3GTJJ

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtjJ00
3BG9A 1JJ8C 3IH3A 1FTTA 2E2JJ 2P81A 1HDDC 1ETOA 3PO3J 2HI3A 1RR7A 1TWAJ 2DA3A 4DW6A 2HOSA 3HOXJ 3H3VK 1I50J 5FKLA 3IH2A 2FX0A 2AO9A 2R5YA 2OPTA 1WI3A 2VUMJ 4B4CA 4MIMA 1UMQA 3RZDJ 1PUFA 3Q0VA 1QVUA 2OF7A 2NOGA 3O8HA 2EZKA 4FTHA 3OSGA 3TP3A 2DA4A 2K9QA 4DYCA 3Q3SA 2DA1A 1SANA 2ME6A 3ZQFA 2X9DA 1T56A 1UG2A 1WGXA 1WPKA 3RKQA 2JA8J 5DS9A 1LFUP 1IDZA 2XB5A 1A5JA 2R93J 1BJZA 2YUSA 1JTXA 2X6OA 4C3JJ 2WB1N 1MH3A 2M0CA 4D5CA 3FIWA 1OCPA 1IC8A 4C3IJ 1ZQ3P 4M3BA 5IP6A 5FKKA 2R5ZA 1OCTC 2CQQA 2L7FP 1GT0C 4L5EA 4DYQA 2B63J 5C3EJ 2LFBA 3MVPA 5K7ZA 3S2DJ 4M6VA 1U9OA 3HM5A 2O8KA 3HOVJ 2LKXA 4FISA 3CQZJ 4W97A 2E19A 3MKLA 4MFDA 3PM1A 4FE4A 1BW5A 2XGCA 3HB9A 3HDDA 3K7AJ 1NK2P 1GV5A 2WAQN 1P7IA 5F0HA 4IHYA 2JA5J 2EH3A 3BT9A 1MBJA 4Y52J 5C4XJ 2GLOA 5J3LA 3I4MJ 4A3KJ 2EBIA 5FLVA 4M3FA 2XB0X 3GTPJ 1H8AC 2ECBA 5EEAA 1JKOC 1ETWA 4I6ZA 3GTLJ 3LNQA 2VKEA 1GDTA 1MBHA 4JP0A 4IHWA 5J1YA 2ELKA 2NVXJ 1Y1WJ 1IDYA 5FLMJ 3TEDA 2XRLA 5IYCJ 2ID3A 3TW7A 2CU7A 5IOYA 1U8BA 3CMYA 1JKRC 1RPWA 1TWFJ 4UUSA 1RKWA 1AU7A 4EEFG 1PUFB 1T33A 3TP0A 2Y30A 3HOUJ 4HNVA 3HEFA 1FEXA 1DU0A 1FTZA 1VNDA 1F43A 1QRYA 1AHDP 3O8GA 1YRNA 2W48A 4NDLA 4JX4A 1LE8A 1WH5A 3JRCA 1EF4A 4M3DA 4UUTA 3LSJA 2CUEA 1UHSA 3BR1A 4W1UA 3GBGA 1I3QJ 5IPAA 4A3MJ 1D5YA 3GTOJ 3L1PA 2JA6J 2KDZA 1P7JA 1X2NA 2CRGA 2ECCA 5E3NA 4IHXA 2HOTA 9ANTA 3S15J 3TW6A 3ZQIA 5E3LA 1VFCA 1K83J 2IAIA 4BKXA 5EZGA 4A3IJ 4FCYA 5F0CA 2NVQJ 2JMWA 4S0HB 4XRSA 2E2IJ 4RBOA 2JN6A 1GVDA 2JK3A 3I4NJ 5K7HA 3OSFA 3E7LA 3H0GJ 1ETXA 5IOZA 5GPCA 2MSYA 1ZGWA 1NK3P 2NVYJ 2I10A 4AC0A 5FKNA 2JJ7A 2MW8A 5E3OA 4D7NA 2HDDA 4XIDA 2M9HA 2G0EA 1X58A 4DZJA 3DEWA 1BA5A 4ABZA 2JWTA 3ZQCA 1WCMJ 5IYBJ 3HOZJ 1X2MA 4RDUA 1ETQA 2COBA 4X6AJ 1JUPA 2JA7J 1B72B 2K40A 3RQIA 3BR2A 3JREA 2H1KA 1R9TJ 4BBSJ 2FQ4A 2Y0SN 4A3DJ 4A3BJ 3Q0WA 3BTCA 1HOMA 3ZQLA 1A6IA 3W6VA 1QPIA 1GUUA 5EZHA 2VKVA 3SJMA 2ZB9A 1F36A 2DMUA 4M3GA 3JRHA 4V2FA 4A3CJ 1RETA 3FK7A 1VI0A 3SDGA 2R7ZJ 5IYDJ 3ZQGA 5M5XJ 5E3MA 5DTDA 4QSHA 2HXIA 2WV1A 4A3JJ 4BXXJ 2R92J 2EZLA 4Y7NJ 4MFEA 3Q0UA 5EGOA 2Y31A 3A01B 3BTJA 4B3AA 3LSPA 1TWGJ 2LY9A 3JRGA 4JX5A 2D5VA 1H88C 3GTQJ 4CYCB 2M34A 2QF7A 5FKOA 2PMZN 1ETYA 3JRIA 1E3OC 5EF6A 2DA7A 1ZKGA 3FKIJ 3HOYJ 3S14J 1ETKA 5EG0A 2EQRA 4GFBA 3PO2J 3S1MJ 2IBDA 1IV6A 1BL0A 2L7MP 2DMNA 3FISA 4A3FJ 2DMQA 4M3EA 2H8RA 2MG4A 1Z77A 2NS8A 1K61A 2HXOA 1JKPC 2DA2A 2L0KA 3ZQHA 4D7MA 2MGQA 2IEKA 2Y9YA 1RESA 2L9RA 2ID6A 5J1RA 2DN0A 2LTPA 1G2HA 1H89C 3C2BA 5FJ8J 1FIPA 4IEJA 5M5YJ 4QTRA 2DTZA 2VPRA 4XRMA 1MSFC 2DA5A 1ENHA 3G1MA 1Q1VA 1BW6A 2XPWA 4MLOA 2XGEA 3A03A 1MBEA 4JYKA 5HODA 1IG7A 3B6CA 5M3MJ 1SFOJ 5M3FJ 2HOAA 3JRDA 5IP7J 4UUSB 3BG5A 3F0CA 2GM4A 1YRNB 2TRTA 5EYRA 2DMTA 1TWHJ 2R5YB 2K9NA 3JRFA 2XSDC 3BR6A 2DA6A 3WHBA 1I6HJ 4FE7A 1ZR2A 1MSEC 2RAEA 3QPSA 2CQXA 2Y2ZA 1IUFA 3HBLA 3S17J 3MN2A 2LD5A 5BNGA 4D5FA 1JGGA 2ME0A 5F08A 2TCTA 3NAUA 1Z0XA 3UKGA 1HLVA 1FIAA 3G1OA 1MBKA 3GTGJ 3S16J 1JTYA 1IGNA 1ZK8A 1W0UA 1HDPA 2GBYA 4BY1J 1APLC 4A93J 3RZOJ 4V2GA 4A3EJ 4A69C 2EZIA 1S7EA 2LLKA 3BG3A 1MBGA 2KT0A 3CCYA 2YS9A 3FK6A 3D1NI 5EG0B 5IP9J 4B1RA 1TWCJ 2LP0A 3G1LA 3LSGA 1OJLA 3GTJJ 2CUFA 1JJ6C 1AKHB 2E2HJ 3HKZN 1HF0A 1POGA 1XG1A 4CYCA 4AUXA 3HGGA 2DJNA 4IHVA 5FKMA 4A3GJ 2CJJA 1FJLA 3S2HJ 1Y1VJ 2M2EA 5EGOB 3S1QJ 4QIWN 2N8GA 4A3LJ 5K7FA 2O9LA 2XPVA 1OFCX 3BTLA 1W0TA 4J19A 3HOWJ 3M4OJ 3BR0A 3BTIA 4XK4A 1MNMC 1HCRA 3BR5A 1RKTA 1LE8B 3BR3A 1JT6A 1MH4A 1LFBA 4C2MJ 4JX6A 3A02A 3JR9A 2X48A 5F0FA 5EDNA 3K2AA 1XS9A 1U9NA 2XPUA 5JLWA 3B6AA 1JT0A 5F04A 1VF9A 4BBRJ 2O7OA 4AYBN 2E1OA 5GPAA 3OOUA 4DZPA 1IRZA 1QVTA 1ZR4A 1ORKA 2EZHA 4XICA 1JUMA 1GV2A 3VPRA 3QQAA 5F27A 3IH4A 1B72A 1B8IB 5F1JA 5GP9A 1O4XA 2HYJA 2LK2A 2DMPA 3S1RJ 2Y9ZA 4C3HJ 4LOCA 1NTCA 1WH7A 3CDLA 1ETVA 1CQTA 1ZTRA 4I76A 3SFIA 3ZOBA 1JUSA 4BY7J 3JRAA 2LR8A 3HGYA 1XC5A 1JKQC 3LOCA 3DCFA 2FJ1A 1AKHA 3OIOA 2M8GX 2QCOA 3JRBA 4XRSG 2FD5A 5JLXA 2NVTJ 1MBFA 3WHCA 5C44J 5M5WJ 2NS7A 3GTKJ 2VI6A 4MO7A 1TC3C 2K9SA 3IV5A 2R5ZB 2HQ5A 2LVSA 4G12A 3LSRA 4X1EA 4DYRA 2AHQA 2XGDA 3BQZA 1B8IA 3S1NJ 1IJWC 3BQYA 3M3YJ 2R0QC 5C4JJ 2YU9J 3A01A 1DU6A 1U78A 3GTMJ 1ITYA 2L7ZA 3QPLA 5J1UA 3NARA
chains in the Genus database with same CATH superfamily
3BG9A 3PSFA 1W4MA 1FTTA 2P81A 3L2VA 4DBRA 1ETOA 4PJMA 1DUXC 2CW0F 4LIUA 2WY8Q 2HI3A 4BAYA 1YI2I 1TWAJ 3FXQA 1A04A 3GO5A 1I50J 2R5YA 4HNUA 2OPTA 5CLSA 3LA7A 4XRFA 5DD8A 3NWTA 3R60A 5B5EC 1G59A 3O8HA 4RB3C 2FOKA 3TP3A 1YX5A 3A0HC 1JHFA 2CWEA 2K9QA 2DQRA 3Q3SA 1W36D 2ME6A 2PFBA 4S05A 3BJ6A 3CLQA 3EUKL 3KP4A 3CO7C 2P7VB 2KFDA 2JA8J 1VQKI 1D3YA 1LFUP 1IDZA 2XB5A 3H5NA 4CCNA 1BJZA 2X6OA 3KZZA 1R1UA 3J7ZI 3KX2A 1MH3A 1T39A 1IC8A 1OCPA 3I0TA 3TBIA 1OCTC 1TW3A 5FKKA 5J4VA 2L7FP 4OU0A 1JXSA 2B63J 5K1YA 2X1EA 1OCOH 4RAZA 1U9OA 2DFEA 3L2UA 1VQ6I 1X4OA 2LY2A 3CQZJ 2ZMEB 3CUQC 4CZZA 4W97A 1O7FA 3MZYA 3PM1A 4J01A 1OMIA 1V4RA 4GXOA 2XGCA 4ZTFA 3PQJA 3MWMA 3NWSA 1O3SA 1NK2P 1GV5A 1U6GA 5HS7A 1WZ2A 5E18F 2CW8A 4IOAF 4WK8F 4IHYA 2JA2A 3GEZA 4II3A 1TNTA 3RJPA 5ILVA 5J40A 2IA1A 2W25A 5J3LA 2E34A 1ZELA 5FLVA 1E0EA 2A6EF 2XB0X 3G6EI 1H8AC 3E6DA 2Z2SB 3D0SA 4A0XA 4I6ZA 3LNQA 3GTLJ 2WV0A 2YPRA 3LL7A 1X1DA 3CDIA 4UV9A 5GAEJ 5D5UB 2VXDA 1VQMI 1SAUA 5J1YA 1BIAA 1Y1WJ 2NVXJ 5FLMJ 1KZHA 2V6CA 3C1DA 3HJEA 1KU3A 2CS3A 2ID3A 2M87A 2V79A 3H5AA 2Y0SA 4CYDA 5IOYA 3GLLA 4AYBA 1T38A 4EEFG 1D1AA 1JHHA 2BEOA 3DPLC 4F52A 4KA4A 1WJ5A 3WTUC 1SD4A 3HEFA 1AHDP 3O8GA 3C2HA 2W48A 4NDLA 3SXYA 4N9HA 2ZC2A 5D6FA 2EFOA 3H9QA 3JRCA 1CF7A 2ZSHB 1S8NA 1VQ5I 4ESFA 3GBGA 3GTOJ 5BQTA 2FEZA 3L1PA 1KU2A 2JA6J 1P9QC 4M73A 5CVVA 1D0YA 5A2QK 4UXNA 4AVZA 3S15J 2PQ8A 3JSOA 2R7VA 1F1ZA 3QU3A 3TDUC 3FKJA 2M4KA 2AQEA 3AG2H 3OIQA 4GO1A 5E3LA 3J80K 1VFCA 1K83J 5BPDA 3FXMA 2PMUA 3I58A 3M8JA 2P5VA 4D1QA 1D0ZA 4ETSA 3GFMA 4XRSA 2E2IJ 4E7SA 1GVDA 2XF5A 1B9MA 2B0LA 3H0GJ 1ETXA 3QPTA 2NVYJ 1WI9A 1Z1DA 4AC0A 1WFXA 2WWYA 4O5VA 2J5PA 5KCMA 2V1UA 1LVKA 1FOYA 1S6LA 1XMXA 5DCMB 2DODA 4D7NA 1XSXA 4U0YA 4YFXF 3H0DA 3PSIA 5IYBJ 3F21A 4GGGA 3CC2I 2LRDA 3HOZJ 3GX4X 4HQEA 2ZNZA 1ETQA 3KZIC 4X6AJ 1JUPA 2MABA 2OC6A 2LNBA 5FFZA 3JREA 2H1KA 4G94A 5HS8A 1QPMA 1R9TJ 1TQMA 2FQ4A 2Y75A 2F48A 2GWRA 2K85A 4M9SA 1R00A 1J75A 3E5XA 4MQVA 2L9SA 3KEQA 3KEOA 3HL2A 2IRFG 1GUUA 2XAHA 3SJMA 4EMSA 3MZ8A 2OZUA 3KETA 1F36A 3PUBA 1G4DA 3JRHA 1NHAA 1B1BA 2CQNA 2DFIA 1R1VA 1XPXA 1G3WA 4EVIA 1B4AA 1YFHA 5E3MA 4QSHA 2WY7Q 1YE9A 1D5VA 2ICWG 1YOVB 1HW2A 3QU6A 3Q0UA 2VQLA 2GIVA 2H94A 3BG6A 3QODA 3W2WA 2LY9A 2VC1A 3ML6A 2JVHA 3GTQJ 4CYCB 1G3YA 5TGTA 5LHHA 2DA7A 3CCLI 3W2VA 1ZKGA 3REOA 4AIDA 2QZ8A 1ETKA 5EG0A 1XX5A 1IO2A 3ABTA 4GFBA 3CESA 3G4SI 3FMSA 1ZARA 2L7MP 4MTEA 2K9MA 3SHFA 4A3FJ 2LG4A 3ZGKA 2H6CA 1K61A 3F9KA 1PVEA 3CC7I 1CGPA 2EA2A 3M07A 1A36A 4ZTJA 2YX4A 1W7PD 3AG1H 3QOEA 1XDUA 2V1NA 2V1DA 4AWXB 3CO6C 1FMVA 3C2BA 5FJ8J 2KZGA 2M45A 2JUCA 1KGSA 2OQRA 2XKOA 3SEQA 2DTZA 2VPRA 2XV4S 2M0MA 3CCSI 1DGRM 2M8EA 1Q1VA 2W57A 1GVJA 4MLOA 3SDBA 4I98B 3OY9A 1TNSA 5HODA 2KRCA 3B6CA 1YW7A 5J4YA 3T8RA 3JTGA 2DT6A 3FHZA 5AIPA 1DGWY 3BG5A 3F0CA 2GM4A 3CCUI 5JR3A 2BY3A 5CVJA 2DCEA 4Y3OA 4UHTA 3OR2C 1YS7A 2EIMH 3QYBA 4CSWA 3KP6A 2RVCA 1YJNI 1R22A 1IW7F 2XSDC 2R7FA 2P4WA 1Z3XA 2KQRA 2EPFA 3COAC 3R0AA 2RAEA 3ZMSA 1WJEA 3DTKA 2ISYA 2CQXA 3DV8A 4LJZF 3WTWC 3RI4A 3A2KA 4PJLA 1FOWA 1BI1A 3DKXA 2WAEA 2EJRA 4RM3A 5H2FC 5BNGA 2G7UA 2XAFA 2VODA 5D8LB 3DP7A 1JGGA 2L9VA 2ME0A 5F08A 3WTXC 1X4PA 5LHGA 1Z0XA 4YIRX 1R71A 5D6EA 2DT7B 3HSFA 3FXLA 3PFYA 2R7SA 1PYVA 1O57A 2ZMEA 3HOSA 2G9WA 3S16J 1JTYA 1IGNA 1ZK8A 4OIRF 2CV0A 4GDFA 2GOXB 1HDPA 4BY1J 2LSOA 5FFXA 2LLKA 2JSPA 4ZC3A 4KIGA 5K5QA 4F3QA 5BOXA 1TLHB 2DAOA 2KT0A 1FLIA 3DPTA 2YS9A 3IL2A 1P4XA 5DYMA 4L9JA 4G7HF 1IV8A 3VSLA 2LP0A 3G1LA 3RKXA 1STZA 1EH6A 2HZTA 3S93A 2LC2A 4I09A 1H0MA 1HF0A 3O3KA 4HX8A 1POGA 1YYVA 4RMNA 3EDPA 4AUXA 2CYYA 4E7LA 1FP2A 5FKMA 4NBQA 1O7LA 2KIMA 2HDWA 3VYUB 3T0YA 1PJRA 5EGOB 4QIWN 3WE2A 1WKMA 3H3UA 4BYYA 1ZHFA 2W1OA 3FXJA 1X3ZB 1QBJA 3AG3H 5JI6A 4J19A 5L3GA 1SAXA 2M1BA 3AL0C 1LE8B 1ZGAA 2BVMA 1MGTA 1MH4A 2QQ9A 4A5NA 1LFBA 2MH9A 2KLOA 4JX6A 3A02A 3JAMZ 4L5IA 1SVLA 3M9AA 4AU7A 5F0FA 2FQ3A 1NG6A 3S3NA 1QO0D 2A05A 3B73A 3RKYA 4BDZA 2STWA 3I71A 3HTUA 3WODF 5J8FA 5LGTA 1QNTA 3LA2A 2HVQA 3I54A 5GPAA 4BE2A 2O61A 1IRZA 1MMNA 1N78A 1KQ9A 3DTIA 3GXOA 3K1NA 4HX7A 2HTSA 4AD9A 2A5WA 2L7KA 4E7HA 1GV2A 4L9TA 3QQAA 5F27A 3IH4A 1OCRH 4HDVA 5GP9A 2O0YA 4IVNA 2P6TA 3S1RJ 2I8DA 1B59A 3HRMA 2BYVE 4XN0A 2XKPA 2D1VA 2VJ5A 1BN5A 2M30A 1ETVA 3V42A 1XSVA 3GFIA 3HC7A 4BY7J 1HW5A 2P8TA 5CVRA 3JRAA 4I2OA 1IXRC 3E0JB 4G6QA 4N9IA 4LB6B 1JKQC 1VQ4I 2M8GX 2ZMEC 2KRHA 3CUQB 1QU3A 3JRBA 4PFPA 4XRSG 1TTYA 2XDVA 2NVTJ 2R7QA 1MBFA 2CGPA 3J81K 1PDNC 2VOOA 3DF8A 3WHCA 3BZ6A 3M1EA 3A4CA 4NQWB 1FMWA 3HTSB 2K9SA 3RIRA 4G12A 2ADUA 3LSRA 4RS8A 3S1NJ 3K4BA 5DUIA 1HSJA 2PJPA 3IHUA 5C4JJ 2R0QC 1T98A 1DU6A 2VBXA 3LA3A 1U78A 3GTMJ 1J09A 2DW4A 4S04A 3FM5A 2L7ZA 3QPLA 4RLFA 2HGCA 2E7WA 3OYIA 1E17A 3M7GA 5J1UA 2UUZA 4EGZA 1JJ8C 3IH3A 3IKVA 5EEGA 3WGIA 1HDDC 2DXIA 3ULQB 2NS0A 4BJ6C 2DA3A 2HOSA 4XLPF 3KCCA 1XMAA 3PFIA 1SFKA 3CP8A 3PNYA 4ITVA 4IX7A 3H3VK 1W5TA 5FKLA 1XGSA 2COMA 4XN3A 4HEA2 2FX0A 3KYLA 2AO9A 3RPQA 3KLOA 3TO9A 3K4JA 3IWFA 1IZ1A 1L0OC 2VUMJ 1S3JA 2ZJ2A 3PNVA 1Y56A 1K78A 4FTHA 2DDAA 4HYEA 5JHUA 5JVTA 5BS6A 1VQNI 1BR1A 4B47A 4PGGA 2GQQA 4DYCA 3V7CA 1Z91A 5F1RA 4FT8A 4YFKF 1UG2A 1WGXA 1BJAA 2I5UA 2X51A 4I99C 3GLXA 1T0FC 1MW7A 5DS9A 3IRQA 3CF5F 2R93J 1JTXA 3DKWA 3K69A 2Q2EB 1TL8A 1FY7A 2NYXA 4CXFA 3EYIA 3CCQI 4LLGF 4D0PA 1ERDA 1B6AA 2OTLI 2PLYA 4I01A 3GCMA 3CCEI 1EH7A 2M0CA 4RM2A 1FNNA 4BL0B 5GTHC 5IP6A 2AXTC 3IWZA 5ILSA 1GT0C 4DYQA 3E6MA 2KHMA 4BNCA 2P6SA 5K7ZA 3JW4A 2E5ZA 4A0ZA 2LKXA 5F64A 3H9GA 5E8IA 4FISA 1VQOI 2X85A 1LKXA 3JSPA 4FE4A 1MNEA 3GWZA 2EINH 5LRSA 2DOAA 2EWNA 2BY1A 3WGGA 1AWCA 1FZPB 2GZWA 4Y52J 1WQ2A 4PZJA 2UXXA 2GLOA 1V5FA 5ICFA 4A6DA 4O3MA 4HF0A 1WJBA 4F92B 4LMYA 5HNFA 5EEAA 1ETWA 2M4GA 3F6OA 3MD2A 1GDTA 1ON2A 1ZGJA 1E3PA 2FMLA 2K9LA 4JP0A 4IHWA 4BGDA 3LSTA 3CMAI 5HDNA 3IKTA 2AQFA 1IDYA 4WXDA 2XRLA 2EB7A 1XN7A 2VQHA 4BDYA 1RKWA 2CQKA 3SZPA 2ISZA 2HQAA 1PUFB 5IY5H 3TP0A 2Y30A 4ZH4F 3LSKA 4MHGA 4R1HA 3OWTA 1FEXA 1IN5A 2OUMA 1QRYA 1PUEE 3GZ6A 3E5UA 1YRNA 4JX4A 4A2UA 2OV7A 1LE8A 1H9GA 2YU3A 3HKZA 4BS9A 3GFJA 4L18B 2LYCA 2FXAA 4M3DA 3MKYB 1EF4A 3AFHA 1LDDA 1EV7A 1T0FA 1UHSA 2CUEA 3K0LA 1UJ8A 4W1UA 4ENJA 1FOKA 5E20A 4HPQA 3GF2A 4YG2F 2MD0A 4IXAA 2XGXA 3Q5FA 2QQBA 4XMYA 2RN7A 1P7JA 2M5WA 4JQFA 2EFQA 1YS6A 1X2NA 2MBFA 3DU5A 2HOTA 4NC6A 2LKPA 3CD6I 5IT3A 3QAHA 2GOMA 2BE5F 3DBLB 2KPMA 3FMQA 4P55A 1DDNA 2K5CA 2FNPA 1S7AA 4PJNA 5F0CA 5IT9K 1SEUA 3K10A 1OKRA 2OBPA 3RDIA 4RBOA 2VE9A 1FSHA 2F4IA 1I3AA 2KDOA 3E7LA 4PSXA 5D5WB 3BCAA 5J8CA 2MSYA 3IRRA 2EILH 1V3FA 3R4KA 2MW8A 1I1GA 2EIJH 2M9HA 4FETA 2PJRB 2YX7A 1FWZA 2DYSH 3VB2A 5ERIA 5CVUA 3HSRA 4ZZLA 4RDUA 2GXAA 3OYAA 2COBA 3DXJF 2DYRH 3TOAA 2K40A 1REPC 2L4AA 3LSMA 1X3WB 3OL3A 3FF5A 3Q9VA 4CCLA 3GUDA 2Z3YA 3Q0WA 1HOMA 1D1CA 3ABLH 1VQ9I 2BVLA 5E1WA 2P7CB 2RKHA 2QYOA 3W6VA 3DEUA 1ZLKA 5EZHA 2RREA 2X1CA 3HZJA 2E7XA 5DM6F 2R4GA 4CCMA 2R7RA 3PQKA 5FRMA 1K6YA 1BBYA 4BE1A 4A3CJ 4KYWA 2K4JA 1P4AA 1VI0A 4U0WA 3G71I 4A0YA 2W7NA 4JOMA 2ZXWH 4LLNA 2O5RA 5KVRA 2WB1A 4A3JJ 3KIOA 1MDMB 2NOJB 3LSIA 1UG0A 2VKDA 1X1BA 4UB8C 2Q0OA 1LUJB 4B3AA 1TWGJ 4JK1X 4JX5A 1H88C 3EUHC 3H5RA 3K4NA 5HLTA 2G7HA 1JI8A 4QLCU 1RI7A 2HU9A 1OYWA 2NXNB 3MEXA 1SFXA 4CCKA 3E6CC 5BPIA 3P7NA 2HVRA 3E6BA 3BDDA 4HLXA 3TMOA 2VJ4A 3S1MJ 1Z7LA 2FRHA 1LNWA 2VXZA 3F8BA 4XORA 2KKOA 3WTVC 1JGSA 3KP5A 3KP7A 3MCZA 4UVBA 4YIIA 2QWWA 3FISA 2GXGA 3WTYC 4ANJA 1A35A 3ABKH 1FBUA 3VSKA 3OYBA 2VBYA 1JKPC 1ZRCA 2QENA 2DA2A 4HRIA 2IEKA 1QQIA 1RESA 4M74A 4V19K 3OS2A 1ZRDA 3WE3A 5J1RA 2MLGA 2FA5A 3O6BB 3VDXA 5L3DA 1H89C 1KU9A 3CZ6A 2CMPA 2VKHA 3LAJA 3ZXSA 1MMDA 2CQ7A 1ZREA 4QTRA 4IL6C 1YO5C 3IAS2 3OMYA 4XRMA 1ENHA 2V9VA 5LEJA 3G1MA 2L4MA 4BHCA 1K78B 2K02A 2L01A 2PI0A 2K4BA 2QSGX 1MBEA 4JYKA 4MTDA 1ZRFA 5M3FJ 5IP7J 2BHZA 4N0BA 1V54H 5KHDA 3KPHA 5H6QA 1V5GA 1R36A 2TRTA 4OIQF 4M72A 1ZG5A 2E1MB 2ZSIB 1K79A 5KAFC 3JRFA 4FHTA 5CPRB 1I6HJ 3E1SA 5FRNA 2HPIA 1SVOA 1YW9A 1BR4A 2L9NA 1S72I 4IRIA 3S17J 2QA4I 4HLYA 3MN2A 1GLNA 1Z7UA 4HOBA 2Y48A 4CICA 2LD5A 3VEPA 3HYIA 1IUYA 3P5JA 4L9NA 2KIQA 3UKGA 1FIAA 4II2A 5ICCA 2OAZA 3OYHA 2VBZA 1T95A 2WAFA 3HSEA 4ZJZA 2IT0A 5K5RA 4DGWB 2R7OA 2A6HF 5KAIC 4RB1A 4A93J 1WJFA 3L00A 4KIFA 4V2GA 4A3EJ 2DFHA 3U2RA 2ZNYA 1QHGA 2Y69H 3CCYA 5L3BA 3HOTA 3FK6A 3DTEA 5ILUA 4WWCA 3CTAA 2CUJA 1E2XA 3CMMA 1OJLA 2CUFA 4CDGA 2E2HJ 2HFHA 1OPCA 2W24A 4HSTA 2P5KA 3HKZN 2HYGD 3CJNA 4EM2A 2L54A 1IN8A 3BZKA 1XG1A 2ETHA 2DJNA 4IHVA 1D8KA 1XSDA 2QKLB 1WVRA 2CJJA 1FJLA 3ZCOA 3S2HJ 1Y1VJ 3PL8A 1K4SA 3HRUA 1P4WA 3IC7A 4DJAA 4OWRB 4PDKA 2QSFX 1MNDA 1RRJA 4C2TA 3BTLA 2UZKA 3E97A 3AAFA 5E1ZB 3DQVC 3M4OJ 1K7AA 1TQPA 3RTRA 4XK4A 1HCRA 3BR5A 2GA1A 3WU1B 1JT6A 4C2MJ 3WGHA 5A2QZ 3L2QA 1FYKA 1WHUA 2CO5A 5LGNA 2X48A 3BY6A 4ON0A 1N25A 1U9NA 5HNHA 4RGRA 2LY1A 4RB2C 3B6AA 2FMYA 1LB2A 1O3TA 1JT0A 2W85A 3G3ZA 1VTNC 5F04A 1VF9A 3BP8A 2O7OA 3OYNA 1UFMA 1OYYA 2JT1A 4EJTA 3KFWX 4DZPA 1ZR4A 2RQPA 4EQQA 3M8FA 4XICA 1FC3A 3VPRA 2F2EA 1OR7C 5B1AH 2BZTA 1B8IB 1H9TA 1O4XA 2E1MC 4M71A 3FMRA 2Y9ZA 1K6OA 3OYCA 4E7JA 2RNGA 2NVUB 2PJRA 4HV6A 1JUSA 2KZVA 3HGYA 4B3XA 2DBBA 3S2WA 2IS1A 3ASOH 2FJ1A 4LFUA 3OIOA 2HWVA 5CQGA 2LBFA 4FASD 1W5SA 2VJJA 1G3SA 1W7PB 5FD6A 3MZHA 3PJRA 3BPXA 5AONA 5B1BH 3TO6A 2V6EA 3F8NA 3HRTA 3MFKA 2ESHA 5M5WJ 1BOAA 2QM3A 4DBQA 5D8KB 2UV1A 4MO7A 3S3OA 2HQ5A 2VQGA 3K1MA 2AHQA 1RZ4A 2XGDA 4NC8A 3KE2A 1RC9A 2A61A 4C9YA 4G6DA 1MJAA 5D4SA 3A01A 1LPQA 4KMFA 3DKYA 1ITYA 1DQUA 2V1XA 2NAZA 4KMUX 1SMTA 3OS0A 5D5XB 2W84A 1XGNA 1QGPA 4DOZA 4BE0A 1FYMA 2IA2A 5DV5A 3ECOA 2IGOA 1ULYA 4BJ5C 2E2JJ 3LQRA 1IRFA 1GHCA 3K6GA 2NRAC 2H1LA 4BJTA 3PO3J 2VBWA 3NQOA 5FB2A 2PMZA 2IS2A 1UAAA 1D8JA 3CCVI 3CF2A 2F5DA 4E7IA 4R79A 3IH2A 2QBYA 1R6RA 3NEUA 3RZDJ 1UMQA 1PUFA 2R7TA 4EATA 3ERMA 3FM3A 5DEQA 2NOGA 3GW2A 2B7EA 4ZYEA 2DA4A 2D45A 2DA1A 1SANA 4A12A 4X0GA 1DPRA 1Z9CA 5L3FA 2ACJA 2X9DA 3SEZA 2E35A 5D5VB 4RB0A 4BQQA 4F93B 3CCJI 2Z16A 4E7KA 5LD2C 1A5JA 4UVAA 1S29A 2YUSA 2VT2A 4LD5A 2IP2A 1UHWA 4C3JJ 2WB1N 2IS6A 4IF4A 1ZQ3P 4MEXF 1XTAA 4M3BA 1EJ9A 1KA8A 2BV6A 1KU7A 3TOBA 5C3EJ 3OYFA 1UZCA 2LDUA 2O8KA 3K9TA 1WRJA 3GVAA 1K4TA 2MH2A 4G9YA 2HQNA 2E19A 3MKLA 2OCEA 4UVCA 3PIOF 1HSTA 1BW5A 3HB9A 5H20A 4IJAA 3HDDA 4BUPA 2A5YB 3K7AJ 4UUVA 2WAQN 1P7IA 1N77A 2JA5J 4HF1A 2PX9A 5HVQC 1MBJA 2MYSA 5C4XJ 2QGUA 3I4MJ 4CO8A 4A3KJ 1F5TA 2JPBA 4M3FA 2E5NA 3GTPJ 2A69F 4UV8A 4HG2A 1JKOC 3IUOA 2VKEA 1WWXA 2R7DA 3H92A 2KP6A 3HXLA 1I5ZA 3TKYA 4IQ4A 3I55I 4MGRA 2ELKA 2XAGA 2C6YA 3ISPA 4XKVA 2XUBA 2UWMA 2V4JC 4IRHA 4BHBA 1U8BA 1WJCA 1GXPA 3SQNA 1RIOH 2DDBA 1MMAA 4UUSA 1LEAA 1EKEA 1OCCH 5HS9A 4HDUA 4ENKA 1YHQI 4AIHA 4EM0B 4HX4A 3HOUJ 3OYMA 4XLNF 3U9GA 3BROA 5ED4A 5J6XA 1QZEA 1R5GA 1DU0A 1VNDA 1FTZA 3B02A 1C0WA 2P0WA 2IXSA 3ZN0A 4KIBA 1T6SA 2L3DA 1I6XA 2VQCA 2ZXHA 2R7XA 2HZDA 2HYFA 2HQRA 1FSEA 3V8LA 1Z05A 4RA2A 5LEKA 4G7OF 2M3AA 3LSHA 1E3HA 1I3QJ 5LFAA 4A3MJ 1AOYA 1KQ8A 1D5YA 4IRGA 3J81Z 3ZP5A 2WC2A 5E3NA 1D0XA 2KIFA 2OQGA 2Z99A 3ZQIA 1RUOA 3S8PA 4HAMA 4U88A 2IAIA 2X4HA 5EZGA 5DDGA 1R4NB 2PMHA 5TISC 4FCYA 4A3IJ 2Z9OA 2NVQJ 1XGOA 4KICA 3CUOA 4S0HB 3KEYA 3PIPF 2FE3A 4LG0B 3ZQQA 1U0JA 5K7HA 1OYIA 5F6FA 4EJWA 3I4NJ 3DWLE 1ZGWA 4I7HA 3QRFF 4I0AA 1DP3A 3EQLF 4XKBA 3X2QH 2JJ7A 1O3QA 5E3OA 4YFNF 2HDDA 1P6RA 4XIDA 1ZH5A 2O8XA 2G0EA 1X58A 3OL4A 4RGXA 4DZJA 1HC8A 2ESNA 3DEWA 1BA5A 5EJCA 5DUKA 4UB6C 2JWTA 3WG7H 1WCMJ 3RYPA 2DFFA 1DP7P 2ELJA 1TT5B 4ENMA 2JA7J 3L2RA 1XB4A 4B8XA 4BEHA 4AIKA 3BR2A 2HEOA 5CQEA 2XROA 5JVGF 1G3TA 4BBSJ 3ROUA 5GADJ 4Z2YA 4A3BJ 3I3LA 3ZMTA 3SYTA 3ZQLA 2XHKA 3FX3A 2F4MB 3CLOA 1A6IA 1X1PA 3J7YJ 1KYWA 4IOCF 2X6WA 4EJOA 4G6TB 3H9JA 2VE8A 2MC4A 2F4OB 3ZN1A 3QP6A 1HKTA 4QPOA 4J00A 1HQCA 4V2FA 3SDGA 1YIOA 1F4KA 3ZQGA 2DOFA 4KT6A 3RPUD 5CVIA 4KJZA 5DTDA 2XAQA 4YELA 2EZLA 2GA2A 3MQ0A 5GAHJ 2KJCA 5EGOA 2AXLA 2FUG2 2Y31A 1WJAA 4CCJA 1OQYA 3JRGA 3D5SC 3FBNB 3ERED 5HLHA 1AA7A 2HKOA 2O03A 4EGYA 2QQAA 3JRIA 3CJQB 5EF6A 3ELKA 1E3OC 1KYZA 2Y0MA 1ZYRF 2QUFA 3DU6A 3FKIJ 3JTHA 5K5OA 3OYLA 3HOYJ 1S9HA 4M9XA 3PO2J 1G8XA 4XBFA 2OJED 1QA6A 2IBDA 2TDXA 2IGNA 3S32A 4DNCA 1N75A 2VC0A 3HHHA 4NC7A 3VFZA 1G6NA 3CC4I 3OYEA 2DMNA 1LJ9A 2WADA 4M3EA 4CZCA 2HTJA 4KITB 1PP7U 2NS8A 1T2KA 2HXOA 2JTVA 3S3MA 3O2PE 2RC4A 2QEXI 1W7PA 3MAJA 1SD5A 4D7MA 4U87A 3F8MA 2L9RA 2PEXA 1UHMA 4LK1F 4ZZDA 4F55A 3K1PA 1FIPA 1P92A 4XLHA 4IEJA 1BC8C 1ZLJA 2DA5A 5TRDA 1UELB 4OIPF 1ZN2A 2XPWA 1RR8C 2XGEA 3NRVA 1Z3YA 2H6BA 1IG7A 2VT3A 5KK1A 2HOAA 3JRDA 4LLLA 4ZDPA 3OYGA 4UUSB 1U5TB 1MD0A 3ASNH 1YRNB 3I9V2 1R5ID 2GXBA 2K3FA 1X1AA 1TWHJ 2ZJPF 1Z6RA 1LFPA 2R5YB 2K9NA 1F9NA 3BR6A 3H35A 2DA6A 2X1DA 3MMYB 3WHBA 4FE7A 4I0BA 2M7AA 4B43A 3QPSA 3CCMI 1IUFA 3HBLA 3F3XA 4KNYA 4UY8I 2QSHX 5TJJA 3TQNA 2BW3A 2VJIA 4D5FA 2OU2A 3BC8A 4PGHA 1HLVA 3DEEA 2EFWA 1ONVA 4MQ9F 5LHIA 4L0ZB 1BR2A 3G1OA 3CCRI 4OAYA 3SZGA 2L02A 2CFOA 3UNGC 3BWGA 4PUSA 4E70A 1Y8QB 2GBYA 2J5OA 1APLC 2PG4A 4U7BA 3RZOJ 3LWFA 2RGVA 2DQLA 2F6CA 3BG3A 1I27A 1MBGA 1OCZH 2FF4A 2Q8KA 1SVMA 5EG0B 4B1RA 1TWCJ 3TGNA 2CH0A 3I4PA 2PBIA 1JJ6C 1AKHB 5B3SH 3VYRB 2V7FA 5D4RA 1V5EA 3K2ZA 4CYCA 2K27A 3F22A 3HGGA 3P9CA 3HPHA 2Q2EA 4LK0F 2M2EA 3S1QJ 1LDJA 2N8GA 1VQ7I 2AS5F 3L2CA 5K7FA 4XLCA 2O9LA 4HA8A 1W0TA 3HOWJ 2X0LA 3C18A 1MNMC 2BHYA 4CCOA 2L5QA 1RKTA 4WCGA 4WXHA 1U5TA 1YX3A 2XSJC 3BOQA 2CW7A 4IKFA 2DOEA 1XCVA 3K2AA 2JZYA 5L3EA 2XPUA 5JLWA 2O6GE 4L0YB 3FXKA 4OAZA 1X1CA 3OYKA 1OR7A 1XD7A 4AYBN 4HBLA 2E36A 3OOPA 3OOUA 4LIVA 3CDHA 1QVTA 1QZYA 1ORKA 4F7ZA 2HPMA 2ZJQF 2D2WA 2FU4A 2CG4A 1JUMA 3TDZC 4IHSA 1BI2A 3FZVA 4HF2A 2V9KA 2HS5A 2RQQA 1MKMA 4P1WA 1UCRA 2EK5A 2HYJA 1OISA 2DMPA 4C3HJ 2NNYA 3KLNA 3ZQ7A 1BIBA 2ZFWA 3EPZA 1TW2A 3RSNA 3PNTA 3CDLA 5E17F 1ZTRA 3K70D 3GZ5A 3F23A 3SFIA 5H6RA 3ZOBA 4KDPA 2HNHA 2LR8A 3V7SA 3F8FA 2LBFB 3DLAA 3QWLA 3DCFA 1FBQA 1IN7A 2VOPA 5LRRA 2QCOA 2KIUA 4BQOA 4ZYDA 1ZG1A 5JLXA 4UNOA 4HV5A 1EH8A 4HQMA 5C44J 2EIKH 2E71A 2NS7A 4XKCA 3U1DA 4BXUA 1IXSB 3GTKJ 2VI6A 5AIQA 4XKWA 3CUQA 1TC3C 3V4GA 2CV1A 2R5ZB 4XLEA 2FBKA 2LVSA 3HG9A 3KYCB 5DD4A 4DYRA 1B8IA 3BQZA 2BXZA 2JPCA 2W82A 3W2AA 3M3YJ 3E3VA 3Q9SA 2YU9J 4XLAA 4LB5A 3MKWB 1BI0A 1USTA 2V9PA 4HW0A 3T5XA 4BHPA 3OS1A 3H3ZA 3LQQA 4CHUA 2VONA 3ESWB 3QYEA 4EV0A 3GZNB 4Z6YA 1Y0UA 4M6XA 2OCCH 1DPUA 2EV6A 3DPUA 4IO9F 3DFGA 3ABUA 3ECHA 3FXUA 4OIOF 2YSRA 1RR7A 4DW6A 3I56I 4BH9A 3HOXJ 4MNUA 3ZMZA 2W00A 4ENNA 3J80Z 1Z67A 4BQAA 3PUFA 1RUNA 2QVOA 1WI3A 2WA0A 1J5YA 4B4CA 4MIMA 3Q0VA 1QVUA 2BY2A 2OF7A 1U5TC 4RAGA 2F5VA 2JRTA 5JHFA 4GCVA 4Q47A 3AG4H 2EZKA 4EJUA 3OSGA 1Y8RB 4XQFA 1A31A 1XMKA 2LF8A 4FX4A 1BM9A 3ZQFA 2KJBA 1WSUA 1V55H 3FDYA 4GYGA 1T56A 1FPQA 1IAWA 1WPKA 3RKQA 3LFUA 4IQJA 1SD6A 1LEBA 5HDKA 5JFRA 3BLYA 3W6KB 4HNTA 1I39A 2E1NA 2RV8A 4D5CA 3N97A 3FIWA 4ASNA 3ZMVA 4C3IJ 2R5ZA 2FBIA 2CQQA 3C2GA 3ZR8X 5ICEA 1XGMA 4PJ0C 4L5EA 4BQNA 3ZRGA 2HOEA 3HUGA 2LFBA 1Z6TA 3MVPA 4LG0A 1T8IA 3S2DJ 4M6VA 3U1KA 3HM5A 3HOVJ 2BBYA 1Y0NA 3FXRA 2DU9A 2EV5A 4KISA 4ZDLA 1U2WA 3BG7A 4MFDA 2IGKA 2ZO4A 4PCQA 3G2BA 3OV8A 3SFZA 3I59A 1HW1A 1R7JA 3VYSB 1HKSA 3DBHB 4G8XA 5F0HA 2MLKA 3G73A 2EH3A 2JUGA 3BT9A 5E1XA 4YRVA 3TO7A 2VIXA 4IHTA 2BY0A 2XF6A 2EBIA 1EA3A 4HZFA 5CJ9A 1YW8A 2M7BA 3EETA 5L3CA 2FBHA 4D9JA 2ECBA 3FWEA 2A6TA 1MBHA 1TT0A 1Y39A 2XF7A 2EFPA 1YJ9I 4HSRA 2DLLA 4F91B 3TEDA 5IYCJ 1JKRC 3TW7A 2CU7A 4XR6A 4EM1A 3CMYA 1RPWA 4NUBA 1A6QA 1TWFJ 4DIQA 3ZMDA 1AU7A 1FX7A 2A07F 1T33A 1GXQA 4BXFA 5HOOA 2WBMA 4AVPA 3GYHX 4Y4RA 4HNVA 2YR2A 3W6JB 2IS4A 4DQ2A 4K2EA 1ACIA 2DT5A 3FXOA 1F43A 2IW5A 3CJRB 5GAGJ 4AIJA 1W5CC 4C2UA 3RYRA 1WH5A 1YG2A 2MD5A 4ZYGA 5GTIC 1IRGA 2FNAA 1X19A 2JVGA 2IJLA 4UUTA 3EYYA 4B09A 3LSJA 3BR1A 5IPAA 1Z21A 2QQ8A 3TL4X 2OTJI 1NG7A 2KDZA 2CRGA 2ECCA 4IHXA 1HA8A 2F5CA 9ANTA 4P5OA 1MZBA 3TW6A 2EFNA 5LBQA 1R4MB 2Z5UA 3L7WA 4C30A 1L3LA 4P9FA 4XNFA 4L9VA 1S7OA 4BKXA 4LITA 3D5RC 3ABMH 3N4MA 1LVAA 4A6EA 2JMWA 3FHNA 1VZ0A 2MA3A 1J59A 3CMEI 2JSCA 2X6XA 2JN6A 2K3PA 3VYTB 2A3SA 2JK3A 4ESJA 2XVCA 2DPDA 3DBRB 3OSFA 5IOZA 5GPCA 2EV0A 1NK3P 2GAUA 2OD5A 3QP5A 2HVSA 2I10A 4NB5A 5FKNA 4WXCA 4NNJA 2MC3A 3RPUA 2E1CA 3GFLA 3R0JA 4Y13A 2FOWA 3HIFA 1BC7C 4ESBA 5HLIA 4ABZA 3ZQCA 2BOLA 5EEHA 3F6VA 2IPQX 1X2MA 3MKZA 3T1BA 4XSXF 2RDPA 2JQ7A 3HRSA 2ZKZA 1D1BA 3KZYA 1B72B 3ZMUA 3RQIA 1U8RA 4XSZF 2NNNA 4OMYA 1SC7A 2Y0SN 4A3DJ 4Q4ZF 1YIJI 3I64A 1FBSA 3BTCA 2V26A 2STTA 4XM3A 3VOEA 4L5JA 1QPIA 2QBYB 2VKVA 2IA0A 2P5LC 5B66C 2ZCWA 2ZB9A 4N4NB 4P9UA 2BGCA 3EUAA 4RGUA 3WG9A 1QZZA 2XRNA 2DMUA 4M3GA 5ICGA 3L2WA 4RAYA 1VQPI 3QYFA 5IT9Z 1RETA 3FK7A 1JE8A 1FOXA 1TQIA 2IGMA 2R7ZJ 5IYDJ 2QLZA 3K4KA 3RCOA 2LMDA 5M5XJ 3VWBA 2Z1DA 1OLTA 2HXIA 2WV1A 4BXXJ 3QOPA 2R92J 3HHGA 3JAMK 3HPGA 4Y7NJ 4MFEA 1SMYF 3IAM2 3A01B 2DPUA 3BTJA 1Y6IA 2LREA 4O6JA 1YITI 4XLFA 3LSPA 2CV2A 1MMGA 3R6SA 1ZAOA 2D5VA 1IRXA 2M34A 2QF7A 5FKOA 1IN4A 2PMZN 3RKWA 1ETYA 1KONA 3KP2A 3BCBA 4FX0A 1I1SA 4IZZA 4PK4A 4XOPA 4I02A 3S14J 5DCMA 2EQRA 1VQ8I 4ZYAA 2ELHA 1IV6A 3I59B 3HUGB 1BL0A 5HLGA 1USSA 4CH7A 2HKXA 4RLQA 2GIZA 2XAJA 6PAXA 2DMQA 3C3WA 2H8RA 5FLXZ 2R3SA 2MG4A 1IN6A 1Z77A 5FROA 4YEJA 2HR3A 2L0KA 3ZQHA 4G7ZF 4NHJA 1MIJA 2MGQA 1VQLI 2Y9YA 3T8TA 2ID6A 4B44A 1YQAA 5E8GA 2DN0A 2LTPA 1G2HA 5DM7F 1ON1A 1R5HA 4KN4X 1SFEA 4XONA 5M5YJ 1ZG3A 1M1EB 4U7DA 1R49A 2H8WA 2LF7A 1MSFC 2FSWA 3K4CA 3J7AO 1IXCA 2WTEA 4P96A 1BW6A 2WAQA 3A03A 3WU0A 5M3MJ 3RQ4A 1SFOJ 1CF7B 2Q1ZB 3WTSC 5BMZA 4QWQA 1FT9A 3SZTA 3KYDB 3K4MA 5EYRA 4CUGA 2DMTA 4RAFA 4GYIA 4KUMA 1TP4A 5CYVA 2KISA 1LQ1A 1MMSA 1ZR2A 4N4OB 1MSEC 2DO7A 2LH9A 1XDSA 2XAUA 3C7JA 3ONQA 2CFXA 2UXNA 2Y2ZA 1SFUA 1YJWI 2KL4A 2ZBKA 2OA4A 4XL9A 3BJAA 4BEHB 1TZLA 2O3FA 5FD5A 5FO5A 1MJ9A 1YTYA 1FYLA 1P2FA 2JRMA 3P9KA 1WJDA 2VASA 4RGSA 2TCTA 3NAUA 3M8EA 3V8JA 3OYJA 2MFZA 3K4LA 3R61A 1MBKA 3AL0B 1HXDA 1S5LC 1YLFA 2CSOA 3GTGJ 2D1HA 2VL8A 3E5QA 3GMEA 4PSWA 2H09A 4TV7A 4FQGA 1W0UA 3L9FA 3BJOA 3U21A 1UB9A 3F72A 4EJVA 3WTZA 4A69C 2EZIA 1S7EA 3A1YA 3ZPLA 3I5UA 1T08B 5E79C 2X6YA 4OOIA 1KQ0A 4M6YA 3D1NI 4BACA 2Z33A 5IP9J 3L09A 2CUZA 3LSGA 4Q5SF 3LMMA 3GTJJ 1O3RA 3FBIB 1ODDA 2E60A 2EA4A 5DCFA 5LLQA 2K86A 2OZ6A 3IP4B 1R1TA 1J2XA 3BPVA 5FGMA 5J47A 5LGUA 2B9SA 4A3GJ 4ZDOA 3V8KA 5FLXK 3V7RA 4A3LJ 2DI3A 4MEYF 4YIFA 2DJIA 2XPVA 1OFCX 1IF1A 1X3UA 4Q48A 3BR0A 4XOTA 3AKZA 2XC7A 3DLLF 2ZXJA 3BTIA 4BU2A 3QPHA 3BR3A 3F8CA 2ZXIA 1MJBA 1J0RA 4GRIA 3JR9A 3D5LA 1XCBA 3P9IA 4A5MA 4WX9A 5EDNA 1XS9A 4QPQA 2VLAA 4ZYHA 2ZJRF 2KRFA 4E7ZA 5HDGA 1NH3A 4BBRJ 1SD7A 4Y33A 2E1OA 3LAPA 4B48A 1Q1HA 1R58A 3CP2A 1B9NA 2EZHA 2DTRA 1QHHD 4WF2A 3BZCA 1PP8F 4PFOA 3W3CA 2H27A 4JBAA 2KMUA 4KT5C 1B72A 1TBXA 2W4SA 2ZFUA 4U0VA 5F1JA 3JCUC 2F5EA 2LK2A 1W1WE 3N05A 3OIPA 4NQWA 4E4HA 4E6KG 3K70C 3VODA 4H0EA 1J7KA 4LOCA 1NTCA 3WU2C 4Y17A 1WH7A 3EUHA 4M9ZA 1CQTA 3H36A 1LDKB 2RNJA 4I76A 2IVMA 1XC5A 3LOCA 3M1CA 2VPLA 2BXYA 2PN6A 1AKHA 2LKSA 1U3EM 4IPAA 4H4KC 3OYDA 2A68F 2FD5A 4LG3A 2R7WA 2HDCA 2LOOA 1HKQA 4R8HA 4CGZA 2XASA 3UR3C 2VB6A 4Y15A 5CKTA 2F5FA 1HBXG 2DK8A 1BOBA 2L2OA 3IV5A 4OMZA 1RNLA 2R7UA 3I53A 4X1EA 3WTTC 3H1CA 5KNLA 1FP1D 3KP3A 3OR1C 2XIGA 3BQYA 4CA0A 1IJWC 3J7AY 2DK5A 1R23A 2BW3B 2QKMB 3CJTB 4KFCA 2VN2A 1J9IA 4KN7X 4LGWA 3A0BC 1MDMA 3LFKA 1BI3A 4PJJA 4OINF 1W36C 4AM3A 3NARA 2K7LA
chains in the Genus database with same CATH topology
3BG9A 1JJ8C 3IH3A 1FTTA 2E2JJ 2P81A 1HDDC 1ETOA 3PO3J 2HI3A 1RR7A 1TWAJ 2DA3A 4DW6A 2HOSA 3HOXJ 3H3VK 1I50J 5FKLA 3IH2A 2FX0A 2AO9A 2R5YA 2OPTA 1WI3A 2VUMJ 4B4CA 4MIMA 1UMQA 3RZDJ 1PUFA 3Q0VA 1QVUA 2OF7A 2NOGA 3O8HA 2EZKA 4FTHA 3OSGA 3TP3A 2DA4A 2K9QA 4DYCA 3Q3SA 2DA1A 1SANA 2ME6A 3ZQFA 2X9DA 1T56A 1UG2A 1WGXA 1WPKA 3RKQA 2JA8J 5DS9A 1LFUP 1IDZA 2XB5A 1A5JA 2R93J 1BJZA 2YUSA 1JTXA 2X6OA 4C3JJ 2WB1N 1MH3A 2M0CA 4D5CA 3FIWA 1OCPA 1IC8A 4C3IJ 1ZQ3P 4M3BA 5IP6A 5FKKA 2R5ZA 1OCTC 2CQQA 2L7FP 1GT0C 4L5EA 4DYQA 2B63J 5C3EJ 2LFBA 3MVPA 5K7ZA 3S2DJ 4M6VA 1U9OA 3HM5A 2O8KA 3HOVJ 2LKXA 4FISA 3CQZJ 4W97A 2E19A 3MKLA 4MFDA 3PM1A 4FE4A 1BW5A 2XGCA 3HB9A 3HDDA 3K7AJ 1NK2P 1GV5A 2WAQN 1P7IA 5F0HA 4IHYA 2JA5J 2EH3A 3BT9A 1MBJA 4Y52J 5C4XJ 2GLOA 5J3LA 3I4MJ 4A3KJ 2EBIA 5FLVA 4M3FA 2XB0X 3GTPJ 1H8AC 2ECBA 5EEAA 1JKOC 1ETWA 4I6ZA 3GTLJ 3LNQA 2VKEA 1GDTA 1MBHA 4JP0A 4IHWA 5J1YA 2ELKA 2NVXJ 1Y1WJ 1IDYA 5FLMJ 3TEDA 2XRLA 5IYCJ 2ID3A 3TW7A 2CU7A 5IOYA 1U8BA 3CMYA 1JKRC 1RPWA 1TWFJ 4UUSA 1RKWA 1AU7A 4EEFG 1PUFB 1T33A 3TP0A 2Y30A 3HOUJ 4HNVA 3HEFA 1FEXA 1DU0A 1FTZA 1VNDA 1F43A 1QRYA 1AHDP 3O8GA 1YRNA 2W48A 4NDLA 4JX4A 1LE8A 1WH5A 3JRCA 1EF4A 4M3DA 4UUTA 3LSJA 2CUEA 1UHSA 3BR1A 4W1UA 3GBGA 1I3QJ 5IPAA 4A3MJ 1D5YA 3GTOJ 3L1PA 2JA6J 2KDZA 1P7JA 1X2NA 2CRGA 2ECCA 5E3NA 4IHXA 2HOTA 9ANTA 3S15J 3TW6A 3ZQIA 5E3LA 1VFCA 1K83J 2IAIA 4BKXA 5EZGA 4A3IJ 4FCYA 5F0CA 2NVQJ 2JMWA 4S0HB 4XRSA 2E2IJ 4RBOA 2JN6A 1GVDA 2JK3A 3I4NJ 5K7HA 3OSFA 3E7LA 3H0GJ 1ETXA 5IOZA 5GPCA 2MSYA 1ZGWA 1NK3P 2NVYJ 2I10A 4AC0A 5FKNA 2JJ7A 2MW8A 5E3OA 4D7NA 2HDDA 4XIDA 2M9HA 2G0EA 1X58A 4DZJA 3DEWA 1BA5A 4ABZA 2JWTA 3ZQCA 1WCMJ 5IYBJ 3HOZJ 1X2MA 4RDUA 1ETQA 2COBA 4X6AJ 1JUPA 2JA7J 1B72B 2K40A 3RQIA 3BR2A 3JREA 2H1KA 1R9TJ 4BBSJ 2FQ4A 2Y0SN 4A3DJ 4A3BJ 3Q0WA 3BTCA 1HOMA 3ZQLA 1A6IA 3W6VA 1QPIA 1GUUA 5EZHA 2VKVA 3SJMA 2ZB9A 1F36A 2DMUA 4M3GA 3JRHA 4V2FA 4A3CJ 1RETA 3FK7A 1VI0A 3SDGA 2R7ZJ 5IYDJ 3ZQGA 5M5XJ 5E3MA 5DTDA 4QSHA 2HXIA 2WV1A 4A3JJ 4BXXJ 2R92J 2EZLA 4Y7NJ 4MFEA 3Q0UA 5EGOA 2Y31A 3A01B 3BTJA 4B3AA 3LSPA 1TWGJ 2LY9A 3JRGA 4JX5A 2D5VA 1H88C 3GTQJ 4CYCB 2M34A 2QF7A 5FKOA 2PMZN 1ETYA 3JRIA 1E3OC 5EF6A 2DA7A 1ZKGA 3FKIJ 3HOYJ 3S14J 1ETKA 5EG0A 2EQRA 4GFBA 3PO2J 3S1MJ 2IBDA 1IV6A 1BL0A 2L7MP 2DMNA 3FISA 4A3FJ 2DMQA 4M3EA 2H8RA 2MG4A 1Z77A 2NS8A 1K61A 2HXOA 1JKPC 2DA2A 2L0KA 3ZQHA 4D7MA 2MGQA 2IEKA 2Y9YA 1RESA 2L9RA 2ID6A 5J1RA 2DN0A 2LTPA 1G2HA 1H89C 3C2BA 5FJ8J 1FIPA 4IEJA 5M5YJ 4QTRA 2DTZA 2VPRA 4XRMA 1MSFC 2DA5A 1ENHA 3G1MA 1Q1VA 1BW6A 2XPWA 4MLOA 2XGEA 3A03A 1MBEA 4JYKA 5HODA 1IG7A 3B6CA 5M3MJ 1SFOJ 5M3FJ 2HOAA 3JRDA 5IP7J 4UUSB 3BG5A 3F0CA 2GM4A 1YRNB 2TRTA 5EYRA 2DMTA 1TWHJ 2R5YB 2K9NA 3JRFA 2XSDC 3BR6A 2DA6A 3WHBA 1I6HJ 4FE7A 1ZR2A 1MSEC 2RAEA 3QPSA 2CQXA 2Y2ZA 1IUFA 3HBLA 3S17J 3MN2A 2LD5A 5BNGA 4D5FA 1JGGA 2ME0A 5F08A 2TCTA 3NAUA 1Z0XA 3UKGA 1HLVA 1FIAA 3G1OA 1MBKA 3GTGJ 3S16J 1JTYA 1IGNA 1ZK8A 1W0UA 1HDPA 2GBYA 4BY1J 1APLC 4A93J 3RZOJ 4V2GA 4A3EJ 4A69C 2EZIA 1S7EA 2LLKA 3BG3A 1MBGA 2KT0A 3CCYA 2YS9A 3FK6A 3D1NI 5EG0B 5IP9J 4B1RA 1TWCJ 2LP0A 3G1LA 3LSGA 1OJLA 3GTJJ 2CUFA 1JJ6C 1AKHB 2E2HJ 3HKZN 1HF0A 1POGA 1XG1A 4CYCA 4AUXA 3HGGA 2DJNA 4IHVA 5FKMA 4A3GJ 2CJJA 1FJLA 3S2HJ 1Y1VJ 2M2EA 5EGOB 3S1QJ 4QIWN 2N8GA 4A3LJ 5K7FA 2O9LA 2XPVA 1OFCX 3BTLA 1W0TA 4J19A 3HOWJ 3M4OJ 3BR0A 3BTIA 4XK4A 1MNMC 1HCRA 3BR5A 1RKTA 1LE8B 3BR3A 1JT6A 1MH4A 1LFBA 4C2MJ 4JX6A 3A02A 3JR9A 2X48A 5F0FA 5EDNA 3K2AA 1XS9A 1U9NA 2XPUA 5JLWA 3B6AA 1JT0A 5F04A 1VF9A 4BBRJ 2O7OA 4AYBN 2E1OA 5GPAA 3OOUA 4DZPA 1IRZA 1QVTA 1ZR4A 1ORKA 2EZHA 4XICA 1JUMA 1GV2A 3VPRA 3QQAA 5F27A 3IH4A 1B72A 1B8IB 5F1JA 5GP9A 1O4XA 2HYJA 2LK2A 2DMPA 3S1RJ 2Y9ZA 4C3HJ 4LOCA 1NTCA 1WH7A 3CDLA 1ETVA 1CQTA 1ZTRA 4I76A 3SFIA 3ZOBA 1JUSA 4BY7J 3JRAA 2LR8A 3HGYA 1XC5A 1JKQC 3LOCA 3DCFA 2FJ1A 1AKHA 3OIOA 2M8GX 2QCOA 3JRBA 4XRSG 2FD5A 5JLXA 2NVTJ 1MBFA 3WHCA 5C44J 5M5WJ 2NS7A 3GTKJ 2VI6A 4MO7A 1TC3C 2K9SA 3IV5A 2R5ZB 2HQ5A 2LVSA 4G12A 3LSRA 4X1EA 4DYRA 2AHQA 2XGDA 3BQZA 1B8IA 3S1NJ 1IJWC 3BQYA 3M3YJ 2R0QC 5C4JJ 2YU9J 3A01A 1DU6A 1U78A 3GTMJ 1ITYA 2L7ZA 3QPLA 5J1UA 3NARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG9 A;  1JJ8 C;  3IH3 A;  1FTT A;  2E2J J;  2P81 A;  1HDD C;  1ETO A;  3PO3 J;  2HI3 A;  1RR7 A;  1TWA J;  2DA3 A;  4DW6 A;  2HOS A;  3HOX J;  3H3V K;  1I50 J;  5FKL A;  3IH2 A;  2FX0 A;  2AO9 A;  2R5Y A;  2OPT A;  1WI3 A;  2VUM J;  4B4C A;  4MIM A;  1UMQ A;  3RZD J;  1PUF A;  3Q0V A;  1QVU A;  2OF7 A;  2NOG A;  3O8H A;  2EZK A;  4FTH A;  3OSG A;  3TP3 A;  2DA4 A;  2K9Q A;  4DYC A;  3Q3S A;  2DA1 A;  1SAN A;  2ME6 A;  3ZQF A;  2X9D A;  1T56 A;  1UG2 A;  1WGX A;  1WPK A;  3RKQ A;  2JA8 J;  5DS9 A;  1LFU P;  1IDZ A;  2XB5 A;  1A5J A;  2R93 J;  1BJZ A;  2YUS A;  1JTX A;  2X6O A;  4C3J J;  2WB1 N;  1MH3 A;  2M0C A;  4D5C A;  3FIW A;  1OCP A;  1IC8 A;  4C3I J;  1ZQ3 P;  4M3B A;  5IP6 A;  5FKK A;  2R5Z A;  1OCT C;  2CQQ A;  2L7F P;  1GT0 C;  4L5E A;  4DYQ A;  2B63 J;  5C3E J;  2LFB A;  3MVP A;  5K7Z A;  3S2D J;  4M6V A;  1U9O A;  3HM5 A;  2O8K A;  3HOV J;  2LKX A;  4FIS A;  3CQZ J;  4W97 A;  2E19 A;  3MKL A;  4MFD A;  3PM1 A;  4FE4 A;  1BW5 A;  2XGC A;  3HB9 A;  3HDD A;  3K7A J;  1NK2 P;  1GV5 A;  2WAQ N;  1P7I A;  5F0H A;  4IHY A;  2JA5 J;  2EH3 A;  3BT9 A;  1MBJ A;  4Y52 J;  5C4X J;  2GLO A;  5J3L A;  3I4M J;  4A3K J;  2EBI A;  5FLV A;  4M3F A;  2XB0 X;  3GTP J;  1H8A C;  2ECB A;  5EEA A;  1JKO C;  1ETW A;  4I6Z A;  3GTL J;  3LNQ A;  2VKE A;  1GDT A;  1MBH A;  4JP0 A;  4IHW A;  5J1Y A;  2ELK A;  2NVX J;  1Y1W J;  1IDY A;  5FLM J;  3TED A;  2XRL A;  5IYC J;  2ID3 A;  3TW7 A;  2CU7 A;  5IOY A;  1U8B A;  3CMY A;  1JKR C;  1RPW A;  1TWF J;  4UUS A;  1RKW A;  1AU7 A;  4EEF G;  1PUF B;  1T33 A;  3TP0 A;  2Y30 A;  3HOU J;  4HNV A;  3HEF A;  1FEX A;  1DU0 A;  1FTZ A;  1VND A;  1F43 A;  1QRY A;  1AHD P;  3O8G A;  1YRN A;  2W48 A;  4NDL A;  4JX4 A;  1LE8 A;  1WH5 A;  3JRC A;  1EF4 A;  4M3D A;  4UUT A;  3LSJ A;  2CUE A;  1UHS A;  3BR1 A;  4W1U A;  3GBG A;  1I3Q J;  5IPA A;  4A3M J;  1D5Y A;  3GTO J;  3L1P A;  2JA6 J;  2KDZ A;  1P7J A;  1X2N A;  2CRG A;  2ECC A;  5E3N A;  4IHX A;  2HOT A;  9ANT A;  3S15 J;  3TW6 A;  3ZQI A;  5E3L A;  1VFC A;  1K83 J;  2IAI A;  4BKX A;  5EZG A;  4A3I J;  4FCY A;  5F0C A;  2NVQ J;  2JMW A;  4S0H B;  4XRS A;  2E2I J;  4RBO A;  2JN6 A;  1GVD A;  2JK3 A;  3I4N J;  5K7H A;  3OSF A;  3E7L A;  3H0G J;  1ETX A;  5IOZ A;  5GPC A;  2MSY A;  1ZGW A;  1NK3 P;  2NVY J;  2I10 A;  4AC0 A;  5FKN A;  2JJ7 A;  2MW8 A;  5E3O A;  4D7N A;  2HDD A;  4XID A;  2M9H A;  2G0E A;  1X58 A;  4DZJ A;  3DEW A;  1BA5 A;  4ABZ A;  2JWT A;  3ZQC A;  1WCM J;  5IYB J;  3HOZ J;  1X2M A;  4RDU A;  1ETQ A;  2COB A;  4X6A J;  1JUP A;  2JA7 J;  1B72 B;  2K40 A;  3RQI A;  3BR2 A;  3JRE A;  2H1K A;  1R9T J;  4BBS J;  2FQ4 A;  2Y0S N;  4A3D J;  4A3B J;  3Q0W A;  3BTC A;  1HOM A;  3ZQL A;  1A6I A;  3W6V A;  1QPI A;  1GUU A;  5EZH A;  2VKV A;  3SJM A;  2ZB9 A;  1F36 A;  2DMU A;  4M3G A;  3JRH A;  4V2F A;  4A3C J;  1RET A;  3FK7 A;  1VI0 A;  3SDG A;  2R7Z J;  5IYD J;  3ZQG A;  5M5X J;  5E3M A;  5DTD A;  4QSH A;  2HXI A;  2WV1 A;  4A3J J;  4BXX J;  2R92 J;  2EZL A;  4Y7N J;  4MFE A;  3Q0U A;  5EGO A;  2Y31 A;  3A01 B;  3BTJ A;  4B3A A;  3LSP A;  1TWG J;  2LY9 A;  3JRG A;  4JX5 A;  2D5V A;  1H88 C;  3GTQ J;  4CYC B;  2M34 A;  2QF7 A;  5FKO A;  2PMZ N;  1ETY A;  3JRI A;  1E3O C;  5EF6 A;  2DA7 A;  1ZKG A;  3FKI J;  3HOY J;  3S14 J;  1ETK A;  5EG0 A;  2EQR A;  4GFB A;  3PO2 J;  3S1M J;  2IBD A;  1IV6 A;  1BL0 A;  2L7M P;  2DMN A;  3FIS A;  4A3F J;  2DMQ A;  4M3E A;  2H8R A;  2MG4 A;  1Z77 A;  2NS8 A;  1K61 A;  2HXO A;  1JKP C;  2DA2 A;  2L0K A;  3ZQH A;  4D7M A;  2MGQ A;  2IEK A;  2Y9Y A;  1RES A;  2L9R A;  2ID6 A;  5J1R A;  2DN0 A;  2LTP A;  1G2H A;  1H89 C;  3C2B A;  5FJ8 J;  1FIP A;  4IEJ A;  5M5Y J;  4QTR A;  2DTZ A;  2VPR A;  4XRM A;  1MSF C;  2DA5 A;  1ENH A;  3G1M A;  1Q1V A;  1BW6 A;  2XPW A;  4MLO A;  2XGE A;  3A03 A;  1MBE A;  4JYK A;  5HOD A;  1IG7 A;  3B6C A;  5M3M J;  1SFO J;  5M3F J;  2HOA A;  3JRD A;  5IP7 J;  4UUS B;  3BG5 A;  3F0C A;  2GM4 A;  1YRN B;  2TRT A;  5EYR A;  2DMT A;  1TWH J;  2R5Y B;  2K9N A;  3JRF A;  2XSD C;  3BR6 A;  2DA6 A;  3WHB A;  1I6H J;  4FE7 A;  1ZR2 A;  1MSE C;  2RAE A;  3QPS A;  2CQX A;  2Y2Z A;  1IUF A;  3HBL A;  3S17 J;  3MN2 A;  2LD5 A;  5BNG A;  4D5F A;  1JGG A;  2ME0 A;  5F08 A;  2TCT A;  3NAU A;  1Z0X A;  3UKG A;  1HLV A;  1FIA A;  3G1O A;  1MBK A;  3GTG J;  3S16 J;  1JTY A;  1IGN A;  1ZK8 A;  1W0U A;  1HDP A;  2GBY A;  4BY1 J;  1APL C;  4A93 J;  3RZO J;  4V2G A;  4A3E J;  4A69 C;  2EZI A;  1S7E A;  2LLK A;  3BG3 A;  1MBG A;  2KT0 A;  3CCY A;  2YS9 A;  3FK6 A;  3D1N I;  5EG0 B;  5IP9 J;  4B1R A;  1TWC J;  2LP0 A;  3G1L A;  3LSG A;  1OJL A;  3GTJ J;  2CUF A;  1JJ6 C;  1AKH B;  2E2H J;  3HKZ N;  1HF0 A;  1POG A;  1XG1 A;  4CYC A;  4AUX A;  3HGG A;  2DJN A;  4IHV A;  5FKM A;  4A3G J;  2CJJ A;  1FJL A;  3S2H J;  1Y1V J;  2M2E A;  5EGO B;  3S1Q J;  4QIW N;  2N8G A;  4A3L J;  5K7F A;  2O9L A;  2XPV A;  1OFC X;  3BTL A;  1W0T A;  4J19 A;  3HOW J;  3M4O J;  3BR0 A;  3BTI A;  4XK4 A;  1MNM C;  1HCR A;  3BR5 A;  1RKT A;  1LE8 B;  3BR3 A;  1JT6 A;  1MH4 A;  1LFB A;  4C2M J;  4JX6 A;  3A02 A;  3JR9 A;  2X48 A;  5F0F A;  5EDN A;  3K2A A;  1XS9 A;  1U9N A;  2XPU A;  5JLW A;  3B6A A;  1JT0 A;  5F04 A;  1VF9 A;  4BBR J;  2O7O A;  4AYB N;  2E1O A;  5GPA A;  3OOU A;  4DZP A;  1IRZ A;  1QVT A;  1ZR4 A;  1ORK A;  2EZH A;  4XIC A;  1JUM A;  1GV2 A;  3VPR A;  3QQA A;  5F27 A;  3IH4 A;  1B72 A;  1B8I B;  5F1J A;  5GP9 A;  1O4X A;  2HYJ A;  2LK2 A;  2DMP A;  3S1R J;  2Y9Z A;  4C3H J;  4LOC A;  1NTC A;  1WH7 A;  3CDL A;  1ETV A;  1CQT A;  1ZTR A;  4I76 A;  3SFI A;  3ZOB A;  1JUS A;  4BY7 J;  3JRA A;  2LR8 A;  3HGY A;  1XC5 A;  1JKQ C;  3LOC A;  3DCF A;  2FJ1 A;  1AKH A;  3OIO A;  2M8G X;  2QCO A;  3JRB A;  4XRS G;  2FD5 A;  5JLX A;  2NVT J;  1MBF A;  3WHC A;  5C44 J;  5M5W J;  2NS7 A;  3GTK J;  2VI6 A;  4MO7 A;  1TC3 C;  2K9S A;  3IV5 A;  2R5Z B;  2HQ5 A;  2LVS A;  4G12 A;  3LSR A;  4X1E A;  4DYR A;  2AHQ A;  2XGD A;  3BQZ A;  1B8I A;  3S1N J;  1IJW C;  3BQY A;  3M3Y J;  2R0Q C;  5C4J J;  2YU9 J;  3A01 A;  1DU6 A;  1U78 A;  3GTM J;  1ITY A;  2L7Z A;  3QPL A;  5J1U A;  3NAR A; 
#chains in the Genus database with same CATH topology
 3BG9 A;  3PSF A;  1W4M A;  1FTT A;  2P81 A;  3L2V A;  4DBR A;  1ETO A;  4PJM A;  1DUX C;  2CW0 F;  4LIU A;  2WY8 Q;  2HI3 A;  4BAY A;  1YI2 I;  1TWA J;  3FXQ A;  1A04 A;  3GO5 A;  1I50 J;  2R5Y A;  4HNU A;  2OPT A;  5CLS A;  3LA7 A;  4XRF A;  5DD8 A;  3NWT A;  3R60 A;  5B5E C;  1G59 A;  3O8H A;  4RB3 C;  2FOK A;  3TP3 A;  1YX5 A;  3A0H C;  1JHF A;  2CWE A;  2K9Q A;  2DQR A;  3Q3S A;  1W36 D;  2ME6 A;  2PFB A;  4S05 A;  3BJ6 A;  3CLQ A;  3EUK L;  3KP4 A;  3CO7 C;  2P7V B;  2KFD A;  2JA8 J;  1VQK I;  1D3Y A;  1LFU P;  1IDZ A;  2XB5 A;  3H5N A;  4CCN A;  1BJZ A;  2X6O A;  3KZZ A;  1R1U A;  3J7Z I;  3KX2 A;  1MH3 A;  1T39 A;  1IC8 A;  1OCP A;  3I0T A;  3TBI A;  1OCT C;  1TW3 A;  5FKK A;  5J4V A;  2L7F P;  4OU0 A;  1JXS A;  2B63 J;  5K1Y A;  2X1E A;  1OCO H;  4RAZ A;  1U9O A;  2DFE A;  3L2U A;  1VQ6 I;  1X4O A;  2LY2 A;  3CQZ J;  2ZME B;  3CUQ C;  4CZZ A;  4W97 A;  1O7F A;  3MZY A;  3PM1 A;  4J01 A;  1OMI A;  1V4R A;  4GXO A;  2XGC A;  4ZTF A;  3PQJ A;  3MWM A;  3NWS A;  1O3S A;  1NK2 P;  1GV5 A;  1U6G A;  5HS7 A;  1WZ2 A;  5E18 F;  2CW8 A;  4IOA F;  4WK8 F;  4IHY A;  2JA2 A;  3GEZ A;  4II3 A;  1TNT A;  3RJP A;  5ILV A;  5J40 A;  2IA1 A;  2W25 A;  5J3L A;  2E34 A;  1ZEL A;  5FLV A;  1E0E A;  2A6E F;  2XB0 X;  3G6E I;  1H8A C;  3E6D A;  2Z2S B;  3D0S A;  4A0X A;  4I6Z A;  3LNQ A;  3GTL J;  2WV0 A;  2YPR A;  3LL7 A;  1X1D A;  3CDI A;  4UV9 A;  5GAE J;  5D5U B;  2VXD A;  1VQM I;  1SAU A;  5J1Y A;  1BIA A;  1Y1W J;  2NVX J;  5FLM J;  1KZH A;  2V6C A;  3C1D A;  3HJE A;  1KU3 A;  2CS3 A;  2ID3 A;  2M87 A;  2V79 A;  3H5A A;  2Y0S A;  4CYD A;  5IOY A;  3GLL A;  4AYB A;  1T38 A;  4EEF G;  1D1A A;  1JHH A;  2BEO A;  3DPL C;  4F52 A;  4KA4 A;  1WJ5 A;  3WTU C;  1SD4 A;  3HEF A;  1AHD P;  3O8G A;  3C2H A;  2W48 A;  4NDL A;  3SXY A;  4N9H A;  2ZC2 A;  5D6F A;  2EFO A;  3H9Q A;  3JRC A;  1CF7 A;  2ZSH B;  1S8N A;  1VQ5 I;  4ESF A;  3GBG A;  3GTO J;  5BQT A;  2FEZ A;  3L1P A;  1KU2 A;  2JA6 J;  1P9Q C;  4M73 A;  5CVV A;  1D0Y A;  5A2Q K;  4UXN A;  4AVZ A;  3S15 J;  2PQ8 A;  3JSO A;  2R7V A;  1F1Z A;  3QU3 A;  3TDU C;  3FKJ A;  2M4K A;  2AQE A;  3AG2 H;  3OIQ A;  4GO1 A;  5E3L A;  3J80 K;  1VFC A;  1K83 J;  5BPD A;  3FXM A;  2PMU A;  3I58 A;  3M8J A;  2P5V A;  4D1Q A;  1D0Z A;  4ETS A;  3GFM A;  4XRS A;  2E2I J;  4E7S A;  1GVD A;  2XF5 A;  1B9M A;  2B0L A;  3H0G J;  1ETX A;  3QPT A;  2NVY J;  1WI9 A;  1Z1D A;  4AC0 A;  1WFX A;  2WWY A;  4O5V A;  2J5P A;  5KCM A;  2V1U A;  1LVK A;  1FOY A;  1S6L A;  1XMX A;  5DCM B;  2DOD A;  4D7N A;  1XSX A;  4U0Y A;  4YFX F;  3H0D A;  3PSI A;  5IYB J;  3F21 A;  4GGG A;  3CC2 I;  2LRD A;  3HOZ J;  3GX4 X;  4HQE A;  2ZNZ A;  1ETQ A;  3KZI C;  4X6A J;  1JUP A;  2MAB A;  2OC6 A;  2LNB A;  5FFZ A;  3JRE A;  2H1K A;  4G94 A;  5HS8 A;  1QPM A;  1R9T J;  1TQM A;  2FQ4 A;  2Y75 A;  2F48 A;  2GWR A;  2K85 A;  4M9S A;  1R00 A;  1J75 A;  3E5X A;  4MQV A;  2L9S A;  3KEQ A;  3KEO A;  3HL2 A;  2IRF G;  1GUU A;  2XAH A;  3SJM A;  4EMS A;  3MZ8 A;  2OZU A;  3KET A;  1F36 A;  3PUB A;  1G4D A;  3JRH A;  1NHA A;  1B1B A;  2CQN A;  2DFI A;  1R1V A;  1XPX A;  1G3W A;  4EVI A;  1B4A A;  1YFH A;  5E3M A;  4QSH A;  2WY7 Q;  1YE9 A;  1D5V A;  2ICW G;  1YOV B;  1HW2 A;  3QU6 A;  3Q0U A;  2VQL A;  2GIV A;  2H94 A;  3BG6 A;  3QOD A;  3W2W A;  2LY9 A;  2VC1 A;  3ML6 A;  2JVH A;  3GTQ J;  4CYC B;  1G3Y A;  5TGT A;  5LHH A;  2DA7 A;  3CCL I;  3W2V A;  1ZKG A;  3REO A;  4AID A;  2QZ8 A;  1ETK A;  5EG0 A;  1XX5 A;  1IO2 A;  3ABT A;  4GFB A;  3CES A;  3G4S I;  3FMS A;  1ZAR A;  2L7M P;  4MTE A;  2K9M A;  3SHF A;  4A3F J;  2LG4 A;  3ZGK A;  2H6C A;  1K61 A;  3F9K A;  1PVE A;  3CC7 I;  1CGP A;  2EA2 A;  3M07 A;  1A36 A;  4ZTJ A;  2YX4 A;  1W7P D;  3AG1 H;  3QOE A;  1XDU A;  2V1N A;  2V1D A;  4AWX B;  3CO6 C;  1FMV A;  3C2B A;  5FJ8 J;  2KZG A;  2M45 A;  2JUC A;  1KGS A;  2OQR A;  2XKO A;  3SEQ A;  2DTZ A;  2VPR A;  2XV4 S;  2M0M A;  3CCS I;  1DGR M;  2M8E A;  1Q1V A;  2W57 A;  1GVJ A;  4MLO A;  3SDB A;  4I98 B;  3OY9 A;  1TNS A;  5HOD A;  2KRC A;  3B6C A;  1YW7 A;  5J4Y A;  3T8R A;  3JTG A;  2DT6 A;  3FHZ A;  5AIP A;  1DGW Y;  3BG5 A;  3F0C A;  2GM4 A;  3CCU I;  5JR3 A;  2BY3 A;  5CVJ A;  2DCE A;  4Y3O A;  4UHT A;  3OR2 C;  1YS7 A;  2EIM H;  3QYB A;  4CSW A;  3KP6 A;  2RVC A;  1YJN I;  1R22 A;  1IW7 F;  2XSD C;  2R7F A;  2P4W A;  1Z3X A;  2KQR A;  2EPF A;  3COA C;  3R0A A;  2RAE A;  3ZMS A;  1WJE A;  3DTK A;  2ISY A;  2CQX A;  3DV8 A;  4LJZ F;  3WTW C;  3RI4 A;  3A2K A;  4PJL A;  1FOW A;  1BI1 A;  3DKX A;  2WAE A;  2EJR A;  4RM3 A;  5H2F C;  5BNG A;  2G7U A;  2XAF A;  2VOD A;  5D8L B;  3DP7 A;  1JGG A;  2L9V A;  2ME0 A;  5F08 A;  3WTX C;  1X4P A;  5LHG A;  1Z0X A;  4YIR X;  1R71 A;  5D6E A;  2DT7 B;  3HSF A;  3FXL A;  3PFY A;  2R7S A;  1PYV A;  1O57 A;  2ZME A;  3HOS A;  2G9W A;  3S16 J;  1JTY A;  1IGN A;  1ZK8 A;  4OIR F;  2CV0 A;  4GDF A;  2GOX B;  1HDP A;  4BY1 J;  2LSO A;  5FFX A;  2LLK A;  2JSP A;  4ZC3 A;  4KIG A;  5K5Q A;  4F3Q A;  5BOX A;  1TLH B;  2DAO A;  2KT0 A;  1FLI A;  3DPT A;  2YS9 A;  3IL2 A;  1P4X A;  5DYM A;  4L9J A;  4G7H F;  1IV8 A;  3VSL A;  2LP0 A;  3G1L A;  3RKX A;  1STZ A;  1EH6 A;  2HZT A;  3S93 A;  2LC2 A;  4I09 A;  1H0M A;  1HF0 A;  3O3K A;  4HX8 A;  1POG A;  1YYV A;  4RMN A;  3EDP A;  4AUX A;  2CYY A;  4E7L A;  1FP2 A;  5FKM A;  4NBQ A;  1O7L A;  2KIM A;  2HDW A;  3VYU B;  3T0Y A;  1PJR A;  5EGO B;  4QIW N;  3WE2 A;  1WKM A;  3H3U A;  4BYY A;  1ZHF A;  2W1O A;  3FXJ A;  1X3Z B;  1QBJ A;  3AG3 H;  5JI6 A;  4J19 A;  5L3G A;  1SAX A;  2M1B A;  3AL0 C;  1LE8 B;  1ZGA A;  2BVM A;  1MGT A;  1MH4 A;  2QQ9 A;  4A5N A;  1LFB A;  2MH9 A;  2KLO A;  4JX6 A;  3A02 A;  3JAM Z;  4L5I A;  1SVL A;  3M9A A;  4AU7 A;  5F0F A;  2FQ3 A;  1NG6 A;  3S3N A;  1QO0 D;  2A05 A;  3B73 A;  3RKY A;  4BDZ A;  2STW A;  3I71 A;  3HTU A;  3WOD F;  5J8F A;  5LGT A;  1QNT A;  3LA2 A;  2HVQ A;  3I54 A;  5GPA A;  4BE2 A;  2O61 A;  1IRZ A;  1MMN A;  1N78 A;  1KQ9 A;  3DTI A;  3GXO A;  3K1N A;  4HX7 A;  2HTS A;  4AD9 A;  2A5W A;  2L7K A;  4E7H A;  1GV2 A;  4L9T A;  3QQA A;  5F27 A;  3IH4 A;  1OCR H;  4HDV A;  5GP9 A;  2O0Y A;  4IVN A;  2P6T A;  3S1R J;  2I8D A;  1B59 A;  3HRM A;  2BYV E;  4XN0 A;  2XKP A;  2D1V A;  2VJ5 A;  1BN5 A;  2M30 A;  1ETV A;  3V42 A;  1XSV A;  3GFI A;  3HC7 A;  4BY7 J;  1HW5 A;  2P8T A;  5CVR A;  3JRA A;  4I2O A;  1IXR C;  3E0J B;  4G6Q A;  4N9I A;  4LB6 B;  1JKQ C;  1VQ4 I;  2M8G X;  2ZME C;  2KRH A;  3CUQ B;  1QU3 A;  3JRB A;  4PFP A;  4XRS G;  1TTY A;  2XDV A;  2NVT J;  2R7Q A;  1MBF A;  2CGP A;  3J81 K;  1PDN C;  2VOO A;  3DF8 A;  3WHC A;  3BZ6 A;  3M1E A;  3A4C A;  4NQW B;  1FMW A;  3HTS B;  2K9S A;  3RIR A;  4G12 A;  2ADU A;  3LSR A;  4RS8 A;  3S1N J;  3K4B A;  5DUI A;  1HSJ A;  2PJP A;  3IHU A;  5C4J J;  2R0Q C;  1T98 A;  1DU6 A;  2VBX A;  3LA3 A;  1U78 A;  3GTM J;  1J09 A;  2DW4 A;  4S04 A;  3FM5 A;  2L7Z A;  3QPL A;  4RLF A;  2HGC A;  2E7W A;  3OYI A;  1E17 A;  3M7G A;  5J1U A;  2UUZ A;  4EGZ A;  1JJ8 C;  3IH3 A;  3IKV A;  5EEG A;  3WGI A;  1HDD C;  2DXI A;  3ULQ B;  2NS0 A;  4BJ6 C;  2DA3 A;  2HOS A;  4XLP F;  3KCC A;  1XMA A;  3PFI A;  1SFK A;  3CP8 A;  3PNY A;  4ITV A;  4IX7 A;  3H3V K;  1W5T A;  5FKL A;  1XGS A;  2COM A;  4XN3 A;  4HEA 2;  2FX0 A;  3KYL A;  2AO9 A;  3RPQ A;  3KLO A;  3TO9 A;  3K4J A;  3IWF A;  1IZ1 A;  1L0O C;  2VUM J;  1S3J A;  2ZJ2 A;  3PNV A;  1Y56 A;  1K78 A;  4FTH A;  2DDA A;  4HYE A;  5JHU A;  5JVT A;  5BS6 A;  1VQN I;  1BR1 A;  4B47 A;  4PGG A;  2GQQ A;  4DYC A;  3V7C A;  1Z91 A;  5F1R A;  4FT8 A;  4YFK F;  1UG2 A;  1WGX A;  1BJA A;  2I5U A;  2X51 A;  4I99 C;  3GLX A;  1T0F C;  1MW7 A;  5DS9 A;  3IRQ A;  3CF5 F;  2R93 J;  1JTX A;  3DKW A;  3K69 A;  2Q2E B;  1TL8 A;  1FY7 A;  2NYX A;  4CXF A;  3EYI A;  3CCQ I;  4LLG F;  4D0P A;  1ERD A;  1B6A A;  2OTL I;  2PLY A;  4I01 A;  3GCM A;  3CCE I;  1EH7 A;  2M0C A;  4RM2 A;  1FNN A;  4BL0 B;  5GTH C;  5IP6 A;  2AXT C;  3IWZ A;  5ILS A;  1GT0 C;  4DYQ A;  3E6M A;  2KHM A;  4BNC A;  2P6S A;  5K7Z A;  3JW4 A;  2E5Z A;  4A0Z A;  2LKX A;  5F64 A;  3H9G A;  5E8I A;  4FIS A;  1VQO I;  2X85 A;  1LKX A;  3JSP A;  4FE4 A;  1MNE A;  3GWZ A;  2EIN H;  5LRS A;  2DOA A;  2EWN A;  2BY1 A;  3WGG A;  1AWC A;  1FZP B;  2GZW A;  4Y52 J;  1WQ2 A;  4PZJ A;  2UXX A;  2GLO A;  1V5F A;  5ICF A;  4A6D A;  4O3M A;  4HF0 A;  1WJB A;  4F92 B;  4LMY A;  5HNF A;  5EEA A;  1ETW A;  2M4G A;  3F6O A;  3MD2 A;  1GDT A;  1ON2 A;  1ZGJ A;  1E3P A;  2FML A;  2K9L A;  4JP0 A;  4IHW A;  4BGD A;  3LST A;  3CMA I;  5HDN A;  3IKT A;  2AQF A;  1IDY A;  4WXD A;  2XRL A;  2EB7 A;  1XN7 A;  2VQH A;  4BDY A;  1RKW A;  2CQK A;  3SZP A;  2ISZ A;  2HQA A;  1PUF B;  5IY5 H;  3TP0 A;  2Y30 A;  4ZH4 F;  3LSK A;  4MHG A;  4R1H A;  3OWT A;  1FEX A;  1IN5 A;  2OUM A;  1QRY A;  1PUE E;  3GZ6 A;  3E5U A;  1YRN A;  4JX4 A;  4A2U A;  2OV7 A;  1LE8 A;  1H9G A;  2YU3 A;  3HKZ A;  4BS9 A;  3GFJ A;  4L18 B;  2LYC A;  2FXA A;  4M3D A;  3MKY B;  1EF4 A;  3AFH A;  1LDD A;  1EV7 A;  1T0F A;  1UHS A;  2CUE A;  3K0L A;  1UJ8 A;  4W1U A;  4ENJ A;  1FOK A;  5E20 A;  4HPQ A;  3GF2 A;  4YG2 F;  2MD0 A;  4IXA A;  2XGX A;  3Q5F A;  2QQB A;  4XMY A;  2RN7 A;  1P7J A;  2M5W A;  4JQF A;  2EFQ A;  1YS6 A;  1X2N A;  2MBF A;  3DU5 A;  2HOT A;  4NC6 A;  2LKP A;  3CD6 I;  5IT3 A;  3QAH A;  2GOM A;  2BE5 F;  3DBL B;  2KPM A;  3FMQ A;  4P55 A;  1DDN A;  2K5C A;  2FNP A;  1S7A A;  4PJN A;  5F0C A;  5IT9 K;  1SEU A;  3K10 A;  1OKR A;  2OBP A;  3RDI A;  4RBO A;  2VE9 A;  1FSH A;  2F4I A;  1I3A A;  2KDO A;  3E7L A;  4PSX A;  5D5W B;  3BCA A;  5J8C A;  2MSY A;  3IRR A;  2EIL H;  1V3F A;  3R4K A;  2MW8 A;  1I1G A;  2EIJ H;  2M9H A;  4FET A;  2PJR B;  2YX7 A;  1FWZ A;  2DYS H;  3VB2 A;  5ERI A;  5CVU A;  3HSR A;  4ZZL A;  4RDU A;  2GXA A;  3OYA A;  2COB A;  3DXJ F;  2DYR H;  3TOA A;  2K40 A;  1REP C;  2L4A A;  3LSM A;  1X3W B;  3OL3 A;  3FF5 A;  3Q9V A;  4CCL A;  3GUD A;  2Z3Y A;  3Q0W A;  1HOM A;  1D1C A;  3ABL H;  1VQ9 I;  2BVL A;  5E1W A;  2P7C B;  2RKH A;  2QYO A;  3W6V A;  3DEU A;  1ZLK A;  5EZH A;  2RRE A;  2X1C A;  3HZJ A;  2E7X A;  5DM6 F;  2R4G A;  4CCM A;  2R7R A;  3PQK A;  5FRM A;  1K6Y A;  1BBY A;  4BE1 A;  4A3C J;  4KYW A;  2K4J A;  1P4A A;  1VI0 A;  4U0W A;  3G71 I;  4A0Y A;  2W7N A;  4JOM A;  2ZXW H;  4LLN A;  2O5R A;  5KVR A;  2WB1 A;  4A3J J;  3KIO A;  1MDM B;  2NOJ B;  3LSI A;  1UG0 A;  2VKD A;  1X1B A;  4UB8 C;  2Q0O A;  1LUJ B;  4B3A A;  1TWG J;  4JK1 X;  4JX5 A;  1H88 C;  3EUH C;  3H5R A;  3K4N A;  5HLT A;  2G7H A;  1JI8 A;  4QLC U;  1RI7 A;  2HU9 A;  1OYW A;  2NXN B;  3MEX A;  1SFX A;  4CCK A;  3E6C C;  5BPI A;  3P7N A;  2HVR A;  3E6B A;  3BDD A;  4HLX A;  3TMO A;  2VJ4 A;  3S1M J;  1Z7L A;  2FRH A;  1LNW A;  2VXZ A;  3F8B A;  4XOR A;  2KKO A;  3WTV C;  1JGS A;  3KP5 A;  3KP7 A;  3MCZ A;  4UVB A;  4YII A;  2QWW A;  3FIS A;  2GXG A;  3WTY C;  4ANJ A;  1A35 A;  3ABK H;  1FBU A;  3VSK A;  3OYB A;  2VBY A;  1JKP C;  1ZRC A;  2QEN A;  2DA2 A;  4HRI A;  2IEK A;  1QQI A;  1RES A;  4M74 A;  4V19 K;  3OS2 A;  1ZRD A;  3WE3 A;  5J1R A;  2MLG A;  2FA5 A;  3O6B B;  3VDX A;  5L3D A;  1H89 C;  1KU9 A;  3CZ6 A;  2CMP A;  2VKH A;  3LAJ A;  3ZXS A;  1MMD A;  2CQ7 A;  1ZRE A;  4QTR A;  4IL6 C;  1YO5 C;  3IAS 2;  3OMY A;  4XRM A;  1ENH A;  2V9V A;  5LEJ A;  3G1M A;  2L4M A;  4BHC A;  1K78 B;  2K02 A;  2L01 A;  2PI0 A;  2K4B A;  2QSG X;  1MBE A;  4JYK A;  4MTD A;  1ZRF A;  5M3F J;  5IP7 J;  2BHZ A;  4N0B A;  1V54 H;  5KHD A;  3KPH A;  5H6Q A;  1V5G A;  1R36 A;  2TRT A;  4OIQ F;  4M72 A;  1ZG5 A;  2E1M B;  2ZSI B;  1K79 A;  5KAF C;  3JRF A;  4FHT A;  5CPR B;  1I6H J;  3E1S A;  5FRN A;  2HPI A;  1SVO A;  1YW9 A;  1BR4 A;  2L9N A;  1S72 I;  4IRI A;  3S17 J;  2QA4 I;  4HLY A;  3MN2 A;  1GLN A;  1Z7U A;  4HOB A;  2Y48 A;  4CIC A;  2LD5 A;  3VEP A;  3HYI A;  1IUY A;  3P5J A;  4L9N A;  2KIQ A;  3UKG A;  1FIA A;  4II2 A;  5ICC A;  2OAZ A;  3OYH A;  2VBZ A;  1T95 A;  2WAF A;  3HSE A;  4ZJZ A;  2IT0 A;  5K5R A;  4DGW B;  2R7O A;  2A6H F;  5KAI C;  4RB1 A;  4A93 J;  1WJF A;  3L00 A;  4KIF A;  4V2G A;  4A3E J;  2DFH A;  3U2R A;  2ZNY A;  1QHG A;  2Y69 H;  3CCY A;  5L3B A;  3HOT A;  3FK6 A;  3DTE A;  5ILU A;  4WWC A;  3CTA A;  2CUJ A;  1E2X A;  3CMM A;  1OJL A;  2CUF A;  4CDG A;  2E2H J;  2HFH A;  1OPC A;  2W24 A;  4HST A;  2P5K A;  3HKZ N;  2HYG D;  3CJN A;  4EM2 A;  2L54 A;  1IN8 A;  3BZK A;  1XG1 A;  2ETH A;  2DJN A;  4IHV A;  1D8K A;  1XSD A;  2QKL B;  1WVR A;  2CJJ A;  1FJL A;  3ZCO A;  3S2H J;  1Y1V J;  3PL8 A;  1K4S A;  3HRU A;  1P4W A;  3IC7 A;  4DJA A;  4OWR B;  4PDK A;  2QSF X;  1MND A;  1RRJ A;  4C2T A;  3BTL A;  2UZK A;  3E97 A;  3AAF A;  5E1Z B;  3DQV C;  3M4O J;  1K7A A;  1TQP A;  3RTR A;  4XK4 A;  1HCR A;  3BR5 A;  2GA1 A;  3WU1 B;  1JT6 A;  4C2M J;  3WGH A;  5A2Q Z;  3L2Q A;  1FYK A;  1WHU A;  2CO5 A;  5LGN A;  2X48 A;  3BY6 A;  4ON0 A;  1N25 A;  1U9N A;  5HNH A;  4RGR A;  2LY1 A;  4RB2 C;  3B6A A;  2FMY A;  1LB2 A;  1O3T A;  1JT0 A;  2W85 A;  3G3Z A;  1VTN C;  5F04 A;  1VF9 A;  3BP8 A;  2O7O A;  3OYN A;  1UFM A;  1OYY A;  2JT1 A;  4EJT A;  3KFW X;  4DZP A;  1ZR4 A;  2RQP A;  4EQQ A;  3M8F A;  4XIC A;  1FC3 A;  3VPR A;  2F2E A;  1OR7 C;  5B1A H;  2BZT A;  1B8I B;  1H9T A;  1O4X A;  2E1M C;  4M71 A;  3FMR A;  2Y9Z A;  1K6O A;  3OYC A;  4E7J A;  2RNG A;  2NVU B;  2PJR A;  4HV6 A;  1JUS A;  2KZV A;  3HGY A;  4B3X A;  2DBB A;  3S2W A;  2IS1 A;  3ASO H;  2FJ1 A;  4LFU A;  3OIO A;  2HWV A;  5CQG A;  2LBF A;  4FAS D;  1W5S A;  2VJJ A;  1G3S A;  1W7P B;  5FD6 A;  3MZH A;  3PJR A;  3BPX A;  5AON A;  5B1B H;  3TO6 A;  2V6E A;  3F8N A;  3HRT A;  3MFK A;  2ESH A;  5M5W J;  1BOA A;  2QM3 A;  4DBQ A;  5D8K B;  2UV1 A;  4MO7 A;  3S3O A;  2HQ5 A;  2VQG A;  3K1M A;  2AHQ A;  1RZ4 A;  2XGD A;  4NC8 A;  3KE2 A;  1RC9 A;  2A61 A;  4C9Y A;  4G6D A;  1MJA A;  5D4S A;  3A01 A;  1LPQ A;  4KMF A;  3DKY A;  1ITY A;  1DQU A;  2V1X A;  2NAZ A;  4KMU X;  1SMT A;  3OS0 A;  5D5X B;  2W84 A;  1XGN A;  1QGP A;  4DOZ A;  4BE0 A;  1FYM A;  2IA2 A;  5DV5 A;  3ECO A;  2IGO A;  1ULY A;  4BJ5 C;  2E2J J;  3LQR A;  1IRF A;  1GHC A;  3K6G A;  2NRA C;  2H1L A;  4BJT A;  3PO3 J;  2VBW A;  3NQO A;  5FB2 A;  2PMZ A;  2IS2 A;  1UAA A;  1D8J A;  3CCV I;  3CF2 A;  2F5D A;  4E7I A;  4R79 A;  3IH2 A;  2QBY A;  1R6R A;  3NEU A;  3RZD J;  1UMQ A;  1PUF A;  2R7T A;  4EAT A;  3ERM A;  3FM3 A;  5DEQ A;  2NOG A;  3GW2 A;  2B7E A;  4ZYE A;  2DA4 A;  2D45 A;  2DA1 A;  1SAN A;  4A12 A;  4X0G A;  1DPR A;  1Z9C A;  5L3F A;  2ACJ A;  2X9D A;  3SEZ A;  2E35 A;  5D5V B;  4RB0 A;  4BQQ A;  4F93 B;  3CCJ I;  2Z16 A;  4E7K A;  5LD2 C;  1A5J A;  4UVA A;  1S29 A;  2YUS A;  2VT2 A;  4LD5 A;  2IP2 A;  1UHW A;  4C3J J;  2WB1 N;  2IS6 A;  4IF4 A;  1ZQ3 P;  4MEX F;  1XTA A;  4M3B A;  1EJ9 A;  1KA8 A;  2BV6 A;  1KU7 A;  3TOB A;  5C3E J;  3OYF A;  1UZC A;  2LDU A;  2O8K A;  3K9T A;  1WRJ A;  3GVA A;  1K4T A;  2MH2 A;  4G9Y A;  2HQN A;  2E19 A;  3MKL A;  2OCE A;  4UVC A;  3PIO F;  1HST A;  1BW5 A;  3HB9 A;  5H20 A;  4IJA A;  3HDD A;  4BUP A;  2A5Y B;  3K7A J;  4UUV A;  2WAQ N;  1P7I A;  1N77 A;  2JA5 J;  4HF1 A;  2PX9 A;  5HVQ C;  1MBJ A;  2MYS A;  5C4X J;  2QGU A;  3I4M J;  4CO8 A;  4A3K J;  1F5T A;  2JPB A;  4M3F A;  2E5N A;  3GTP J;  2A69 F;  4UV8 A;  4HG2 A;  1JKO C;  3IUO A;  2VKE A;  1WWX A;  2R7D A;  3H92 A;  2KP6 A;  3HXL A;  1I5Z A;  3TKY A;  4IQ4 A;  3I55 I;  4MGR A;  2ELK A;  2XAG A;  2C6Y A;  3ISP A;  4XKV A;  2XUB A;  2UWM A;  2V4J C;  4IRH A;  4BHB A;  1U8B A;  1WJC A;  1GXP A;  3SQN A;  1RIO H;  2DDB A;  1MMA A;  4UUS A;  1LEA A;  1EKE A;  1OCC H;  5HS9 A;  4HDU A;  4ENK A;  1YHQ I;  4AIH A;  4EM0 B;  4HX4 A;  3HOU J;  3OYM A;  4XLN F;  3U9G A;  3BRO A;  5ED4 A;  5J6X A;  1QZE A;  1R5G A;  1DU0 A;  1VND A;  1FTZ A;  3B02 A;  1C0W A;  2P0W A;  2IXS A;  3ZN0 A;  4KIB A;  1T6S A;  2L3D A;  1I6X A;  2VQC A;  2ZXH A;  2R7X A;  2HZD A;  2HYF A;  2HQR A;  1FSE A;  3V8L A;  1Z05 A;  4RA2 A;  5LEK A;  4G7O F;  2M3A A;  3LSH A;  1E3H A;  1I3Q J;  5LFA A;  4A3M J;  1AOY A;  1KQ8 A;  1D5Y A;  4IRG A;  3J81 Z;  3ZP5 A;  2WC2 A;  5E3N A;  1D0X A;  2KIF A;  2OQG A;  2Z99 A;  3ZQI A;  1RUO A;  3S8P A;  4HAM A;  4U88 A;  2IAI A;  2X4H A;  5EZG A;  5DDG A;  1R4N B;  2PMH A;  5TIS C;  4FCY A;  4A3I J;  2Z9O A;  2NVQ J;  1XGO A;  4KIC A;  3CUO A;  4S0H B;  3KEY A;  3PIP F;  2FE3 A;  4LG0 B;  3ZQQ A;  1U0J A;  5K7H A;  1OYI A;  5F6F A;  4EJW A;  3I4N J;  3DWL E;  1ZGW A;  4I7H A;  3QRF F;  4I0A A;  1DP3 A;  3EQL F;  4XKB A;  3X2Q H;  2JJ7 A;  1O3Q A;  5E3O A;  4YFN F;  2HDD A;  1P6R A;  4XID A;  1ZH5 A;  2O8X A;  2G0E A;  1X58 A;  3OL4 A;  4RGX A;  4DZJ A;  1HC8 A;  2ESN A;  3DEW A;  1BA5 A;  5EJC A;  5DUK A;  4UB6 C;  2JWT A;  3WG7 H;  1WCM J;  3RYP A;  2DFF A;  1DP7 P;  2ELJ A;  1TT5 B;  4ENM A;  2JA7 J;  3L2R A;  1XB4 A;  4B8X A;  4BEH A;  4AIK A;  3BR2 A;  2HEO A;  5CQE A;  2XRO A;  5JVG F;  1G3T A;  4BBS J;  3ROU A;  5GAD J;  4Z2Y A;  4A3B J;  3I3L A;  3ZMT A;  3SYT A;  3ZQL A;  2XHK A;  3FX3 A;  2F4M B;  3CLO A;  1A6I A;  1X1P A;  3J7Y J;  1KYW A;  4IOC F;  2X6W A;  4EJO A;  4G6T B;  3H9J A;  2VE8 A;  2MC4 A;  2F4O B;  3ZN1 A;  3QP6 A;  1HKT A;  4QPO A;  4J00 A;  1HQC A;  4V2F A;  3SDG A;  1YIO A;  1F4K A;  3ZQG A;  2DOF A;  4KT6 A;  3RPU D;  5CVI A;  4KJZ A;  5DTD A;  2XAQ A;  4YEL A;  2EZL A;  2GA2 A;  3MQ0 A;  5GAH J;  2KJC A;  5EGO A;  2AXL A;  2FUG 2;  2Y31 A;  1WJA A;  4CCJ A;  1OQY A;  3JRG A;  3D5S C;  3FBN B;  3ERE D;  5HLH A;  1AA7 A;  2HKO A;  2O03 A;  4EGY A;  2QQA A;  3JRI A;  3CJQ B;  5EF6 A;  3ELK A;  1E3O C;  1KYZ A;  2Y0M A;  1ZYR F;  2QUF A;  3DU6 A;  3FKI J;  3JTH A;  5K5O A;  3OYL A;  3HOY J;  1S9H A;  4M9X A;  3PO2 J;  1G8X A;  4XBF A;  2OJE D;  1QA6 A;  2IBD A;  2TDX A;  2IGN A;  3S32 A;  4DNC A;  1N75 A;  2VC0 A;  3HHH A;  4NC7 A;  3VFZ A;  1G6N A;  3CC4 I;  3OYE A;  2DMN A;  1LJ9 A;  2WAD A;  4M3E A;  4CZC A;  2HTJ A;  4KIT B;  1PP7 U;  2NS8 A;  1T2K A;  2HXO A;  2JTV A;  3S3M A;  3O2P E;  2RC4 A;  2QEX I;  1W7P A;  3MAJ A;  1SD5 A;  4D7M A;  4U87 A;  3F8M A;  2L9R A;  2PEX A;  1UHM A;  4LK1 F;  4ZZD A;  4F55 A;  3K1P A;  1FIP A;  1P92 A;  4XLH A;  4IEJ A;  1BC8 C;  1ZLJ A;  2DA5 A;  5TRD A;  1UEL B;  4OIP F;  1ZN2 A;  2XPW A;  1RR8 C;  2XGE A;  3NRV A;  1Z3Y A;  2H6B A;  1IG7 A;  2VT3 A;  5KK1 A;  2HOA A;  3JRD A;  4LLL A;  4ZDP A;  3OYG A;  4UUS B;  1U5T B;  1MD0 A;  3ASN H;  1YRN B;  3I9V 2;  1R5I D;  2GXB A;  2K3F A;  1X1A A;  1TWH J;  2ZJP F;  1Z6R A;  1LFP A;  2R5Y B;  2K9N A;  1F9N A;  3BR6 A;  3H35 A;  2DA6 A;  2X1D A;  3MMY B;  3WHB A;  4FE7 A;  4I0B A;  2M7A A;  4B43 A;  3QPS A;  3CCM I;  1IUF A;  3HBL A;  3F3X A;  4KNY A;  4UY8 I;  2QSH X;  5TJJ A;  3TQN A;  2BW3 A;  2VJI A;  4D5F A;  2OU2 A;  3BC8 A;  4PGH A;  1HLV A;  3DEE A;  2EFW A;  1ONV A;  4MQ9 F;  5LHI A;  4L0Z B;  1BR2 A;  3G1O A;  3CCR I;  4OAY A;  3SZG A;  2L02 A;  2CFO A;  3UNG C;  3BWG A;  4PUS A;  4E70 A;  1Y8Q B;  2GBY A;  2J5O A;  1APL C;  2PG4 A;  4U7B A;  3RZO J;  3LWF A;  2RGV A;  2DQL A;  2F6C A;  3BG3 A;  1I27 A;  1MBG A;  1OCZ H;  2FF4 A;  2Q8K A;  1SVM A;  5EG0 B;  4B1R A;  1TWC J;  3TGN A;  2CH0 A;  3I4P A;  2PBI A;  1JJ6 C;  1AKH B;  5B3S H;  3VYR B;  2V7F A;  5D4R A;  1V5E A;  3K2Z A;  4CYC A;  2K27 A;  3F22 A;  3HGG A;  3P9C A;  3HPH A;  2Q2E A;  4LK0 F;  2M2E A;  3S1Q J;  1LDJ A;  2N8G A;  1VQ7 I;  2AS5 F;  3L2C A;  5K7F A;  4XLC A;  2O9L A;  4HA8 A;  1W0T A;  3HOW J;  2X0L A;  3C18 A;  1MNM C;  2BHY A;  4CCO A;  2L5Q A;  1RKT A;  4WCG A;  4WXH A;  1U5T A;  1YX3 A;  2XSJ C;  3BOQ A;  2CW7 A;  4IKF A;  2DOE A;  1XCV A;  3K2A A;  2JZY A;  5L3E A;  2XPU A;  5JLW A;  2O6G E;  4L0Y B;  3FXK A;  4OAZ A;  1X1C A;  3OYK A;  1OR7 A;  1XD7 A;  4AYB N;  4HBL A;  2E36 A;  3OOP A;  3OOU A;  4LIV A;  3CDH A;  1QVT A;  1QZY A;  1ORK A;  4F7Z A;  2HPM A;  2ZJQ F;  2D2W A;  2FU4 A;  2CG4 A;  1JUM A;  3TDZ C;  4IHS A;  1BI2 A;  3FZV A;  4HF2 A;  2V9K A;  2HS5 A;  2RQQ A;  1MKM A;  4P1W A;  1UCR A;  2EK5 A;  2HYJ A;  1OIS A;  2DMP A;  4C3H J;  2NNY A;  3KLN A;  3ZQ7 A;  1BIB A;  2ZFW A;  3EPZ A;  1TW2 A;  3RSN A;  3PNT A;  3CDL A;  5E17 F;  1ZTR A;  3K70 D;  3GZ5 A;  3F23 A;  3SFI A;  5H6R A;  3ZOB A;  4KDP A;  2HNH A;  2LR8 A;  3V7S A;  3F8F A;  2LBF B;  3DLA A;  3QWL A;  3DCF A;  1FBQ A;  1IN7 A;  2VOP A;  5LRR A;  2QCO A;  2KIU A;  4BQO A;  4ZYD A;  1ZG1 A;  5JLX A;  4UNO A;  4HV5 A;  1EH8 A;  4HQM A;  5C44 J;  2EIK H;  2E71 A;  2NS7 A;  4XKC A;  3U1D A;  4BXU A;  1IXS B;  3GTK J;  2VI6 A;  5AIQ A;  4XKW A;  3CUQ A;  1TC3 C;  3V4G A;  2CV1 A;  2R5Z B;  4XLE A;  2FBK A;  2LVS A;  3HG9 A;  3KYC B;  5DD4 A;  4DYR A;  1B8I A;  3BQZ A;  2BXZ A;  2JPC A;  2W82 A;  3W2A A;  3M3Y J;  3E3V A;  3Q9S A;  2YU9 J;  4XLA A;  4LB5 A;  3MKW B;  1BI0 A;  1UST A;  2V9P A;  4HW0 A;  3T5X A;  4BHP A;  3OS1 A;  3H3Z A;  3LQQ A;  4CHU A;  2VON A;  3ESW B;  3QYE A;  4EV0 A;  3GZN B;  4Z6Y A;  1Y0U A;  4M6X A;  2OCC H;  1DPU A;  2EV6 A;  3DPU A;  4IO9 F;  3DFG A;  3ABU A;  3ECH A;  3FXU A;  4OIO F;  2YSR A;  1RR7 A;  4DW6 A;  3I56 I;  4BH9 A;  3HOX J;  4MNU A;  3ZMZ A;  2W00 A;  4ENN A;  3J80 Z;  1Z67 A;  4BQA A;  3PUF A;  1RUN A;  2QVO A;  1WI3 A;  2WA0 A;  1J5Y A;  4B4C A;  4MIM A;  3Q0V A;  1QVU A;  2BY2 A;  2OF7 A;  1U5T C;  4RAG A;  2F5V A;  2JRT A;  5JHF A;  4GCV A;  4Q47 A;  3AG4 H;  2EZK A;  4EJU A;  3OSG A;  1Y8R B;  4XQF A;  1A31 A;  1XMK A;  2LF8 A;  4FX4 A;  1BM9 A;  3ZQF A;  2KJB A;  1WSU A;  1V55 H;  3FDY A;  4GYG A;  1T56 A;  1FPQ A;  1IAW A;  1WPK A;  3RKQ A;  3LFU A;  4IQJ A;  1SD6 A;  1LEB A;  5HDK A;  5JFR A;  3BLY A;  3W6K B;  4HNT A;  1I39 A;  2E1N A;  2RV8 A;  4D5C A;  3N97 A;  3FIW A;  4ASN A;  3ZMV A;  4C3I J;  2R5Z A;  2FBI A;  2CQQ A;  3C2G A;  3ZR8 X;  5ICE A;  1XGM A;  4PJ0 C;  4L5E A;  4BQN A;  3ZRG A;  2HOE A;  3HUG A;  2LFB A;  1Z6T A;  3MVP A;  4LG0 A;  1T8I A;  3S2D J;  4M6V A;  3U1K A;  3HM5 A;  3HOV J;  2BBY A;  1Y0N A;  3FXR A;  2DU9 A;  2EV5 A;  4KIS A;  4ZDL A;  1U2W A;  3BG7 A;  4MFD A;  2IGK A;  2ZO4 A;  4PCQ A;  3G2B A;  3OV8 A;  3SFZ A;  3I59 A;  1HW1 A;  1R7J A;  3VYS B;  1HKS A;  3DBH B;  4G8X A;  5F0H A;  2MLK A;  3G73 A;  2EH3 A;  2JUG A;  3BT9 A;  5E1X A;  4YRV A;  3TO7 A;  2VIX A;  4IHT A;  2BY0 A;  2XF6 A;  2EBI A;  1EA3 A;  4HZF A;  5CJ9 A;  1YW8 A;  2M7B A;  3EET A;  5L3C A;  2FBH A;  4D9J A;  2ECB A;  3FWE A;  2A6T A;  1MBH A;  1TT0 A;  1Y39 A;  2XF7 A;  2EFP A;  1YJ9 I;  4HSR A;  2DLL A;  4F91 B;  3TED A;  5IYC J;  1JKR C;  3TW7 A;  2CU7 A;  4XR6 A;  4EM1 A;  3CMY A;  1RPW A;  4NUB A;  1A6Q A;  1TWF J;  4DIQ A;  3ZMD A;  1AU7 A;  1FX7 A;  2A07 F;  1T33 A;  1GXQ A;  4BXF A;  5HOO A;  2WBM A;  4AVP A;  3GYH X;  4Y4R A;  4HNV A;  2YR2 A;  3W6J B;  2IS4 A;  4DQ2 A;  4K2E A;  1ACI A;  2DT5 A;  3FXO A;  1F43 A;  2IW5 A;  3CJR B;  5GAG J;  4AIJ A;  1W5C C;  4C2U A;  3RYR A;  1WH5 A;  1YG2 A;  2MD5 A;  4ZYG A;  5GTI C;  1IRG A;  2FNA A;  1X19 A;  2JVG A;  2IJL A;  4UUT A;  3EYY A;  4B09 A;  3LSJ A;  3BR1 A;  5IPA A;  1Z21 A;  2QQ8 A;  3TL4 X;  2OTJ I;  1NG7 A;  2KDZ A;  2CRG A;  2ECC A;  4IHX A;  1HA8 A;  2F5C A;  9ANT A;  4P5O A;  1MZB A;  3TW6 A;  2EFN A;  5LBQ A;  1R4M B;  2Z5U A;  3L7W A;  4C30 A;  1L3L A;  4P9F A;  4XNF A;  4L9V A;  1S7O A;  4BKX A;  4LIT A;  3D5R C;  3ABM H;  3N4M A;  1LVA A;  4A6E A;  2JMW A;  3FHN A;  1VZ0 A;  2MA3 A;  1J59 A;  3CME I;  2JSC A;  2X6X A;  2JN6 A;  2K3P A;  3VYT B;  2A3S A;  2JK3 A;  4ESJ A;  2XVC A;  2DPD A;  3DBR B;  3OSF A;  5IOZ A;  5GPC A;  2EV0 A;  1NK3 P;  2GAU A;  2OD5 A;  3QP5 A;  2HVS A;  2I10 A;  4NB5 A;  5FKN A;  4WXC A;  4NNJ A;  2MC3 A;  3RPU A;  2E1C A;  3GFL A;  3R0J A;  4Y13 A;  2FOW A;  3HIF A;  1BC7 C;  4ESB A;  5HLI A;  4ABZ A;  3ZQC A;  2BOL A;  5EEH A;  3F6V A;  2IPQ X;  1X2M A;  3MKZ A;  3T1B A;  4XSX F;  2RDP A;  2JQ7 A;  3HRS A;  2ZKZ A;  1D1B A;  3KZY A;  1B72 B;  3ZMU A;  3RQI A;  1U8R A;  4XSZ F;  2NNN A;  4OMY A;  1SC7 A;  2Y0S N;  4A3D J;  4Q4Z F;  1YIJ I;  3I64 A;  1FBS A;  3BTC A;  2V26 A;  2STT A;  4XM3 A;  3VOE A;  4L5J A;  1QPI A;  2QBY B;  2VKV A;  2IA0 A;  2P5L C;  5B66 C;  2ZCW A;  2ZB9 A;  4N4N B;  4P9U A;  2BGC A;  3EUA A;  4RGU A;  3WG9 A;  1QZZ A;  2XRN A;  2DMU A;  4M3G A;  5ICG A;  3L2W A;  4RAY A;  1VQP I;  3QYF A;  5IT9 Z;  1RET A;  3FK7 A;  1JE8 A;  1FOX A;  1TQI A;  2IGM A;  2R7Z J;  5IYD J;  2QLZ A;  3K4K A;  3RCO A;  2LMD A;  5M5X J;  3VWB A;  2Z1D A;  1OLT A;  2HXI A;  2WV1 A;  4BXX J;  3QOP A;  2R92 J;  3HHG A;  3JAM K;  3HPG A;  4Y7N J;  4MFE A;  1SMY F;  3IAM 2;  3A01 B;  2DPU A;  3BTJ A;  1Y6I A;  2LRE A;  4O6J A;  1YIT I;  4XLF A;  3LSP A;  2CV2 A;  1MMG A;  3R6S A;  1ZAO A;  2D5V A;  1IRX A;  2M34 A;  2QF7 A;  5FKO A;  1IN4 A;  2PMZ N;  3RKW A;  1ETY A;  1KON A;  3KP2 A;  3BCB A;  4FX0 A;  1I1S A;  4IZZ A;  4PK4 A;  4XOP A;  4I02 A;  3S14 J;  5DCM A;  2EQR A;  1VQ8 I;  4ZYA A;  2ELH A;  1IV6 A;  3I59 B;  3HUG B;  1BL0 A;  5HLG A;  1USS A;  4CH7 A;  2HKX A;  4RLQ A;  2GIZ A;  2XAJ A;  6PAX A;  2DMQ A;  3C3W A;  2H8R A;  5FLX Z;  2R3S A;  2MG4 A;  1IN6 A;  1Z77 A;  5FRO A;  4YEJ A;  2HR3 A;  2L0K A;  3ZQH A;  4G7Z F;  4NHJ A;  1MIJ A;  2MGQ A;  1VQL I;  2Y9Y A;  3T8T A;  2ID6 A;  4B44 A;  1YQA A;  5E8G A;  2DN0 A;  2LTP A;  1G2H A;  5DM7 F;  1ON1 A;  1R5H A;  4KN4 X;  1SFE A;  4XON A;  5M5Y J;  1ZG3 A;  1M1E B;  4U7D A;  1R49 A;  2H8W A;  2LF7 A;  1MSF C;  2FSW A;  3K4C A;  3J7A O;  1IXC A;  2WTE A;  4P96 A;  1BW6 A;  2WAQ A;  3A03 A;  3WU0 A;  5M3M J;  3RQ4 A;  1SFO J;  1CF7 B;  2Q1Z B;  3WTS C;  5BMZ A;  4QWQ A;  1FT9 A;  3SZT A;  3KYD B;  3K4M A;  5EYR A;  4CUG A;  2DMT A;  4RAF A;  4GYI A;  4KUM A;  1TP4 A;  5CYV A;  2KIS A;  1LQ1 A;  1MMS A;  1ZR2 A;  4N4O B;  1MSE C;  2DO7 A;  2LH9 A;  1XDS A;  2XAU A;  3C7J A;  3ONQ A;  2CFX A;  2UXN A;  2Y2Z A;  1SFU A;  1YJW I;  2KL4 A;  2ZBK A;  2OA4 A;  4XL9 A;  3BJA A;  4BEH B;  1TZL A;  2O3F A;  5FD5 A;  5FO5 A;  1MJ9 A;  1YTY A;  1FYL A;  1P2F A;  2JRM A;  3P9K A;  1WJD A;  2VAS A;  4RGS A;  2TCT A;  3NAU A;  3M8E A;  3V8J A;  3OYJ A;  2MFZ A;  3K4L A;  3R61 A;  1MBK A;  3AL0 B;  1HXD A;  1S5L C;  1YLF A;  2CSO A;  3GTG J;  2D1H A;  2VL8 A;  3E5Q A;  3GME A;  4PSW A;  2H09 A;  4TV7 A;  4FQG A;  1W0U A;  3L9F A;  3BJO A;  3U21 A;  1UB9 A;  3F72 A;  4EJV A;  3WTZ A;  4A69 C;  2EZI A;  1S7E A;  3A1Y A;  3ZPL A;  3I5U A;  1T08 B;  5E79 C;  2X6Y A;  4OOI A;  1KQ0 A;  4M6Y A;  3D1N I;  4BAC A;  2Z33 A;  5IP9 J;  3L09 A;  2CUZ A;  3LSG A;  4Q5S F;  3LMM A;  3GTJ J;  1O3R A;  3FBI B;  1ODD A;  2E60 A;  2EA4 A;  5DCF A;  5LLQ A;  2K86 A;  2OZ6 A;  3IP4 B;  1R1T A;  1J2X A;  3BPV A;  5FGM A;  5J47 A;  5LGU A;  2B9S A;  4A3G J;  4ZDO A;  3V8K A;  5FLX K;  3V7R A;  4A3L J;  2DI3 A;  4MEY F;  4YIF A;  2DJI A;  2XPV A;  1OFC X;  1IF1 A;  1X3U A;  4Q48 A;  3BR0 A;  4XOT A;  3AKZ A;  2XC7 A;  3DLL F;  2ZXJ A;  3BTI A;  4BU2 A;  3QPH A;  3BR3 A;  3F8C A;  2ZXI A;  1MJB A;  1J0R A;  4GRI A;  3JR9 A;  3D5L A;  1XCB A;  3P9I A;  4A5M A;  4WX9 A;  5EDN A;  1XS9 A;  4QPQ A;  2VLA A;  4ZYH A;  2ZJR F;  2KRF A;  4E7Z A;  5HDG A;  1NH3 A;  4BBR J;  1SD7 A;  4Y33 A;  2E1O A;  3LAP A;  4B48 A;  1Q1H A;  1R58 A;  3CP2 A;  1B9N A;  2EZH A;  2DTR A;  1QHH D;  4WF2 A;  3BZC A;  1PP8 F;  4PFO A;  3W3C A;  2H27 A;  4JBA A;  2KMU A;  4KT5 C;  1B72 A;  1TBX A;  2W4S A;  2ZFU A;  4U0V A;  5F1J A;  3JCU C;  2F5E A;  2LK2 A;  1W1W E;  3N05 A;  3OIP A;  4NQW A;  4E4H A;  4E6K G;  3K70 C;  3VOD A;  4H0E A;  1J7K A;  4LOC A;  1NTC A;  3WU2 C;  4Y17 A;  1WH7 A;  3EUH A;  4M9Z A;  1CQT A;  3H36 A;  1LDK B;  2RNJ A;  4I76 A;  2IVM A;  1XC5 A;  3LOC A;  3M1C A;  2VPL A;  2BXY A;  2PN6 A;  1AKH A;  2LKS A;  1U3E M;  4IPA A;  4H4K C;  3OYD A;  2A68 F;  2FD5 A;  4LG3 A;  2R7W A;  2HDC A;  2LOO A;  1HKQ A;  4R8H A;  4CGZ A;  2XAS A;  3UR3 C;  2VB6 A;  4Y15 A;  5CKT A;  2F5F A;  1HBX G;  2DK8 A;  1BOB A;  2L2O A;  3IV5 A;  4OMZ A;  1RNL A;  2R7U A;  3I53 A;  4X1E A;  3WTT C;  3H1C A;  5KNL A;  1FP1 D;  3KP3 A;  3OR1 C;  2XIG A;  3BQY A;  4CA0 A;  1IJW C;  3J7A Y;  2DK5 A;  1R23 A;  2BW3 B;  2QKM B;  3CJT B;  4KFC A;  2VN2 A;  1J9I A;  4KN7 X;  4LGW A;  3A0B C;  1MDM A;  3LFK A;  1BI3 A;  4PJJ A;  4OIN F;  1W36 C;  4AM3 A;  3NAR A;  2K7L A; 
#chains in the Genus database with same CATH homology
 3BG9 A;  1JJ8 C;  3IH3 A;  1FTT A;  2E2J J;  2P81 A;  1HDD C;  1ETO A;  3PO3 J;  2HI3 A;  1RR7 A;  1TWA J;  2DA3 A;  4DW6 A;  2HOS A;  3HOX J;  3H3V K;  1I50 J;  5FKL A;  3IH2 A;  2FX0 A;  2AO9 A;  2R5Y A;  2OPT A;  1WI3 A;  2VUM J;  4B4C A;  4MIM A;  1UMQ A;  3RZD J;  1PUF A;  3Q0V A;  1QVU A;  2OF7 A;  2NOG A;  3O8H A;  2EZK A;  4FTH A;  3OSG A;  3TP3 A;  2DA4 A;  2K9Q A;  4DYC A;  3Q3S A;  2DA1 A;  1SAN A;  2ME6 A;  3ZQF A;  2X9D A;  1T56 A;  1UG2 A;  1WGX A;  1WPK A;  3RKQ A;  2JA8 J;  5DS9 A;  1LFU P;  1IDZ A;  2XB5 A;  1A5J A;  2R93 J;  1BJZ A;  2YUS A;  1JTX A;  2X6O A;  4C3J J;  2WB1 N;  1MH3 A;  2M0C A;  4D5C A;  3FIW A;  1OCP A;  1IC8 A;  4C3I J;  1ZQ3 P;  4M3B A;  5IP6 A;  5FKK A;  2R5Z A;  1OCT C;  2CQQ A;  2L7F P;  1GT0 C;  4L5E A;  4DYQ A;  2B63 J;  5C3E J;  2LFB A;  3MVP A;  5K7Z A;  3S2D J;  4M6V A;  1U9O A;  3HM5 A;  2O8K A;  3HOV J;  2LKX A;  4FIS A;  3CQZ J;  4W97 A;  2E19 A;  3MKL A;  4MFD A;  3PM1 A;  4FE4 A;  1BW5 A;  2XGC A;  3HB9 A;  3HDD A;  3K7A J;  1NK2 P;  1GV5 A;  2WAQ N;  1P7I A;  5F0H A;  4IHY A;  2JA5 J;  2EH3 A;  3BT9 A;  1MBJ A;  4Y52 J;  5C4X J;  2GLO A;  5J3L A;  3I4M J;  4A3K J;  2EBI A;  5FLV A;  4M3F A;  2XB0 X;  3GTP J;  1H8A C;  2ECB A;  5EEA A;  1JKO C;  1ETW A;  4I6Z A;  3GTL J;  3LNQ A;  2VKE A;  1GDT A;  1MBH A;  4JP0 A;  4IHW A;  5J1Y A;  2ELK A;  2NVX J;  1Y1W J;  1IDY A;  5FLM J;  3TED A;  2XRL A;  5IYC J;  2ID3 A;  3TW7 A;  2CU7 A;  5IOY A;  1U8B A;  3CMY A;  1JKR C;  1RPW A;  1TWF J;  4UUS A;  1RKW A;  1AU7 A;  4EEF G;  1PUF B;  1T33 A;  3TP0 A;  2Y30 A;  3HOU J;  4HNV A;  3HEF A;  1FEX A;  1DU0 A;  1FTZ A;  1VND A;  1F43 A;  1QRY A;  1AHD P;  3O8G A;  1YRN A;  2W48 A;  4NDL A;  4JX4 A;  1LE8 A;  1WH5 A;  3JRC A;  1EF4 A;  4M3D A;  4UUT A;  3LSJ A;  2CUE A;  1UHS A;  3BR1 A;  4W1U A;  3GBG A;  1I3Q J;  5IPA A;  4A3M J;  1D5Y A;  3GTO J;  3L1P A;  2JA6 J;  2KDZ A;  1P7J A;  1X2N A;  2CRG A;  2ECC A;  5E3N A;  4IHX A;  2HOT A;  9ANT A;  3S15 J;  3TW6 A;  3ZQI A;  5E3L A;  1VFC A;  1K83 J;  2IAI A;  4BKX A;  5EZG A;  4A3I J;  4FCY A;  5F0C A;  2NVQ J;  2JMW A;  4S0H B;  4XRS A;  2E2I J;  4RBO A;  2JN6 A;  1GVD A;  2JK3 A;  3I4N J;  5K7H A;  3OSF A;  3E7L A;  3H0G J;  1ETX A;  5IOZ A;  5GPC A;  2MSY A;  1ZGW A;  1NK3 P;  2NVY J;  2I10 A;  4AC0 A;  5FKN A;  2JJ7 A;  2MW8 A;  5E3O A;  4D7N A;  2HDD A;  4XID A;  2M9H A;  2G0E A;  1X58 A;  4DZJ A;  3DEW A;  1BA5 A;  4ABZ A;  2JWT A;  3ZQC A;  1WCM J;  5IYB J;  3HOZ J;  1X2M A;  4RDU A;  1ETQ A;  2COB A;  4X6A J;  1JUP A;  2JA7 J;  1B72 B;  2K40 A;  3RQI A;  3BR2 A;  3JRE A;  2H1K A;  1R9T J;  4BBS J;  2FQ4 A;  2Y0S N;  4A3D J;  4A3B J;  3Q0W A;  3BTC A;  1HOM A;  3ZQL A;  1A6I A;  3W6V A;  1QPI A;  1GUU A;  5EZH A;  2VKV A;  3SJM A;  2ZB9 A;  1F36 A;  2DMU A;  4M3G A;  3JRH A;  4V2F A;  4A3C J;  1RET A;  3FK7 A;  1VI0 A;  3SDG A;  2R7Z J;  5IYD J;  3ZQG A;  5M5X J;  5E3M A;  5DTD A;  4QSH A;  2HXI A;  2WV1 A;  4A3J J;  4BXX J;  2R92 J;  2EZL A;  4Y7N J;  4MFE A;  3Q0U A;  5EGO A;  2Y31 A;  3A01 B;  3BTJ A;  4B3A A;  3LSP A;  1TWG J;  2LY9 A;  3JRG A;  4JX5 A;  2D5V A;  1H88 C;  3GTQ J;  4CYC B;  2M34 A;  2QF7 A;  5FKO A;  2PMZ N;  1ETY A;  3JRI A;  1E3O C;  5EF6 A;  2DA7 A;  1ZKG A;  3FKI J;  3HOY J;  3S14 J;  1ETK A;  5EG0 A;  2EQR A;  4GFB A;  3PO2 J;  3S1M J;  2IBD A;  1IV6 A;  1BL0 A;  2L7M P;  2DMN A;  3FIS A;  4A3F J;  2DMQ A;  4M3E A;  2H8R A;  2MG4 A;  1Z77 A;  2NS8 A;  1K61 A;  2HXO A;  1JKP C;  2DA2 A;  2L0K A;  3ZQH A;  4D7M A;  2MGQ A;  2IEK A;  2Y9Y A;  1RES A;  2L9R A;  2ID6 A;  5J1R A;  2DN0 A;  2LTP A;  1G2H A;  1H89 C;  3C2B A;  5FJ8 J;  1FIP A;  4IEJ A;  5M5Y J;  4QTR A;  2DTZ A;  2VPR A;  4XRM A;  1MSF C;  2DA5 A;  1ENH A;  3G1M A;  1Q1V A;  1BW6 A;  2XPW A;  4MLO A;  2XGE A;  3A03 A;  1MBE A;  4JYK A;  5HOD A;  1IG7 A;  3B6C A;  5M3M J;  1SFO J;  5M3F J;  2HOA A;  3JRD A;  5IP7 J;  4UUS B;  3BG5 A;  3F0C A;  2GM4 A;  1YRN B;  2TRT A;  5EYR A;  2DMT A;  1TWH J;  2R5Y B;  2K9N A;  3JRF A;  2XSD C;  3BR6 A;  2DA6 A;  3WHB A;  1I6H J;  4FE7 A;  1ZR2 A;  1MSE C;  2RAE A;  3QPS A;  2CQX A;  2Y2Z A;  1IUF A;  3HBL A;  3S17 J;  3MN2 A;  2LD5 A;  5BNG A;  4D5F A;  1JGG A;  2ME0 A;  5F08 A;  2TCT A;  3NAU A;  1Z0X A;  3UKG A;  1HLV A;  1FIA A;  3G1O A;  1MBK A;  3GTG J;  3S16 J;  1JTY A;  1IGN A;  1ZK8 A;  1W0U A;  1HDP A;  2GBY A;  4BY1 J;  1APL C;  4A93 J;  3RZO J;  4V2G A;  4A3E J;  4A69 C;  2EZI A;  1S7E A;  2LLK A;  3BG3 A;  1MBG A;  2KT0 A;  3CCY A;  2YS9 A;  3FK6 A;  3D1N I;  5EG0 B;  5IP9 J;  4B1R A;  1TWC J;  2LP0 A;  3G1L A;  3LSG A;  1OJL A;  3GTJ J;  2CUF A;  1JJ6 C;  1AKH B;  2E2H J;  3HKZ N;  1HF0 A;  1POG A;  1XG1 A;  4CYC A;  4AUX A;  3HGG A;  2DJN A;  4IHV A;  5FKM A;  4A3G J;  2CJJ A;  1FJL A;  3S2H J;  1Y1V J;  2M2E A;  5EGO B;  3S1Q J;  4QIW N;  2N8G A;  4A3L J;  5K7F A;  2O9L A;  2XPV A;  1OFC X;  3BTL A;  1W0T A;  4J19 A;  3HOW J;  3M4O J;  3BR0 A;  3BTI A;  4XK4 A;  1MNM C;  1HCR A;  3BR5 A;  1RKT A;  1LE8 B;  3BR3 A;  1JT6 A;  1MH4 A;  1LFB A;  4C2M J;  4JX6 A;  3A02 A;  3JR9 A;  2X48 A;  5F0F A;  5EDN A;  3K2A A;  1XS9 A;  1U9N A;  2XPU A;  5JLW A;  3B6A A;  1JT0 A;  5F04 A;  1VF9 A;  4BBR J;  2O7O A;  4AYB N;  2E1O A;  5GPA A;  3OOU A;  4DZP A;  1IRZ A;  1QVT A;  1ZR4 A;  1ORK A;  2EZH A;  4XIC A;  1JUM A;  1GV2 A;  3VPR A;  3QQA A;  5F27 A;  3IH4 A;  1B72 A;  1B8I B;  5F1J A;  5GP9 A;  1O4X A;  2HYJ A;  2LK2 A;  2DMP A;  3S1R J;  2Y9Z A;  4C3H J;  4LOC A;  1NTC A;  1WH7 A;  3CDL A;  1ETV A;  1CQT A;  1ZTR A;  4I76 A;  3SFI A;  3ZOB A;  1JUS A;  4BY7 J;  3JRA A;  2LR8 A;  3HGY A;  1XC5 A;  1JKQ C;  3LOC A;  3DCF A;  2FJ1 A;  1AKH A;  3OIO A;  2M8G X;  2QCO A;  3JRB A;  4XRS G;  2FD5 A;  5JLX A;  2NVT J;  1MBF A;  3WHC A;  5C44 J;  5M5W J;  2NS7 A;  3GTK J;  2VI6 A;  4MO7 A;  1TC3 C;  2K9S A;  3IV5 A;  2R5Z B;  2HQ5 A;  2LVS A;  4G12 A;  3LSR A;  4X1E A;  4DYR A;  2AHQ A;  2XGD A;  3BQZ A;  1B8I A;  3S1N J;  1IJW C;  3BQY A;  3M3Y J;  2R0Q C;  5C4J J;  2YU9 J;  3A01 A;  1DU6 A;  1U78 A;  3GTM J;  1ITY A;  2L7Z A;  3QPL A;  5J1U A;  3NAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...