3GTJJ

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna-rna hybrid
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtjJ00
1TWHJ 1TWCJ 1IV6A 1IC8A 1PUFA 1O4XA 3QQAA 3K2AA 4XIDA 1AKHB 2XGEA 3BTLA 4NDLA 4S0HB 5J1UA 5FJ8J 4D5FA 2R5ZB 1U78A 3PM1A 3BR3A 1IDYA 1K83J 1WH7A 1LFBA 1BW5A 2HOTA 3LSPA 1JGGA 2FQ4A 2CQQA 5FLVA 4DZJA 4QIWN 1F43A 2M34A 4A3FJ 4M3FA 1UMQA 1ZR2A 1H89C 2NVXJ 2Y31A 4A93J 3RZOJ 4UUSA 2B63J 1T56A 3IH4A 1G2HA 2ECCA 4HNVA 3NARA 5IYCJ 5EG0B 2IAIA 1MBGA 3B6AA 4B1RA 1RPWA 9ANTA 3B6CA 1YRNA 2Y2ZA 3RKQA 2L7FP 1MBKA 4XRSA 3ZQFA 5DS9A 5GP9A 2EQRA 3JREA 3BTJA 3HDDA 3I4NJ 3S15J 5E3LA 3JRAA 5F04A 1Y1WJ 4MLOA 1ETQA 1DU0A 4IEJA 1OCTC 1JKPC 1OCPA 3ZQCA 3GTMJ 3JRCA 2CUFA 5J1RA 3BQYA 3HOYJ 4A3BJ 1MH3A 2R7ZJ 1POGA 2XPWA 1NK2P 1HOMA 2RAEA 3S2HJ 2DA3A 1DU6A 1FJLA 1UHSA 2H1KA 2TRTA 2P81A 1W0TA 1ETOA 1VNDA 1GVDA 3BR5A 2E2HJ 4QSHA 2K40A 3HEFA 4FCYA 3ZOBA 1MBJA 1B72A 4IHXA 2JJ7A 2E19A 2XRLA 5C3EJ 5EZGA 2LP0A 2XSDC 1MSFC 2GLOA 1I3QJ 4A69C 4A3KJ 4CYCB 2LVSA 2M9HA 2JN6A 1B8IB 1XG1A 3SJMA 1WI3A 2FD5A 2KDZA 3OSFA 4FISA 3S17J 5IP7J 2NS8A 2CUEA 4B3AA 3IH3A 4FE4A 4D7NA 1AU7A 3W6VA 2IEKA 4MIMA 4X6AJ 2NOGA 1VF9A 2CRGA 3H0GJ 4QTRA 2HOAA 1OJLA 3O8GA 2EH3A 2FJ1A 4C2MJ 2CQXA 1Y1VJ 1JUPA 3GTLJ 4M3EA 4I76A 2OF7A 3BT9A 2DMNA 1RR7A 1HDPA 4ABZA 2LLKA 2M2EA 4Y7NJ 2LFBA 1LFUP 2DA6A 5FKKA 1K61A 3GTGJ 1EF4A 2VPRA 2XB0X 3SFIA 1ETWA 3L1PA 3HOVJ 3TEDA 4JYKA 3S1MJ 2ELKA 4UUSB 2DMUA 5EGOA 2JA7J 1BJZA 1X2NA 3HOXJ 5K7ZA 1RETA 2DA4A 3E7LA 3S14J 1QPIA 1VI0A 1IJWC 1A5JA 1OFCX 1YRNB 3ZQHA 4XICA 2EZKA 3BG3A 3FK6A 1U8BA 1APLC 2DJNA 2Y9ZA 2M8GX 3TP3A 1TWFJ 4B4CA 3Q3SA 1XS9A 1GV2A 2CU7A 1JTXA 2Y9YA 2QCOA 3NAUA 2QF7A 5J3LA 2NVYJ 5M3MJ 2N8GA 1MH4A 3TP0A 4M3GA 2DMPA 1JKOC 1CQTA 4DYRA 1HCRA 4M3BA 2XB5A 4XK4A 2R5YB 5FLMJ 5M5YJ 2HXIA 2R92J 1P7IA 4D5CA 4M6VA 2L9RA 4MFDA 1LE8A 1NK3P 1XC5A 3TW6A 3IH2A 1FTTA 1RESA 1WPKA 1B72B 5F0HA 3MN2A 3JRFA 1ZTRA 4A3JJ 4L5EA 1NTCA 1FEXA 1S7EA 5IOYA 3A01A 3OSGA 3M4OJ 2Y0SN 2YUSA 3G1LA 1ZGWA 3OIOA 2DMQA 3BQZA 5F08A 3S1QJ 1I50J 2JWTA 2DTZA 2R0QC 2EZIA 1TWAJ 2W48A 3Q0VA 3WHCA 1MNMC 3CQZJ 2G0EA 2NVTJ 3HKZN 2E2JJ 5J1YA 2COBA 3M3YJ 1ORKA 4FE7A 2EBIA 3GTKJ 2DA2A 2NS7A 2IBDA 2ZB9A 4GFBA 1TC3C 2XPUA 3ZQLA 3IV5A 2K9QA 2EZHA 3CMYA 2R5ZA 3FK7A 1ETYA 2DA7A 1Q1VA 3DCFA 3JRIA 3FKIJ 3HOWJ 3TW7A 2EZLA 1MSEC 5F0FA 1WCMJ 3S16J 2LY9A 5EDNA 3S2DJ 3HGYA 1ZQ3P 2HQ5A 1Z0XA 5EGOB 1IGNA 1GUUA 2VUMJ 5F1JA 4BBRJ 4BXXJ 3GTQJ 2XGDA 5EEAA 1GT0C 1JJ8C 2TCTA 5K7FA 1MBFA 1BW6A 2MG4A 1PUFB 4MFEA 2VKEA 3BTCA 2OPTA 4AC0A 1R9TJ 3SDGA 4W97A 4Y52J 1WH5A 5JLWA 3Q0WA 5F0CA 3CDLA 4A3CJ 2FX0A 2PMZN 1VFCA 1AHDP 2LR8A 3G1OA 3MVPA 4C3JJ 5C4XJ 3BR6A 4V2FA 5IOZA 2E2IJ 3LOCA 2L7ZA 4W1UA 5HODA 1HF0A 2O9LA 4C3HJ 2HOSA 2JA5J 1ETVA 2L7MP 1ZKGA 4RBOA 1BA5A 2CJJA 3WHBA 3GTJJ 2HXOA 1LE8B 1U9NA 5GPCA 1JKQC 4A3GJ 4BKXA 2HDDA 5EF6A 3I4MJ 3LSJA 5E3OA 2YU9J 4JX6A 3DEWA 1MBHA 2DMTA 1QVUA 2KT0A 1B8IA 1JT0A 1HLVA 3F0CA 3PO2J 2WB1N 1JT6A 4C3IJ 5IPAA 3HB9A 1ENHA 2AHQA 1IG7A 5IP6A 3A02A 1TWGJ 3H3VK 5C4JJ 3JRDA 4IHYA 3UKGA 5M5XJ 4I6ZA 5IYDJ 4EEFG 1P7JA 4JX4A 4JP0A 1SANA 2JA8J 1MBEA 5M3FJ 1IUFA 2LD5A 5DTDA 3RQIA 5GPAA 2LTPA 2DN0A 1JJ6C 3QPSA 3S1RJ 2XGCA 2MSYA 1D5YA 4DZPA 5FKMA 3K7AJ 1JUSA 2ID3A 1GDTA 3HOZJ 3BR0A 1HDDC 1X58A 2XPVA 2X9DA 3FISA 4A3DJ 2GM4A 4BY7J 4RDUA 4BBSJ 4LOCA 1T33A 4J19A 3ZQGA 2NVQJ 1I6HJ 4V2GA 2R93J 3Q0UA 3ZQIA 2HYJA 5EYRA 3LSRA 2WV1A 1ZR4A 2H8RA 1FIPA 4DYCA 2VI6A 5JLXA 5FKLA 5IYBJ 2MGQA 3BR2A 5IP9J 4IHWA 1AKHA 1ZK8A 4D7MA 5C44J 4DYQA 1IRZA 1E3OC 1QRYA 1W0UA 2ME6A 3PO3J 3MKLA 2YS9A 1FTZA 2JMWA 3JRGA 2WAQN 5M5WJ 2DA1A 4A3IJ 1U9OA 1UG2A 3OOUA 2O7OA 4XRSG 1X2MA 2L0KA 3GTPJ 2E1OA 1H8AC 1JUMA 2R5YA 1ETKA 4G12A 5E3MA 2JA6J 3VPRA 5EG0A 2LKXA 4BY1J 4A3LJ 4FTHA 5F27A 4UUTA 4XRMA 1IDZA 2HI3A 5E3NA 1JTYA 3GTOJ 3JR9A 2I10A 3HOUJ 3D1NI 5EZHA 3BR1A 1A6IA 4AUXA 3LSGA 1QVTA 2MW8A 1JKRC 2AO9A 1GV5A 5FKNA 1BL0A 1RKWA 2ID6A 3HM5A 2D5VA 2GBYA 1FIAA 3HBLA 2Y30A 3BG9A 3JRBA 3BTIA 2LK2A 3GBGA 2ME0A 3C2BA 3BG5A 3LNQA 3HGGA 3O8HA 1Z77A 4JX5A 4A3EJ 4DW6A 3S1NJ 1H88C 4IHVA 4MO7A 5FKOA 2O8KA 5BNGA 3A03A 3A01B 1SFOJ 2ECBA 1RKTA 2JK3A 2K9NA 2M0CA 3CCYA 1ETXA 4X1EA 4CYCA 4M3DA 4AYBN 2VKVA 2X6OA 3QPLA 3JRHA 2K9SA 4A3MJ 1WGXA 2X48A 2DA5A 3RZDJ 3FIWA 5K7HA 1F36A 1ITYA 3G1MA
chains in the Genus database with same CATH superfamily
1EH8A 3IL2A 1MZBA 3QU3A 1IV6A 3CC7I 1W4MA 2E36A 1O4XA 2W57A 3K2AA 4R8HA 2HR3A 3AFHA 4I0AA 4XIDA 1USTA 3BTLA 3IAS2 4N9IA 5J40A 3G71I 1AWCA 1U78A 3HUGA 1IDYA 2QSGX 1BW5A 5TRDA 3KZYA 2FQ4A 2CQQA 4QIWN 4L9TA 2PJPA 3WGIA 1UMQA 2ZJQF 1ZR2A 4EGYA 2VQCA 2NVXJ 2O0YA 2FNAA 3FBIB 4LD5A 3RZOJ 1LEAA 5LD2C 1HA8A 3OYMA 3BJOA 3OYFA 4MGRA 2ECCA 3COAC 1GLNA 3OYBA 3NARA 2XGXA 5IYCJ 1MBGA 1S6LA 3B6AA 3WTVC 9ANTA 2Y2ZA 3IC7A 3QYEA 4LMYA 2H09A 3DPTA 3R0JA 1D1BA 4XRSA 2G7UA 2PN6A 2ZCWA 5GP9A 3DWLE 3IRQA 1E2XA 4HBLA 5E1WA 3OS1A 2I8DA 1WJFA 5F64A 1Y1WJ 1ETQA 1TBXA 2A68F 2D2WA 3CCEI 1DU0A 1ZH5A 1D0ZA 3PNYA 3U9GA 1JKPC 4I0BA 2WWYA 4KUMA 4PJ0C 3BDDA 3CMEI 5L3DA 5JFRA 4I98B 3HOYJ 2X6XA 4LFUA 3CO6C 4E4HA 3FXUA 1EH6A 3UNGC 1NK2P 3C18A 1Y8RB 4OOIA 2FXAA 4V19K 1FJLA 1UHSA 2H1KA 4GDFA 1SC7A 4IL6C 2COMA 4IXAA 4KT6A 5E8IA 1D8KA 3J7AY 2QM3A 2CQKA 3KYLA 3HEFA 3ABUA 2V1DA 3RYPA 1L3LA 1VQ5I 1B72A 2JJ7A 2EV6A 3Q5FA 1BBYA 2E19A 1PVEA 2QQ9A 3NQOA 2LP0A 3MWMA 1X4OA 3ZMSA 1MSFC 1I3QJ 2P5KA 1N25A 4A69C 4A3KJ 3J7ZI 3A2KA 1X3WB 3L2CA 5E8GA 3OSFA 2FBIA 2G7HA 1FP2A 2DODA 1YW8A 1ZG1A 4JK1X 1M1EB 1ZLJA 3DKWA 1TQMA 3W6VA 3CF2A 2NVUB 2O8XA 4MIMA 2WAEA 4X6AJ 1FYMA 3H0GJ 4QTRA 3I54A 4CCOA 2RQPA 3K0LA 2EH3A 3O8GA 4TV7A 4C2MJ 1ZGJA 1Y1VJ 3H5NA 5LRSA 4BH9A 4M3EA 1RR7A 2Y0SA 2IPQX 2Y69H 2ZJ2A 4BU2A 5FD5A 3SZPA 1LFUP 2DA6A 3RYRA 1ZRCA 4BDYA 1WI9A 2KMUA 5IT9K 5B1BH 2JUCA 3FM5A 3OWTA 3L1PA 3HOVJ 1OR7A 1YW9A 2XDVA 1H9GA 2JA7J 4IF4A 4U0YA 4OMZA 4O6JA 3HOXJ 5K7ZA 1RETA 2DA4A 2NNYA 2HWVA 4Z6YA 1IJWC 2JZYA 4U7BA 4XICA 3W6JB 2XHKA 3DEEA 1APLC 1IF1A 2M8GX 5CVJA 5B5EC 4RMNA 1NG6A 3DBHB 2KJBA 4B4CA 3Q3SA 5DD4A 2EIMH 2CU7A 2PX9A 1JTXA 1X4PA 1A31A 2QCOA 2NVYJ 2HKXA 2N8GA 4HW0A 1WFXA 4XLNF 2JPCA 1J75A 1A04A 5CQEA 1XN7A 3RDIA 3RKXA 3MKYB 3CZ6A 2H6CA 3C2HA 4BQAA 4FASD 4II2A 4ZYAA 1S72I 4OU0A 1T0FC 1KGSA 2L9RA 3AG3H 5GADJ 4OIOF 3MKWB 2BOLA 1RESA 2V9KA 3ULQB 1W5SA 1FSHA 2L2OA 3CCSI 2DT6A 3G4SI 3ZQ7A 1DQUA 3JW4A 1NTCA 3A01A 1RZ4A 4L9JA 4CCNA 1SAXA 3M4OJ 2Y0SN 3JTHA 2VKHA 4I01A 3TO6A 3EPZA 1FYKA 4KNYA 2DMQA 3BQZA 5F08A 3MFKA 4IX7A 2XRNA 2EZIA 4KA4A 3P9IA 1HKQA 2FQ3A 2W48A 4BJ6C 4ZC3A 3DKXA 2CV1A 3WHCA 3ELKA 3CQZJ 3KP3A 2E2JJ 2XAFA 5BPDA 2JVHA 5J1YA 5HNHA 1UAAA 3DPUA 4KMFA 3M9AA 1KONA 4FE7A 5L3FA 3MZYA 3K70C 2BHZA 2BW3A 2XV4S 2PBIA 1QZZA 2IBDA 4GFBA 1TC3C 2PEXA 3C2GA 4ASNA 1PDNC 5HS8A 2M8EA 2CYYA 2LREA 3CMYA 1Z1DA 1K6OA 2R5ZA 3CDIA 3FK7A 1D0XA 3T0YA 3TL4X 2YSRA 4IHTA 3FMSA 2EZLA 5LHHA 2QA4I 1XCVA 3V7SA 1WCMJ 4PK4A 3OYEA 4XRFA 2D1HA 1OMIA 4KICA 4LLNA 3MD2A 2VUMJ 5CQGA 2ESHA 5F1JA 2LBFB 4QPOA 4XLCA 2XGDA 5CVUA 2O5RA 1IN4A 3T5XA 5E79C 3FXOA 2L7KA 2E1MC 2H1LA 4YFNF 3OYCA 1UHMA 4ENMA 1R1VA 2UWMA 4KN7X 4MFEA 3EETA 2VKEA 4AC0A 2OPTA 1ZREA 3FXMA 2DQRA 2OD5A 5JLWA 3V7RA 4RAZA 1TW3A 2R7DA 4A3CJ 4AVPA 3KP5A 3HUGB 4V2FA 4P55A 3E6DA 3H5RA 4DQ2A 2BY1A 1LB2A 4UHTA 2OQRA 2EFQA 1O3SA 1T8IA 2DJIA 1JGSA 1T2KA 4CCLA 3AAFA 3HKZA 1KQ8A 1TTYA 4A12A 2HOSA 1ZG5A 5BQTA 1YI2I 2CJJA 3AG2H 1RUOA 3CCQI 3WTZA 2HTSA 1QO0D 4E7LA 2OZUA 3RI4A 5FB2A 5H2FC 2HDDA 5EF6A 1HXDA 1MKMA 5D6FA 3ABMH 5E3OA 2YU9J 3WTTC 2VBWA 1K4SA 1IN5A 2HVRA 1MBHA 1QVUA 2DOAA 2E7WA 2A61A 2KT0A 1B8IA 1Z7LA 5TISC 1ONVA 5CYVA 3GF2A 2ZFWA 3SEZA 3REOA 2F4IA 1W36C 3SXYA 1R4NB 2CMPA 3PSIA 1ZN2A 2AQFA 1D1CA 1LDDA 3PQKA 4OAZA 2BXYA 2W84A 2IVMA 5L3EA 1SANA 1G3YA 3CD6I 2E60A 3WODF 5M3FJ 2J5PA 2LTPA 2QSHX 1HW2A 2DN0A 1JJ6C 3QPSA 5LFAA 2DOFA 2M1BA 3OYLA 4CH7A 4DGWB 1Z05A 3S8PA 5BPIA 4OIRF 3HPGA 2Y75A 1IN6A 4B8XA 1G8XA 5ICFA 1J7KA 2W00A 2H8WA 4CZCA 5A2QK 2GM4A 4BY7J 3K4MA 1IXRC 1SVMA 3M8JA 3ZQGA 4MEXF 4NB5A 1MDMA 2NVQJ 1R6RA 3AG4H 4MNUA 1T0FA 2JQ7A 3ZQIA 4XONA 5EYRA 3HOSA 2KRFA 4HV6A 3N4MA 2WV1A 1O7FA 5HDGA 2HGCA 3HSFA 3OR2C 3I59B 3BR2A 4DYQA 4YRVA 5HDNA 1W0UA 3PO3J 2WB1A 4U0WA 1EV7A 2IGMA 4FQGA 4A3IJ 4O3MA 3OOUA 1T98A 2O7OA 1STZA 3JCUC 2L0KA 3GTPJ 1FP1D 2YPRA 2FRHA 2CS3A 5J47A 2CV2A 1ETKA 4G12A 5E3MA 3LAPA 4HA8A 3VPRA 5JVGF 2VQLA 1R00A 3PUBA 2OAZA 1R1UA 4XRMA 1IDZA 2ACJA 1MNEA 3L7WA 3G73A 4UV8A 3LSKA 4PSWA 4L0ZB 3C3WA 3D5RC 3PNTA 2A6EF 4MQ9F 3BR1A 2VONA 3CMAI 5FKNA 2DYSH 4UB8C 1MGTA 1VQ6I 2KDOA 2X6YA 1SD6A 2FNPA 2LMDA 1RKWA 4BACA 2MH9A 3VYRB 3K4NA 4BHCA 2GBYA 4AWXB 4C2UA 4KYWA 2XAHA 3ECOA 3VYUB 4YIRX 2Y30A 4M71A 5LBQA 3AKZA 2R3SA 3K6GA 3OYNA 1GXQA 2LK2A 2OA4A 2DFEA 4ENJA 1FMVA 3GBGA 2OV7A 1FZPB 1DPUA 2K02A 4A3EJ 4DW6A 3S1NJ 4A0YA 5H20A 2DXIA 4KN4X 3PQJA 3OYIA 4BHBA 3A01B 5CKTA 4G6TB 4E70A 2HPIA 1ETXA 4Y17A 1D3YA 2WAQA 3M8EA 2K85A 1OCOH 5J8FA 2L54A 2R7WA 4ZYGA 3VFZA 4B44A 4EJWA 4IO9F 2P7VB 3RZDJ 3FIWA 1F9NA 3VDXA 4ZYEA 2FE3A 1ON1A 3W2VA 3E5QA 1TWHJ 3WTXC 1TWCJ 2NNNA 1PUFA 2GA1A 4LK1F 2M4GA 1X1PA 2KL4A 3OOPA 2BY0A 2XGEA 2L9SA 4BQQA 4NDLA 2LYCA 2A6TA 3KP7A 1BC7C 3DV8A 5FJ8J 4A0ZA 3P5JA 1LVAA 2ZXHA 2R5ZB 4GO1A 3V8LA 3PL8A 2ZSHB 2E34A 5DV5A 1MW7A 2ELJA 3F8FA 1DGWY 3LSPA 4DZJA 3DF8A 1JGGA 1XMXA 2OCCH 4L0YB 2Y31A 3OYJA 2EFNA 2XF6A 1T56A 1ZAOA 2XIGA 3IH4A 3OYKA 1U0JA 2ZSIB 3KEQA 1ODDA 3GW2A 1Z7UA 3I3LA 3BLYA 3K9TA 3ABTA 4HQMA 1RC9A 1FOYA 4BHPA 2BGCA 3OYGA 1KZHA 3RKQA 2MABA 2HVQA 2Z99A 1U2WA 5GAGJ 3L00A 4F7ZA 3ZQFA 2EQRA 1UG0A 2F48A 2DOEA 3BTJA 1JE8A 1CGPA 1P6RA 1SAUA 3S15J 2IGNA 3CCVI 3JRAA 2IJLA 4JQFA 1LJ9A 1ZGAA 4MEYF 3K4BA 2C6YA 4IEJA 4U7DA 3CJQB 4IVNA 1OCPA 4HF1A 3ZQCA 2O3FA 3TDUC 3CDHA 4ZTJA 2DFIA 2R7ZJ 1SVLA 4P5OA 4CDGA 1Z67A 4UNOA 2K9LA 4RLQA 5BMZA 3G6EI 2CSOA 1HOMA 3SZTA 3A0BC 2RAEA 2DLLA 3HRUA 3QYBA 1DU6A 3LSMA 2P81A 1W0TA 1LUJB 1ETOA 1VNDA 2OJED 3BR5A 3VYSB 1PP7U 4QSHA 2E2HJ 1WVRA 2BV6A 1QZYA 2D45A 3ZOBA 1R36A 3H0DA 1MJBA 5KK1A 2OQGA 3F6OA 2QUFA 2FMLA 2XSDC 4HZFA 2QGUA 1HKTA 2LVSA 2JN6A 1B8IB 1XG1A 3SJMA 1F5TA 3BOQA 2FD5A 2V26A 1X1CA 4NC6A 5L3GA 3S17J 4G7OF 2P8TA 5IP7J 2NS8A 3O3KA 2XAGA 1ZELA 4M73A 5ED4A 3CP2A 2P7CB 4FX0A 4WXHA 2GAUA 1W5CC 3IH3A 3T8TA 4IRGA 5ICCA 2QVOA 3LQQA 2NOGA 4Y3OA 4FX4A 1VF9A 2CRGA 4ZDPA 2E5ZA 3ZQQA 1WHUA 2M45A 1OJLA 3GLXA 3K1NA 2FJ1A 1BI2A 3NWTA 1HBXG 2F5VA 2V7FA 3BT9A 4MHGA 1HDPA 2EFPA 2M2EA 3GLLA 3OIPA 4EGZA 4Y7NJ 2LFBA 2B7EA 2DTRA 2TDXA 3W2AA 2VPRA 3I53A 3W6KB 2XB0X 3V7CA 3SFIA 4Y33A 5CVIA 4UY8I 3HSRA 4EJOA 3HXLA 1IV8A 5GTHC 3S1MJ 2ELKA 2X1CA 2DMUA 4UUSB 4ZDLA 3QYFA 2KFDA 2LDUA 3KEOA 1A36A 4F52A 1BJZA 5GAHJ 1XCBA 2FMYA 3DTEA 2EPFA 1S5LC 3E7LA 3ECHA 3I58A 4BUPA 3WG7H 2GXAA 1VI0A 2IS2A 1Z3YA 1OFCX 1R23A 3R0AA 1YRNB 3IWFA 2Z5UA 3WU0A 1U8BA 4PJNA 2R7FA 3S2WA 3A1YA 4S05A 3CC2I 2GIZA 1FOKA 3OR1C 3R61A 1UB9A 2L5QA 5BS6A 3QPHA 2E35A 3GZNB 2F4MB 5J8CA 3Q9VA 1IZ1A 2L02A 4QLCU 2QF7A 2XKOA 3X2QH 1YE9A 4P9FA 2FOWA 3RPQA 2KPMA 1X3ZB 4YFXF 4M3GA 4ZYDA 4MTDA 2PFBA 4PUSA 4M3BA 4XR6A 2MBFA 4I99C 2RGVA 3K4KA 1N75A 2WY8Q 4XK4A 2HXIA 2OZ6A 4D5CA 1J09A 3SQNA 3CCMI 1E17A 3FXLA 4BQOA 1VZ0A 2VBZA 4E7SA 4AM3A 1XDUA 1WPKA 3KZZA 2DPDA 3D5SC 2BY2A 1B9NA 5KAFC 1FEXA 4HF2A 3HHGA 4CSWA 2CG4A 2BHYA 3S1QJ 1OQYA 4CO8A 1TWAJ 4NHJA 2CFOA 3I55I 1V5EA 1WJEA 3KPHA 3HHHA 2BXZA 1LVKA 5DUIA 2COBA 3M3YJ 2B9SA 2E1MB 5D8LB 5LHGA 1I1GA 3KP2A 5ILUA 3J80Z 3S3MA 2LRDA 2JA2A 1K7AA 2NAZA 1Z91A 2CH0A 3BP8A 3JAMZ 3KX2A 3ZQLA 3HPHA 2HEOA 3DTIA 4WXCA 2K9QA 2EZHA 3R4KA 3JSPA 3SZGA 4IQ4A 2X6WA 3F3XA 3FX3A 3FMQA 2DA7A 1PYVA 3DCFA 3JRIA 4IOCF 2ZJRF 3HOWJ 3IAM2 3TW7A 3DBRB 3RKYA 4BNCA 2K86A 2LY9A 4B3XA 4KIGA 1Z0XA 4KJZA 5EGOB 1IGNA 1GUUA 1KYWA 3P7NA 2JTVA 4XNFA 1IW7F 4BXXJ 5D8KB 1XGSA 4E7JA 4XKWA 4KIBA 5DYMA 1QQIA 1XB4A 4XLHA 5K7FA 1IN7A 1MBFA 3I59A 1PUFB 3IKTA 2M0MA 3MAJA 2DDAA 2DK8A 4AIHA 3BTCA 3GXOA 2F5FA 1XGMA 4W97A 1NHAA 1WH5A 1ZHFA 2DYRH 2FOKA 3I4PA 5KCMA 4ON0A 3CDLA 4IJAA 2DI3A 4BEHB 4PGHA 1AHDP 3FHZA 3WGGA 3BR6A 3FBNB 3ESWB 1BM9A 2VT3A 2W1OA 2F5EA 4B43A 3K1MA 1BJAA 2XKPA 4AD9A 2ZBKA 1WRJA 1BI1A 2L7ZA 3E0JB 3GCMA 2QBYA 2O9LA 1BN5A 3RPUD 4C3HJ 1N77A 4XN3A 1HW5A 4M9XA 2DDBA 4HX4A 4BE1A 4C2TA 2HXOA 1LE8B 3I5UA 1JKQC 1YX3A 2VT2A 1HKSA 4XMYA 1LNWA 1SEUA 1YFHA 4PCQA 4P1WA 1EKEA 5CPRB 4Q5SF 2VBXA 4HF0A 3DEWA 4E7IA 3M7GA 3ZMDA 3HRMA 4ANJA 4OINF 4EM0B 1HLVA 1JT6A 4C3IJ 5IPAA 3ABLH 3KYDB 4CA0A 3CO7C 1IG7A 2GXBA 1IRGA 4OMYA 5KHDA 3H3VK 5C4JJ 1Z21A 4IHYA 4N0BA 5FRMA 5M5XJ 4I6ZA 4CCMA 2PG4A 4EEFG 4JX4A 1J9IA 2MFZA 4LLGF 1OKRA 2XVCA 4IRIA 2QKMB 2LD5A 2Y0MA 2R7SA 3QWLA 5D6EA 4AIKA 1GXPA 5HOOA 3J81Z 1G4DA 4XM3A 1R5HA 2OTLI 1D5YA 1Z6TA 2NOJB 4AIDA 1C0WA 1GDTA 1UZCA 4PZJA 2KRCA 5EEHA 3MZHA 2A05A 4CUGA 2XPVA 1BOBA 3F6VA 1G3WA 1FMWA 4BBSJ 4LG0A 1T33A 1OYWA 1XGOA 1HSJA 1I6HJ 4V2GA 2R93J 2CW0F 4BYYA 2HDCA 2HYJA 1HW1A 3DU5A 2PQ8A 1K6YA 3AL0B 1LQ1A 3PUFA 4PFPA 2VI6A 5IYBJ 4IHWA 2HQRA 1ZK8A 3V42A 4D7MA 5C44J 2AS5F 1IRZA 4HLYA 4GGGA 2FBHA 3CJNA 1K78B 1ULYA 2DT5A 4CHUA 2JMWA 3JRGA 1S29A 2DW4A 1R49A 2RQQA 4HEA2 2DA1A 4R79A 3LL7A 5J4VA 1UG2A 1G6NA 1YOVB 4K2EA 5F6FA 4XRSG 5EEGA 1YITI 1X2MA 4EM2A 3GVAA 1P2FA 1VQLI 3EUHC 1H8AC 2LOOA 4BY1J 2LKXA 4Y15A 2LG4A 2VLAA 2PMUA 4XKVA 2ISZA 1ZRDA 2HI3A 2HQNA 1PJRA 2GOXB 1JTYA 2XAQA 3ZRGA 3TKYA 2BYVE 4EMSA 3ABKH 1FBQA 2K3PA 3D1NI 4HX7A 5EZHA 4UB6C 3ASOH 3B73A 2L9VA 2CQNA 1RUNA 5AIPA 3LSGA 2MW8A 4LGWA 1N78A 3S93A 2HU9A 3F8NA 2BBYA 3MCZA 2FU4A 4G9YA 4H4KC 1RRJA 3V4GA 2D5VA 5JVTA 1P4XA 1O57A 1FIAA 3HBLA 3BG9A 4XLAA 3T8RA 1OCZH 1AA7A 4ESFA 4HLXA 1MMNA 4EM1A 3PIOF 2HDWA 2VOOA 2HYGD 4DJAA 3FZVA 4NUBA 1XDSA 3O8HA 1U3EM 1WJ5A 4IHVA 3KZIC 2VN2A 4UV9A 1W5TA 5E1XA 3SHFA 5FKOA 2KKOA 2VPLA 3L2RA 3KLOA 3A03A 4EATA 3L2VA 1RKTA 4EV0A 1I6XA 2M0CA 1LEBA 4A2UA 4UUVA 4XSZF 2VJ4A 2ELHA 2VKVA 4AYBN 2EFOA 2X6OA 3QPLA 3JRHA 3QAHA 2K9SA 1BIAA 1WGXA 1MMGA 2M87A 2X48A 4L5IA 5LGUA 2DA5A 3MKZA 5K7HA 4AU7A 1F36A 1ITYA 3G1MA 1ZGWA 4FT8A 2M7AA 3F22A 1FLIA 1IC8A 1VQ4I 3WTYC 3CP8A 4OIPF 1OCCH 3LWFA 3TOBA 1AKHB 1MJ9A 3CESA 4HV5A 3HTSB 3ZMUA 1TT5B 2RNGA 3OL3A 3DLLF 4A5NA 1YIJI 4FHTA 1K83J 1LFBA 5E1ZB 2HOTA 1F43A 4A3FJ 1YHQI 4M3FA 2P5LC 1GHCA 4C9YA 1BIBA 4UUSA 2B63J 3WTSC 3M1EA 1W7PB 1MD0A 3L9FA 3MMYB 2DQLA 4HNVA 4M72A 5EG0B 3IP4B 4BAYA 2UUZA 4XKBA 2QENA 4BJTA 5DDGA 2V9VA 1RPWA 1Z3XA 1YRNA 1R22A 1QNTA 4GYGA 5DS9A 2XUBA 1Y0UA 2PLYA 3JREA 3HDDA 2ZXWH 3I4NJ 1ACIA 2NYXA 2JT1A 3SEQA 4RB0A 3ZCOA 4QPQA 1FYLA 4BL0B 3A4CA 4MLOA 1QHGA 4ZH4F 1V3FA 3FKJA 4WWCA 4GYIA 4BGDA 4HG2A 3GTMJ 3JRCA 4JBAA 2CUFA 4PJMA 3BQYA 3ZR8X 1MH3A 3RPUA 1POGA 3KCCA 2XPWA 4HQEA 3QP6A 3F8BA 4GXOA 1WJDA 2QBYB 3E6CC 3LSTA 4GRIA 1SFUA 1ZLKA 4L18B 2Z1DA 1R58A 3BZKA 3VODA 1KU3A 2JSCA 1GVDA 2GZWA 3OL4A 3F21A 1HQCA 3H36A 1MBJA 3PFIA 4IHXA 3KP6A 3AL0C 4LJZF 1BC8C 2YR2A 2KLOA 1E0EA 3ERMA 3LFUA 5B3SH 5C3EJ 2XAUA 5AIQA 2LF7A 2FF4A 3KE2A 2Z33A 3H3UA 4NQWB 2CQ7A 3I9V2 2HZDA 3OYHA 1YQAA 1IN8A 3HRSA 3ML6A 1WI3A 2YU3A 3EUHA 3IHUA 2KDZA 2R7RA 1PP8F 3VWBA 4FISA 2HQAA 3I0TA 1RI7A 1ON2A 3I64A 1IXSB 3TO9A 2XF7A 4N4OB 3ZN0A 1DGRM 1QU3A 1TW2A 2X51A 4FE4A 1UJ8A 2JRTA 1I3AA 4XOPA 2W24A 1DP3A 2AXTC 4MTEA 3DEUA 2HOAA 2VQHA 3CUQB 2CQXA 3CLQA 1JUPA 1EH7A 4I76A 2DMNA 5LRRA 5F1RA 4HPQA 2P4WA 1F4KA 1XMKA 3GMEA 1TLHB 4XN0A 5FKKA 2EB7A 1XSXA 3WE2A 3GTGJ 1FOWA 1LPQA 3TEDA 1VQ9I 2R7UA 2CO5A 2VB6A 4JOMA 4OIQF 2R7OA 4M74A 3FXQA 2DU9A 5EGOA 4LG0B 1BR4A 5D5XB 3CCLI 1X2NA 2ZMEC 1W7PD 3WU2C 3CCJI 2K4BA 5IY5H 1QA6A 1QPIA 2V1UA 5HLTA 5LGNA 1A5JA 5LEJA 3TOAA 2A6HF 2VQGA 2VBYA 3BG3A 3Q9SA 4UXNA 1MJAA 2NS0A 3QOPA 5HDKA 4RS8A 2Y9ZA 3EYIA 3H5AA 5JI6A 1CF7B 3C1DA 1FX7A 1TWFJ 2CWEA 1FT9A 1S9HA 1WQ2A 2ZJPF 4Y13A 4ENNA 1GV2A 1XS9A 2KQRA 5D4RA 1O3TA 4BEHA 1T95A 2Y9YA 4RGXA 5HS7A 5M3MJ 3L2WA 2KIQA 3CCRI 2ZXJA 4HSRA 3HOTA 2JVGA 3QRFF 1MMSA 5DCMB 2F4OB 2GWRA 3TP0A 1JKOC 3CC4I 1TQIA 2MD0A 2K9MA 4UVAA 1HCRA 4KIFA 5HVQC 3WTUC 1ZG3A 1DUXC 5M5YJ 3DKYA 1P7IA 1WJCA 3WU1B 1LE8A 1XC5A 1R1TA 4ZYHA 2FUG2 1SMYF 1FTTA 1SVOA 5F0HA 3MN2A 4L5EA 3GFJA 3OSGA 1YS7A 3ZPLA 2EFWA 2YUSA 3G1LA 3OIOA 3QODA 3BZCA 3CF5F 2NXNB 1I50J 2JWTA 2DTZA 2R0QC 1FSEA 5LEKA 1Z9CA 1KQ9A 4M6XA 2P6TA 1FY7A 2Z16A 1G59A 3Q0VA 1J5YA 1IRXA 2G0EA 2NVTJ 3ZP5A 2QWWA 3BCAA 1TNSA 4KT5C 3TQNA 3LMMA 1KU2A 2EBIA 3ZMTA 2O03A 5TGTA 4G6DA 2DBBA 2ZB9A 1Z6RA 2IA0A 2MLKA 2XPUA 3IV5A 1R5GA 4LITA 1REPC 4YG2F 3E3VA 2VC1A 2PJRA 2HFHA 3MEXA 5FLXZ 1ETYA 2R7XA 3EYYA 4AVZA 1KQ0A 1X1BA 1USSA 1MSEC 1DDNA 3DQVC 4P9UA 2P0WA 4E7KA 3MZ8A 3HGYA 4Y4RA 3D0SA 2HQ5A 1ZQ3P 2M5WA 3ROUA 5ICEA 3PJRA 3S32A 3GTQJ 1JJ8C 4BS9A 3HTUA 1YJWI 2WADA 3RKWA 2KZVA 2CW7A 2RN7A 2CFXA 2MA3A 1BW6A 1JHHA 3OIQA 2GXGA 3HL2A 2MG4A 1R7JA 1R9TJ 2X4HA 3BY6A 3GEZA 4RB1A 4E6KG 4YIFA 4XQFA 1WZ2A 1QGPA 2STTA 3M8FA 2LR8A 1K78A 3G1OA 3MVPA 5C4XJ 2VJIA 2QZ8A 2CUZA 3J80K 2K3FA 5IOZA 2E2IJ 4ZJZA 2ZXIA 3GUDA 3JAMK 3LOCA 5HODA 2ESNA 1HF0A 2AQEA 2JA5J 2IS4A 3G2BA 1ZKGA 4IOAF 1W1WE 2KRHA 4RBOA 2B0LA 1BI0A 4X0GA 3WHBA 2M7BA 3LAJA 3GTJJ 1BA5A 1U9NA 5GPCA 4XL9A 2PI0A 4A3GJ 4BKXA 3HC7A 4BE0A 3LSIA 3I4MJ 4PJLA 3ERED 3LSJA 2ZKZA 2IP2A 4KFCA 4JX6A 2P6SA 3CUQC 2JPBA 5KAIC 4KITB 1U6GA 2DMTA 4HYEA 1YS6A 1YO5C 4RAGA 2E1CA 1JT0A 4LLLA 3F0CA 2QEXI 1ENHA 2VODA 2KISA 5LHIA 1YLFA 2EA4A 3IWZA 1B59A 5IP6A 1D5VA 2ZMEA 2IA1A 1ZRFA 1T38A 1B9MA 3UKGA 2L9NA 1BI3A 4BDZA 2IS6A 4XLFA 3U1DA 3F23A 4B47A 2H6BA 4I2OA 1V4RA 2IRFG 2VIXA 5L3CA 1JI8A 1IUFA 5DTDA 2WAFA 1VQMI 2F6CA 5K5QA 3J7YJ 3S1RJ 2R7VA 2XGCA 2MSYA 4BXFA 2BVLA 4DZPA 5TJJA 2GOMA 2EILH 3K7AJ 4HNTA 1XGNA 3CJTB 3HOZJ 1U5TB 1SFXA 3IUOA 2Q8KA 2HOEA 4RDUA 4A3DJ 4LOCA 4J19A 1VQNI 2Q2EB 1XPXA 4FETA 1T08B 1TNTA 2ETHA 1X3UA 2CUJA 3M07A 1XSVA 1QPMA 2G9WA 1IO2A 5JHFA 1ZR4A 2H8RA 1FIPA 2BVMA 2DFHA 4S04A 2A07F 1SMTA 2DCEA 4A0XA 2MGQA 5IP9J 5K5RA 4F93B 1AKHA 4IZZA 4CICA 3EUKL 1E3OC 2JRMA 5K5OA 4KISA 2M30A 1FPQA 4RAYA 2FSWA 2ZFUA 2DFFA 3MKLA 4II3A 5CVRA 1FTZA 4EJTA 5M5WJ 2V79A 1NG7A 4OWRB 2VC0A 1YJNI 2E1OA 3J81K 1RIOH 1E3PA 1W7PA 3TBIA 2LY2A 1JUMA 2R5YA 3BROA 2YX4A 4HOBA 3GFIA 2KP6A 1QZEA 2XSJC 3BG7A 5EG0A 1BOAA 3VOEA 4XKCA 5FD6A 1O7LA 5D5WB 3BWGA 3SYTA 2ISYA 4F55A 3JTGA 6PAXA 3WE3A 1YIOA 1FWZA 2FEZA 2Z9OA 4D0PA 2J5OA 4CZZA 1LDJA 1PUEE 1A6IA 1S3JA 4M9SA 2AO9A 1GV5A 2A5WA 5DM6F 1BL0A 2W7NA 4NBQA 2VJ5A 3M1CA 2EV0A 3G3ZA 5LGTA 2L01A 1O3RA 1BR2A 4WK8F 2QSFX 3JRBA 1SD5A 5KNLA 3TMOA 4DOZA 1P4WA 1H0MA 2E7XA 2ME0A 3C2BA 3BG5A 1TT0A 2PMHA 3HGGA 1OISA 3LNQA 1IXCA 1S7OA 3KP4A 4JX5A 3I56I 1WWXA 1XD7A 1H88C 4MO7A 4RA2A 4ZZLA 2DT7B 3N97A 1AOYA 2RNJA 4RGSA 2HYFA 3QPTA 3BG6A 1D0YA 1SFOJ 2VL8A 3DFGA 2JK3A 2VXZA 2LF8A 3FXJA 3CCYA 4IKFA 3K4LA 4NQWA 3K1PA 4X1EA 1Y6IA 4IHSA 4QWQA 4YELA 1SD7A 3EDPA 2L3DA 2IS1A 3RSNA 1VQ8I 2GIVA 4WF2A 3V8KA 3L09A 3H9JA 2OC6A 1R71A 4A3MJ 1MIJA 1K4TA 3K70D 1MNDA 2KIFA 4EQQA 2ZO4A 1K79A 3UR3C 4AIJA 5E17F 5JHUA 4ETSA 4A6DA 3CUQA 3QQAA 4HAMA 4LG3A 5HNFA 3DXJF 4XLPF 2LSOA 3CLOA 4ESJA 3VSKA 4S0HB 5J1UA 4I09A 4D5FA 3KFWX 3PM1A 3RTRA 3BR3A 1WH7A 2PJRB 3VB2A 2HZTA 5FLVA 3K4JA 2M34A 2X0LA 3O6BB 1OPCA 3K4CA 1H89C 1V5GA 1XMAA 3C7JA 5KVRA 5AONA 1X19A 4A93J 3T1BA 4B09A 1G2HA 2HVSA 2UXXA 2OTJI 4RAFA 2W25A 2FA5A 2IAIA 1BR1A 3VSLA 2OBPA 4B1RA 3TDZC 2ICWG 3B6CA 1B1BA 5E20A 3J7AO 4DIQA 2L7FP 1MBKA 2OUMA 4HDVA 2M3AA 3A0HC 4RM3A 5FGMA 1CF7A 1SFEA 2WA0A 3R60A 5E3LA 1DPRA 5F04A 4G7HF 3RCOA 1OCTC 4DNCA 5CVVA 4AYBA 3VYTB 3DU6A 5J1RA 1U5TC 5DCMA 2IT0A 4A3BJ 5HS9A 4U87A 4G94A 3S2HJ 3AG1H 2DA3A 2K7LA 3EUAA 1JXSA 5IT9Z 4G8XA 1P9QC 1Q1HA 2TRTA 3SDBA 3OS2A 1OYIA 3WG9A 4KDPA 3H1CA 5D4SA 2KIMA 3H9GA 4UVBA 2L4MA 2K40A 4PSXA 4FCYA 2QQ8A 4E7ZA 1R5ID 4M6YA 1U8RA 1J0RA 2XRLA 1Y56A 5HLHA 5HLIA 3PFYA 2BE5F 5EZGA 4LB5A 1WSUA 2IGKA 3BJAA 3E97A 1FBSA 1I5ZA 1NH3A 2GLOA 4CYCB 1TP4A 2CW8A 2M9HA 4CCJA 4DBQA 2H94A 1W36D 1FOXA 3HZJA 1WJBA 5FFXA 4WX9A 3ASNH 2CUEA 3H9QA 1WKMA 4B3AA 1D8JA 5J6XA 2IW5A 2ZMEB 4G6QA 2ADUA 2EWNA 2JUGA 3GO5A 1AU7A 4D7NA 2IEKA 4IRHA 3DP7A 1D1AA 2HS5A 1Y39A 1ERDA 3K10A 3DLAA 4RGRA 2R4GA 4ZZDA 3E1SA 3GFLA 3GTLJ 4U0VA 2OF7A 3HRTA 4ABZA 1YJ9I 2LLKA 3GFMA 2RKHA 3BJ6A 1T39A 1K61A 3WTWC 2ZC2A 1EF4A 4XLEA 1ETWA 2RV8A 3FXRA 4JYKA 3BCBA 3CUOA 2JSPA 2DPUA 3FXKA 4NC7A 3S14J 1X1DA 4F91B 5CLSA 1GVJA 1S7AA 3ZQHA 5J4YA 2EZKA 5FFZA 1G3SA 2WV0A 3FK6A 2DJNA 1VQKI 2A3SA 3F8MA 4ZDOA 5GTIC 1TL8A 3TP3A 2R7TA 2D1VA 5FROA 4P96A 5D5UB 1UELB 2E5NA 2K5CA 3F72A 3EQLF 5DCFA 5DD8A 1B6AA 3NAUA 5J3LA 1P4AA 2NRAC 4KMUX 1Y8QB 1OLTA 1MH4A 2XAJA 5ERIA 2DMPA 2EV5A 2QQAA 1CQTA 1V5FA 2MC4A 4DYRA 4RB3C 3HYIA 1O3QA 2XB5A 4PDKA 2R5YB 5E18F 5BOXA 4RM2A 5FLMJ 2RC4A 2IGOA 4D9JA 4BJ5C 2R92J 4M6VA 4MFDA 2P5VA 4H0EA 1NK3P 3QP5A 3TW6A 2EA2A 3IH2A 1MMDA 1L0OC 1KU7A 3P9KA 1B72B 3JRFA 1ZTRA 4A3JJ 2PMZA 3NWSA 1IUYA 4CGZA 1S7EA 5IOYA 1EJ9A 4HRIA 1OYYA 1UCRA 3NEUA 4HSTA 4UVCA 3H92A 1Y0NA 2BEOA 4F3QA 1IAWA 4O5VA 3BPXA 3SFZA 2LC2A 4NC8A 1TZLA 4ITVA 4BE2A 5DEQA 2Q0OA 4CCKA 1A35A 4L9NA 5B66C 3B02A 2WTEA 1MNMC 3O2PE 2QKLB 3HKZN 2E1NA 2KZGA 2MYSA 1ORKA 3ZMVA 1YTYA 5FO5A 2WC2A 3OY9A 3GTKJ 2DA2A 2NS7A 1QBJA 1XSDA 3CJRB 3E5XA 2LH9A 3KEYA 5ILSA 5K1YA 2XC7A 2OU2A 1P92A 3ZXSA 2R7QA 4OAYA 2KIUA 2UXNA 3PSFA 1YG2A 1Q1VA 3KETA 1KU9A 3NRVA 1QHHD 3FDYA 3FKIJ 4YIIA 4RLFA 1U5TA 3I71A 5F0FA 2W82A 4I7HA 3S16J 3F8CA 5EDNA 3S2DJ 1KYZA 2Z3YA 2EIJH 3K69A 1YX5A 5B1AH 2VJJA 3KLNA 1R4MB 2Q2EA 4BBRJ 3CCUI 2Q1ZB 3R6SA 5ILVA 4M9ZA 5EEAA 1GT0C 4XORA 5EJCA 2TCTA 1X1AA 1V54H 3N05A 3OYDA 3OS0A 2QQBA 2FBKA 3HG9A 4EJVA 3QOEA 3SDGA 4Y52J 3PIPF 2LKSA 3Q0WA 2GQQA 5F0CA 4L9VA 2FX0A 2PMZN 1VFCA 2EJRA 4C3JJ 3BZ6A 4U88A 2IXSA 2XF5A 2UZKA 4HDUA 2HPMA 3FWEA 4XSXF 4J00A 2IA2A 4XOTA 5HLGA 4LB6B 3IKVA 4WXDA 3HJEA 4N9HA 4NNJA 2F5CA 3KIOA 4W1UA 4RGUA 4I02A 2F2EA 1OCRH 4RB2C 1ETVA 4PJJA 2L7MP 2VE9A 2X1DA 5DUKA 3HIFA 5FLXK 4YFKF 2XROA 3ZN1A 5JR3A 5A2QZ 2I5UA 1B4AA 1DP7P 2HTJA 3DBLB 2X85A 3GZ5A 5IT3A 4EVIA 4LIUA 2AXLA 1TQPA 1WJAA 4IPAA 1H9TA 2WB1N 4A6EA 3PO2J 2XASA 2LNBA 3HB9A 2AHQA 4MQVA 1S8NA 2HNHA 1SFKA 3JSOA 3A02A 1I27A 1TWGJ 4R1HA 5LLQA 2V9PA 4BQNA 3JRDA 4Q48A 1JHFA 3V8JA 2HKOA 5IYDJ 2OCEA 1P7JA 4JP0A 1UFMA 4C30A 3S3OA 2BW3B 3RQ4A 5GAEJ 2JA8J 4ESBA 1MBEA 4D1QA 1VQOI 1UHWA 2Z2SB 3MQ0A 5GPAA 3RQIA 2O6GE 2RVCA 1LKXA 2STWA 3U2RA 2UV1A 1YW7A 1E3HA 2Y48A 1J59A 1FBUA 5FKMA 1JUSA 1F1ZA 2ID3A 2RDPA 1VTNC 2O61A 3BR0A 1HDDC 3PNVA 3LFKA 3GX4X 3E6BA 2MC3A 2X9DA 3FISA 3FF5A 2YX7A 3VEPA 4XBFA 4PFOA 3BC8A 4N4NB 2BZTA 3Q0UA 5CJ9A 4YEJA 5H6QA 2QLZA 1XX5A 3LSRA 4G7ZF 2EIKH 3L2UA 2VE8A 1LDKB 4B48A 3ONQA 1ZYRF 2KHMA 4DYCA 1RR8C 2DAOA 5JLXA 1RNLA 5FKLA 3OYAA 1SD4A 1VQ7I 1VQPI 2VASA 3BPVA 4DBRA 1HSTA 3U1KA 1QRYA 5L3BA 3U21A 1MMAA 3D5LA 2ME6A 1LFPA 5FRNA 3DTKA 5D5VB 4PGGA 3W3CA 2LY1A 2ZNZA 4IQJA 2H27A 2YS9A 1J2XA 4HX8A 3FMRA 2WAQN 3TO7A 1U9OA 3CMMA 3QU6A 3S3NA 2M4KA 1FNNA 1V55H 2JA6J 2K4JA 4A3LJ 5DM7F 3DPLC 4FTHA 3ZGKA 1I1SA 5ICGA 5F27A 2QYOA 4UUTA 3KYCB 2V6EA 2V1NA 5E3NA 2A5YB 2MLGA 3GTOJ 2V6CA 3JR9A 2DK5A 2VKDA 2VXDA 2I10A 3E6MA 3HOUJ 1EA3A 2E71A 4HNUA 4CXFA 2RREA 2A69F 2K27A 1ZARA 4AUXA 1QVTA 3ISPA 1JKRC 2X1EA 4GCVA 2EINH 3P9CA 2ID6A 3GZ6A 2WBMA 3HM5A 3GWZA 3L2QA 2BY3A 3W2WA 2DO7A 2CV0A 3BTIA 1OR7C 3GYHX 3FHNA 4ZTFA 3FM3A 1KA8A 3H35A 1T6SA 2MD5A 3H3ZA 3LA3A 4Q4ZF 2EK5A 2CGPA 4ENKA 3RIRA 4Q47A 2L4AA 4E7HA 1IRFA 4EJUA 2GA2A 1Z77A 2KJCA 2VOPA 2V1XA 1YYVA 3OV8A 2LKPA 2O8KA 5BNGA 2WY7Q 2W4SA 3LQRA 3WGHA 2ECBA 2K9NA 4L5JA 3ZMZA 3K2ZA 4CYDA 4J01A 3TGNA 1A6QA 4BXUA 4CYCA 4LIVA 3IRRA 4M3DA 1XTAA 3HSEA 1G3TA 1HC8A 1FC3A 4Z2YA 3RJPA 3CTAA 4LK0F 5H6RA 1MDMB 3OMYA 2LBFA 3E5UA 2V4JC 3F9KA 4A5MA 4F92B 3LA2A 2ZNYA 3LA7A 2MH2A 3LSHA 2W85A 1X58A 2F5DA 1I39A 4WCGA
chains in the Genus database with same CATH topology
1TWHJ 1TWCJ 1IV6A 1IC8A 1PUFA 1O4XA 3QQAA 3K2AA 4XIDA 1AKHB 2XGEA 3BTLA 4NDLA 4S0HB 5J1UA 5FJ8J 4D5FA 2R5ZB 1U78A 3PM1A 3BR3A 1IDYA 1K83J 1WH7A 1LFBA 1BW5A 2HOTA 3LSPA 1JGGA 2FQ4A 2CQQA 5FLVA 4DZJA 4QIWN 1F43A 2M34A 4A3FJ 4M3FA 1UMQA 1ZR2A 1H89C 2NVXJ 2Y31A 4A93J 3RZOJ 4UUSA 2B63J 1T56A 3IH4A 1G2HA 2ECCA 4HNVA 3NARA 5IYCJ 5EG0B 2IAIA 1MBGA 3B6AA 4B1RA 1RPWA 9ANTA 3B6CA 1YRNA 2Y2ZA 3RKQA 2L7FP 1MBKA 4XRSA 3ZQFA 5DS9A 5GP9A 2EQRA 3JREA 3BTJA 3HDDA 3I4NJ 3S15J 5E3LA 3JRAA 5F04A 1Y1WJ 4MLOA 1ETQA 1DU0A 4IEJA 1OCTC 1JKPC 1OCPA 3ZQCA 3GTMJ 3JRCA 2CUFA 5J1RA 3BQYA 3HOYJ 4A3BJ 1MH3A 2R7ZJ 1POGA 2XPWA 1NK2P 1HOMA 2RAEA 3S2HJ 2DA3A 1DU6A 1FJLA 1UHSA 2H1KA 2TRTA 2P81A 1W0TA 1ETOA 1VNDA 1GVDA 3BR5A 2E2HJ 4QSHA 2K40A 3HEFA 4FCYA 3ZOBA 1MBJA 1B72A 4IHXA 2JJ7A 2E19A 2XRLA 5C3EJ 5EZGA 2LP0A 2XSDC 1MSFC 2GLOA 1I3QJ 4A69C 4A3KJ 4CYCB 2LVSA 2M9HA 2JN6A 1B8IB 1XG1A 3SJMA 1WI3A 2FD5A 2KDZA 3OSFA 4FISA 3S17J 5IP7J 2NS8A 2CUEA 4B3AA 3IH3A 4FE4A 4D7NA 1AU7A 3W6VA 2IEKA 4MIMA 4X6AJ 2NOGA 1VF9A 2CRGA 3H0GJ 4QTRA 2HOAA 1OJLA 3O8GA 2EH3A 2FJ1A 4C2MJ 2CQXA 1Y1VJ 1JUPA 3GTLJ 4M3EA 4I76A 2OF7A 3BT9A 2DMNA 1RR7A 1HDPA 4ABZA 2LLKA 2M2EA 4Y7NJ 2LFBA 1LFUP 2DA6A 5FKKA 1K61A 3GTGJ 1EF4A 2VPRA 2XB0X 3SFIA 1ETWA 3L1PA 3HOVJ 3TEDA 4JYKA 3S1MJ 2ELKA 4UUSB 2DMUA 5EGOA 2JA7J 1BJZA 1X2NA 3HOXJ 5K7ZA 1RETA 2DA4A 3E7LA 3S14J 1QPIA 1VI0A 1IJWC 1A5JA 1OFCX 1YRNB 3ZQHA 4XICA 2EZKA 3BG3A 3FK6A 1U8BA 1APLC 2DJNA 2Y9ZA 2M8GX 3TP3A 1TWFJ 4B4CA 3Q3SA 1XS9A 1GV2A 2CU7A 1JTXA 2Y9YA 2QCOA 3NAUA 2QF7A 5J3LA 2NVYJ 5M3MJ 2N8GA 1MH4A 3TP0A 4M3GA 2DMPA 1JKOC 1CQTA 4DYRA 1HCRA 4M3BA 2XB5A 4XK4A 2R5YB 5FLMJ 5M5YJ 2HXIA 2R92J 1P7IA 4D5CA 4M6VA 2L9RA 4MFDA 1LE8A 1NK3P 1XC5A 3TW6A 3IH2A 1FTTA 1RESA 1WPKA 1B72B 5F0HA 3MN2A 3JRFA 1ZTRA 4A3JJ 4L5EA 1NTCA 1FEXA 1S7EA 5IOYA 3A01A 3OSGA 3M4OJ 2Y0SN 2YUSA 3G1LA 1ZGWA 3OIOA 2DMQA 3BQZA 5F08A 3S1QJ 1I50J 2JWTA 2DTZA 2R0QC 2EZIA 1TWAJ 2W48A 3Q0VA 3WHCA 1MNMC 3CQZJ 2G0EA 2NVTJ 3HKZN 2E2JJ 5J1YA 2COBA 3M3YJ 1ORKA 4FE7A 2EBIA 3GTKJ 2DA2A 2NS7A 2IBDA 2ZB9A 4GFBA 1TC3C 2XPUA 3ZQLA 3IV5A 2K9QA 2EZHA 3CMYA 2R5ZA 3FK7A 1ETYA 2DA7A 1Q1VA 3DCFA 3JRIA 3FKIJ 3HOWJ 3TW7A 2EZLA 1MSEC 5F0FA 1WCMJ 3S16J 2LY9A 5EDNA 3S2DJ 3HGYA 1ZQ3P 2HQ5A 1Z0XA 5EGOB 1IGNA 1GUUA 2VUMJ 5F1JA 4BBRJ 4BXXJ 3GTQJ 2XGDA 5EEAA 1GT0C 1JJ8C 2TCTA 5K7FA 1MBFA 1BW6A 2MG4A 1PUFB 4MFEA 2VKEA 3BTCA 2OPTA 4AC0A 1R9TJ 3SDGA 4W97A 4Y52J 1WH5A 5JLWA 3Q0WA 5F0CA 3CDLA 4A3CJ 2FX0A 2PMZN 1VFCA 1AHDP 2LR8A 3G1OA 3MVPA 4C3JJ 5C4XJ 3BR6A 4V2FA 5IOZA 2E2IJ 3LOCA 2L7ZA 4W1UA 5HODA 1HF0A 2O9LA 4C3HJ 2HOSA 2JA5J 1ETVA 2L7MP 1ZKGA 4RBOA 1BA5A 2CJJA 3WHBA 3GTJJ 2HXOA 1LE8B 1U9NA 5GPCA 1JKQC 4A3GJ 4BKXA 2HDDA 5EF6A 3I4MJ 3LSJA 5E3OA 2YU9J 4JX6A 3DEWA 1MBHA 2DMTA 1QVUA 2KT0A 1B8IA 1JT0A 1HLVA 3F0CA 3PO2J 2WB1N 1JT6A 4C3IJ 5IPAA 3HB9A 1ENHA 2AHQA 1IG7A 5IP6A 3A02A 1TWGJ 3H3VK 5C4JJ 3JRDA 4IHYA 3UKGA 5M5XJ 4I6ZA 5IYDJ 4EEFG 1P7JA 4JX4A 4JP0A 1SANA 2JA8J 1MBEA 5M3FJ 1IUFA 2LD5A 5DTDA 3RQIA 5GPAA 2LTPA 2DN0A 1JJ6C 3QPSA 3S1RJ 2XGCA 2MSYA 1D5YA 4DZPA 5FKMA 3K7AJ 1JUSA 2ID3A 1GDTA 3HOZJ 3BR0A 1HDDC 1X58A 2XPVA 2X9DA 3FISA 4A3DJ 2GM4A 4BY7J 4RDUA 4BBSJ 4LOCA 1T33A 4J19A 3ZQGA 2NVQJ 1I6HJ 4V2GA 2R93J 3Q0UA 3ZQIA 2HYJA 5EYRA 3LSRA 2WV1A 1ZR4A 2H8RA 1FIPA 4DYCA 2VI6A 5JLXA 5FKLA 5IYBJ 2MGQA 3BR2A 5IP9J 4IHWA 1AKHA 1ZK8A 4D7MA 5C44J 4DYQA 1IRZA 1E3OC 1QRYA 1W0UA 2ME6A 3PO3J 3MKLA 2YS9A 1FTZA 2JMWA 3JRGA 2WAQN 5M5WJ 2DA1A 4A3IJ 1U9OA 1UG2A 3OOUA 2O7OA 4XRSG 1X2MA 2L0KA 3GTPJ 2E1OA 1H8AC 1JUMA 2R5YA 1ETKA 4G12A 5E3MA 2JA6J 3VPRA 5EG0A 2LKXA 4BY1J 4A3LJ 4FTHA 5F27A 4UUTA 4XRMA 1IDZA 2HI3A 5E3NA 1JTYA 3GTOJ 3JR9A 2I10A 3HOUJ 3D1NI 5EZHA 3BR1A 1A6IA 4AUXA 3LSGA 1QVTA 2MW8A 1JKRC 2AO9A 1GV5A 5FKNA 1BL0A 1RKWA 2ID6A 3HM5A 2D5VA 2GBYA 1FIAA 3HBLA 2Y30A 3BG9A 3JRBA 3BTIA 2LK2A 3GBGA 2ME0A 3C2BA 3BG5A 3LNQA 3HGGA 3O8HA 1Z77A 4JX5A 4A3EJ 4DW6A 3S1NJ 1H88C 4IHVA 4MO7A 5FKOA 2O8KA 5BNGA 3A03A 3A01B 1SFOJ 2ECBA 1RKTA 2JK3A 2K9NA 2M0CA 3CCYA 1ETXA 4X1EA 4CYCA 4M3DA 4AYBN 2VKVA 2X6OA 3QPLA 3JRHA 2K9SA 4A3MJ 1WGXA 2X48A 2DA5A 3RZDJ 3FIWA 5K7HA 1F36A 1ITYA 3G1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH J;  1TWC J;  1IV6 A;  1IC8 A;  1PUF A;  1O4X A;  3QQA A;  3K2A A;  4XID A;  1AKH B;  2XGE A;  3BTL A;  4NDL A;  4S0H B;  5J1U A;  5FJ8 J;  4D5F A;  2R5Z B;  1U78 A;  3PM1 A;  3BR3 A;  1IDY A;  1K83 J;  1WH7 A;  1LFB A;  1BW5 A;  2HOT A;  3LSP A;  1JGG A;  2FQ4 A;  2CQQ A;  5FLV A;  4DZJ A;  4QIW N;  1F43 A;  2M34 A;  4A3F J;  4M3F A;  1UMQ A;  1ZR2 A;  1H89 C;  2NVX J;  2Y31 A;  4A93 J;  3RZO J;  4UUS A;  2B63 J;  1T56 A;  3IH4 A;  1G2H A;  2ECC A;  4HNV A;  3NAR A;  5IYC J;  5EG0 B;  2IAI A;  1MBG A;  3B6A A;  4B1R A;  1RPW A;  9ANT A;  3B6C A;  1YRN A;  2Y2Z A;  3RKQ A;  2L7F P;  1MBK A;  4XRS A;  3ZQF A;  5DS9 A;  5GP9 A;  2EQR A;  3JRE A;  3BTJ A;  3HDD A;  3I4N J;  3S15 J;  5E3L A;  3JRA A;  5F04 A;  1Y1W J;  4MLO A;  1ETQ A;  1DU0 A;  4IEJ A;  1OCT C;  1JKP C;  1OCP A;  3ZQC A;  3GTM J;  3JRC A;  2CUF A;  5J1R A;  3BQY A;  3HOY J;  4A3B J;  1MH3 A;  2R7Z J;  1POG A;  2XPW A;  1NK2 P;  1HOM A;  2RAE A;  3S2H J;  2DA3 A;  1DU6 A;  1FJL A;  1UHS A;  2H1K A;  2TRT A;  2P81 A;  1W0T A;  1ETO A;  1VND A;  1GVD A;  3BR5 A;  2E2H J;  4QSH A;  2K40 A;  3HEF A;  4FCY A;  3ZOB A;  1MBJ A;  1B72 A;  4IHX A;  2JJ7 A;  2E19 A;  2XRL A;  5C3E J;  5EZG A;  2LP0 A;  2XSD C;  1MSF C;  2GLO A;  1I3Q J;  4A69 C;  4A3K J;  4CYC B;  2LVS A;  2M9H A;  2JN6 A;  1B8I B;  1XG1 A;  3SJM A;  1WI3 A;  2FD5 A;  2KDZ A;  3OSF A;  4FIS A;  3S17 J;  5IP7 J;  2NS8 A;  2CUE A;  4B3A A;  3IH3 A;  4FE4 A;  4D7N A;  1AU7 A;  3W6V A;  2IEK A;  4MIM A;  4X6A J;  2NOG A;  1VF9 A;  2CRG A;  3H0G J;  4QTR A;  2HOA A;  1OJL A;  3O8G A;  2EH3 A;  2FJ1 A;  4C2M J;  2CQX A;  1Y1V J;  1JUP A;  3GTL J;  4M3E A;  4I76 A;  2OF7 A;  3BT9 A;  2DMN A;  1RR7 A;  1HDP A;  4ABZ A;  2LLK A;  2M2E A;  4Y7N J;  2LFB A;  1LFU P;  2DA6 A;  5FKK A;  1K61 A;  3GTG J;  1EF4 A;  2VPR A;  2XB0 X;  3SFI A;  1ETW A;  3L1P A;  3HOV J;  3TED A;  4JYK A;  3S1M J;  2ELK A;  4UUS B;  2DMU A;  5EGO A;  2JA7 J;  1BJZ A;  1X2N A;  3HOX J;  5K7Z A;  1RET A;  2DA4 A;  3E7L A;  3S14 J;  1QPI A;  1VI0 A;  1IJW C;  1A5J A;  1OFC X;  1YRN B;  3ZQH A;  4XIC A;  2EZK A;  3BG3 A;  3FK6 A;  1U8B A;  1APL C;  2DJN A;  2Y9Z A;  2M8G X;  3TP3 A;  1TWF J;  4B4C A;  3Q3S A;  1XS9 A;  1GV2 A;  2CU7 A;  1JTX A;  2Y9Y A;  2QCO A;  3NAU A;  2QF7 A;  5J3L A;  2NVY J;  5M3M J;  2N8G A;  1MH4 A;  3TP0 A;  4M3G A;  2DMP A;  1JKO C;  1CQT A;  4DYR A;  1HCR A;  4M3B A;  2XB5 A;  4XK4 A;  2R5Y B;  5FLM J;  5M5Y J;  2HXI A;  2R92 J;  1P7I A;  4D5C A;  4M6V A;  2L9R A;  4MFD A;  1LE8 A;  1NK3 P;  1XC5 A;  3TW6 A;  3IH2 A;  1FTT A;  1RES A;  1WPK A;  1B72 B;  5F0H A;  3MN2 A;  3JRF A;  1ZTR A;  4A3J J;  4L5E A;  1NTC A;  1FEX A;  1S7E A;  5IOY A;  3A01 A;  3OSG A;  3M4O J;  2Y0S N;  2YUS A;  3G1L A;  1ZGW A;  3OIO A;  2DMQ A;  3BQZ A;  5F08 A;  3S1Q J;  1I50 J;  2JWT A;  2DTZ A;  2R0Q C;  2EZI A;  1TWA J;  2W48 A;  3Q0V A;  3WHC A;  1MNM C;  3CQZ J;  2G0E A;  2NVT J;  3HKZ N;  2E2J J;  5J1Y A;  2COB A;  3M3Y J;  1ORK A;  4FE7 A;  2EBI A;  3GTK J;  2DA2 A;  2NS7 A;  2IBD A;  2ZB9 A;  4GFB A;  1TC3 C;  2XPU A;  3ZQL A;  3IV5 A;  2K9Q A;  2EZH A;  3CMY A;  2R5Z A;  3FK7 A;  1ETY A;  2DA7 A;  1Q1V A;  3DCF A;  3JRI A;  3FKI J;  3HOW J;  3TW7 A;  2EZL A;  1MSE C;  5F0F A;  1WCM J;  3S16 J;  2LY9 A;  5EDN A;  3S2D J;  3HGY A;  1ZQ3 P;  2HQ5 A;  1Z0X A;  5EGO B;  1IGN A;  1GUU A;  2VUM J;  5F1J A;  4BBR J;  4BXX J;  3GTQ J;  2XGD A;  5EEA A;  1GT0 C;  1JJ8 C;  2TCT A;  5K7F A;  1MBF A;  1BW6 A;  2MG4 A;  1PUF B;  4MFE A;  2VKE A;  3BTC A;  2OPT A;  4AC0 A;  1R9T J;  3SDG A;  4W97 A;  4Y52 J;  1WH5 A;  5JLW A;  3Q0W A;  5F0C A;  3CDL A;  4A3C J;  2FX0 A;  2PMZ N;  1VFC A;  1AHD P;  2LR8 A;  3G1O A;  3MVP A;  4C3J J;  5C4X J;  3BR6 A;  4V2F A;  5IOZ A;  2E2I J;  3LOC A;  2L7Z A;  4W1U A;  5HOD A;  1HF0 A;  2O9L A;  4C3H J;  2HOS A;  2JA5 J;  1ETV A;  2L7M P;  1ZKG A;  4RBO A;  1BA5 A;  2CJJ A;  3WHB A;  3GTJ J;  2HXO A;  1LE8 B;  1U9N A;  5GPC A;  1JKQ C;  4A3G J;  4BKX A;  2HDD A;  5EF6 A;  3I4M J;  3LSJ A;  5E3O A;  2YU9 J;  4JX6 A;  3DEW A;  1MBH A;  2DMT A;  1QVU A;  2KT0 A;  1B8I A;  1JT0 A;  1HLV A;  3F0C A;  3PO2 J;  2WB1 N;  1JT6 A;  4C3I J;  5IPA A;  3HB9 A;  1ENH A;  2AHQ A;  1IG7 A;  5IP6 A;  3A02 A;  1TWG J;  3H3V K;  5C4J J;  3JRD A;  4IHY A;  3UKG A;  5M5X J;  4I6Z A;  5IYD J;  4EEF G;  1P7J A;  4JX4 A;  4JP0 A;  1SAN A;  2JA8 J;  1MBE A;  5M3F J;  1IUF A;  2LD5 A;  5DTD A;  3RQI A;  5GPA A;  2LTP A;  2DN0 A;  1JJ6 C;  3QPS A;  3S1R J;  2XGC A;  2MSY A;  1D5Y A;  4DZP A;  5FKM A;  3K7A J;  1JUS A;  2ID3 A;  1GDT A;  3HOZ J;  3BR0 A;  1HDD C;  1X58 A;  2XPV A;  2X9D A;  3FIS A;  4A3D J;  2GM4 A;  4BY7 J;  4RDU A;  4BBS J;  4LOC A;  1T33 A;  4J19 A;  3ZQG A;  2NVQ J;  1I6H J;  4V2G A;  2R93 J;  3Q0U A;  3ZQI A;  2HYJ A;  5EYR A;  3LSR A;  2WV1 A;  1ZR4 A;  2H8R A;  1FIP A;  4DYC A;  2VI6 A;  5JLX A;  5FKL A;  5IYB J;  2MGQ A;  3BR2 A;  5IP9 J;  4IHW A;  1AKH A;  1ZK8 A;  4D7M A;  5C44 J;  4DYQ A;  1IRZ A;  1E3O C;  1QRY A;  1W0U A;  2ME6 A;  3PO3 J;  3MKL A;  2YS9 A;  1FTZ A;  2JMW A;  3JRG A;  2WAQ N;  5M5W J;  2DA1 A;  4A3I J;  1U9O A;  1UG2 A;  3OOU A;  2O7O A;  4XRS G;  1X2M A;  2L0K A;  3GTP J;  2E1O A;  1H8A C;  1JUM A;  2R5Y A;  1ETK A;  4G12 A;  5E3M A;  2JA6 J;  3VPR A;  5EG0 A;  2LKX A;  4BY1 J;  4A3L J;  4FTH A;  5F27 A;  4UUT A;  4XRM A;  1IDZ A;  2HI3 A;  5E3N A;  1JTY A;  3GTO J;  3JR9 A;  2I10 A;  3HOU J;  3D1N I;  5EZH A;  3BR1 A;  1A6I A;  4AUX A;  3LSG A;  1QVT A;  2MW8 A;  1JKR C;  2AO9 A;  1GV5 A;  5FKN A;  1BL0 A;  1RKW A;  2ID6 A;  3HM5 A;  2D5V A;  2GBY A;  1FIA A;  3HBL A;  2Y30 A;  3BG9 A;  3JRB A;  3BTI A;  2LK2 A;  3GBG A;  2ME0 A;  3C2B A;  3BG5 A;  3LNQ A;  3HGG A;  3O8H A;  1Z77 A;  4JX5 A;  4A3E J;  4DW6 A;  3S1N J;  1H88 C;  4IHV A;  4MO7 A;  5FKO A;  2O8K A;  5BNG A;  3A03 A;  3A01 B;  1SFO J;  2ECB A;  1RKT A;  2JK3 A;  2K9N A;  2M0C A;  3CCY A;  1ETX A;  4X1E A;  4CYC A;  4M3D A;  4AYB N;  2VKV A;  2X6O A;  3QPL A;  3JRH A;  2K9S A;  4A3M J;  1WGX A;  2X48 A;  2DA5 A;  3RZD J;  3FIW A;  5K7H A;  1F36 A;  1ITY A;  3G1M A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  3IL2 A;  1MZB A;  3QU3 A;  1IV6 A;  3CC7 I;  1W4M A;  2E36 A;  1O4X A;  2W57 A;  3K2A A;  4R8H A;  2HR3 A;  3AFH A;  4I0A A;  4XID A;  1UST A;  3BTL A;  3IAS 2;  4N9I A;  5J40 A;  3G71 I;  1AWC A;  1U78 A;  3HUG A;  1IDY A;  2QSG X;  1BW5 A;  5TRD A;  3KZY A;  2FQ4 A;  2CQQ A;  4QIW N;  4L9T A;  2PJP A;  3WGI A;  1UMQ A;  2ZJQ F;  1ZR2 A;  4EGY A;  2VQC A;  2NVX J;  2O0Y A;  2FNA A;  3FBI B;  4LD5 A;  3RZO J;  1LEA A;  5LD2 C;  1HA8 A;  3OYM A;  3BJO A;  3OYF A;  4MGR A;  2ECC A;  3COA C;  1GLN A;  3OYB A;  3NAR A;  2XGX A;  5IYC J;  1MBG A;  1S6L A;  3B6A A;  3WTV C;  9ANT A;  2Y2Z A;  3IC7 A;  3QYE A;  4LMY A;  2H09 A;  3DPT A;  3R0J A;  1D1B A;  4XRS A;  2G7U A;  2PN6 A;  2ZCW A;  5GP9 A;  3DWL E;  3IRQ A;  1E2X A;  4HBL A;  5E1W A;  3OS1 A;  2I8D A;  1WJF A;  5F64 A;  1Y1W J;  1ETQ A;  1TBX A;  2A68 F;  2D2W A;  3CCE I;  1DU0 A;  1ZH5 A;  1D0Z A;  3PNY A;  3U9G A;  1JKP C;  4I0B A;  2WWY A;  4KUM A;  4PJ0 C;  3BDD A;  3CME I;  5L3D A;  5JFR A;  4I98 B;  3HOY J;  2X6X A;  4LFU A;  3CO6 C;  4E4H A;  3FXU A;  1EH6 A;  3UNG C;  1NK2 P;  3C18 A;  1Y8R B;  4OOI A;  2FXA A;  4V19 K;  1FJL A;  1UHS A;  2H1K A;  4GDF A;  1SC7 A;  4IL6 C;  2COM A;  4IXA A;  4KT6 A;  5E8I A;  1D8K A;  3J7A Y;  2QM3 A;  2CQK A;  3KYL A;  3HEF A;  3ABU A;  2V1D A;  3RYP A;  1L3L A;  1VQ5 I;  1B72 A;  2JJ7 A;  2EV6 A;  3Q5F A;  1BBY A;  2E19 A;  1PVE A;  2QQ9 A;  3NQO A;  2LP0 A;  3MWM A;  1X4O A;  3ZMS A;  1MSF C;  1I3Q J;  2P5K A;  1N25 A;  4A69 C;  4A3K J;  3J7Z I;  3A2K A;  1X3W B;  3L2C A;  5E8G A;  3OSF A;  2FBI A;  2G7H A;  1FP2 A;  2DOD A;  1YW8 A;  1ZG1 A;  4JK1 X;  1M1E B;  1ZLJ A;  3DKW A;  1TQM A;  3W6V A;  3CF2 A;  2NVU B;  2O8X A;  4MIM A;  2WAE A;  4X6A J;  1FYM A;  3H0G J;  4QTR A;  3I54 A;  4CCO A;  2RQP A;  3K0L A;  2EH3 A;  3O8G A;  4TV7 A;  4C2M J;  1ZGJ A;  1Y1V J;  3H5N A;  5LRS A;  4BH9 A;  4M3E A;  1RR7 A;  2Y0S A;  2IPQ X;  2Y69 H;  2ZJ2 A;  4BU2 A;  5FD5 A;  3SZP A;  1LFU P;  2DA6 A;  3RYR A;  1ZRC A;  4BDY A;  1WI9 A;  2KMU A;  5IT9 K;  5B1B H;  2JUC A;  3FM5 A;  3OWT A;  3L1P A;  3HOV J;  1OR7 A;  1YW9 A;  2XDV A;  1H9G A;  2JA7 J;  4IF4 A;  4U0Y A;  4OMZ A;  4O6J A;  3HOX J;  5K7Z A;  1RET A;  2DA4 A;  2NNY A;  2HWV A;  4Z6Y A;  1IJW C;  2JZY A;  4U7B A;  4XIC A;  3W6J B;  2XHK A;  3DEE A;  1APL C;  1IF1 A;  2M8G X;  5CVJ A;  5B5E C;  4RMN A;  1NG6 A;  3DBH B;  2KJB A;  4B4C A;  3Q3S A;  5DD4 A;  2EIM H;  2CU7 A;  2PX9 A;  1JTX A;  1X4P A;  1A31 A;  2QCO A;  2NVY J;  2HKX A;  2N8G A;  4HW0 A;  1WFX A;  4XLN F;  2JPC A;  1J75 A;  1A04 A;  5CQE A;  1XN7 A;  3RDI A;  3RKX A;  3MKY B;  3CZ6 A;  2H6C A;  3C2H A;  4BQA A;  4FAS D;  4II2 A;  4ZYA A;  1S72 I;  4OU0 A;  1T0F C;  1KGS A;  2L9R A;  3AG3 H;  5GAD J;  4OIO F;  3MKW B;  2BOL A;  1RES A;  2V9K A;  3ULQ B;  1W5S A;  1FSH A;  2L2O A;  3CCS I;  2DT6 A;  3G4S I;  3ZQ7 A;  1DQU A;  3JW4 A;  1NTC A;  3A01 A;  1RZ4 A;  4L9J A;  4CCN A;  1SAX A;  3M4O J;  2Y0S N;  3JTH A;  2VKH A;  4I01 A;  3TO6 A;  3EPZ A;  1FYK A;  4KNY A;  2DMQ A;  3BQZ A;  5F08 A;  3MFK A;  4IX7 A;  2XRN A;  2EZI A;  4KA4 A;  3P9I A;  1HKQ A;  2FQ3 A;  2W48 A;  4BJ6 C;  4ZC3 A;  3DKX A;  2CV1 A;  3WHC A;  3ELK A;  3CQZ J;  3KP3 A;  2E2J J;  2XAF A;  5BPD A;  2JVH A;  5J1Y A;  5HNH A;  1UAA A;  3DPU A;  4KMF A;  3M9A A;  1KON A;  4FE7 A;  5L3F A;  3MZY A;  3K70 C;  2BHZ A;  2BW3 A;  2XV4 S;  2PBI A;  1QZZ A;  2IBD A;  4GFB A;  1TC3 C;  2PEX A;  3C2G A;  4ASN A;  1PDN C;  5HS8 A;  2M8E A;  2CYY A;  2LRE A;  3CMY A;  1Z1D A;  1K6O A;  2R5Z A;  3CDI A;  3FK7 A;  1D0X A;  3T0Y A;  3TL4 X;  2YSR A;  4IHT A;  3FMS A;  2EZL A;  5LHH A;  2QA4 I;  1XCV A;  3V7S A;  1WCM J;  4PK4 A;  3OYE A;  4XRF A;  2D1H A;  1OMI A;  4KIC A;  4LLN A;  3MD2 A;  2VUM J;  5CQG A;  2ESH A;  5F1J A;  2LBF B;  4QPO A;  4XLC A;  2XGD A;  5CVU A;  2O5R A;  1IN4 A;  3T5X A;  5E79 C;  3FXO A;  2L7K A;  2E1M C;  2H1L A;  4YFN F;  3OYC A;  1UHM A;  4ENM A;  1R1V A;  2UWM A;  4KN7 X;  4MFE A;  3EET A;  2VKE A;  4AC0 A;  2OPT A;  1ZRE A;  3FXM A;  2DQR A;  2OD5 A;  5JLW A;  3V7R A;  4RAZ A;  1TW3 A;  2R7D A;  4A3C J;  4AVP A;  3KP5 A;  3HUG B;  4V2F A;  4P55 A;  3E6D A;  3H5R A;  4DQ2 A;  2BY1 A;  1LB2 A;  4UHT A;  2OQR A;  2EFQ A;  1O3S A;  1T8I A;  2DJI A;  1JGS A;  1T2K A;  4CCL A;  3AAF A;  3HKZ A;  1KQ8 A;  1TTY A;  4A12 A;  2HOS A;  1ZG5 A;  5BQT A;  1YI2 I;  2CJJ A;  3AG2 H;  1RUO A;  3CCQ I;  3WTZ A;  2HTS A;  1QO0 D;  4E7L A;  2OZU A;  3RI4 A;  5FB2 A;  5H2F C;  2HDD A;  5EF6 A;  1HXD A;  1MKM A;  5D6F A;  3ABM H;  5E3O A;  2YU9 J;  3WTT C;  2VBW A;  1K4S A;  1IN5 A;  2HVR A;  1MBH A;  1QVU A;  2DOA A;  2E7W A;  2A61 A;  2KT0 A;  1B8I A;  1Z7L A;  5TIS C;  1ONV A;  5CYV A;  3GF2 A;  2ZFW A;  3SEZ A;  3REO A;  2F4I A;  1W36 C;  3SXY A;  1R4N B;  2CMP A;  3PSI A;  1ZN2 A;  2AQF A;  1D1C A;  1LDD A;  3PQK A;  4OAZ A;  2BXY A;  2W84 A;  2IVM A;  5L3E A;  1SAN A;  1G3Y A;  3CD6 I;  2E60 A;  3WOD F;  5M3F J;  2J5P A;  2LTP A;  2QSH X;  1HW2 A;  2DN0 A;  1JJ6 C;  3QPS A;  5LFA A;  2DOF A;  2M1B A;  3OYL A;  4CH7 A;  4DGW B;  1Z05 A;  3S8P A;  5BPI A;  4OIR F;  3HPG A;  2Y75 A;  1IN6 A;  4B8X A;  1G8X A;  5ICF A;  1J7K A;  2W00 A;  2H8W A;  4CZC A;  5A2Q K;  2GM4 A;  4BY7 J;  3K4M A;  1IXR C;  1SVM A;  3M8J A;  3ZQG A;  4MEX F;  4NB5 A;  1MDM A;  2NVQ J;  1R6R A;  3AG4 H;  4MNU A;  1T0F A;  2JQ7 A;  3ZQI A;  4XON A;  5EYR A;  3HOS A;  2KRF A;  4HV6 A;  3N4M A;  2WV1 A;  1O7F A;  5HDG A;  2HGC A;  3HSF A;  3OR2 C;  3I59 B;  3BR2 A;  4DYQ A;  4YRV A;  5HDN A;  1W0U A;  3PO3 J;  2WB1 A;  4U0W A;  1EV7 A;  2IGM A;  4FQG A;  4A3I J;  4O3M A;  3OOU A;  1T98 A;  2O7O A;  1STZ A;  3JCU C;  2L0K A;  3GTP J;  1FP1 D;  2YPR A;  2FRH A;  2CS3 A;  5J47 A;  2CV2 A;  1ETK A;  4G12 A;  5E3M A;  3LAP A;  4HA8 A;  3VPR A;  5JVG F;  2VQL A;  1R00 A;  3PUB A;  2OAZ A;  1R1U A;  4XRM A;  1IDZ A;  2ACJ A;  1MNE A;  3L7W A;  3G73 A;  4UV8 A;  3LSK A;  4PSW A;  4L0Z B;  3C3W A;  3D5R C;  3PNT A;  2A6E F;  4MQ9 F;  3BR1 A;  2VON A;  3CMA I;  5FKN A;  2DYS H;  4UB8 C;  1MGT A;  1VQ6 I;  2KDO A;  2X6Y A;  1SD6 A;  2FNP A;  2LMD A;  1RKW A;  4BAC A;  2MH9 A;  3VYR B;  3K4N A;  4BHC A;  2GBY A;  4AWX B;  4C2U A;  4KYW A;  2XAH A;  3ECO A;  3VYU B;  4YIR X;  2Y30 A;  4M71 A;  5LBQ A;  3AKZ A;  2R3S A;  3K6G A;  3OYN A;  1GXQ A;  2LK2 A;  2OA4 A;  2DFE A;  4ENJ A;  1FMV A;  3GBG A;  2OV7 A;  1FZP B;  1DPU A;  2K02 A;  4A3E J;  4DW6 A;  3S1N J;  4A0Y A;  5H20 A;  2DXI A;  4KN4 X;  3PQJ A;  3OYI A;  4BHB A;  3A01 B;  5CKT A;  4G6T B;  4E70 A;  2HPI A;  1ETX A;  4Y17 A;  1D3Y A;  2WAQ A;  3M8E A;  2K85 A;  1OCO H;  5J8F A;  2L54 A;  2R7W A;  4ZYG A;  3VFZ A;  4B44 A;  4EJW A;  4IO9 F;  2P7V B;  3RZD J;  3FIW A;  1F9N A;  3VDX A;  4ZYE A;  2FE3 A;  1ON1 A;  3W2V A;  3E5Q A;  1TWH J;  3WTX C;  1TWC J;  2NNN A;  1PUF A;  2GA1 A;  4LK1 F;  2M4G A;  1X1P A;  2KL4 A;  3OOP A;  2BY0 A;  2XGE A;  2L9S A;  4BQQ A;  4NDL A;  2LYC A;  2A6T A;  3KP7 A;  1BC7 C;  3DV8 A;  5FJ8 J;  4A0Z A;  3P5J A;  1LVA A;  2ZXH A;  2R5Z B;  4GO1 A;  3V8L A;  3PL8 A;  2ZSH B;  2E34 A;  5DV5 A;  1MW7 A;  2ELJ A;  3F8F A;  1DGW Y;  3LSP A;  4DZJ A;  3DF8 A;  1JGG A;  1XMX A;  2OCC H;  4L0Y B;  2Y31 A;  3OYJ A;  2EFN A;  2XF6 A;  1T56 A;  1ZAO A;  2XIG A;  3IH4 A;  3OYK A;  1U0J A;  2ZSI B;  3KEQ A;  1ODD A;  3GW2 A;  1Z7U A;  3I3L A;  3BLY A;  3K9T A;  3ABT A;  4HQM A;  1RC9 A;  1FOY A;  4BHP A;  2BGC A;  3OYG A;  1KZH A;  3RKQ A;  2MAB A;  2HVQ A;  2Z99 A;  1U2W A;  5GAG J;  3L00 A;  4F7Z A;  3ZQF A;  2EQR A;  1UG0 A;  2F48 A;  2DOE A;  3BTJ A;  1JE8 A;  1CGP A;  1P6R A;  1SAU A;  3S15 J;  2IGN A;  3CCV I;  3JRA A;  2IJL A;  4JQF A;  1LJ9 A;  1ZGA A;  4MEY F;  3K4B A;  2C6Y A;  4IEJ A;  4U7D A;  3CJQ B;  4IVN A;  1OCP A;  4HF1 A;  3ZQC A;  2O3F A;  3TDU C;  3CDH A;  4ZTJ A;  2DFI A;  2R7Z J;  1SVL A;  4P5O A;  4CDG A;  1Z67 A;  4UNO A;  2K9L A;  4RLQ A;  5BMZ A;  3G6E I;  2CSO A;  1HOM A;  3SZT A;  3A0B C;  2RAE A;  2DLL A;  3HRU A;  3QYB A;  1DU6 A;  3LSM A;  2P81 A;  1W0T A;  1LUJ B;  1ETO A;  1VND A;  2OJE D;  3BR5 A;  3VYS B;  1PP7 U;  4QSH A;  2E2H J;  1WVR A;  2BV6 A;  1QZY A;  2D45 A;  3ZOB A;  1R36 A;  3H0D A;  1MJB A;  5KK1 A;  2OQG A;  3F6O A;  2QUF A;  2FML A;  2XSD C;  4HZF A;  2QGU A;  1HKT A;  2LVS A;  2JN6 A;  1B8I B;  1XG1 A;  3SJM A;  1F5T A;  3BOQ A;  2FD5 A;  2V26 A;  1X1C A;  4NC6 A;  5L3G A;  3S17 J;  4G7O F;  2P8T A;  5IP7 J;  2NS8 A;  3O3K A;  2XAG A;  1ZEL A;  4M73 A;  5ED4 A;  3CP2 A;  2P7C B;  4FX0 A;  4WXH A;  2GAU A;  1W5C C;  3IH3 A;  3T8T A;  4IRG A;  5ICC A;  2QVO A;  3LQQ A;  2NOG A;  4Y3O A;  4FX4 A;  1VF9 A;  2CRG A;  4ZDP A;  2E5Z A;  3ZQQ A;  1WHU A;  2M45 A;  1OJL A;  3GLX A;  3K1N A;  2FJ1 A;  1BI2 A;  3NWT A;  1HBX G;  2F5V A;  2V7F A;  3BT9 A;  4MHG A;  1HDP A;  2EFP A;  2M2E A;  3GLL A;  3OIP A;  4EGZ A;  4Y7N J;  2LFB A;  2B7E A;  2DTR A;  2TDX A;  3W2A A;  2VPR A;  3I53 A;  3W6K B;  2XB0 X;  3V7C A;  3SFI A;  4Y33 A;  5CVI A;  4UY8 I;  3HSR A;  4EJO A;  3HXL A;  1IV8 A;  5GTH C;  3S1M J;  2ELK A;  2X1C A;  2DMU A;  4UUS B;  4ZDL A;  3QYF A;  2KFD A;  2LDU A;  3KEO A;  1A36 A;  4F52 A;  1BJZ A;  5GAH J;  1XCB A;  2FMY A;  3DTE A;  2EPF A;  1S5L C;  3E7L A;  3ECH A;  3I58 A;  4BUP A;  3WG7 H;  2GXA A;  1VI0 A;  2IS2 A;  1Z3Y A;  1OFC X;  1R23 A;  3R0A A;  1YRN B;  3IWF A;  2Z5U A;  3WU0 A;  1U8B A;  4PJN A;  2R7F A;  3S2W A;  3A1Y A;  4S05 A;  3CC2 I;  2GIZ A;  1FOK A;  3OR1 C;  3R61 A;  1UB9 A;  2L5Q A;  5BS6 A;  3QPH A;  2E35 A;  3GZN B;  2F4M B;  5J8C A;  3Q9V A;  1IZ1 A;  2L02 A;  4QLC U;  2QF7 A;  2XKO A;  3X2Q H;  1YE9 A;  4P9F A;  2FOW A;  3RPQ A;  2KPM A;  1X3Z B;  4YFX F;  4M3G A;  4ZYD A;  4MTD A;  2PFB A;  4PUS A;  4M3B A;  4XR6 A;  2MBF A;  4I99 C;  2RGV A;  3K4K A;  1N75 A;  2WY8 Q;  4XK4 A;  2HXI A;  2OZ6 A;  4D5C A;  1J09 A;  3SQN A;  3CCM I;  1E17 A;  3FXL A;  4BQO A;  1VZ0 A;  2VBZ A;  4E7S A;  4AM3 A;  1XDU A;  1WPK A;  3KZZ A;  2DPD A;  3D5S C;  2BY2 A;  1B9N A;  5KAF C;  1FEX A;  4HF2 A;  3HHG A;  4CSW A;  2CG4 A;  2BHY A;  3S1Q J;  1OQY A;  4CO8 A;  1TWA J;  4NHJ A;  2CFO A;  3I55 I;  1V5E A;  1WJE A;  3KPH A;  3HHH A;  2BXZ A;  1LVK A;  5DUI A;  2COB A;  3M3Y J;  2B9S A;  2E1M B;  5D8L B;  5LHG A;  1I1G A;  3KP2 A;  5ILU A;  3J80 Z;  3S3M A;  2LRD A;  2JA2 A;  1K7A A;  2NAZ A;  1Z91 A;  2CH0 A;  3BP8 A;  3JAM Z;  3KX2 A;  3ZQL A;  3HPH A;  2HEO A;  3DTI A;  4WXC A;  2K9Q A;  2EZH A;  3R4K A;  3JSP A;  3SZG A;  4IQ4 A;  2X6W A;  3F3X A;  3FX3 A;  3FMQ A;  2DA7 A;  1PYV A;  3DCF A;  3JRI A;  4IOC F;  2ZJR F;  3HOW J;  3IAM 2;  3TW7 A;  3DBR B;  3RKY A;  4BNC A;  2K86 A;  2LY9 A;  4B3X A;  4KIG A;  1Z0X A;  4KJZ A;  5EGO B;  1IGN A;  1GUU A;  1KYW A;  3P7N A;  2JTV A;  4XNF A;  1IW7 F;  4BXX J;  5D8K B;  1XGS A;  4E7J A;  4XKW A;  4KIB A;  5DYM A;  1QQI A;  1XB4 A;  4XLH A;  5K7F A;  1IN7 A;  1MBF A;  3I59 A;  1PUF B;  3IKT A;  2M0M A;  3MAJ A;  2DDA A;  2DK8 A;  4AIH A;  3BTC A;  3GXO A;  2F5F A;  1XGM A;  4W97 A;  1NHA A;  1WH5 A;  1ZHF A;  2DYR H;  2FOK A;  3I4P A;  5KCM A;  4ON0 A;  3CDL A;  4IJA A;  2DI3 A;  4BEH B;  4PGH A;  1AHD P;  3FHZ A;  3WGG A;  3BR6 A;  3FBN B;  3ESW B;  1BM9 A;  2VT3 A;  2W1O A;  2F5E A;  4B43 A;  3K1M A;  1BJA A;  2XKP A;  4AD9 A;  2ZBK A;  1WRJ A;  1BI1 A;  2L7Z A;  3E0J B;  3GCM A;  2QBY A;  2O9L A;  1BN5 A;  3RPU D;  4C3H J;  1N77 A;  4XN3 A;  1HW5 A;  4M9X A;  2DDB A;  4HX4 A;  4BE1 A;  4C2T A;  2HXO A;  1LE8 B;  3I5U A;  1JKQ C;  1YX3 A;  2VT2 A;  1HKS A;  4XMY A;  1LNW A;  1SEU A;  1YFH A;  4PCQ A;  4P1W A;  1EKE A;  5CPR B;  4Q5S F;  2VBX A;  4HF0 A;  3DEW A;  4E7I A;  3M7G A;  3ZMD A;  3HRM A;  4ANJ A;  4OIN F;  4EM0 B;  1HLV A;  1JT6 A;  4C3I J;  5IPA A;  3ABL H;  3KYD B;  4CA0 A;  3CO7 C;  1IG7 A;  2GXB A;  1IRG A;  4OMY A;  5KHD A;  3H3V K;  5C4J J;  1Z21 A;  4IHY A;  4N0B A;  5FRM A;  5M5X J;  4I6Z A;  4CCM A;  2PG4 A;  4EEF G;  4JX4 A;  1J9I A;  2MFZ A;  4LLG F;  1OKR A;  2XVC A;  4IRI A;  2QKM B;  2LD5 A;  2Y0M A;  2R7S A;  3QWL A;  5D6E A;  4AIK A;  1GXP A;  5HOO A;  3J81 Z;  1G4D A;  4XM3 A;  1R5H A;  2OTL I;  1D5Y A;  1Z6T A;  2NOJ B;  4AID A;  1C0W A;  1GDT A;  1UZC A;  4PZJ A;  2KRC A;  5EEH A;  3MZH A;  2A05 A;  4CUG A;  2XPV A;  1BOB A;  3F6V A;  1G3W A;  1FMW A;  4BBS J;  4LG0 A;  1T33 A;  1OYW A;  1XGO A;  1HSJ A;  1I6H J;  4V2G A;  2R93 J;  2CW0 F;  4BYY A;  2HDC A;  2HYJ A;  1HW1 A;  3DU5 A;  2PQ8 A;  1K6Y A;  3AL0 B;  1LQ1 A;  3PUF A;  4PFP A;  2VI6 A;  5IYB J;  4IHW A;  2HQR A;  1ZK8 A;  3V42 A;  4D7M A;  5C44 J;  2AS5 F;  1IRZ A;  4HLY A;  4GGG A;  2FBH A;  3CJN A;  1K78 B;  1ULY A;  2DT5 A;  4CHU A;  2JMW A;  3JRG A;  1S29 A;  2DW4 A;  1R49 A;  2RQQ A;  4HEA 2;  2DA1 A;  4R79 A;  3LL7 A;  5J4V A;  1UG2 A;  1G6N A;  1YOV B;  4K2E A;  5F6F A;  4XRS G;  5EEG A;  1YIT I;  1X2M A;  4EM2 A;  3GVA A;  1P2F A;  1VQL I;  3EUH C;  1H8A C;  2LOO A;  4BY1 J;  2LKX A;  4Y15 A;  2LG4 A;  2VLA A;  2PMU A;  4XKV A;  2ISZ A;  1ZRD A;  2HI3 A;  2HQN A;  1PJR A;  2GOX B;  1JTY A;  2XAQ A;  3ZRG A;  3TKY A;  2BYV E;  4EMS A;  3ABK H;  1FBQ A;  2K3P A;  3D1N I;  4HX7 A;  5EZH A;  4UB6 C;  3ASO H;  3B73 A;  2L9V A;  2CQN A;  1RUN A;  5AIP A;  3LSG A;  2MW8 A;  4LGW A;  1N78 A;  3S93 A;  2HU9 A;  3F8N A;  2BBY A;  3MCZ A;  2FU4 A;  4G9Y A;  4H4K C;  1RRJ A;  3V4G A;  2D5V A;  5JVT A;  1P4X A;  1O57 A;  1FIA A;  3HBL A;  3BG9 A;  4XLA A;  3T8R A;  1OCZ H;  1AA7 A;  4ESF A;  4HLX A;  1MMN A;  4EM1 A;  3PIO F;  2HDW A;  2VOO A;  2HYG D;  4DJA A;  3FZV A;  4NUB A;  1XDS A;  3O8H A;  1U3E M;  1WJ5 A;  4IHV A;  3KZI C;  2VN2 A;  4UV9 A;  1W5T A;  5E1X A;  3SHF A;  5FKO A;  2KKO A;  2VPL A;  3L2R A;  3KLO A;  3A03 A;  4EAT A;  3L2V A;  1RKT A;  4EV0 A;  1I6X A;  2M0C A;  1LEB A;  4A2U A;  4UUV A;  4XSZ F;  2VJ4 A;  2ELH A;  2VKV A;  4AYB N;  2EFO A;  2X6O A;  3QPL A;  3JRH A;  3QAH A;  2K9S A;  1BIA A;  1WGX A;  1MMG A;  2M87 A;  2X48 A;  4L5I A;  5LGU A;  2DA5 A;  3MKZ A;  5K7H A;  4AU7 A;  1F36 A;  1ITY A;  3G1M A;  1ZGW A;  4FT8 A;  2M7A A;  3F22 A;  1FLI A;  1IC8 A;  1VQ4 I;  3WTY C;  3CP8 A;  4OIP F;  1OCC H;  3LWF A;  3TOB A;  1AKH B;  1MJ9 A;  3CES A;  4HV5 A;  3HTS B;  3ZMU A;  1TT5 B;  2RNG A;  3OL3 A;  3DLL F;  4A5N A;  1YIJ I;  4FHT A;  1K83 J;  1LFB A;  5E1Z B;  2HOT A;  1F43 A;  4A3F J;  1YHQ I;  4M3F A;  2P5L C;  1GHC A;  4C9Y A;  1BIB A;  4UUS A;  2B63 J;  3WTS C;  3M1E A;  1W7P B;  1MD0 A;  3L9F A;  3MMY B;  2DQL A;  4HNV A;  4M72 A;  5EG0 B;  3IP4 B;  4BAY A;  2UUZ A;  4XKB A;  2QEN A;  4BJT A;  5DDG A;  2V9V A;  1RPW A;  1Z3X A;  1YRN A;  1R22 A;  1QNT A;  4GYG A;  5DS9 A;  2XUB A;  1Y0U A;  2PLY A;  3JRE A;  3HDD A;  2ZXW H;  3I4N J;  1ACI A;  2NYX A;  2JT1 A;  3SEQ A;  4RB0 A;  3ZCO A;  4QPQ A;  1FYL A;  4BL0 B;  3A4C A;  4MLO A;  1QHG A;  4ZH4 F;  1V3F A;  3FKJ A;  4WWC A;  4GYI A;  4BGD A;  4HG2 A;  3GTM J;  3JRC A;  4JBA A;  2CUF A;  4PJM A;  3BQY A;  3ZR8 X;  1MH3 A;  3RPU A;  1POG A;  3KCC A;  2XPW A;  4HQE A;  3QP6 A;  3F8B A;  4GXO A;  1WJD A;  2QBY B;  3E6C C;  3LST A;  4GRI A;  1SFU A;  1ZLK A;  4L18 B;  2Z1D A;  1R58 A;  3BZK A;  3VOD A;  1KU3 A;  2JSC A;  1GVD A;  2GZW A;  3OL4 A;  3F21 A;  1HQC A;  3H36 A;  1MBJ A;  3PFI A;  4IHX A;  3KP6 A;  3AL0 C;  4LJZ F;  1BC8 C;  2YR2 A;  2KLO A;  1E0E A;  3ERM A;  3LFU A;  5B3S H;  5C3E J;  2XAU A;  5AIQ A;  2LF7 A;  2FF4 A;  3KE2 A;  2Z33 A;  3H3U A;  4NQW B;  2CQ7 A;  3I9V 2;  2HZD A;  3OYH A;  1YQA A;  1IN8 A;  3HRS A;  3ML6 A;  1WI3 A;  2YU3 A;  3EUH A;  3IHU A;  2KDZ A;  2R7R A;  1PP8 F;  3VWB A;  4FIS A;  2HQA A;  3I0T A;  1RI7 A;  1ON2 A;  3I64 A;  1IXS B;  3TO9 A;  2XF7 A;  4N4O B;  3ZN0 A;  1DGR M;  1QU3 A;  1TW2 A;  2X51 A;  4FE4 A;  1UJ8 A;  2JRT A;  1I3A A;  4XOP A;  2W24 A;  1DP3 A;  2AXT C;  4MTE A;  3DEU A;  2HOA A;  2VQH A;  3CUQ B;  2CQX A;  3CLQ A;  1JUP A;  1EH7 A;  4I76 A;  2DMN A;  5LRR A;  5F1R A;  4HPQ A;  2P4W A;  1F4K A;  1XMK A;  3GME A;  1TLH B;  4XN0 A;  5FKK A;  2EB7 A;  1XSX A;  3WE2 A;  3GTG J;  1FOW A;  1LPQ A;  3TED A;  1VQ9 I;  2R7U A;  2CO5 A;  2VB6 A;  4JOM A;  4OIQ F;  2R7O A;  4M74 A;  3FXQ A;  2DU9 A;  5EGO A;  4LG0 B;  1BR4 A;  5D5X B;  3CCL I;  1X2N A;  2ZME C;  1W7P D;  3WU2 C;  3CCJ I;  2K4B A;  5IY5 H;  1QA6 A;  1QPI A;  2V1U A;  5HLT A;  5LGN A;  1A5J A;  5LEJ A;  3TOA A;  2A6H F;  2VQG A;  2VBY A;  3BG3 A;  3Q9S A;  4UXN A;  1MJA A;  2NS0 A;  3QOP A;  5HDK A;  4RS8 A;  2Y9Z A;  3EYI A;  3H5A A;  5JI6 A;  1CF7 B;  3C1D A;  1FX7 A;  1TWF J;  2CWE A;  1FT9 A;  1S9H A;  1WQ2 A;  2ZJP F;  4Y13 A;  4ENN A;  1GV2 A;  1XS9 A;  2KQR A;  5D4R A;  1O3T A;  4BEH A;  1T95 A;  2Y9Y A;  4RGX A;  5HS7 A;  5M3M J;  3L2W A;  2KIQ A;  3CCR I;  2ZXJ A;  4HSR A;  3HOT A;  2JVG A;  3QRF F;  1MMS A;  5DCM B;  2F4O B;  2GWR A;  3TP0 A;  1JKO C;  3CC4 I;  1TQI A;  2MD0 A;  2K9M A;  4UVA A;  1HCR A;  4KIF A;  5HVQ C;  3WTU C;  1ZG3 A;  1DUX C;  5M5Y J;  3DKY A;  1P7I A;  1WJC A;  3WU1 B;  1LE8 A;  1XC5 A;  1R1T A;  4ZYH A;  2FUG 2;  1SMY F;  1FTT A;  1SVO A;  5F0H A;  3MN2 A;  4L5E A;  3GFJ A;  3OSG A;  1YS7 A;  3ZPL A;  2EFW A;  2YUS A;  3G1L A;  3OIO A;  3QOD A;  3BZC A;  3CF5 F;  2NXN B;  1I50 J;  2JWT A;  2DTZ A;  2R0Q C;  1FSE A;  5LEK A;  1Z9C A;  1KQ9 A;  4M6X A;  2P6T A;  1FY7 A;  2Z16 A;  1G59 A;  3Q0V A;  1J5Y A;  1IRX A;  2G0E A;  2NVT J;  3ZP5 A;  2QWW A;  3BCA A;  1TNS A;  4KT5 C;  3TQN A;  3LMM A;  1KU2 A;  2EBI A;  3ZMT A;  2O03 A;  5TGT A;  4G6D A;  2DBB A;  2ZB9 A;  1Z6R A;  2IA0 A;  2MLK A;  2XPU A;  3IV5 A;  1R5G A;  4LIT A;  1REP C;  4YG2 F;  3E3V A;  2VC1 A;  2PJR A;  2HFH A;  3MEX A;  5FLX Z;  1ETY A;  2R7X A;  3EYY A;  4AVZ A;  1KQ0 A;  1X1B A;  1USS A;  1MSE C;  1DDN A;  3DQV C;  4P9U A;  2P0W A;  4E7K A;  3MZ8 A;  3HGY A;  4Y4R A;  3D0S A;  2HQ5 A;  1ZQ3 P;  2M5W A;  3ROU A;  5ICE A;  3PJR A;  3S32 A;  3GTQ J;  1JJ8 C;  4BS9 A;  3HTU A;  1YJW I;  2WAD A;  3RKW A;  2KZV A;  2CW7 A;  2RN7 A;  2CFX A;  2MA3 A;  1BW6 A;  1JHH A;  3OIQ A;  2GXG A;  3HL2 A;  2MG4 A;  1R7J A;  1R9T J;  2X4H A;  3BY6 A;  3GEZ A;  4RB1 A;  4E6K G;  4YIF A;  4XQF A;  1WZ2 A;  1QGP A;  2STT A;  3M8F A;  2LR8 A;  1K78 A;  3G1O A;  3MVP A;  5C4X J;  2VJI A;  2QZ8 A;  2CUZ A;  3J80 K;  2K3F A;  5IOZ A;  2E2I J;  4ZJZ A;  2ZXI A;  3GUD A;  3JAM K;  3LOC A;  5HOD A;  2ESN A;  1HF0 A;  2AQE A;  2JA5 J;  2IS4 A;  3G2B A;  1ZKG A;  4IOA F;  1W1W E;  2KRH A;  4RBO A;  2B0L A;  1BI0 A;  4X0G A;  3WHB A;  2M7B A;  3LAJ A;  3GTJ J;  1BA5 A;  1U9N A;  5GPC A;  4XL9 A;  2PI0 A;  4A3G J;  4BKX A;  3HC7 A;  4BE0 A;  3LSI A;  3I4M J;  4PJL A;  3ERE D;  3LSJ A;  2ZKZ A;  2IP2 A;  4KFC A;  4JX6 A;  2P6S A;  3CUQ C;  2JPB A;  5KAI C;  4KIT B;  1U6G A;  2DMT A;  4HYE A;  1YS6 A;  1YO5 C;  4RAG A;  2E1C A;  1JT0 A;  4LLL A;  3F0C A;  2QEX I;  1ENH A;  2VOD A;  2KIS A;  5LHI A;  1YLF A;  2EA4 A;  3IWZ A;  1B59 A;  5IP6 A;  1D5V A;  2ZME A;  2IA1 A;  1ZRF A;  1T38 A;  1B9M A;  3UKG A;  2L9N A;  1BI3 A;  4BDZ A;  2IS6 A;  4XLF A;  3U1D A;  3F23 A;  4B47 A;  2H6B A;  4I2O A;  1V4R A;  2IRF G;  2VIX A;  5L3C A;  1JI8 A;  1IUF A;  5DTD A;  2WAF A;  1VQM I;  2F6C A;  5K5Q A;  3J7Y J;  3S1R J;  2R7V A;  2XGC A;  2MSY A;  4BXF A;  2BVL A;  4DZP A;  5TJJ A;  2GOM A;  2EIL H;  3K7A J;  4HNT A;  1XGN A;  3CJT B;  3HOZ J;  1U5T B;  1SFX A;  3IUO A;  2Q8K A;  2HOE A;  4RDU A;  4A3D J;  4LOC A;  4J19 A;  1VQN I;  2Q2E B;  1XPX A;  4FET A;  1T08 B;  1TNT A;  2ETH A;  1X3U A;  2CUJ A;  3M07 A;  1XSV A;  1QPM A;  2G9W A;  1IO2 A;  5JHF A;  1ZR4 A;  2H8R A;  1FIP A;  2BVM A;  2DFH A;  4S04 A;  2A07 F;  1SMT A;  2DCE A;  4A0X A;  2MGQ A;  5IP9 J;  5K5R A;  4F93 B;  1AKH A;  4IZZ A;  4CIC A;  3EUK L;  1E3O C;  2JRM A;  5K5O A;  4KIS A;  2M30 A;  1FPQ A;  4RAY A;  2FSW A;  2ZFU A;  2DFF A;  3MKL A;  4II3 A;  5CVR A;  1FTZ A;  4EJT A;  5M5W J;  2V79 A;  1NG7 A;  4OWR B;  2VC0 A;  1YJN I;  2E1O A;  3J81 K;  1RIO H;  1E3P A;  1W7P A;  3TBI A;  2LY2 A;  1JUM A;  2R5Y A;  3BRO A;  2YX4 A;  4HOB A;  3GFI A;  2KP6 A;  1QZE A;  2XSJ C;  3BG7 A;  5EG0 A;  1BOA A;  3VOE A;  4XKC A;  5FD6 A;  1O7L A;  5D5W B;  3BWG A;  3SYT A;  2ISY A;  4F55 A;  3JTG A;  6PAX A;  3WE3 A;  1YIO A;  1FWZ A;  2FEZ A;  2Z9O A;  4D0P A;  2J5O A;  4CZZ A;  1LDJ A;  1PUE E;  1A6I A;  1S3J A;  4M9S A;  2AO9 A;  1GV5 A;  2A5W A;  5DM6 F;  1BL0 A;  2W7N A;  4NBQ A;  2VJ5 A;  3M1C A;  2EV0 A;  3G3Z A;  5LGT A;  2L01 A;  1O3R A;  1BR2 A;  4WK8 F;  2QSF X;  3JRB A;  1SD5 A;  5KNL A;  3TMO A;  4DOZ A;  1P4W A;  1H0M A;  2E7X A;  2ME0 A;  3C2B A;  3BG5 A;  1TT0 A;  2PMH A;  3HGG A;  1OIS A;  3LNQ A;  1IXC A;  1S7O A;  3KP4 A;  4JX5 A;  3I56 I;  1WWX A;  1XD7 A;  1H88 C;  4MO7 A;  4RA2 A;  4ZZL A;  2DT7 B;  3N97 A;  1AOY A;  2RNJ A;  4RGS A;  2HYF A;  3QPT A;  3BG6 A;  1D0Y A;  1SFO J;  2VL8 A;  3DFG A;  2JK3 A;  2VXZ A;  2LF8 A;  3FXJ A;  3CCY A;  4IKF A;  3K4L A;  4NQW A;  3K1P A;  4X1E A;  1Y6I A;  4IHS A;  4QWQ A;  4YEL A;  1SD7 A;  3EDP A;  2L3D A;  2IS1 A;  3RSN A;  1VQ8 I;  2GIV A;  4WF2 A;  3V8K A;  3L09 A;  3H9J A;  2OC6 A;  1R71 A;  4A3M J;  1MIJ A;  1K4T A;  3K70 D;  1MND A;  2KIF A;  4EQQ A;  2ZO4 A;  1K79 A;  3UR3 C;  4AIJ A;  5E17 F;  5JHU A;  4ETS A;  4A6D A;  3CUQ A;  3QQA A;  4HAM A;  4LG3 A;  5HNF A;  3DXJ F;  4XLP F;  2LSO A;  3CLO A;  4ESJ A;  3VSK A;  4S0H B;  5J1U A;  4I09 A;  4D5F A;  3KFW X;  3PM1 A;  3RTR A;  3BR3 A;  1WH7 A;  2PJR B;  3VB2 A;  2HZT A;  5FLV A;  3K4J A;  2M34 A;  2X0L A;  3O6B B;  1OPC A;  3K4C A;  1H89 C;  1V5G A;  1XMA A;  3C7J A;  5KVR A;  5AON A;  1X19 A;  4A93 J;  3T1B A;  4B09 A;  1G2H A;  2HVS A;  2UXX A;  2OTJ I;  4RAF A;  2W25 A;  2FA5 A;  2IAI A;  1BR1 A;  3VSL A;  2OBP A;  4B1R A;  3TDZ C;  2ICW G;  3B6C A;  1B1B A;  5E20 A;  3J7A O;  4DIQ A;  2L7F P;  1MBK A;  2OUM A;  4HDV A;  2M3A A;  3A0H C;  4RM3 A;  5FGM A;  1CF7 A;  1SFE A;  2WA0 A;  3R60 A;  5E3L A;  1DPR A;  5F04 A;  4G7H F;  3RCO A;  1OCT C;  4DNC A;  5CVV A;  4AYB A;  3VYT B;  3DU6 A;  5J1R A;  1U5T C;  5DCM A;  2IT0 A;  4A3B J;  5HS9 A;  4U87 A;  4G94 A;  3S2H J;  3AG1 H;  2DA3 A;  2K7L A;  3EUA A;  1JXS A;  5IT9 Z;  4G8X A;  1P9Q C;  1Q1H A;  2TRT A;  3SDB A;  3OS2 A;  1OYI A;  3WG9 A;  4KDP A;  3H1C A;  5D4S A;  2KIM A;  3H9G A;  4UVB A;  2L4M A;  2K40 A;  4PSX A;  4FCY A;  2QQ8 A;  4E7Z A;  1R5I D;  4M6Y A;  1U8R A;  1J0R A;  2XRL A;  1Y56 A;  5HLH A;  5HLI A;  3PFY A;  2BE5 F;  5EZG A;  4LB5 A;  1WSU A;  2IGK A;  3BJA A;  3E97 A;  1FBS A;  1I5Z A;  1NH3 A;  2GLO A;  4CYC B;  1TP4 A;  2CW8 A;  2M9H A;  4CCJ A;  4DBQ A;  2H94 A;  1W36 D;  1FOX A;  3HZJ A;  1WJB A;  5FFX A;  4WX9 A;  3ASN H;  2CUE A;  3H9Q A;  1WKM A;  4B3A A;  1D8J A;  5J6X A;  2IW5 A;  2ZME B;  4G6Q A;  2ADU A;  2EWN A;  2JUG A;  3GO5 A;  1AU7 A;  4D7N A;  2IEK A;  4IRH A;  3DP7 A;  1D1A A;  2HS5 A;  1Y39 A;  1ERD A;  3K10 A;  3DLA A;  4RGR A;  2R4G A;  4ZZD A;  3E1S A;  3GFL A;  3GTL J;  4U0V A;  2OF7 A;  3HRT A;  4ABZ A;  1YJ9 I;  2LLK A;  3GFM A;  2RKH A;  3BJ6 A;  1T39 A;  1K61 A;  3WTW C;  2ZC2 A;  1EF4 A;  4XLE A;  1ETW A;  2RV8 A;  3FXR A;  4JYK A;  3BCB A;  3CUO A;  2JSP A;  2DPU A;  3FXK A;  4NC7 A;  3S14 J;  1X1D A;  4F91 B;  5CLS A;  1GVJ A;  1S7A A;  3ZQH A;  5J4Y A;  2EZK A;  5FFZ A;  1G3S A;  2WV0 A;  3FK6 A;  2DJN A;  1VQK I;  2A3S A;  3F8M A;  4ZDO A;  5GTI C;  1TL8 A;  3TP3 A;  2R7T A;  2D1V A;  5FRO A;  4P96 A;  5D5U B;  1UEL B;  2E5N A;  2K5C A;  3F72 A;  3EQL F;  5DCF A;  5DD8 A;  1B6A A;  3NAU A;  5J3L A;  1P4A A;  2NRA C;  4KMU X;  1Y8Q B;  1OLT A;  1MH4 A;  2XAJ A;  5ERI A;  2DMP A;  2EV5 A;  2QQA A;  1CQT A;  1V5F A;  2MC4 A;  4DYR A;  4RB3 C;  3HYI A;  1O3Q A;  2XB5 A;  4PDK A;  2R5Y B;  5E18 F;  5BOX A;  4RM2 A;  5FLM J;  2RC4 A;  2IGO A;  4D9J A;  4BJ5 C;  2R92 J;  4M6V A;  4MFD A;  2P5V A;  4H0E A;  1NK3 P;  3QP5 A;  3TW6 A;  2EA2 A;  3IH2 A;  1MMD A;  1L0O C;  1KU7 A;  3P9K A;  1B72 B;  3JRF A;  1ZTR A;  4A3J J;  2PMZ A;  3NWS A;  1IUY A;  4CGZ A;  1S7E A;  5IOY A;  1EJ9 A;  4HRI A;  1OYY A;  1UCR A;  3NEU A;  4HST A;  4UVC A;  3H92 A;  1Y0N A;  2BEO A;  4F3Q A;  1IAW A;  4O5V A;  3BPX A;  3SFZ A;  2LC2 A;  4NC8 A;  1TZL A;  4ITV A;  4BE2 A;  5DEQ A;  2Q0O A;  4CCK A;  1A35 A;  4L9N A;  5B66 C;  3B02 A;  2WTE A;  1MNM C;  3O2P E;  2QKL B;  3HKZ N;  2E1N A;  2KZG A;  2MYS A;  1ORK A;  3ZMV A;  1YTY A;  5FO5 A;  2WC2 A;  3OY9 A;  3GTK J;  2DA2 A;  2NS7 A;  1QBJ A;  1XSD A;  3CJR B;  3E5X A;  2LH9 A;  3KEY A;  5ILS A;  5K1Y A;  2XC7 A;  2OU2 A;  1P92 A;  3ZXS A;  2R7Q A;  4OAY A;  2KIU A;  2UXN A;  3PSF A;  1YG2 A;  1Q1V A;  3KET A;  1KU9 A;  3NRV A;  1QHH D;  3FDY A;  3FKI J;  4YII A;  4RLF A;  1U5T A;  3I71 A;  5F0F A;  2W82 A;  4I7H A;  3S16 J;  3F8C A;  5EDN A;  3S2D J;  1KYZ A;  2Z3Y A;  2EIJ H;  3K69 A;  1YX5 A;  5B1A H;  2VJJ A;  3KLN A;  1R4M B;  2Q2E A;  4BBR J;  3CCU I;  2Q1Z B;  3R6S A;  5ILV A;  4M9Z A;  5EEA A;  1GT0 C;  4XOR A;  5EJC A;  2TCT A;  1X1A A;  1V54 H;  3N05 A;  3OYD A;  3OS0 A;  2QQB A;  2FBK A;  3HG9 A;  4EJV A;  3QOE A;  3SDG A;  4Y52 J;  3PIP F;  2LKS A;  3Q0W A;  2GQQ A;  5F0C A;  4L9V A;  2FX0 A;  2PMZ N;  1VFC A;  2EJR A;  4C3J J;  3BZ6 A;  4U88 A;  2IXS A;  2XF5 A;  2UZK A;  4HDU A;  2HPM A;  3FWE A;  4XSX F;  4J00 A;  2IA2 A;  4XOT A;  5HLG A;  4LB6 B;  3IKV A;  4WXD A;  3HJE A;  4N9H A;  4NNJ A;  2F5C A;  3KIO A;  4W1U A;  4RGU A;  4I02 A;  2F2E A;  1OCR H;  4RB2 C;  1ETV A;  4PJJ A;  2L7M P;  2VE9 A;  2X1D A;  5DUK A;  3HIF A;  5FLX K;  4YFK F;  2XRO A;  3ZN1 A;  5JR3 A;  5A2Q Z;  2I5U A;  1B4A A;  1DP7 P;  2HTJ A;  3DBL B;  2X85 A;  3GZ5 A;  5IT3 A;  4EVI A;  4LIU A;  2AXL A;  1TQP A;  1WJA A;  4IPA A;  1H9T A;  2WB1 N;  4A6E A;  3PO2 J;  2XAS A;  2LNB A;  3HB9 A;  2AHQ A;  4MQV A;  1S8N A;  2HNH A;  1SFK A;  3JSO A;  3A02 A;  1I27 A;  1TWG J;  4R1H A;  5LLQ A;  2V9P A;  4BQN A;  3JRD A;  4Q48 A;  1JHF A;  3V8J A;  2HKO A;  5IYD J;  2OCE A;  1P7J A;  4JP0 A;  1UFM A;  4C30 A;  3S3O A;  2BW3 B;  3RQ4 A;  5GAE J;  2JA8 J;  4ESB A;  1MBE A;  4D1Q A;  1VQO I;  1UHW A;  2Z2S B;  3MQ0 A;  5GPA A;  3RQI A;  2O6G E;  2RVC A;  1LKX A;  2STW A;  3U2R A;  2UV1 A;  1YW7 A;  1E3H A;  2Y48 A;  1J59 A;  1FBU A;  5FKM A;  1JUS A;  1F1Z A;  2ID3 A;  2RDP A;  1VTN C;  2O61 A;  3BR0 A;  1HDD C;  3PNV A;  3LFK A;  3GX4 X;  3E6B A;  2MC3 A;  2X9D A;  3FIS A;  3FF5 A;  2YX7 A;  3VEP A;  4XBF A;  4PFO A;  3BC8 A;  4N4N B;  2BZT A;  3Q0U A;  5CJ9 A;  4YEJ A;  5H6Q A;  2QLZ A;  1XX5 A;  3LSR A;  4G7Z F;  2EIK H;  3L2U A;  2VE8 A;  1LDK B;  4B48 A;  3ONQ A;  1ZYR F;  2KHM A;  4DYC A;  1RR8 C;  2DAO A;  5JLX A;  1RNL A;  5FKL A;  3OYA A;  1SD4 A;  1VQ7 I;  1VQP I;  2VAS A;  3BPV A;  4DBR A;  1HST A;  3U1K A;  1QRY A;  5L3B A;  3U21 A;  1MMA A;  3D5L A;  2ME6 A;  1LFP A;  5FRN A;  3DTK A;  5D5V B;  4PGG A;  3W3C A;  2LY1 A;  2ZNZ A;  4IQJ A;  2H27 A;  2YS9 A;  1J2X A;  4HX8 A;  3FMR A;  2WAQ N;  3TO7 A;  1U9O A;  3CMM A;  3QU6 A;  3S3N A;  2M4K A;  1FNN A;  1V55 H;  2JA6 J;  2K4J A;  4A3L J;  5DM7 F;  3DPL C;  4FTH A;  3ZGK A;  1I1S A;  5ICG A;  5F27 A;  2QYO A;  4UUT A;  3KYC B;  2V6E A;  2V1N A;  5E3N A;  2A5Y B;  2MLG A;  3GTO J;  2V6C A;  3JR9 A;  2DK5 A;  2VKD A;  2VXD A;  2I10 A;  3E6M A;  3HOU J;  1EA3 A;  2E71 A;  4HNU A;  4CXF A;  2RRE A;  2A69 F;  2K27 A;  1ZAR A;  4AUX A;  1QVT A;  3ISP A;  1JKR C;  2X1E A;  4GCV A;  2EIN H;  3P9C A;  2ID6 A;  3GZ6 A;  2WBM A;  3HM5 A;  3GWZ A;  3L2Q A;  2BY3 A;  3W2W A;  2DO7 A;  2CV0 A;  3BTI A;  1OR7 C;  3GYH X;  3FHN A;  4ZTF A;  3FM3 A;  1KA8 A;  3H35 A;  1T6S A;  2MD5 A;  3H3Z A;  3LA3 A;  4Q4Z F;  2EK5 A;  2CGP A;  4ENK A;  3RIR A;  4Q47 A;  2L4A A;  4E7H A;  1IRF A;  4EJU A;  2GA2 A;  1Z77 A;  2KJC A;  2VOP A;  2V1X A;  1YYV A;  3OV8 A;  2LKP A;  2O8K A;  5BNG A;  2WY7 Q;  2W4S A;  3LQR A;  3WGH A;  2ECB A;  2K9N A;  4L5J A;  3ZMZ A;  3K2Z A;  4CYD A;  4J01 A;  3TGN A;  1A6Q A;  4BXU A;  4CYC A;  4LIV A;  3IRR A;  4M3D A;  1XTA A;  3HSE A;  1G3T A;  1HC8 A;  1FC3 A;  4Z2Y A;  3RJP A;  3CTA A;  4LK0 F;  5H6R A;  1MDM B;  3OMY A;  2LBF A;  3E5U A;  2V4J C;  3F9K A;  4A5M A;  4F92 B;  3LA2 A;  2ZNY A;  3LA7 A;  2MH2 A;  3LSH A;  2W85 A;  1X58 A;  2F5D A;  1I39 A;  4WCG A; 
#chains in the Genus database with same CATH homology
 1TWH J;  1TWC J;  1IV6 A;  1IC8 A;  1PUF A;  1O4X A;  3QQA A;  3K2A A;  4XID A;  1AKH B;  2XGE A;  3BTL A;  4NDL A;  4S0H B;  5J1U A;  5FJ8 J;  4D5F A;  2R5Z B;  1U78 A;  3PM1 A;  3BR3 A;  1IDY A;  1K83 J;  1WH7 A;  1LFB A;  1BW5 A;  2HOT A;  3LSP A;  1JGG A;  2FQ4 A;  2CQQ A;  5FLV A;  4DZJ A;  4QIW N;  1F43 A;  2M34 A;  4A3F J;  4M3F A;  1UMQ A;  1ZR2 A;  1H89 C;  2NVX J;  2Y31 A;  4A93 J;  3RZO J;  4UUS A;  2B63 J;  1T56 A;  3IH4 A;  1G2H A;  2ECC A;  4HNV A;  3NAR A;  5IYC J;  5EG0 B;  2IAI A;  1MBG A;  3B6A A;  4B1R A;  1RPW A;  9ANT A;  3B6C A;  1YRN A;  2Y2Z A;  3RKQ A;  2L7F P;  1MBK A;  4XRS A;  3ZQF A;  5DS9 A;  5GP9 A;  2EQR A;  3JRE A;  3BTJ A;  3HDD A;  3I4N J;  3S15 J;  5E3L A;  3JRA A;  5F04 A;  1Y1W J;  4MLO A;  1ETQ A;  1DU0 A;  4IEJ A;  1OCT C;  1JKP C;  1OCP A;  3ZQC A;  3GTM J;  3JRC A;  2CUF A;  5J1R A;  3BQY A;  3HOY J;  4A3B J;  1MH3 A;  2R7Z J;  1POG A;  2XPW A;  1NK2 P;  1HOM A;  2RAE A;  3S2H J;  2DA3 A;  1DU6 A;  1FJL A;  1UHS A;  2H1K A;  2TRT A;  2P81 A;  1W0T A;  1ETO A;  1VND A;  1GVD A;  3BR5 A;  2E2H J;  4QSH A;  2K40 A;  3HEF A;  4FCY A;  3ZOB A;  1MBJ A;  1B72 A;  4IHX A;  2JJ7 A;  2E19 A;  2XRL A;  5C3E J;  5EZG A;  2LP0 A;  2XSD C;  1MSF C;  2GLO A;  1I3Q J;  4A69 C;  4A3K J;  4CYC B;  2LVS A;  2M9H A;  2JN6 A;  1B8I B;  1XG1 A;  3SJM A;  1WI3 A;  2FD5 A;  2KDZ A;  3OSF A;  4FIS A;  3S17 J;  5IP7 J;  2NS8 A;  2CUE A;  4B3A A;  3IH3 A;  4FE4 A;  4D7N A;  1AU7 A;  3W6V A;  2IEK A;  4MIM A;  4X6A J;  2NOG A;  1VF9 A;  2CRG A;  3H0G J;  4QTR A;  2HOA A;  1OJL A;  3O8G A;  2EH3 A;  2FJ1 A;  4C2M J;  2CQX A;  1Y1V J;  1JUP A;  3GTL J;  4M3E A;  4I76 A;  2OF7 A;  3BT9 A;  2DMN A;  1RR7 A;  1HDP A;  4ABZ A;  2LLK A;  2M2E A;  4Y7N J;  2LFB A;  1LFU P;  2DA6 A;  5FKK A;  1K61 A;  3GTG J;  1EF4 A;  2VPR A;  2XB0 X;  3SFI A;  1ETW A;  3L1P A;  3HOV J;  3TED A;  4JYK A;  3S1M J;  2ELK A;  4UUS B;  2DMU A;  5EGO A;  2JA7 J;  1BJZ A;  1X2N A;  3HOX J;  5K7Z A;  1RET A;  2DA4 A;  3E7L A;  3S14 J;  1QPI A;  1VI0 A;  1IJW C;  1A5J A;  1OFC X;  1YRN B;  3ZQH A;  4XIC A;  2EZK A;  3BG3 A;  3FK6 A;  1U8B A;  1APL C;  2DJN A;  2Y9Z A;  2M8G X;  3TP3 A;  1TWF J;  4B4C A;  3Q3S A;  1XS9 A;  1GV2 A;  2CU7 A;  1JTX A;  2Y9Y A;  2QCO A;  3NAU A;  2QF7 A;  5J3L A;  2NVY J;  5M3M J;  2N8G A;  1MH4 A;  3TP0 A;  4M3G A;  2DMP A;  1JKO C;  1CQT A;  4DYR A;  1HCR A;  4M3B A;  2XB5 A;  4XK4 A;  2R5Y B;  5FLM J;  5M5Y J;  2HXI A;  2R92 J;  1P7I A;  4D5C A;  4M6V A;  2L9R A;  4MFD A;  1LE8 A;  1NK3 P;  1XC5 A;  3TW6 A;  3IH2 A;  1FTT A;  1RES A;  1WPK A;  1B72 B;  5F0H A;  3MN2 A;  3JRF A;  1ZTR A;  4A3J J;  4L5E A;  1NTC A;  1FEX A;  1S7E A;  5IOY A;  3A01 A;  3OSG A;  3M4O J;  2Y0S N;  2YUS A;  3G1L A;  1ZGW A;  3OIO A;  2DMQ A;  3BQZ A;  5F08 A;  3S1Q J;  1I50 J;  2JWT A;  2DTZ A;  2R0Q C;  2EZI A;  1TWA J;  2W48 A;  3Q0V A;  3WHC A;  1MNM C;  3CQZ J;  2G0E A;  2NVT J;  3HKZ N;  2E2J J;  5J1Y A;  2COB A;  3M3Y J;  1ORK A;  4FE7 A;  2EBI A;  3GTK J;  2DA2 A;  2NS7 A;  2IBD A;  2ZB9 A;  4GFB A;  1TC3 C;  2XPU A;  3ZQL A;  3IV5 A;  2K9Q A;  2EZH A;  3CMY A;  2R5Z A;  3FK7 A;  1ETY A;  2DA7 A;  1Q1V A;  3DCF A;  3JRI A;  3FKI J;  3HOW J;  3TW7 A;  2EZL A;  1MSE C;  5F0F A;  1WCM J;  3S16 J;  2LY9 A;  5EDN A;  3S2D J;  3HGY A;  1ZQ3 P;  2HQ5 A;  1Z0X A;  5EGO B;  1IGN A;  1GUU A;  2VUM J;  5F1J A;  4BBR J;  4BXX J;  3GTQ J;  2XGD A;  5EEA A;  1GT0 C;  1JJ8 C;  2TCT A;  5K7F A;  1MBF A;  1BW6 A;  2MG4 A;  1PUF B;  4MFE A;  2VKE A;  3BTC A;  2OPT A;  4AC0 A;  1R9T J;  3SDG A;  4W97 A;  4Y52 J;  1WH5 A;  5JLW A;  3Q0W A;  5F0C A;  3CDL A;  4A3C J;  2FX0 A;  2PMZ N;  1VFC A;  1AHD P;  2LR8 A;  3G1O A;  3MVP A;  4C3J J;  5C4X J;  3BR6 A;  4V2F A;  5IOZ A;  2E2I J;  3LOC A;  2L7Z A;  4W1U A;  5HOD A;  1HF0 A;  2O9L A;  4C3H J;  2HOS A;  2JA5 J;  1ETV A;  2L7M P;  1ZKG A;  4RBO A;  1BA5 A;  2CJJ A;  3WHB A;  3GTJ J;  2HXO A;  1LE8 B;  1U9N A;  5GPC A;  1JKQ C;  4A3G J;  4BKX A;  2HDD A;  5EF6 A;  3I4M J;  3LSJ A;  5E3O A;  2YU9 J;  4JX6 A;  3DEW A;  1MBH A;  2DMT A;  1QVU A;  2KT0 A;  1B8I A;  1JT0 A;  1HLV A;  3F0C A;  3PO2 J;  2WB1 N;  1JT6 A;  4C3I J;  5IPA A;  3HB9 A;  1ENH A;  2AHQ A;  1IG7 A;  5IP6 A;  3A02 A;  1TWG J;  3H3V K;  5C4J J;  3JRD A;  4IHY A;  3UKG A;  5M5X J;  4I6Z A;  5IYD J;  4EEF G;  1P7J A;  4JX4 A;  4JP0 A;  1SAN A;  2JA8 J;  1MBE A;  5M3F J;  1IUF A;  2LD5 A;  5DTD A;  3RQI A;  5GPA A;  2LTP A;  2DN0 A;  1JJ6 C;  3QPS A;  3S1R J;  2XGC A;  2MSY A;  1D5Y A;  4DZP A;  5FKM A;  3K7A J;  1JUS A;  2ID3 A;  1GDT A;  3HOZ J;  3BR0 A;  1HDD C;  1X58 A;  2XPV A;  2X9D A;  3FIS A;  4A3D J;  2GM4 A;  4BY7 J;  4RDU A;  4BBS J;  4LOC A;  1T33 A;  4J19 A;  3ZQG A;  2NVQ J;  1I6H J;  4V2G A;  2R93 J;  3Q0U A;  3ZQI A;  2HYJ A;  5EYR A;  3LSR A;  2WV1 A;  1ZR4 A;  2H8R A;  1FIP A;  4DYC A;  2VI6 A;  5JLX A;  5FKL A;  5IYB J;  2MGQ A;  3BR2 A;  5IP9 J;  4IHW A;  1AKH A;  1ZK8 A;  4D7M A;  5C44 J;  4DYQ A;  1IRZ A;  1E3O C;  1QRY A;  1W0U A;  2ME6 A;  3PO3 J;  3MKL A;  2YS9 A;  1FTZ A;  2JMW A;  3JRG A;  2WAQ N;  5M5W J;  2DA1 A;  4A3I J;  1U9O A;  1UG2 A;  3OOU A;  2O7O A;  4XRS G;  1X2M A;  2L0K A;  3GTP J;  2E1O A;  1H8A C;  1JUM A;  2R5Y A;  1ETK A;  4G12 A;  5E3M A;  2JA6 J;  3VPR A;  5EG0 A;  2LKX A;  4BY1 J;  4A3L J;  4FTH A;  5F27 A;  4UUT A;  4XRM A;  1IDZ A;  2HI3 A;  5E3N A;  1JTY A;  3GTO J;  3JR9 A;  2I10 A;  3HOU J;  3D1N I;  5EZH A;  3BR1 A;  1A6I A;  4AUX A;  3LSG A;  1QVT A;  2MW8 A;  1JKR C;  2AO9 A;  1GV5 A;  5FKN A;  1BL0 A;  1RKW A;  2ID6 A;  3HM5 A;  2D5V A;  2GBY A;  1FIA A;  3HBL A;  2Y30 A;  3BG9 A;  3JRB A;  3BTI A;  2LK2 A;  3GBG A;  2ME0 A;  3C2B A;  3BG5 A;  3LNQ A;  3HGG A;  3O8H A;  1Z77 A;  4JX5 A;  4A3E J;  4DW6 A;  3S1N J;  1H88 C;  4IHV A;  4MO7 A;  5FKO A;  2O8K A;  5BNG A;  3A03 A;  3A01 B;  1SFO J;  2ECB A;  1RKT A;  2JK3 A;  2K9N A;  2M0C A;  3CCY A;  1ETX A;  4X1E A;  4CYC A;  4M3D A;  4AYB N;  2VKV A;  2X6O A;  3QPL A;  3JRH A;  2K9S A;  4A3M J;  1WGX A;  2X48 A;  2DA5 A;  3RZD J;  3FIW A;  5K7H A;  1F36 A;  1ITY A;  3G1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...