3GTJJ

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtjJ00
5FJ8J 4MO7A 3WHBA 2CQXA 1GUUA 5FKNA 4D7MA 1BA5A 5EGOB 4BBRJ 2HYJA 3UKGA 3BG9A 1X2MA 5GP9A 1IUFA 3F0CA 1XS9A 3JRDA 2Y9YA 2ID3A 3K7AJ 1W0UA 3A01B 2XSDC 4XICA 4MIMA 4DW6A 1VI0A 1B8IA 5F0FA 2CRGA 4C3JJ 5C4XJ 1GVDA 1AKHB 2NVXJ 4A3BJ 2DMQA 2ME0A 2VPRA 3TP0A 2DA4A 2HI3A 4FE7A 3ZQGA 1JKRC 3JRAA 4A93J 3D1NI 1BW6A 4JYKA 2KDZA 2ME6A 2HDDA 4LOCA 2XGDA 2YUSA 4QIWN 2JA6J 1ETXA 1IRZA 2R7ZJ 3HOXJ 1GT0C 4I76A 2GLOA 1FTZA 2L0KA 2Y0SN 3DEWA 1VF9A 2JJ7A 3ZQCA 4M3BA 1F43A 4XK4A 2JA8J 3BTJA 5BNGA 5GPCA 4RDUA 1GDTA 5GPAA 2O7OA 5M3FJ 3CDLA 1LE8A 3JRIA 3S16J 1RETA 3HM5A 3GBGA 2M9HA 1ZK8A 3VPRA 3S1RJ 3IH2A 1MBGA 3GTOJ 2WB1N 3FK6A 4W1UA 1ETOA 3GTQJ 1U78A 1OFCX 3BQYA 1HLVA 4BY1J 1X58A 2P81A 3GTKJ 2IBDA 3BR1A 2DA5A 3S2DJ 2NOGA 4C3HJ 2XRLA 2OF7A 1JUSA 3JREA 5EG0A 2G0EA 4M3DA 3S1QJ 2WV1A 2R5ZB 2IEKA 3C2BA 1UG2A 1FIPA 1ETWA 3H0GJ 3O8HA 4NDLA 4G12A 1ORKA 3HGYA 3HEFA 2X9DA 4M6VA 4A3JJ 1NK2P 1ITYA 2EZIA 2JWTA 2FD5A 2YS9A 5IYBJ 5IOZA 3B6AA 3IH3A 2YU9J 2LD5A 1MSFC 3HOYJ 2O9LA 1FJLA 4I6ZA 1Y1WJ 2K9QA 2ECCA 2R5YA 4S0HB 3BG5A 3HBLA 1QRYA 3BTLA 1YRNA 1BW5A 1ZGWA 1OCPA 4BKXA 1QVUA 2AO9A 2H1KA 4FCYA 5EGOA 4W97A 1JUPA 1RR7A 1JKQC 1WH7A 4A3FJ 4XIDA 3L1PA 3PM1A 5C4JJ 3MVPA 2DMPA 2EQRA 1RKTA 4IHYA 1TWFJ 5HODA 2R93J 4EEFG 2MSYA 5M5WJ 4UUSB 3OIOA 5J1RA 2JN6A 2R92J 1QVTA 1U9OA 2JA7J 2E2JJ 2RAEA 2CUEA 1UHSA 3QQAA 4DZJA 4B4CA 3H3VK 1H8AC 1TC3C 5E3OA 1TWGJ 1VNDA 2QCOA 2Y2ZA 1JT6A 3GTMJ 1IV6A 5E3MA 5FKMA 5K7FA 4ABZA 4IHVA 5IYCJ 5C3EJ 1MBHA 4CYCB 2FQ4A 3LNQA 1H89C 2VKVA 1MSEC 2L7MP 2HOTA 2DJNA 5F27A 2LFBA 1HF0A 2ID6A 4L5EA 2LKXA 3LSJA 1HCRA 1FTTA 4M3EA 3DCFA 3OOUA 1HOMA 2VI6A 3GTLJ 3LOCA 2X48A 1D5YA 1Q1VA 5DS9A 2EZHA 1WGXA 3ZQHA 1WCMJ 3JRCA 1T33A 2DN0A 1JKOC 3BR0A 3G1LA 1ZKGA 5F1JA 1U9NA 1IG7A 1I6HJ 2IAIA 2DA1A 1H88C 9ANTA 2LP0A 1JJ6C 3SDGA 3BTIA 2L9RA 3RQIA 1F36A 2XB0X 2DA7A 2NVQJ 3O8GA 3CMYA 4B3AA 3JRHA 4D5FA 1FEXA 1PUFB 3JRFA 4A3MJ 4B1RA 5M5YJ 1E3OC 3HOVJ 4X6AJ 1JKPC 5IPAA 2QF7A 1P7JA 1HDPA 1POGA 2M0CA 3LSPA 3BT9A 2MG4A 3JRBA 3JRGA 2N8GA 4AYBN 3Q0UA 1DU6A 3BR3A 2HXOA 2M8GX 5EZHA 2I10A 1LFUP 1B72A 3CQZJ 1K83J 1UMQA 3M3YJ 1RESA 2R0QC 3I4MJ 1Z0XA 4A3LJ 2M2EA 1SFOJ 4M3GA 5F08A 3NAUA 2X6OA 2B63J 1MH4A 4C2MJ 2HQ5A 1TWAJ 3LSRA 1O4XA 1ZTRA 2PMZN 2JA5J 4QTRA 3B6CA 2O8KA 3OSFA 4MLOA 1IDYA 1TWCJ 3S1NJ 1EF4A 1A6IA 3FKIJ 1K61A 1T56A 4JX5A 1APLC 5EDNA 2Y9ZA 2LVSA 1MBFA 4A3IJ 4MFEA 2XGEA 1XG1A 4XRSA 2D5VA 1Y1VJ 3GTJJ 1ETQA 1MBKA 5EZGA 2K9SA 1LE8B 3S2HJ 1ETYA 1WH5A 3A02A 1ENHA 2MGQA 5FLVA 2LY9A 4D7NA 1WI3A 3Q0WA 3GTPJ 3LSGA 1AHDP 1WPKA 1JUMA 4JX6A 2ZB9A 2DMUA 2DA6A 3TEDA 2JK3A 3A01A 4A3DJ 3OSGA 3G1OA 2LR8A 3BR5A 4A3GJ 1OCTC 1HDDC 3RZDJ 2NS7A 3BG3A 5FKKA 4FE4A 1AKHA 1X2NA 4X1EA 1XC5A 5DTDA 1VFCA 5EF6A 2WAQN 3PO3J 3A03A 2L7FP 4IHXA 3ZQIA 2GBYA 2XPVA 2Y30A 5M5XJ 2NS8A 5IP6A 4A3KJ 3TW6A 2GM4A 1OJLA 3RKQA 4AUXA 2VUMJ 3M4OJ 2R5YB 4GFBA 2CQQA 2DA2A 3HGGA 1U8BA 2Y31A 3RZOJ 1NK3P 2TRTA 5F04A 2EH3A 1PUFA 2COBA 2EZKA 1MBJA 1FIAA 4AC0A 3WHCA 5FKOA 4IHWA 3Q0VA 3FK7A 1MH3A 4M3FA 1ETVA 2L7ZA 1R9TJ 3SJMA 2LLKA 3SFIA 2K9NA 2H8RA 1I3QJ 4A69C 3JR9A 1BJZA 3S17J 1AU7A 3S15J 3MKLA 4BXXJ 5F0CA 2E1OA 4Y52J 3PO2J 3BQZA 4HNVA 3BTCA 4XRSG 5E3LA 3HOWJ 2JMWA 2XPUA 2R5ZA 1MNMC 3IV5A 1BL0A 2FJ1A 1DU0A 3ZQFA 5K7HA 4QSHA 5FLMJ 1IGNA 3HB9A 5J1YA 5IP7J 4DZPA 3IH4A 4DYCA 1P7IA 1B8IB 2TCTA 2DMTA 1IDZA 3TP3A 2E2HJ 1JTXA 3ZQLA 3S1MJ 4DYRA 3HKZN 1ZQ3P 5IYDJ 1IJWC 2DA3A 3GTGJ 2CUFA 2FX0A 4BBSJ 1RPWA 4BY7J 3CCYA 4MFDA 2E2IJ 4V2GA 4XRMA 5J1UA 1ZR2A 1ETKA 3ZOBA 3HDDA 1G2HA 4J19A 4UUSA 4Y7NJ 4C3IJ 1W0TA 4JP0A 2W48A 5M3MJ 2MW8A 2CU7A 3HOUJ 1JT0A 2CJJA 2EZLA 4FISA 5JLXA 5EEAA 4A3CJ 1S7EA 3FIWA 3K2AA 4A3EJ 5IP9J 2HOSA 3E7LA 1NTCA 1GV2A 2K40A 2HOAA 2XB5A 3QPSA 4IEJA 1B72B 2NVTJ 1Z77A 1IC8A 3HOZJ 4CYCA 3I4NJ 1A5JA 3BR6A 5FKLA 2VKEA 5K7ZA 2E19A 5C44J 2XPWA 4FTHA 1MBEA 2NVYJ 4DYQA 3S14J 3FISA 3BR2A 5EG0B 4JX4A 4V2FA 2LTPA 2ECBA 2M34A 2AHQA 2DMNA 2DTZA 3MN2A 2HXIA 5JLWA 5J3LA 4D5CA 2XGCA 5E3NA 2OPTA 1CQTA 1GV5A 1TWHJ 3TW7A 4RBOA 2EBIA 1JGGA 1SANA 5F0HA 3W6VA 1JTYA 3G1MA 2LK2A 4UUTA 1QPIA 1LFBA 1RKWA 3NARA 3QPLA 2KT0A 3Q3SA 5IOYA 1I50J 2ELKA 1ZR4A 1JJ8C 1YRNB 5EYRA
chains in the Genus database with same CATH superfamily
2VOOA 3GZ5A 1HA8A 4ZYAA 2EFQA 3K4KA 1GXQA 2VBYA 2JUGA 4XLHA 1ERDA 4B09A 4HPQA 4QPQA 4BBRJ 4IHTA 2FBHA 2E5NA 2EV5A 3UKGA 2F4IA 2OCCH 3F0CA 4II2A 3TMOA 1I5ZA 4XRFA 1W7PB 5JVGF 2F5FA 3FF5A 4ASNA 4GYGA 4DW6A 5D8LB 2AS5F 4BL0B 1VI0A 2A6EF 2IGMA 1WHUA 3B73A 2CRGA 3HRTA 2VC0A 2UZKA 1H9GA 2YSRA 3F8BA 2FNPA 2NVUB 1O3RA 2MLKA 2CW8A 2D45A 4R79A 3B02A 4A3BJ 2ME0A 4U87A 2JA2A 4XONA 4XORA 2ZXIA 3OYAA 2VPRA 2HI3A 1GLNA 4FE7A 3BJ6A 4N4OB 3JRAA 1MIJA 1BW6A 4D0PA 1F4KA 2MBFA 2XF5A 1OPCA 2IGKA 2JA6J 3F9KA 1RRJA 1GT0C 4G8XA 5FD5A 1VF9A 2JJ7A 3CF2A 2GA1A 4F55A 1ZLJA 1F43A 4XK4A 2ISYA 4RDUA 4LLNA 3FX3A 5M3FJ 4C2UA 3GBGA 1D8JA 2FSWA 1P4WA 1WVRA 2DT7B 1QQIA 3ONQA 3HPHA 1D1BA 1P2FA 3IH2A 4EM2A 5DM6F 2HTSA 3DTKA 3F6OA 4XNFA 4YFNF 3IKVA 1CF7B 3FK6A 4W1UA 3PQKA 1E0EA 1U78A 3MD2A 3K4JA 4PFOA 1HLVA 3ZQ7A 3Q5FA 3HPGA 4LD5A 1X58A 5FRMA 2IBDA 1D5VA 3QODA 2QENA 3TOBA 2PMUA 2XAHA 4L0ZB 2RN7A 2EK5A 3ERMA 2MABA 2XC7A 4KMUX 2G0EA 1T38A 1TW3A 5LBQA 4M3DA 3S1QJ 1IN7A 1BI2A 2D2WA 2WV1A 1FYMA 2RC4A 2DOEA 2I5UA 2IEKA 2Y0SA 3LSIA 1FIPA 3BY6A 3RIRA 2K85A 4WXCA 3KPHA 1B6AA 1UHWA 3HEFA 3GCMA 4A3JJ 4GDFA 1NK2P 1WJBA 2D1HA 5AIQA 4E7SA 2BBYA 2F48A 3SDBA 5IT3A 2O9LA 3M1CA 3FXUA 1FJLA 3K6GA 4BQNA 4IJAA 1WJ5A 2K9QA 2ECCA 3KLOA 1Y1WJ 4S0HB 3BG5A 2LMDA 2OA4A 1ZGWA 2XHKA 2KRFA 3CUQC 1OCPA 1OCRH 4G6DA 2H1KA 1GHCA 1YW8A 4U7DA 1XB4A 3HTUA 3GEZA 4BXFA 5ICGA 4FCYA 1YJ9I 4PFPA 5E79C 1WH7A 1S29A 3KP5A 1OCOH 2K9MA 1MGTA 1TWFJ 3WTVC 3V4GA 3BLYA 3A2KA 2DLLA 4EEFG 4UUSB 2IGNA 1VQKI 4NC7A 2MC4A 2VASA 1YJNI 1BBYA 2CW0F 2R92J 2VQLA 2PEXA 3K70D 4ZYHA 1O57A 2GWRA 2JA7J 2RAEA 2J5OA 3FWEA 5HS8A 2CUEA 2ZNYA 1ULYA 3H3VK 4BAYA 4F52A 1H8AC 5E3OA 1TC3C 1TWGJ 3OR1C 2BHYA 3GTMJ 2VKHA 1J2XA 1L0OC 1IV6A 4L5JA 5FKMA 1ZN2A 3MCZA 2EFOA 3RYRA 2O03A 3VSLA 5C3EJ 1MBHA 5J47A 2M4KA 2FQ4A 4BYYA 4LFUA 5JHFA 4P9UA 3HHHA 4PGHA 2L7MP 4BHBA 2LFBA 2H6CA 1HF0A 2LKXA 2W1OA 1FTTA 2Q2EA 4MNUA 5LGUA 3VOEA 3OOUA 2VI6A 2W4SA 1KQ9A 1V54H 2F5EA 4UY8I 4DIQA 2QWWA 2LY2A 3KZIC 1FP1D 3JRCA 3HIFA 3SHFA 2MD0A 5FO5A 5D8KB 3CC2I 1ZKGA 1I6HJ 1H88C 2HVQA 2Q8KA 3RQIA 2KDOA 2UXNA 3KYCB 2IS6A 3TL4X 2NVQJ 3O8GA 1X1CA 2VOPA 3ZMUA 4WK8F 4B3AA 3JRHA 4G6TB 1BR2A 4BJTA 4Q47A 2GAUA 2V6CA 1T08B 2E71A 3DKYA 1HC8A 3MQ0A 3CO6C 4B1RA 3OYFA 3HOVJ 4X6AJ 1U0JA 4Y3OA 5KHDA 1TQMA 2VXZA 3BT9A 2XAUA 1IW7F 3LSKA 3PL8A 4XKWA 2NXNB 2O3FA 2CG4A 2YX7A 1K83J 2HR3A 5LLQA 1RESA 2XRNA 3NWTA 4CZCA 1DPUA 2BE5F 4A3LJ 3MKYB 2OZUA 3CMEI 3GFMA 4M3GA 5F08A 2MA3A 4MQ9F 2B9SA 3NAUA 2KFDA 4U0VA 4LK0F 1MH4A 3W6JB 3M8EA 4PJ0C 1EKEA 2P8TA 4RGSA 1X3UA 5LFAA 1V5GA 1WJCA 3OY9A 3LAJA 3QP6A 4LLGF 3IWZA 4HF2A 2F6CA 3L7WA 5FFXA 4L9JA 4QTRA 1SVLA 1BR1A 3BJAA 4GO1A 5EEHA 4S05A 3AL0B 1N25A 3E6MA 1A6IA 3A0BC 4OMYA 3ABTA 3C7JA 2CFOA 1Y56A 1ZRFA 1PYVA 2LVSA 2EA2A 3DBHB 2O5RA 4P1WA 5D5UB 3L2CA 2P6TA 3BCBA 1V4RA 1SD6A 1ETYA 1TLHB 1WH5A 4L0YB 2MGQA 2WV0A 3WTZA 4ANJA 1D0XA 3M07A 5HDNA 4U88A 2VKDA 5TRDA 3GTPJ 3RKWA 2AQEA 4I2OA 2DMUA 1LDJA 5HVQC 4YIIA 1XGNA 1S3JA 1XGOA 1OQYA 3A01A 4PZJA 1I6XA 5E8GA 3H5NA 1KYZA 1KYWA 2JVGA 3AG1H 4A3DJ 4A3GJ 4BQAA 1BOBA 2F4MB 5DCMA 2Z33A 1USSA 4MEXF 1HDDC 2RDPA 3C18A 3MKWB 3ZPLA 4YIFA 2HGCA 1U3EM 1A31A 3V8LA 1X2NA 2DQRA 2KP6A 4RB0A 4YEJA 3U9GA 4F93B 4M71A 1E3PA 4NQWA 3OYHA 1R4MB 2LF7A 3PO3J 4I01A 3Q9SA 3CCLI 2C6YA 1J5YA 2DDAA 2KIFA 4BQQA 3TW6A 2GM4A 2LBFA 2CQQA 4OOIA 3AG4H 2Y31A 4XLEA 5L3GA 5JR3A 2EH3A 2DODA 3N97A 2XDVA 5LHIA 2XROA 4PCQA 2V1UA 1BM9A 1X1DA 3Q0VA 2XSJC 2V4JC 4A2UA 1ETVA 2CQNA 5FB2A 1TT0A 3DTIA 4L5IA 1BIBA 2GXAA 5LHHA 3SFIA 2K9NA 3H5AA 2OUMA 1SFXA 5D4RA 1D0ZA 1LPQA 2FNAA 5HLTA 2H8RA 3JR9A 3ZMVA 3WGHA 4PK4A 1AU7A 1XGSA 2WAQA 1S72I 4Z6YA 3MKLA 4XSZF 4BXXJ 3FHZA 4BU2A 5EJCA 1DGWY 2VE8A 5BS6A 2VBWA 2ZC2A 4HNVA 3F22A 3J81Z 4DGWB 4XRSG 2JTVA 4JQFA 3E6DA 2X4HA 3E6BA 2XPUA 2QKLB 4CCJA 4YFXF 1DU0A 1YX5A 3ZQFA 4LLLA 5LRSA 1IGNA 2OJED 4C30A 3JAMZ 3L2VA 4XOTA 1G6NA 1P7IA 2VJ5A 3PQJA 1XSXA 1UELB 2IW5A 3I56I 2R7UA 1IDZA 2X6YA 1MMDA 3OS1A 3L2RA 1MW7A 4HV6A 3DFGA 2GZWA 2Z99A 3S1MJ 4DYRA 1ZQ3P 1S9HA 5L3EA 3E5QA 1KU7A 1YQAA 1IJWC 1RNLA 5A2QK 3RKYA 1ON1A 4CCKA 2VL8A 4G7OF 3S2WA 3KLNA 2FX0A 3V8KA 3S93A 3CCRI 4BBSJ 2VONA 1YS6A 3BCAA 1R5GA 1TNTA 2XAJA 3VYRB 1UJ8A 1IAWA 5J1UA 1ZR2A 3FZVA 3ZOBA 3HDDA 1G2HA 3FXRA 4CXFA 4ESFA 1IN5A 2VXDA 3BROA 5IT9Z 2QQ9A 4ZTJA 2E36A 3CCUI 2MW8A 1MD0A 2EWNA 2FMLA 2R7QA 1FBQA 2BW3A 2LY1A 3G4SI 1FPQA 5D4SA 3G3ZA 3FXMA 3FXOA 3K4BA 1FYKA 1BI1A 2E34A 3GFIA 5IP9J 2JT1A 1GV2A 2XB5A 1B72B 3D5LA 3P7NA 2Z16A 4N4NB 4CYCA 3I4NJ 1FMVA 1FNNA 3HUGA 3V7RA 2YR2A 5K7ZA 2E19A 3LSTA 4WX9A 1VQ8I 4P5OA 1MZBA 1FZPB 2F5CA 3OV8A 4ITVA 4DYQA 5DD4A 1BN5A 1HXDA 2HOEA 5EG0B 4AWXB 3LQQA 2LTPA 1FYLA 2M34A 2E60A 1R49A 2DTZA 3S3NA 3L9FA 3SXYA 1FBUA 5FLXZ 1E17A 4RBOA 3KP2A 2GIZA 4EJOA 2FA5A 5F64A 3W6VA 3K4LA 1O7LA 2PLYA 3G1MA 2TDXA 4ETSA 1RKWA 1RUOA 4CO8A 1Y8RB 5CKTA 1K79A 2IS1A 2ELKA 4HEA2 2DDBA 2FBIA 1ZR4A 1JJ8C 3ABMH 3ZGKA 4H0EA 5FJ8J 2BYVE 5ED4A 3WHBA 1RZ4A 2CQXA 3I4PA 4E7LA 2A07F 4XLNF 4CGZA 2A61A 5J8FA 3G73A 3H9QA 3CUQA 4HYEA 2Y9YA 3RJPA 3ZN0A 2Z1DA 1P9QC 1W0UA 3CD6I 4XN3A 3DF8A 2LRDA 2K3FA 2XSDC 4XICA 4G6QA 4MIMA 3T8TA 5F0FA 5F6FA 3CF5F 3PSIA 4C3JJ 5C4XJ 3IC7A 1AKHB 2NVXJ 1YYVA 3CCSI 1ON2A 2W24A 3PUFA 2FOWA 3N4MA 3EYIA 3TP0A 1JKRC 2DJIA 4N9IA 4I7HA 3FMRA 1MDMB 2KRHA 1ETXA 4KIFA 5BQTA 1IRZA 3T8RA 3JW4A 2Y0SN 3DEWA 2Q1ZB 2ETHA 2A05A 3WU2C 2RVCA 3OR2C 3LA2A 5DM7F 5GPCA 1O3TA 1XN7A 4E7JA 5CVJA 2J5PA 2O7OA 3WG9A 3MWMA 3JRIA 2PJRB 3SFZA 4OIRF 2M9HA 3BPVA 3WODF 1FOYA 4N0BA 1TT5B 1K7AA 1IN6A 3I3LA 2ZMEC 1U5TC 3V7SA 3GTOJ 2Y48A 3GTQJ 2HNHA 1ETOA 1T2KA 3BQYA 1X1AA 3O6BB 4UB8C 2MH9A 2DO7A 3X2QH 3ZMSA 1T39A 3WG7H 3S2DJ 5CVVA 3VEPA 5J4YA 3LFKA 1IXSB 1PP8F 3DEUA 1XDSA 2OF7A 3IRQA 1YHQI 5EG0A 5H2FC 1ZARA 2RGVA 3IL2A 1AWCA 2QSHX 2W85A 4LIVA 2ADUA 1KU2A 3C2BA 3ZCOA 3FMQA 5ILSA 2FEZA 4IZZA 1UG2A 2IA2A 3CC4I 1Z91A 4MQVA 3H0GJ 1QZYA 1MMGA 1ORKA 1SMTA 4M6VA 1R7JA 2EV6A 1ITYA 2JWTA 3QWLA 1LEAA 3BWGA 2EFNA 2YS9A 4RGXA 4BEHB 5DD8A 3JTHA 3KIOA 3IH3A 5CPRB 2KISA 1RUNA 4UVCA 1QRYA 1BW5A 3OS0A 4OINF 1QZEA 2JZYA 4FX0A 2X51A 3J7AO 1YIJI 3V7CA 1R22A 4M72A 2KKOA 1VQ6I 3R6SA 1SVMA 2HS5A 4NBQA 4BDZA 1ZAOA 3PM1A 1O3QA 5C4JJ 3O2PE 3MVPA 1QGPA 4B44A 4IHYA 5KCMA 4OIPF 2F5DA 2QVOA 2VT3A 3OIOA 3OYIA 3MEXA 2IA0A 4CCOA 4ZZLA 3JTGA 2HTJA 3PFYA 2R7VA 2PQ8A 1FSHA 1X19A 2X1EA 4A0XA 3AL0C 1UHSA 1ZG1A 3QQAA 1VQOI 4O3MA 1ZG5A 1VNDA 2QCOA 5LEJA 1VQNI 3GYHX 3AAFA 1D1AA 5E3MA 2R3SA 2KRCA 1Y0UA 3FBIB 2CFXA 2G9WA 4Z2YA 2FRHA 3ZMZA 3LL7A 1MDMA 3QP5A 4A0ZA 4HRIA 4C2TA 2HQAA 1SD5A 4GYIA 3OYMA 2H94A 2O0YA 2BHZA 3L2WA 4P96A 1X1PA 4IOAF 1Y8QB 1H89C 2DJNA 5F27A 3D5SC 5BPDA 1IV8A 2CV1A 4M3EA 2P0WA 3DCFA 3F8CA 4BE0A 4KIGA 1Y0NA 3LOCA 2X48A 2VQGA 5B1BH 1MJ9A 2PJRA 2ICWG 1WGXA 2OZ6A 3IAM2 3RYPA 4XL9A 2QBYA 4RM2A 4NC8A 2DFIA 2XAQA 3G1LA 5K5OA 3GLXA 2Z2SB 1G3YA 2IAIA 5DYMA 2A3SA 2DA1A 2L9VA 4E7IA 9ANTA 4NUBA 2LP0A 1PJRA 2MYSA 2NNYA 1S8NA 2JPCA 1F36A 4ESBA 5ILVA 3J7YJ 2YU3A 1R00A 5E17F 3GZNB 2K4JA 3I59B 2LYCA 5M5YJ 2O61A 4MGRA 1I1GA 3G71I 1VQLI 1HDPA 2ZJQF 2G7HA 2M0CA 2EIJH 4KN4X 2L9SA 4HQMA 3Q9VA 3ECHA 1OCCH 5GAHJ 3BR3A 2HXOA 5LRRA 3CQZJ 2ZXHA 2XVCA 4II3A 2HYFA 3OS2A 4BEHA 3M3YJ 2R0QC 1WWXA 4ENMA 2HU9A 4G94A 3SEQA 1UCRA 2VQCA 2B63J 1KONA 1A36A 4IO9F 2HQ5A 5LGTA 1O4XA 1ZTRA 2FE3A 1ZG3A 2OBPA 2E35A 2ZCWA 1IDYA 1TWCJ 3S1NJ 1OLTA 5AONA 1V55H 3ZP5A 4KUMA 3P9IA 5CQEA 1T56A 2QZ8A 2IPQX 1APLC 1ZYRF 1WJEA 2M5WA 5EDNA 3W2VA 1S7AA 4A3IJ 5JVTA 3KX2A 2JQ7A 2CO5A 2DFEA 2JRMA 2KMUA 1XG1A 3C2GA 4XRSA 1G3SA 1Y1VJ 3HOTA 1ETQA 5EZGA 1PVEA 4DNCA 1LE8B 3S2HJ 1R1VA 2CQ7A 4CICA 5FLVA 4D7NA 3DBLB 2M8EA 5GAEJ 1I3AA 1WI3A 3CJRB 5ERIA 1WZ2A 4LK1F 4AIJA 4PJNA 4JX6A 2M7AA 3R4KA 4WXHA 2DI3A 4KICA 2JK3A 1W7PA 1P6RA 4BH9A 3BR5A 4WWCA 1WJFA 2PMZA 2CWEA 4HSRA 4B48A 2HVRA 3BG3A 2HDCA 3OYCA 3KE2A 1TL8A 2P5VA 1DDNA 5HOOA 4BACA 2BZTA 4RLFA 4RM3A 1XC5A 4PJMA 1X4OA 2OAZA 2GXBA 1OMIA 2WAQN 2E5ZA 2VC1A 1FP2A 2L7FP 2X85A 2XPVA 2A69F 2LC2A 2VJIA 3BJOA 5TJJA 2ZMEB 1U5TB 2KL4A 3VSKA 3J81K 3RKQA 4AUXA 2EFPA 2WWYA 1X1BA 2R5YB 5K5QA 1XPXA 4CDGA 3CZ6A 1BIAA 2HQRA 1RI7A 2M7BA 2HEOA 1MBJA 1FIAA 4RGUA 5FKOA 2UWMA 3WTXC 3DLAA 1CF7A 1HSJA 4LG3A 4F7ZA 3OYLA 4Q5SF 4LMYA 4KYWA 3P9CA 4QLCU 3K4MA 3CP2A 1I3QJ 1SAUA 4IL6C 2BVMA 4IKFA 1BJZA 2IXSA 2W82A 3ABLH 3S17J 2L4MA 1H0MA 4L9VA 3K1PA 5F0CA 1MKMA 2E1OA 2KZGA 4EJUA 2BOLA 3BQZA 4ENNA 3PO2J 3BTCA 4Q4ZF 3HOSA 2NRAC 4AIKA 3K2ZA 4OU0A 2JMWA 3LMMA 5E18F 2ACJA 3HOWJ 1MNMC 3IV5A 1N77A 3H9JA 3IAS2 2LDUA 4QSHA 5IT9K 1G8XA 4Y33A 3DKXA 4DZPA 4Q48A 5CQGA 3IH4A 1AA7A 4DYCA 3L2UA 1B8IB 4ENJA 2DAOA 2A68F 5DUKA 4IHSA 4AU7A 2ZXWH 2K27A 1DGRM 3AFHA 3TP3A 4ZYEA 2VIXA 3OWTA 3ZQLA 4M9XA 3HKZN 2HDWA 1L3LA 3QU3A 2NS0A 5AIPA 4IOCF 3ABKH 4Y17A 2DA3A 3CCEI 2ZJRF 3F6VA 3TBIA 1RPWA 1USTA 2V9PA 3CCYA 4MFDA 4LGWA 2EPFA 3M9AA 4HDUA 1ZHFA 1ETKA 4E7KA 2X6XA 3I54A 1LNWA 2Y69H 2DYRH 4J19A 1E2XA 4UHTA 2L7KA 4UUSA 3K10A 5CVRA 3IKTA 3I9V2 1P4XA 3QRFF 1CGPA 4Y7NJ 3GVAA 5DV5A 4C3IJ 5TISC 4JOMA 2W48A 3U1KA 2CQKA 1K6OA 5GAGJ 1LFPA 3I64A 5DDGA 3L2QA 2EZLA 4FISA 4XMYA 2GIVA 2I8DA 1K6YA 2NAZA 1T0FC 5JLXA 5EEAA 3CC7I 1IXCA 1S7EA 3FIWA 1NTCA 2K40A 3E7LA 2WY7Q 4HQEA 3V42A 2LKSA 3HOZJ 3J80Z 2R7RA 2ZMEA 1U5TA 3BR6A 3PNTA 2X1DA 5FKLA 5CJ9A 1Y6IA 4CH7A 3J7AY 4I99C 2QEXI 1W5CC 3OYDA 4XM3A 3REOA 4MTDA 5FFZA 1IN8A 3DKWA 3HTSB 4JX4A 4L9TA 3PIPF 2CUZA 1OISA 2ECBA 3F21A 2K3PA 2W57A 3HZJA 2H27A 3ZQQA 2HXIA 5J3LA 5E3NA 3WTYC 1I39A 1TWHJ 3TW7A 3OIPA 2FOKA 1JGGA 4BNCA 1SANA 4KFCA 3KYDB 1JTYA 2L4AA 3G2BA 1EJ9A 3NARA 2EILH 3QPLA 3OYGA 1RIOH 4N9HA 3TGNA 2HPMA 4BHCA 1ZRCA 1NH3A 2EIMH 1Z6TA 1IN4A 5EYRA 4ZC3A 1MNDA 4IRGA 5L3FA 3F23A 3ESWB 2L54A 1GUUA 4UV8A 3K4NA 3DXJF 2EV0A 1X2MA 5GP9A 1IUFA 4LB5A 4YG2F 1XS9A 2QSFX 2ID3A 1OR7C 3KP4A 1XMAA 3CUOA 1BOAA 2LREA 2RQPA 2MC3A 1R23A 1FY7A 4R1HA 5CVUA 4EM0B 1LJ9A 1N75A 1B9MA 4KITB 2RQQA 2W00A 1B8IA 1LQ1A 5F1RA 3GWZA 1GVDA 1MMSA 4M74A 1HW5A 1XCVA 2FF4A 5D6FA 3CLOA 1P4AA 1YIOA 4KJZA 3W6KB 3OYJA 2KJCA 4PUSA 1WFXA 3IRRA 2KIUA 2DMQA 5LD2C 1K78B 4RAYA 3ZQGA 4JYKA 1DP3A 3HRUA 4LOCA 3ZXSA 1SFKA 2XGDA 1IO2A 3PNYA 2CV0A 2YUSA 4QIWN 1REPC 3CMMA 4I76A 4TV7A 2IA1A 4RAZA 2GLOA 1FTZA 4F92B 3ZQCA 4M3BA 1TZLA 2JA8J 3BTJA 4HOBA 4RLQA 3GF2A 5GPAA 3K9TA 1FOWA 3CDLA 1YS7A 2FBKA 1RETA 3H36A 3S16J 3SYTA 4I09A 4YIRX 2K02A 5J6XA 3BZKA 1MBGA 4B43A 1OFCX 2V1NA 2V9KA 3RI4A 2F4OB 4BY1J 2QSGX 1R1TA 2H1LA 2MFZA 3E1SA 2GQQA 4EGYA 1UB9A 3BR1A 3F8NA 2UUZA 4CCLA 1KQ0A 3EUAA 5J8CA 2K86A 2P6SA 4E7HA 5D5XB 2XRLA 4ENKA 3EDPA 1YO5C 3FXQA 5B1AH 5B66C 2HQNA 2R5ZB 4IPAA 3C3WA 5HNFA 1R71A 3GFJA 2ISZA 1EA3A 4E7ZA 4NDLA 2BY3A 1KZHA 3MMYB 2L02A 2IRFG 3HGYA 2X9DA 1JHFA 1I1SA 3EPZA 5E1XA 3C2HA 2FD5A 1OYIA 2W25A 3WGGA 4BDYA 2CYYA 5IOZA 3B6AA 3FM5A 3HKZA 2LD5A 1YG2A 3S3OA 1Z9CA 2AQFA 2WB1A 3HBLA 5ICCA 3LAPA 2RKHA 3DBRB 3TDUC 4AVPA 2LKPA 4WXDA 3GX4X 4BKXA 2ESNA 2QQAA 3RQ4A 4HX4A 1HSTA 6PAXA 1IRFA 3KCCA 1HKSA 3H1CA 1F5TA 2Y0MA 1RR7A 1JKQC 1WJAA 4L9NA 4XIDA 2P4WA 3L1PA 4PGGA 1J75A 3H92A 5B5EC 2HVSA 1RKTA 5HODA 3S32A 1QA6A 2R93J 2XF6A 1Q1HA 5M5WJ 3R0JA 3A0HC 3AKZA 2RV8A 1VQ7I 1OYWA 2JN6A 5GADJ 3OOPA 1QVTA 3AG3H 1U9OA 2BY1A 1OCZH 2OV7A 4ZYGA 2EB7A 1Z7UA 1R4NB 3W2WA 4JBAA 1BJAA 4DJAA 3R60A 1LDKB 2OTJI 1JI8A 3QOPA 5K7FA 3NWSA 4M6YA 4ABZA 2D1VA 3CCMI 3S1RJ 2P5KA 1TQIA 2DOFA 2V79A 3BZCA 3GLLA 3LFUA 5CYVA 4DOZA 3ECOA 4YRVA 1MSEC 2VKVA 2KHMA 2HOTA 1O3SA 4L5EA 2CGPA 1HCRA 1E3HA 1QO0D 1HOMA 2GXGA 4AIDA 2V6EA 2HZTA 2DFHA 1Q1VA 4O6JA 3FXLA 2E1NA 4I98B 3TKYA 2Y75A 5DS9A 3PFIA 3ZQHA 2EA4A 4CCNA 2DPUA 3EYYA 5L3CA 2H6BA 1WQ2A 5JI6A 3RPUA 2X6WA 1R6RA 1SVOA 1U9NA 2EINH 1IG7A 4U0WA 3IP4B 3G6EI 3VYSB 3SDGA 3KYLA 1X4PA 3BTIA 4ZYDA 1HKQA 4IQJA 1R58A 3OMYA 1D3YA 3TOAA 3CMYA 4D5FA 3GFLA 4RB3C 1FEXA 2H09A 3K69A 2HWVA 1E3OC 4Y15A 4RAFA 1JKPC 2QF7A 4Y13A 3LSPA 3ABUA 1OKRA 2NOJB 3FXJA 2N8GA 2PI0A 4P55A 5IY5H 3KEQA 4U7BA 2M8GX 1LFUP 2I10A 4PSWA 5LEKA 1B72A 2EJRA 2L2OA 2M30A 3I53A 3I4MJ 4DBQA 1Z0XA 2VJ4A 2R7TA 4RMNA 1V3FA 4RGRA 3DV8A 3IWFA 1W7PD 4WCGA 1TWAJ 3LSRA 4XN0A 4EV0A 2PMZN 1F9NA 1FMWA 2JA5J 2JRTA 1LDDA 5LHGA 1YLFA 2LF8A 3B6CA 2O8KA 3JSPA 2KIQA 3J7ZI 2HYGD 2WA0A 1DQUA 4A6EA 4JX5A 1FX7A 2HKXA 1W5TA 1SFEA 1FC3A 1XDUA 1MBFA 2XUBA 2DU9A 5D6EA 2KPMA 1WI9A 3DU6A 1YW9A 2D5VA 2PN6A 1TTYA 3DPTA 1HKTA 1MBKA 2NNNA 2V9VA 2K9SA 3TO9A 4UNOA 1S5LC 3M8FA 2HFHA 3A02A 1ENHA 1HQCA 2M0MA 2E1MC 3Q0WA 3LSGA 3F8MA 4B8XA 1EV7A 4FASD 1FT9A 3FHNA 1YX3A 2DA6A 3CTAA 1DP7P 3FM3A 5KAFC 4EVIA 3DEEA 1FSEA 3OSGA 3BOQA 3G1OA 1WKMA 2LR8A 4J00A 2QQ8A 1OCTC 1KGSA 3O3KA 4E6KG 4L18B 3VB2A 3ASOH 5L3BA 4FE4A 1W4MA 3WTSC 1AKHA 2QM3A 2Q0OA 2E1CA 2O6GE 5DTDA 2JVHA 1T6SA 4CYDA 3K70C 3VWBA 1WSUA 3WTTC 4XBFA 3ZQIA 2GBYA 4DQ2A 4XSXF 4OMZA 2IJLA 2Y30A 5M5XJ 1T0FA 1S6LA 4A3KJ 4CA0A 5HLGA 1W5SA 2XV4S 3OYEA 4BHPA 3M4OJ 2PG4A 4GFBA 2BV6A 3HGGA 2DW4A 2R7SA 3RZOJ 2PX9A 1NK3P 1J59A 3T0YA 1QHHD 3H3UA 2EZKA 3CCVI 4FETA 4M9ZA 2YPRA 3WHCA 4AC0A 3I5UA 4NC6A 1GVJA 3FK7A 2CMPA 4M3FA 1JE8A 1ZELA 4HG2A 2L7ZA 5E1ZB 4XQFA 3SJMA 3GZ6A 1HBXG 3U21A 1QHGA 3CCQI 3R0AA 4A69C 1B9NA 4HNUA 2RNJA 4HA8A 2QYOA 3BG7A 1B59A 2IS2A 1G3WA 2E7WA 4Y52J 4IRIA 2UXXA 3OIQA 3SZPA 4EJTA 1Z7LA 5BMZA 5E3LA 4FX4A 2E7XA 2H8WA 3E97A 4A0YA 3GW2A 2MD5A 3ZRGA 1STZA 5KAIC 4DBRA 1BL0A 2FJ1A 4UVAA 1KU9A 5K7HA 5FLMJ 3I55I 3HB9A 4PDKA 5FROA 5D5VB 2B7EA 3IHUA 3HYIA 1JHHA 1M1EB 5K5RA 2TCTA 3L00A 4LG0B 2DBBA 1OR7A 1ZLKA 2NYXA 3CCJI 5DUIA 2Q2EB 1A35A 2QQBA 1EH8A 2VE9A 2EIKH 4M6XA 1NG7A 4YELA 3I0TA 4A5NA 5IYDJ 1P92A 5ILUA 1Z6RA 3J80K 2OCEA 2HKOA 3OYBA 2STTA 4QPOA 1YI2I 4BY7J 3K1MA 2LG4A 1KA8A 4UV9A 1SMYF 2KLOA 3HG9A 3KETA 4RB2C 3QU6A 4XRMA 4HLYA 1LEBA 4EM1A 1W36C 4R8HA 1Z3XA 2O8XA 4GCVA 3C1DA 4ZH4F 2FU4A 2K7LA 4RAGA 1XTAA 3SEZA 3GUDA 5FD6A 4HX8A 5M3MJ 4G9YA 4KN7X 4KNYA 2CJJA 3HOUJ 1YTYA 4OWRB 2QGUA 3R61A 2JSCA 3PUBA 4A3EJ 1VQ4I 2XF7A 1KQ8A 2XGXA 2DK5A 1TNSA 2HOAA 3BP8A 4IEJA 1YITI 2NVTJ 4LIUA 1Z77A 3HHGA 4WF2A 1IC8A 1R5HA 4GXOA 1A5JA 1ACIA 5HLHA 2OC6A 2VKEA 2IT0A 2L9NA 4UVBA 4HF0A 4OIOF 2DT6A 1WJDA 3CJTB 1MBEA 2NVYJ 4NHJA 2ZNZA 4V2FA 3EUKL 4XLCA 2AHQA 2VBZA 3RPQA 4AIHA 3W2AA 5JLWA 2IS4A 2OD5A 5K1YA 1XD7A 2UV1A 1G3TA 3SZTA 1QBJA 4XR6A 3OL4A 2OTLI 2XAFA 2EBIA 1ZREA 2Z3YA 4LB6B 3ISPA 3P5JA 3ROUA 3UNGC 2VODA 2W84A 1LFBA 2ZSHB 1VQMI 2KT0A 1ZGJA 3EQLF 3Q3SA 1I50J 3TDZC 3WTUC 1JGSA 3OL3A 3U2RA 1VQ5I 4BQOA 1YRNB 5CVIA 1ZGAA 2L5QA 4OAYA 4MO7A 2DCEA 3I59A 4XLFA 5FKNA 3ERED 4D7MA 1BA5A 5EGOB 2DK8A 3FXKA 3JAMK 2HYJA 3OYKA 3BG9A 4BGDA 4XLPF 3JRDA 3K7AJ 3UR3C 5FGMA 3A01B 3AG2H 1U2WA 2HZDA 5DCMB 1G4DA 2V7FA 2ZJ2A 3WU0A 3H0DA 4BE1A 3ULQB 3DPLC 1SD7A 4LG0A 2BXZA 2GOMA 4IF4A 1IXRC 3CJQB 2LNBA 2VPLA 4FT8A 3DP7A 2M3AA 3VYTB 4E4HA 3MZ8A 4HZFA 4NQWB 1PDNC 3FBNB 2DA4A 5FRNA 4A93J 4FQGA 3P9KA 3D1NI 2KDZA 1RC9A 2B0LA 2XIGA 2ME6A 2HDDA 4KIBA 1XCBA 1FOXA 5JHUA 1XGMA 1U6GA 2OU2A 2E1MB 3MZYA 5GTIC 2R7ZJ 3HOXJ 2WBMA 4HAMA 2A5WA 5TGTA 2LBFB 2L0KA 1KU3A 5L3DA 4BXUA 1UZCA 3VDXA 4NB5A 5BNGA 1D1CA 1UAAA 1GDTA 2R7WA 3A4CA 1Z05A 1LE8A 3HM5A 1XMXA 1ZK8A 2VT2A 2ELHA 3VPRA 4HV5A 3L09A 3RCOA 2WB1N 1BI3A 2ZJPF 1BC7C 4GRIA 1QZZA 1O7FA 2WTEA 1XSVA 1IRXA 3KP6A 4KDPA 2P81A 4A5MA 3GTKJ 3QAHA 4BE2A 2K9LA 2DA5A 2KJBA 1R36A 3GO5A 4XKCA 1VZ0A 1ZH5A 2NOGA 4C3HJ 1D0YA 1R5ID 4A6DA 1Z67A 3S3MA 4KT6A 1AOYA 4IRHA 3PIOF 1JUSA 3EUHC 3JREA 5FLXK 4PJLA 3E0JB 3E5UA 3GXOA 5J40A 1ETWA 2Z5UA 4CUGA 1W36D 3A1YA 2YX4A 3O8HA 4G12A 1LB2A 5ICEA 2A5YB 3FKJA 4MTEA 1S7OA 4EMSA 2EFWA 1I27A 2PMHA 4ZDLA 2EZIA 1FWZA 3NQOA 2AXTC 4AD9A 4Y4RA 1J0RA 5IYBJ 5HS9A 2BY2A 2AXLA 2YU9J 1SC7A 2JSPA 3CP8A 1MSFC 3HOYJ 2ZFWA 1BR4A 4F91B 4I6ZA 3RKXA 2R5YA 4I0BA 3BTLA 1TW2A 1YRNA 5DEQA 2L01A 2XASA 3N05A 2BGCA 1V5FA 1VQ9I 1QVUA 2AO9A 3QYFA 5EGOA 4W97A 4B3XA 4X0GA 1JUPA 4A3FJ 3T5XA 4EGZA 2DMPA 2EQRA 2KIMA 3HC7A 4ZZDA 2MSYA 3K0LA 3RPUD 1YOVB 5J1RA 1Z21A 2M45A 3CDIA 1N78A 3LA3A 2PFBA 5BOXA 2CH0A 3MFKA 2IP2A 4F3QA 5H20A 2E2JJ 2BW3B 3HSEA 4DZJA 1QPMA 3E3VA 4B4CA 2Y2ZA 4D1QA 3COAC 3F72A 1JT6A 3DLLF 3MZHA 4G7HF 4BJ5C 4PSXA 3PSFA 4IHVA 2LSOA 5IYCJ 4CYCB 1H9TA 3HUGB 4IX7A 1T8IA 3WE2A 2A6HF 3LNQA 2VLAA 1HW2A 5LGNA 4EJWA 2F2EA 3DPUA 1FOKA 2ID6A 2R7DA 4I02A 3DQVC 3LSJA 2ZBKA 3GTLJ 1D5YA 4RA2A 2EZHA 2K5CA 3EETA 5BPIA 3QOEA 1J09A 3KZZA 1WCMJ 2R7OA 5DCFA 1T33A 2DN0A 2P7VB 3KEOA 1JXSA 1JKOC 3K4CA 1F1ZA 3BR0A 1NHAA 1LVAA 5F1JA 2VN2A 4KMFA 4P9FA 3WE3A 1HW1A 1TP4A 2QLZA 1JJ6C 3S8PA 4KISA 2GA2A 3BDDA 3E6CC 4MHGA 2L9RA 2ZFUA 1K4SA 2XB0X 1MMNA 2DA7A 2WC2A 4CCMA 4C9YA 2X1CA 3CLQA 2JUCA 4IXAA 4XKBA 1PUFB 3JRFA 3V8JA 4A3MJ 3QYBA 5HLIA 2HPIA 5IPAA 1ZRDA 1P7JA 3KP3A 4LITA 1POGA 1V5EA 3BPXA 4QWQA 3CUQB 5JFRA 3TO7A 2MG4A 3JRBA 3GMEA 4CSWA 3JRGA 4AYBN 2FUG2 3Q0UA 3LWFA 3OYNA 1DU6A 1IZ1A 5EZHA 3QPTA 1UMQA 4EJVA 4I0AA 3IUOA 4G7ZF 2OQRA 2BEOA 3DU5A 1FBSA 1A6QA 1LVKA 2M2EA 1SFOJ 1K4TA 2X6OA 4HDVA 1ONVA 2DQLA 4C2MJ 2COMA 3F3XA 1GXPA 4AM3A 2CV2A 2G7UA 1D8KA 2P5LC 1ODDA 2W7NA 4XLAA 3KFWX 3RDIA 3OSFA 4MLOA 1EF4A 3VODA 3CESA 3D0SA 2ELJA 3FKIJ 1K61A 4JK1X 2BY0A 5E1WA 4HLXA 4ZDOA 2FMYA 2X0LA 3FDYA 1MMAA 3HJEA 3M1EA 2Y9ZA 4RS8A 5J4VA 1R1UA 4MFEA 2XGEA 4IVNA 2IVMA 1UHMA 1SFUA 3PNVA 1OYYA 1PP7U 3GTJJ 1X3WB 3H35A 3HSFA 3VYUB 1YJWI 4BJ6C 3LSHA 3K1NA 1SEUA 3HL2A 1XMKA 1DUXC 4ON0A 2P7CB 2LY9A 3H3ZA 4YFKF 4J01A 1AHDP 1WPKA 1JUMA 3E5XA 2DPDA 2ZB9A 4RB1A 3TEDA 5KVRA 3BG6A 2K4BA 2A6TA 4HF1A 2VQHA 1C0WA 3BZ6A 1B1BA 4E70A 3RZDJ 2NS7A 5FKKA 5HNHA 5EEGA 2VJJA 3H9GA 3QYEA 1T95A 4LJZF 4X1EA 2DTRA 4M73A 5KK1A 1VFCA 5EF6A 1J7KA 2RNGA 1K78A 3ELKA 2DFFA 3A03A 4ZJZA 3FMSA 3CJNA 2WY8Q 4IHXA 3LA7A 5E20A 1VTNC 3WTWC 4HSTA 2R4GA 2NS8A 5IP6A 1TQPA 1Y39A 3MKZA 4V19K 1OJLA 2VUMJ 3LQRA 1IRGA 4HNTA 2DA2A 1U8BA 2TRTA 5F04A 1SD4A 2V26A 1PUFA 2BXYA 2COBA 2GOXB 2M1BA 5ICFA 1MJBA 4IHWA 2LH9A 2ZSIB 1UFMA 3ZMDA 5D5WB 4ZTFA 2L3DA 1MH3A 1X3ZB 2CS3A 3F8FA 3TO6A 2ZKZA 1R9TJ 1W1WE 1MNEA 2LLKA 4HBLA 1TBXA 4H4KC 4M9SA 2Z9OA 4CZZA 2ESHA 2BVLA 3NEUA 2OQGA 3M7GA 5B3SH 3CMAI 1RR8C 3S15J 2FQ3A 4IQ4A 4OAZA 4B47A 2QA4I 3ASNH 1LUJB 3TQNA 1PUEE 3SZGA 1XSDA 3W3CA 1BI0A 4XKVA 3T1BA 3KEYA 3ZR8X 2R5ZA 1XX5A 1YFHA 3WGIA 1BC8C 2MLGA 1WRJA 3PJRA 4O5VA 4A12A 3M8JA 2ZO4A 2KZVA 4FHTA 2ZXJA 4HW0A 3VFZA 5IP7J 5J1YA 2VB6A 3KP7A 3NRVA 5H6QA 1IF1A 2STWA 2LOOA 5CLSA 2QUFA 2DMTA 3HXLA 2CUJA 5H6RA 5KNLA 3ZMTA 3MAJA 3H5RA 2WADA 2QKMB 2E2HJ 1JTXA 1MJAA 3JSOA 1EH7A 3I71A 3HRSA 1YE9A 3ML6A 2DOAA 1U8RA 2QBYB 3HSRA 3JCUC 3WU1B 2R7XA 4EQQA 3GTGJ 3CDHA 2CUFA 3I58A 3SQNA 4XOPA 2CSOA 3LSMA 1A04A 2R7FA 2WAEA 2XKPA 2FXAA 2E2IJ 4V2GA 3RTRA 3CO7C 5E8IA 4S04A 1DPRA 4UXNA 4AVZA 2XAGA 4MEYF 1W0TA 4ESJA 2V1XA 4JP0A 4KT5C 5HS7A 1QU3A 2CU7A 2MH2A 4AYBA 1G59A 1JT0A 1Z3YA 4ZDPA 4K2EA 4A3CJ 4D9JA 4EATA 3K2AA 2HOSA 2V1DA 1EH6A 3QPSA 2F5VA 4KA4A 2IGOA 1Z1DA 2WAFA 5A2QZ 1SAXA 4U0YA 3D5RC 1IUYA 5C44J 4OIQF 2XPWA 3RSNA 2DYSH 4FTHA 1NG6A 4UUVA 1LKXA 3S14J 4NNJA 1VQPI 2DT5A 2VBXA 3FISA 5GTHC 3BR2A 1T98A 3DTEA 2JPBA 2DMNA 1UG0A 3KZYA 4PJJA 1B4AA 3MN2A 4D5CA 2XGCA 3ZN1A 2OPTA 1CQTA 1GV5A 2RREA 2XKOA 3BC8A 3EUHA 2M4GA 4BUPA 5HDKA 1J9IA 1YW7A 5F0HA 3DWLE 4BS9A 2LK2A 3QPHA 4UUTA 5HDGA 1QPIA 4CHUA 3HRMA 4HX7A 2CW7A 2M87A 4GGGA 3U1DA 2DXIA 2PJPA 5IOYA 1FLIA 2KQRA 2PBIA 1QNTA 4UB6C
chains in the Genus database with same CATH topology
5FJ8J 4MO7A 3WHBA 2CQXA 1GUUA 5FKNA 4D7MA 1BA5A 5EGOB 4BBRJ 2HYJA 3UKGA 3BG9A 1X2MA 5GP9A 1IUFA 3F0CA 1XS9A 3JRDA 2Y9YA 2ID3A 3K7AJ 1W0UA 3A01B 2XSDC 4XICA 4MIMA 4DW6A 1VI0A 1B8IA 5F0FA 2CRGA 4C3JJ 5C4XJ 1GVDA 1AKHB 2NVXJ 4A3BJ 2DMQA 2ME0A 2VPRA 3TP0A 2DA4A 2HI3A 4FE7A 3ZQGA 1JKRC 3JRAA 4A93J 3D1NI 1BW6A 4JYKA 2KDZA 2ME6A 2HDDA 4LOCA 2XGDA 2YUSA 4QIWN 2JA6J 1ETXA 1IRZA 2R7ZJ 3HOXJ 1GT0C 4I76A 2GLOA 1FTZA 2L0KA 2Y0SN 3DEWA 1VF9A 2JJ7A 3ZQCA 4M3BA 1F43A 4XK4A 2JA8J 3BTJA 5BNGA 5GPCA 4RDUA 1GDTA 5GPAA 2O7OA 5M3FJ 3CDLA 1LE8A 3JRIA 3S16J 1RETA 3HM5A 3GBGA 2M9HA 1ZK8A 3VPRA 3S1RJ 3IH2A 1MBGA 3GTOJ 2WB1N 3FK6A 4W1UA 1ETOA 3GTQJ 1U78A 1OFCX 3BQYA 1HLVA 4BY1J 1X58A 2P81A 3GTKJ 2IBDA 3BR1A 2DA5A 3S2DJ 2NOGA 4C3HJ 2XRLA 2OF7A 1JUSA 3JREA 5EG0A 2G0EA 4M3DA 3S1QJ 2WV1A 2R5ZB 2IEKA 3C2BA 1UG2A 1FIPA 1ETWA 3H0GJ 3O8HA 4NDLA 4G12A 1ORKA 3HGYA 3HEFA 2X9DA 4M6VA 4A3JJ 1NK2P 1ITYA 2EZIA 2JWTA 2FD5A 2YS9A 5IYBJ 5IOZA 3B6AA 3IH3A 2YU9J 2LD5A 1MSFC 3HOYJ 2O9LA 1FJLA 4I6ZA 1Y1WJ 2K9QA 2ECCA 2R5YA 4S0HB 3BG5A 3HBLA 1QRYA 3BTLA 1YRNA 1BW5A 1ZGWA 1OCPA 4BKXA 1QVUA 2AO9A 2H1KA 4FCYA 5EGOA 4W97A 1JUPA 1RR7A 1JKQC 1WH7A 4A3FJ 4XIDA 3L1PA 3PM1A 5C4JJ 3MVPA 2DMPA 2EQRA 1RKTA 4IHYA 1TWFJ 5HODA 2R93J 4EEFG 2MSYA 5M5WJ 4UUSB 3OIOA 5J1RA 2JN6A 2R92J 1QVTA 1U9OA 2JA7J 2E2JJ 2RAEA 2CUEA 1UHSA 3QQAA 4DZJA 4B4CA 3H3VK 1H8AC 1TC3C 5E3OA 1TWGJ 1VNDA 2QCOA 2Y2ZA 1JT6A 3GTMJ 1IV6A 5E3MA 5FKMA 5K7FA 4ABZA 4IHVA 5IYCJ 5C3EJ 1MBHA 4CYCB 2FQ4A 3LNQA 1H89C 2VKVA 1MSEC 2L7MP 2HOTA 2DJNA 5F27A 2LFBA 1HF0A 2ID6A 4L5EA 2LKXA 3LSJA 1HCRA 1FTTA 4M3EA 3DCFA 3OOUA 1HOMA 2VI6A 3GTLJ 3LOCA 2X48A 1D5YA 1Q1VA 5DS9A 2EZHA 1WGXA 3ZQHA 1WCMJ 3JRCA 1T33A 2DN0A 1JKOC 3BR0A 3G1LA 1ZKGA 5F1JA 1U9NA 1IG7A 1I6HJ 2IAIA 2DA1A 1H88C 9ANTA 2LP0A 1JJ6C 3SDGA 3BTIA 2L9RA 3RQIA 1F36A 2XB0X 2DA7A 2NVQJ 3O8GA 3CMYA 4B3AA 3JRHA 4D5FA 1FEXA 1PUFB 3JRFA 4A3MJ 4B1RA 5M5YJ 1E3OC 3HOVJ 4X6AJ 1JKPC 5IPAA 2QF7A 1P7JA 1HDPA 1POGA 2M0CA 3LSPA 3BT9A 2MG4A 3JRBA 3JRGA 2N8GA 4AYBN 3Q0UA 1DU6A 3BR3A 2HXOA 2M8GX 5EZHA 2I10A 1LFUP 1B72A 3CQZJ 1K83J 1UMQA 3M3YJ 1RESA 2R0QC 3I4MJ 1Z0XA 4A3LJ 2M2EA 1SFOJ 4M3GA 5F08A 3NAUA 2X6OA 2B63J 1MH4A 4C2MJ 2HQ5A 1TWAJ 3LSRA 1O4XA 1ZTRA 2PMZN 2JA5J 4QTRA 3B6CA 2O8KA 3OSFA 4MLOA 1IDYA 1TWCJ 3S1NJ 1EF4A 1A6IA 3FKIJ 1K61A 1T56A 4JX5A 1APLC 5EDNA 2Y9ZA 2LVSA 1MBFA 4A3IJ 4MFEA 2XGEA 1XG1A 4XRSA 2D5VA 1Y1VJ 3GTJJ 1ETQA 1MBKA 5EZGA 2K9SA 1LE8B 3S2HJ 1ETYA 1WH5A 3A02A 1ENHA 2MGQA 5FLVA 2LY9A 4D7NA 1WI3A 3Q0WA 3GTPJ 3LSGA 1AHDP 1WPKA 1JUMA 4JX6A 2ZB9A 2DMUA 2DA6A 3TEDA 2JK3A 3A01A 4A3DJ 3OSGA 3G1OA 2LR8A 3BR5A 4A3GJ 1OCTC 1HDDC 3RZDJ 2NS7A 3BG3A 5FKKA 4FE4A 1AKHA 1X2NA 4X1EA 1XC5A 5DTDA 1VFCA 5EF6A 2WAQN 3PO3J 3A03A 2L7FP 4IHXA 3ZQIA 2GBYA 2XPVA 2Y30A 5M5XJ 2NS8A 5IP6A 4A3KJ 3TW6A 2GM4A 1OJLA 3RKQA 4AUXA 2VUMJ 3M4OJ 2R5YB 4GFBA 2CQQA 2DA2A 3HGGA 1U8BA 2Y31A 3RZOJ 1NK3P 2TRTA 5F04A 2EH3A 1PUFA 2COBA 2EZKA 1MBJA 1FIAA 4AC0A 3WHCA 5FKOA 4IHWA 3Q0VA 3FK7A 1MH3A 4M3FA 1ETVA 2L7ZA 1R9TJ 3SJMA 2LLKA 3SFIA 2K9NA 2H8RA 1I3QJ 4A69C 3JR9A 1BJZA 3S17J 1AU7A 3S15J 3MKLA 4BXXJ 5F0CA 2E1OA 4Y52J 3PO2J 3BQZA 4HNVA 3BTCA 4XRSG 5E3LA 3HOWJ 2JMWA 2XPUA 2R5ZA 1MNMC 3IV5A 1BL0A 2FJ1A 1DU0A 3ZQFA 5K7HA 4QSHA 5FLMJ 1IGNA 3HB9A 5J1YA 5IP7J 4DZPA 3IH4A 4DYCA 1P7IA 1B8IB 2TCTA 2DMTA 1IDZA 3TP3A 2E2HJ 1JTXA 3ZQLA 3S1MJ 4DYRA 3HKZN 1ZQ3P 5IYDJ 1IJWC 2DA3A 3GTGJ 2CUFA 2FX0A 4BBSJ 1RPWA 4BY7J 3CCYA 4MFDA 2E2IJ 4V2GA 4XRMA 5J1UA 1ZR2A 1ETKA 3ZOBA 3HDDA 1G2HA 4J19A 4UUSA 4Y7NJ 4C3IJ 1W0TA 4JP0A 2W48A 5M3MJ 2MW8A 2CU7A 3HOUJ 1JT0A 2CJJA 2EZLA 4FISA 5JLXA 5EEAA 4A3CJ 1S7EA 3FIWA 3K2AA 4A3EJ 5IP9J 2HOSA 3E7LA 1NTCA 1GV2A 2K40A 2HOAA 2XB5A 3QPSA 4IEJA 1B72B 2NVTJ 1Z77A 1IC8A 3HOZJ 4CYCA 3I4NJ 1A5JA 3BR6A 5FKLA 2VKEA 5K7ZA 2E19A 5C44J 2XPWA 4FTHA 1MBEA 2NVYJ 4DYQA 3S14J 3FISA 3BR2A 5EG0B 4JX4A 4V2FA 2LTPA 2ECBA 2M34A 2AHQA 2DMNA 2DTZA 3MN2A 2HXIA 5JLWA 5J3LA 4D5CA 2XGCA 5E3NA 2OPTA 1CQTA 1GV5A 1TWHJ 3TW7A 4RBOA 2EBIA 1JGGA 1SANA 5F0HA 3W6VA 1JTYA 3G1MA 2LK2A 4UUTA 1QPIA 1LFBA 1RKWA 3NARA 3QPLA 2KT0A 3Q3SA 5IOYA 1I50J 2ELKA 1ZR4A 1JJ8C 1YRNB 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 J;  4MO7 A;  3WHB A;  2CQX A;  1GUU A;  5FKN A;  4D7M A;  1BA5 A;  5EGO B;  4BBR J;  2HYJ A;  3UKG A;  3BG9 A;  1X2M A;  5GP9 A;  1IUF A;  3F0C A;  1XS9 A;  3JRD A;  2Y9Y A;  2ID3 A;  3K7A J;  1W0U A;  3A01 B;  2XSD C;  4XIC A;  4MIM A;  4DW6 A;  1VI0 A;  1B8I A;  5F0F A;  2CRG A;  4C3J J;  5C4X J;  1GVD A;  1AKH B;  2NVX J;  4A3B J;  2DMQ A;  2ME0 A;  2VPR A;  3TP0 A;  2DA4 A;  2HI3 A;  4FE7 A;  3ZQG A;  1JKR C;  3JRA A;  4A93 J;  3D1N I;  1BW6 A;  4JYK A;  2KDZ A;  2ME6 A;  2HDD A;  4LOC A;  2XGD A;  2YUS A;  4QIW N;  2JA6 J;  1ETX A;  1IRZ A;  2R7Z J;  3HOX J;  1GT0 C;  4I76 A;  2GLO A;  1FTZ A;  2L0K A;  2Y0S N;  3DEW A;  1VF9 A;  2JJ7 A;  3ZQC A;  4M3B A;  1F43 A;  4XK4 A;  2JA8 J;  3BTJ A;  5BNG A;  5GPC A;  4RDU A;  1GDT A;  5GPA A;  2O7O A;  5M3F J;  3CDL A;  1LE8 A;  3JRI A;  3S16 J;  1RET A;  3HM5 A;  3GBG A;  2M9H A;  1ZK8 A;  3VPR A;  3S1R J;  3IH2 A;  1MBG A;  3GTO J;  2WB1 N;  3FK6 A;  4W1U A;  1ETO A;  3GTQ J;  1U78 A;  1OFC X;  3BQY A;  1HLV A;  4BY1 J;  1X58 A;  2P81 A;  3GTK J;  2IBD A;  3BR1 A;  2DA5 A;  3S2D J;  2NOG A;  4C3H J;  2XRL A;  2OF7 A;  1JUS A;  3JRE A;  5EG0 A;  2G0E A;  4M3D A;  3S1Q J;  2WV1 A;  2R5Z B;  2IEK A;  3C2B A;  1UG2 A;  1FIP A;  1ETW A;  3H0G J;  3O8H A;  4NDL A;  4G12 A;  1ORK A;  3HGY A;  3HEF A;  2X9D A;  4M6V A;  4A3J J;  1NK2 P;  1ITY A;  2EZI A;  2JWT A;  2FD5 A;  2YS9 A;  5IYB J;  5IOZ A;  3B6A A;  3IH3 A;  2YU9 J;  2LD5 A;  1MSF C;  3HOY J;  2O9L A;  1FJL A;  4I6Z A;  1Y1W J;  2K9Q A;  2ECC A;  2R5Y A;  4S0H B;  3BG5 A;  3HBL A;  1QRY A;  3BTL A;  1YRN A;  1BW5 A;  1ZGW A;  1OCP A;  4BKX A;  1QVU A;  2AO9 A;  2H1K A;  4FCY A;  5EGO A;  4W97 A;  1JUP A;  1RR7 A;  1JKQ C;  1WH7 A;  4A3F J;  4XID A;  3L1P A;  3PM1 A;  5C4J J;  3MVP A;  2DMP A;  2EQR A;  1RKT A;  4IHY A;  1TWF J;  5HOD A;  2R93 J;  4EEF G;  2MSY A;  5M5W J;  4UUS B;  3OIO A;  5J1R A;  2JN6 A;  2R92 J;  1QVT A;  1U9O A;  2JA7 J;  2E2J J;  2RAE A;  2CUE A;  1UHS A;  3QQA A;  4DZJ A;  4B4C A;  3H3V K;  1H8A C;  1TC3 C;  5E3O A;  1TWG J;  1VND A;  2QCO A;  2Y2Z A;  1JT6 A;  3GTM J;  1IV6 A;  5E3M A;  5FKM A;  5K7F A;  4ABZ A;  4IHV A;  5IYC J;  5C3E J;  1MBH A;  4CYC B;  2FQ4 A;  3LNQ A;  1H89 C;  2VKV A;  1MSE C;  2L7M P;  2HOT A;  2DJN A;  5F27 A;  2LFB A;  1HF0 A;  2ID6 A;  4L5E A;  2LKX A;  3LSJ A;  1HCR A;  1FTT A;  4M3E A;  3DCF A;  3OOU A;  1HOM A;  2VI6 A;  3GTL J;  3LOC A;  2X48 A;  1D5Y A;  1Q1V A;  5DS9 A;  2EZH A;  1WGX A;  3ZQH A;  1WCM J;  3JRC A;  1T33 A;  2DN0 A;  1JKO C;  3BR0 A;  3G1L A;  1ZKG A;  5F1J A;  1U9N A;  1IG7 A;  1I6H J;  2IAI A;  2DA1 A;  1H88 C;  9ANT A;  2LP0 A;  1JJ6 C;  3SDG A;  3BTI A;  2L9R A;  3RQI A;  1F36 A;  2XB0 X;  2DA7 A;  2NVQ J;  3O8G A;  3CMY A;  4B3A A;  3JRH A;  4D5F A;  1FEX A;  1PUF B;  3JRF A;  4A3M J;  4B1R A;  5M5Y J;  1E3O C;  3HOV J;  4X6A J;  1JKP C;  5IPA A;  2QF7 A;  1P7J A;  1HDP A;  1POG A;  2M0C A;  3LSP A;  3BT9 A;  2MG4 A;  3JRB A;  3JRG A;  2N8G A;  4AYB N;  3Q0U A;  1DU6 A;  3BR3 A;  2HXO A;  2M8G X;  5EZH A;  2I10 A;  1LFU P;  1B72 A;  3CQZ J;  1K83 J;  1UMQ A;  3M3Y J;  1RES A;  2R0Q C;  3I4M J;  1Z0X A;  4A3L J;  2M2E A;  1SFO J;  4M3G A;  5F08 A;  3NAU A;  2X6O A;  2B63 J;  1MH4 A;  4C2M J;  2HQ5 A;  1TWA J;  3LSR A;  1O4X A;  1ZTR A;  2PMZ N;  2JA5 J;  4QTR A;  3B6C A;  2O8K A;  3OSF A;  4MLO A;  1IDY A;  1TWC J;  3S1N J;  1EF4 A;  1A6I A;  3FKI J;  1K61 A;  1T56 A;  4JX5 A;  1APL C;  5EDN A;  2Y9Z A;  2LVS A;  1MBF A;  4A3I J;  4MFE A;  2XGE A;  1XG1 A;  4XRS A;  2D5V A;  1Y1V J;  3GTJ J;  1ETQ A;  1MBK A;  5EZG A;  2K9S A;  1LE8 B;  3S2H J;  1ETY A;  1WH5 A;  3A02 A;  1ENH A;  2MGQ A;  5FLV A;  2LY9 A;  4D7N A;  1WI3 A;  3Q0W A;  3GTP J;  3LSG A;  1AHD P;  1WPK A;  1JUM A;  4JX6 A;  2ZB9 A;  2DMU A;  2DA6 A;  3TED A;  2JK3 A;  3A01 A;  4A3D J;  3OSG A;  3G1O A;  2LR8 A;  3BR5 A;  4A3G J;  1OCT C;  1HDD C;  3RZD J;  2NS7 A;  3BG3 A;  5FKK A;  4FE4 A;  1AKH A;  1X2N A;  4X1E A;  1XC5 A;  5DTD A;  1VFC A;  5EF6 A;  2WAQ N;  3PO3 J;  3A03 A;  2L7F P;  4IHX A;  3ZQI A;  2GBY A;  2XPV A;  2Y30 A;  5M5X J;  2NS8 A;  5IP6 A;  4A3K J;  3TW6 A;  2GM4 A;  1OJL A;  3RKQ A;  4AUX A;  2VUM J;  3M4O J;  2R5Y B;  4GFB A;  2CQQ A;  2DA2 A;  3HGG A;  1U8B A;  2Y31 A;  3RZO J;  1NK3 P;  2TRT A;  5F04 A;  2EH3 A;  1PUF A;  2COB A;  2EZK A;  1MBJ A;  1FIA A;  4AC0 A;  3WHC A;  5FKO A;  4IHW A;  3Q0V A;  3FK7 A;  1MH3 A;  4M3F A;  1ETV A;  2L7Z A;  1R9T J;  3SJM A;  2LLK A;  3SFI A;  2K9N A;  2H8R A;  1I3Q J;  4A69 C;  3JR9 A;  1BJZ A;  3S17 J;  1AU7 A;  3S15 J;  3MKL A;  4BXX J;  5F0C A;  2E1O A;  4Y52 J;  3PO2 J;  3BQZ A;  4HNV A;  3BTC A;  4XRS G;  5E3L A;  3HOW J;  2JMW A;  2XPU A;  2R5Z A;  1MNM C;  3IV5 A;  1BL0 A;  2FJ1 A;  1DU0 A;  3ZQF A;  5K7H A;  4QSH A;  5FLM J;  1IGN A;  3HB9 A;  5J1Y A;  5IP7 J;  4DZP A;  3IH4 A;  4DYC A;  1P7I A;  1B8I B;  2TCT A;  2DMT A;  1IDZ A;  3TP3 A;  2E2H J;  1JTX A;  3ZQL A;  3S1M J;  4DYR A;  3HKZ N;  1ZQ3 P;  5IYD J;  1IJW C;  2DA3 A;  3GTG J;  2CUF A;  2FX0 A;  4BBS J;  1RPW A;  4BY7 J;  3CCY A;  4MFD A;  2E2I J;  4V2G A;  4XRM A;  5J1U A;  1ZR2 A;  1ETK A;  3ZOB A;  3HDD A;  1G2H A;  4J19 A;  4UUS A;  4Y7N J;  4C3I J;  1W0T A;  4JP0 A;  2W48 A;  5M3M J;  2MW8 A;  2CU7 A;  3HOU J;  1JT0 A;  2CJJ A;  2EZL A;  4FIS A;  5JLX A;  5EEA A;  4A3C J;  1S7E A;  3FIW A;  3K2A A;  4A3E J;  5IP9 J;  2HOS A;  3E7L A;  1NTC A;  1GV2 A;  2K40 A;  2HOA A;  2XB5 A;  3QPS A;  4IEJ A;  1B72 B;  2NVT J;  1Z77 A;  1IC8 A;  3HOZ J;  4CYC A;  3I4N J;  1A5J A;  3BR6 A;  5FKL A;  2VKE A;  5K7Z A;  2E19 A;  5C44 J;  2XPW A;  4FTH A;  1MBE A;  2NVY J;  4DYQ A;  3S14 J;  3FIS A;  3BR2 A;  5EG0 B;  4JX4 A;  4V2F A;  2LTP A;  2ECB A;  2M34 A;  2AHQ A;  2DMN A;  2DTZ A;  3MN2 A;  2HXI A;  5JLW A;  5J3L A;  4D5C A;  2XGC A;  5E3N A;  2OPT A;  1CQT A;  1GV5 A;  1TWH J;  3TW7 A;  4RBO A;  2EBI A;  1JGG A;  1SAN A;  5F0H A;  3W6V A;  1JTY A;  3G1M A;  2LK2 A;  4UUT A;  1QPI A;  1LFB A;  1RKW A;  3NAR A;  3QPL A;  2KT0 A;  3Q3S A;  5IOY A;  1I50 J;  2ELK A;  1ZR4 A;  1JJ8 C;  1YRN B;  5EYR A; 
#chains in the Genus database with same CATH topology
 2VOO A;  3GZ5 A;  1HA8 A;  4ZYA A;  2EFQ A;  3K4K A;  1GXQ A;  2VBY A;  2JUG A;  4XLH A;  1ERD A;  4B09 A;  4HPQ A;  4QPQ A;  4BBR J;  4IHT A;  2FBH A;  2E5N A;  2EV5 A;  3UKG A;  2F4I A;  2OCC H;  3F0C A;  4II2 A;  3TMO A;  1I5Z A;  4XRF A;  1W7P B;  5JVG F;  2F5F A;  3FF5 A;  4ASN A;  4GYG A;  4DW6 A;  5D8L B;  2AS5 F;  4BL0 B;  1VI0 A;  2A6E F;  2IGM A;  1WHU A;  3B73 A;  2CRG A;  3HRT A;  2VC0 A;  2UZK A;  1H9G A;  2YSR A;  3F8B A;  2FNP A;  2NVU B;  1O3R A;  2MLK A;  2CW8 A;  2D45 A;  4R79 A;  3B02 A;  4A3B J;  2ME0 A;  4U87 A;  2JA2 A;  4XON A;  4XOR A;  2ZXI A;  3OYA A;  2VPR A;  2HI3 A;  1GLN A;  4FE7 A;  3BJ6 A;  4N4O B;  3JRA A;  1MIJ A;  1BW6 A;  4D0P A;  1F4K A;  2MBF A;  2XF5 A;  1OPC A;  2IGK A;  2JA6 J;  3F9K A;  1RRJ A;  1GT0 C;  4G8X A;  5FD5 A;  1VF9 A;  2JJ7 A;  3CF2 A;  2GA1 A;  4F55 A;  1ZLJ A;  1F43 A;  4XK4 A;  2ISY A;  4RDU A;  4LLN A;  3FX3 A;  5M3F J;  4C2U A;  3GBG A;  1D8J A;  2FSW A;  1P4W A;  1WVR A;  2DT7 B;  1QQI A;  3ONQ A;  3HPH A;  1D1B A;  1P2F A;  3IH2 A;  4EM2 A;  5DM6 F;  2HTS A;  3DTK A;  3F6O A;  4XNF A;  4YFN F;  3IKV A;  1CF7 B;  3FK6 A;  4W1U A;  3PQK A;  1E0E A;  1U78 A;  3MD2 A;  3K4J A;  4PFO A;  1HLV A;  3ZQ7 A;  3Q5F A;  3HPG A;  4LD5 A;  1X58 A;  5FRM A;  2IBD A;  1D5V A;  3QOD A;  2QEN A;  3TOB A;  2PMU A;  2XAH A;  4L0Z B;  2RN7 A;  2EK5 A;  3ERM A;  2MAB A;  2XC7 A;  4KMU X;  2G0E A;  1T38 A;  1TW3 A;  5LBQ A;  4M3D A;  3S1Q J;  1IN7 A;  1BI2 A;  2D2W A;  2WV1 A;  1FYM A;  2RC4 A;  2DOE A;  2I5U A;  2IEK A;  2Y0S A;  3LSI A;  1FIP A;  3BY6 A;  3RIR A;  2K85 A;  4WXC A;  3KPH A;  1B6A A;  1UHW A;  3HEF A;  3GCM A;  4A3J J;  4GDF A;  1NK2 P;  1WJB A;  2D1H A;  5AIQ A;  4E7S A;  2BBY A;  2F48 A;  3SDB A;  5IT3 A;  2O9L A;  3M1C A;  3FXU A;  1FJL A;  3K6G A;  4BQN A;  4IJA A;  1WJ5 A;  2K9Q A;  2ECC A;  3KLO A;  1Y1W J;  4S0H B;  3BG5 A;  2LMD A;  2OA4 A;  1ZGW A;  2XHK A;  2KRF A;  3CUQ C;  1OCP A;  1OCR H;  4G6D A;  2H1K A;  1GHC A;  1YW8 A;  4U7D A;  1XB4 A;  3HTU A;  3GEZ A;  4BXF A;  5ICG A;  4FCY A;  1YJ9 I;  4PFP A;  5E79 C;  1WH7 A;  1S29 A;  3KP5 A;  1OCO H;  2K9M A;  1MGT A;  1TWF J;  3WTV C;  3V4G A;  3BLY A;  3A2K A;  2DLL A;  4EEF G;  4UUS B;  2IGN A;  1VQK I;  4NC7 A;  2MC4 A;  2VAS A;  1YJN I;  1BBY A;  2CW0 F;  2R92 J;  2VQL A;  2PEX A;  3K70 D;  4ZYH A;  1O57 A;  2GWR A;  2JA7 J;  2RAE A;  2J5O A;  3FWE A;  5HS8 A;  2CUE A;  2ZNY A;  1ULY A;  3H3V K;  4BAY A;  4F52 A;  1H8A C;  5E3O A;  1TC3 C;  1TWG J;  3OR1 C;  2BHY A;  3GTM J;  2VKH A;  1J2X A;  1L0O C;  1IV6 A;  4L5J A;  5FKM A;  1ZN2 A;  3MCZ A;  2EFO A;  3RYR A;  2O03 A;  3VSL A;  5C3E J;  1MBH A;  5J47 A;  2M4K A;  2FQ4 A;  4BYY A;  4LFU A;  5JHF A;  4P9U A;  3HHH A;  4PGH A;  2L7M P;  4BHB A;  2LFB A;  2H6C A;  1HF0 A;  2LKX A;  2W1O A;  1FTT A;  2Q2E A;  4MNU A;  5LGU A;  3VOE A;  3OOU A;  2VI6 A;  2W4S A;  1KQ9 A;  1V54 H;  2F5E A;  4UY8 I;  4DIQ A;  2QWW A;  2LY2 A;  3KZI C;  1FP1 D;  3JRC A;  3HIF A;  3SHF A;  2MD0 A;  5FO5 A;  5D8K B;  3CC2 I;  1ZKG A;  1I6H J;  1H88 C;  2HVQ A;  2Q8K A;  3RQI A;  2KDO A;  2UXN A;  3KYC B;  2IS6 A;  3TL4 X;  2NVQ J;  3O8G A;  1X1C A;  2VOP A;  3ZMU A;  4WK8 F;  4B3A A;  3JRH A;  4G6T B;  1BR2 A;  4BJT A;  4Q47 A;  2GAU A;  2V6C A;  1T08 B;  2E71 A;  3DKY A;  1HC8 A;  3MQ0 A;  3CO6 C;  4B1R A;  3OYF A;  3HOV J;  4X6A J;  1U0J A;  4Y3O A;  5KHD A;  1TQM A;  2VXZ A;  3BT9 A;  2XAU A;  1IW7 F;  3LSK A;  3PL8 A;  4XKW A;  2NXN B;  2O3F A;  2CG4 A;  2YX7 A;  1K83 J;  2HR3 A;  5LLQ A;  1RES A;  2XRN A;  3NWT A;  4CZC A;  1DPU A;  2BE5 F;  4A3L J;  3MKY B;  2OZU A;  3CME I;  3GFM A;  4M3G A;  5F08 A;  2MA3 A;  4MQ9 F;  2B9S A;  3NAU A;  2KFD A;  4U0V A;  4LK0 F;  1MH4 A;  3W6J B;  3M8E A;  4PJ0 C;  1EKE A;  2P8T A;  4RGS A;  1X3U A;  5LFA A;  1V5G A;  1WJC A;  3OY9 A;  3LAJ A;  3QP6 A;  4LLG F;  3IWZ A;  4HF2 A;  2F6C A;  3L7W A;  5FFX A;  4L9J A;  4QTR A;  1SVL A;  1BR1 A;  3BJA A;  4GO1 A;  5EEH A;  4S05 A;  3AL0 B;  1N25 A;  3E6M A;  1A6I A;  3A0B C;  4OMY A;  3ABT A;  3C7J A;  2CFO A;  1Y56 A;  1ZRF A;  1PYV A;  2LVS A;  2EA2 A;  3DBH B;  2O5R A;  4P1W A;  5D5U B;  3L2C A;  2P6T A;  3BCB A;  1V4R A;  1SD6 A;  1ETY A;  1TLH B;  1WH5 A;  4L0Y B;  2MGQ A;  2WV0 A;  3WTZ A;  4ANJ A;  1D0X A;  3M07 A;  5HDN A;  4U88 A;  2VKD A;  5TRD A;  3GTP J;  3RKW A;  2AQE A;  4I2O A;  2DMU A;  1LDJ A;  5HVQ C;  4YII A;  1XGN A;  1S3J A;  1XGO A;  1OQY A;  3A01 A;  4PZJ A;  1I6X A;  5E8G A;  3H5N A;  1KYZ A;  1KYW A;  2JVG A;  3AG1 H;  4A3D J;  4A3G J;  4BQA A;  1BOB A;  2F4M B;  5DCM A;  2Z33 A;  1USS A;  4MEX F;  1HDD C;  2RDP A;  3C18 A;  3MKW B;  3ZPL A;  4YIF A;  2HGC A;  1U3E M;  1A31 A;  3V8L A;  1X2N A;  2DQR A;  2KP6 A;  4RB0 A;  4YEJ A;  3U9G A;  4F93 B;  4M71 A;  1E3P A;  4NQW A;  3OYH A;  1R4M B;  2LF7 A;  3PO3 J;  4I01 A;  3Q9S A;  3CCL I;  2C6Y A;  1J5Y A;  2DDA A;  2KIF A;  4BQQ A;  3TW6 A;  2GM4 A;  2LBF A;  2CQQ A;  4OOI A;  3AG4 H;  2Y31 A;  4XLE A;  5L3G A;  5JR3 A;  2EH3 A;  2DOD A;  3N97 A;  2XDV A;  5LHI A;  2XRO A;  4PCQ A;  2V1U A;  1BM9 A;  1X1D A;  3Q0V A;  2XSJ C;  2V4J C;  4A2U A;  1ETV A;  2CQN A;  5FB2 A;  1TT0 A;  3DTI A;  4L5I A;  1BIB A;  2GXA A;  5LHH A;  3SFI A;  2K9N A;  3H5A A;  2OUM A;  1SFX A;  5D4R A;  1D0Z A;  1LPQ A;  2FNA A;  5HLT A;  2H8R A;  3JR9 A;  3ZMV A;  3WGH A;  4PK4 A;  1AU7 A;  1XGS A;  2WAQ A;  1S72 I;  4Z6Y A;  3MKL A;  4XSZ F;  4BXX J;  3FHZ A;  4BU2 A;  5EJC A;  1DGW Y;  2VE8 A;  5BS6 A;  2VBW A;  2ZC2 A;  4HNV A;  3F22 A;  3J81 Z;  4DGW B;  4XRS G;  2JTV A;  4JQF A;  3E6D A;  2X4H A;  3E6B A;  2XPU A;  2QKL B;  4CCJ A;  4YFX F;  1DU0 A;  1YX5 A;  3ZQF A;  4LLL A;  5LRS A;  1IGN A;  2OJE D;  4C30 A;  3JAM Z;  3L2V A;  4XOT A;  1G6N A;  1P7I A;  2VJ5 A;  3PQJ A;  1XSX A;  1UEL B;  2IW5 A;  3I56 I;  2R7U A;  1IDZ A;  2X6Y A;  1MMD A;  3OS1 A;  3L2R A;  1MW7 A;  4HV6 A;  3DFG A;  2GZW A;  2Z99 A;  3S1M J;  4DYR A;  1ZQ3 P;  1S9H A;  5L3E A;  3E5Q A;  1KU7 A;  1YQA A;  1IJW C;  1RNL A;  5A2Q K;  3RKY A;  1ON1 A;  4CCK A;  2VL8 A;  4G7O F;  3S2W A;  3KLN A;  2FX0 A;  3V8K A;  3S93 A;  3CCR I;  4BBS J;  2VON A;  1YS6 A;  3BCA A;  1R5G A;  1TNT A;  2XAJ A;  3VYR B;  1UJ8 A;  1IAW A;  5J1U A;  1ZR2 A;  3FZV A;  3ZOB A;  3HDD A;  1G2H A;  3FXR A;  4CXF A;  4ESF A;  1IN5 A;  2VXD A;  3BRO A;  5IT9 Z;  2QQ9 A;  4ZTJ A;  2E36 A;  3CCU I;  2MW8 A;  1MD0 A;  2EWN A;  2FML A;  2R7Q A;  1FBQ A;  2BW3 A;  2LY1 A;  3G4S I;  1FPQ A;  5D4S A;  3G3Z A;  3FXM A;  3FXO A;  3K4B A;  1FYK A;  1BI1 A;  2E34 A;  3GFI A;  5IP9 J;  2JT1 A;  1GV2 A;  2XB5 A;  1B72 B;  3D5L A;  3P7N A;  2Z16 A;  4N4N B;  4CYC A;  3I4N J;  1FMV A;  1FNN A;  3HUG A;  3V7R A;  2YR2 A;  5K7Z A;  2E19 A;  3LST A;  4WX9 A;  1VQ8 I;  4P5O A;  1MZB A;  1FZP B;  2F5C A;  3OV8 A;  4ITV A;  4DYQ A;  5DD4 A;  1BN5 A;  1HXD A;  2HOE A;  5EG0 B;  4AWX B;  3LQQ A;  2LTP A;  1FYL A;  2M34 A;  2E60 A;  1R49 A;  2DTZ A;  3S3N A;  3L9F A;  3SXY A;  1FBU A;  5FLX Z;  1E17 A;  4RBO A;  3KP2 A;  2GIZ A;  4EJO A;  2FA5 A;  5F64 A;  3W6V A;  3K4L A;  1O7L A;  2PLY A;  3G1M A;  2TDX A;  4ETS A;  1RKW A;  1RUO A;  4CO8 A;  1Y8R B;  5CKT A;  1K79 A;  2IS1 A;  2ELK A;  4HEA 2;  2DDB A;  2FBI A;  1ZR4 A;  1JJ8 C;  3ABM H;  3ZGK A;  4H0E A;  5FJ8 J;  2BYV E;  5ED4 A;  3WHB A;  1RZ4 A;  2CQX A;  3I4P A;  4E7L A;  2A07 F;  4XLN F;  4CGZ A;  2A61 A;  5J8F A;  3G73 A;  3H9Q A;  3CUQ A;  4HYE A;  2Y9Y A;  3RJP A;  3ZN0 A;  2Z1D A;  1P9Q C;  1W0U A;  3CD6 I;  4XN3 A;  3DF8 A;  2LRD A;  2K3F A;  2XSD C;  4XIC A;  4G6Q A;  4MIM A;  3T8T A;  5F0F A;  5F6F A;  3CF5 F;  3PSI A;  4C3J J;  5C4X J;  3IC7 A;  1AKH B;  2NVX J;  1YYV A;  3CCS I;  1ON2 A;  2W24 A;  3PUF A;  2FOW A;  3N4M A;  3EYI A;  3TP0 A;  1JKR C;  2DJI A;  4N9I A;  4I7H A;  3FMR A;  1MDM B;  2KRH A;  1ETX A;  4KIF A;  5BQT A;  1IRZ A;  3T8R A;  3JW4 A;  2Y0S N;  3DEW A;  2Q1Z B;  2ETH A;  2A05 A;  3WU2 C;  2RVC A;  3OR2 C;  3LA2 A;  5DM7 F;  5GPC A;  1O3T A;  1XN7 A;  4E7J A;  5CVJ A;  2J5P A;  2O7O A;  3WG9 A;  3MWM A;  3JRI A;  2PJR B;  3SFZ A;  4OIR F;  2M9H A;  3BPV A;  3WOD F;  1FOY A;  4N0B A;  1TT5 B;  1K7A A;  1IN6 A;  3I3L A;  2ZME C;  1U5T C;  3V7S A;  3GTO J;  2Y48 A;  3GTQ J;  2HNH A;  1ETO A;  1T2K A;  3BQY A;  1X1A A;  3O6B B;  4UB8 C;  2MH9 A;  2DO7 A;  3X2Q H;  3ZMS A;  1T39 A;  3WG7 H;  3S2D J;  5CVV A;  3VEP A;  5J4Y A;  3LFK A;  1IXS B;  1PP8 F;  3DEU A;  1XDS A;  2OF7 A;  3IRQ A;  1YHQ I;  5EG0 A;  5H2F C;  1ZAR A;  2RGV A;  3IL2 A;  1AWC A;  2QSH X;  2W85 A;  4LIV A;  2ADU A;  1KU2 A;  3C2B A;  3ZCO A;  3FMQ A;  5ILS A;  2FEZ A;  4IZZ A;  1UG2 A;  2IA2 A;  3CC4 I;  1Z91 A;  4MQV A;  3H0G J;  1QZY A;  1MMG A;  1ORK A;  1SMT A;  4M6V A;  1R7J A;  2EV6 A;  1ITY A;  2JWT A;  3QWL A;  1LEA A;  3BWG A;  2EFN A;  2YS9 A;  4RGX A;  4BEH B;  5DD8 A;  3JTH A;  3KIO A;  3IH3 A;  5CPR B;  2KIS A;  1RUN A;  4UVC A;  1QRY A;  1BW5 A;  3OS0 A;  4OIN F;  1QZE A;  2JZY A;  4FX0 A;  2X51 A;  3J7A O;  1YIJ I;  3V7C A;  1R22 A;  4M72 A;  2KKO A;  1VQ6 I;  3R6S A;  1SVM A;  2HS5 A;  4NBQ A;  4BDZ A;  1ZAO A;  3PM1 A;  1O3Q A;  5C4J J;  3O2P E;  3MVP A;  1QGP A;  4B44 A;  4IHY A;  5KCM A;  4OIP F;  2F5D A;  2QVO A;  2VT3 A;  3OIO A;  3OYI A;  3MEX A;  2IA0 A;  4CCO A;  4ZZL A;  3JTG A;  2HTJ A;  3PFY A;  2R7V A;  2PQ8 A;  1FSH A;  1X19 A;  2X1E A;  4A0X A;  3AL0 C;  1UHS A;  1ZG1 A;  3QQA A;  1VQO I;  4O3M A;  1ZG5 A;  1VND A;  2QCO A;  5LEJ A;  1VQN I;  3GYH X;  3AAF A;  1D1A A;  5E3M A;  2R3S A;  2KRC A;  1Y0U A;  3FBI B;  2CFX A;  2G9W A;  4Z2Y A;  2FRH A;  3ZMZ A;  3LL7 A;  1MDM A;  3QP5 A;  4A0Z A;  4HRI A;  4C2T A;  2HQA A;  1SD5 A;  4GYI A;  3OYM A;  2H94 A;  2O0Y A;  2BHZ A;  3L2W A;  4P96 A;  1X1P A;  4IOA F;  1Y8Q B;  1H89 C;  2DJN A;  5F27 A;  3D5S C;  5BPD A;  1IV8 A;  2CV1 A;  4M3E A;  2P0W A;  3DCF A;  3F8C A;  4BE0 A;  4KIG A;  1Y0N A;  3LOC A;  2X48 A;  2VQG A;  5B1B H;  1MJ9 A;  2PJR A;  2ICW G;  1WGX A;  2OZ6 A;  3IAM 2;  3RYP A;  4XL9 A;  2QBY A;  4RM2 A;  4NC8 A;  2DFI A;  2XAQ A;  3G1L A;  5K5O A;  3GLX A;  2Z2S B;  1G3Y A;  2IAI A;  5DYM A;  2A3S A;  2DA1 A;  2L9V A;  4E7I A;  9ANT A;  4NUB A;  2LP0 A;  1PJR A;  2MYS A;  2NNY A;  1S8N A;  2JPC A;  1F36 A;  4ESB A;  5ILV A;  3J7Y J;  2YU3 A;  1R00 A;  5E17 F;  3GZN B;  2K4J A;  3I59 B;  2LYC A;  5M5Y J;  2O61 A;  4MGR A;  1I1G A;  3G71 I;  1VQL I;  1HDP A;  2ZJQ F;  2G7H A;  2M0C A;  2EIJ H;  4KN4 X;  2L9S A;  4HQM A;  3Q9V A;  3ECH A;  1OCC H;  5GAH J;  3BR3 A;  2HXO A;  5LRR A;  3CQZ J;  2ZXH A;  2XVC A;  4II3 A;  2HYF A;  3OS2 A;  4BEH A;  3M3Y J;  2R0Q C;  1WWX A;  4ENM A;  2HU9 A;  4G94 A;  3SEQ A;  1UCR A;  2VQC A;  2B63 J;  1KON A;  1A36 A;  4IO9 F;  2HQ5 A;  5LGT A;  1O4X A;  1ZTR A;  2FE3 A;  1ZG3 A;  2OBP A;  2E35 A;  2ZCW A;  1IDY A;  1TWC J;  3S1N J;  1OLT A;  5AON A;  1V55 H;  3ZP5 A;  4KUM A;  3P9I A;  5CQE A;  1T56 A;  2QZ8 A;  2IPQ X;  1APL C;  1ZYR F;  1WJE A;  2M5W A;  5EDN A;  3W2V A;  1S7A A;  4A3I J;  5JVT A;  3KX2 A;  2JQ7 A;  2CO5 A;  2DFE A;  2JRM A;  2KMU A;  1XG1 A;  3C2G A;  4XRS A;  1G3S A;  1Y1V J;  3HOT A;  1ETQ A;  5EZG A;  1PVE A;  4DNC A;  1LE8 B;  3S2H J;  1R1V A;  2CQ7 A;  4CIC A;  5FLV A;  4D7N A;  3DBL B;  2M8E A;  5GAE J;  1I3A A;  1WI3 A;  3CJR B;  5ERI A;  1WZ2 A;  4LK1 F;  4AIJ A;  4PJN A;  4JX6 A;  2M7A A;  3R4K A;  4WXH A;  2DI3 A;  4KIC A;  2JK3 A;  1W7P A;  1P6R A;  4BH9 A;  3BR5 A;  4WWC A;  1WJF A;  2PMZ A;  2CWE A;  4HSR A;  4B48 A;  2HVR A;  3BG3 A;  2HDC A;  3OYC A;  3KE2 A;  1TL8 A;  2P5V A;  1DDN A;  5HOO A;  4BAC A;  2BZT A;  4RLF A;  4RM3 A;  1XC5 A;  4PJM A;  1X4O A;  2OAZ A;  2GXB A;  1OMI A;  2WAQ N;  2E5Z A;  2VC1 A;  1FP2 A;  2L7F P;  2X85 A;  2XPV A;  2A69 F;  2LC2 A;  2VJI A;  3BJO A;  5TJJ A;  2ZME B;  1U5T B;  2KL4 A;  3VSK A;  3J81 K;  3RKQ A;  4AUX A;  2EFP A;  2WWY A;  1X1B A;  2R5Y B;  5K5Q A;  1XPX A;  4CDG A;  3CZ6 A;  1BIA A;  2HQR A;  1RI7 A;  2M7B A;  2HEO A;  1MBJ A;  1FIA A;  4RGU A;  5FKO A;  2UWM A;  3WTX C;  3DLA A;  1CF7 A;  1HSJ A;  4LG3 A;  4F7Z A;  3OYL A;  4Q5S F;  4LMY A;  4KYW A;  3P9C A;  4QLC U;  3K4M A;  3CP2 A;  1I3Q J;  1SAU A;  4IL6 C;  2BVM A;  4IKF A;  1BJZ A;  2IXS A;  2W82 A;  3ABL H;  3S17 J;  2L4M A;  1H0M A;  4L9V A;  3K1P A;  5F0C A;  1MKM A;  2E1O A;  2KZG A;  4EJU A;  2BOL A;  3BQZ A;  4ENN A;  3PO2 J;  3BTC A;  4Q4Z F;  3HOS A;  2NRA C;  4AIK A;  3K2Z A;  4OU0 A;  2JMW A;  3LMM A;  5E18 F;  2ACJ A;  3HOW J;  1MNM C;  3IV5 A;  1N77 A;  3H9J A;  3IAS 2;  2LDU A;  4QSH A;  5IT9 K;  1G8X A;  4Y33 A;  3DKX A;  4DZP A;  4Q48 A;  5CQG A;  3IH4 A;  1AA7 A;  4DYC A;  3L2U A;  1B8I B;  4ENJ A;  2DAO A;  2A68 F;  5DUK A;  4IHS A;  4AU7 A;  2ZXW H;  2K27 A;  1DGR M;  3AFH A;  3TP3 A;  4ZYE A;  2VIX A;  3OWT A;  3ZQL A;  4M9X A;  3HKZ N;  2HDW A;  1L3L A;  3QU3 A;  2NS0 A;  5AIP A;  4IOC F;  3ABK H;  4Y17 A;  2DA3 A;  3CCE I;  2ZJR F;  3F6V A;  3TBI A;  1RPW A;  1UST A;  2V9P A;  3CCY A;  4MFD A;  4LGW A;  2EPF A;  3M9A A;  4HDU A;  1ZHF A;  1ETK A;  4E7K A;  2X6X A;  3I54 A;  1LNW A;  2Y69 H;  2DYR H;  4J19 A;  1E2X A;  4UHT A;  2L7K A;  4UUS A;  3K10 A;  5CVR A;  3IKT A;  3I9V 2;  1P4X A;  3QRF F;  1CGP A;  4Y7N J;  3GVA A;  5DV5 A;  4C3I J;  5TIS C;  4JOM A;  2W48 A;  3U1K A;  2CQK A;  1K6O A;  5GAG J;  1LFP A;  3I64 A;  5DDG A;  3L2Q A;  2EZL A;  4FIS A;  4XMY A;  2GIV A;  2I8D A;  1K6Y A;  2NAZ A;  1T0F C;  5JLX A;  5EEA A;  3CC7 I;  1IXC A;  1S7E A;  3FIW A;  1NTC A;  2K40 A;  3E7L A;  2WY7 Q;  4HQE A;  3V42 A;  2LKS A;  3HOZ J;  3J80 Z;  2R7R A;  2ZME A;  1U5T A;  3BR6 A;  3PNT A;  2X1D A;  5FKL A;  5CJ9 A;  1Y6I A;  4CH7 A;  3J7A Y;  4I99 C;  2QEX I;  1W5C C;  3OYD A;  4XM3 A;  3REO A;  4MTD A;  5FFZ A;  1IN8 A;  3DKW A;  3HTS B;  4JX4 A;  4L9T A;  3PIP F;  2CUZ A;  1OIS A;  2ECB A;  3F21 A;  2K3P A;  2W57 A;  3HZJ A;  2H27 A;  3ZQQ A;  2HXI A;  5J3L A;  5E3N A;  3WTY C;  1I39 A;  1TWH J;  3TW7 A;  3OIP A;  2FOK A;  1JGG A;  4BNC A;  1SAN A;  4KFC A;  3KYD B;  1JTY A;  2L4A A;  3G2B A;  1EJ9 A;  3NAR A;  2EIL H;  3QPL A;  3OYG A;  1RIO H;  4N9H A;  3TGN A;  2HPM A;  4BHC A;  1ZRC A;  1NH3 A;  2EIM H;  1Z6T A;  1IN4 A;  5EYR A;  4ZC3 A;  1MND A;  4IRG A;  5L3F A;  3F23 A;  3ESW B;  2L54 A;  1GUU A;  4UV8 A;  3K4N A;  3DXJ F;  2EV0 A;  1X2M A;  5GP9 A;  1IUF A;  4LB5 A;  4YG2 F;  1XS9 A;  2QSF X;  2ID3 A;  1OR7 C;  3KP4 A;  1XMA A;  3CUO A;  1BOA A;  2LRE A;  2RQP A;  2MC3 A;  1R23 A;  1FY7 A;  4R1H A;  5CVU A;  4EM0 B;  1LJ9 A;  1N75 A;  1B9M A;  4KIT B;  2RQQ A;  2W00 A;  1B8I A;  1LQ1 A;  5F1R A;  3GWZ A;  1GVD A;  1MMS A;  4M74 A;  1HW5 A;  1XCV A;  2FF4 A;  5D6F A;  3CLO A;  1P4A A;  1YIO A;  4KJZ A;  3W6K B;  3OYJ A;  2KJC A;  4PUS A;  1WFX A;  3IRR A;  2KIU A;  2DMQ A;  5LD2 C;  1K78 B;  4RAY A;  3ZQG A;  4JYK A;  1DP3 A;  3HRU A;  4LOC A;  3ZXS A;  1SFK A;  2XGD A;  1IO2 A;  3PNY A;  2CV0 A;  2YUS A;  4QIW N;  1REP C;  3CMM A;  4I76 A;  4TV7 A;  2IA1 A;  4RAZ A;  2GLO A;  1FTZ A;  4F92 B;  3ZQC A;  4M3B A;  1TZL A;  2JA8 J;  3BTJ A;  4HOB A;  4RLQ A;  3GF2 A;  5GPA A;  3K9T A;  1FOW A;  3CDL A;  1YS7 A;  2FBK A;  1RET A;  3H36 A;  3S16 J;  3SYT A;  4I09 A;  4YIR X;  2K02 A;  5J6X A;  3BZK A;  1MBG A;  4B43 A;  1OFC X;  2V1N A;  2V9K A;  3RI4 A;  2F4O B;  4BY1 J;  2QSG X;  1R1T A;  2H1L A;  2MFZ A;  3E1S A;  2GQQ A;  4EGY A;  1UB9 A;  3BR1 A;  3F8N A;  2UUZ A;  4CCL A;  1KQ0 A;  3EUA A;  5J8C A;  2K86 A;  2P6S A;  4E7H A;  5D5X B;  2XRL A;  4ENK A;  3EDP A;  1YO5 C;  3FXQ A;  5B1A H;  5B66 C;  2HQN A;  2R5Z B;  4IPA A;  3C3W A;  5HNF A;  1R71 A;  3GFJ A;  2ISZ A;  1EA3 A;  4E7Z A;  4NDL A;  2BY3 A;  1KZH A;  3MMY B;  2L02 A;  2IRF G;  3HGY A;  2X9D A;  1JHF A;  1I1S A;  3EPZ A;  5E1X A;  3C2H A;  2FD5 A;  1OYI A;  2W25 A;  3WGG A;  4BDY A;  2CYY A;  5IOZ A;  3B6A A;  3FM5 A;  3HKZ A;  2LD5 A;  1YG2 A;  3S3O A;  1Z9C A;  2AQF A;  2WB1 A;  3HBL A;  5ICC A;  3LAP A;  2RKH A;  3DBR B;  3TDU C;  4AVP A;  2LKP A;  4WXD A;  3GX4 X;  4BKX A;  2ESN A;  2QQA A;  3RQ4 A;  4HX4 A;  1HST A;  6PAX A;  1IRF A;  3KCC A;  1HKS A;  3H1C A;  1F5T A;  2Y0M A;  1RR7 A;  1JKQ C;  1WJA A;  4L9N A;  4XID A;  2P4W A;  3L1P A;  4PGG A;  1J75 A;  3H92 A;  5B5E C;  2HVS A;  1RKT A;  5HOD A;  3S32 A;  1QA6 A;  2R93 J;  2XF6 A;  1Q1H A;  5M5W J;  3R0J A;  3A0H C;  3AKZ A;  2RV8 A;  1VQ7 I;  1OYW A;  2JN6 A;  5GAD J;  3OOP A;  1QVT A;  3AG3 H;  1U9O A;  2BY1 A;  1OCZ H;  2OV7 A;  4ZYG A;  2EB7 A;  1Z7U A;  1R4N B;  3W2W A;  4JBA A;  1BJA A;  4DJA A;  3R60 A;  1LDK B;  2OTJ I;  1JI8 A;  3QOP A;  5K7F A;  3NWS A;  4M6Y A;  4ABZ A;  2D1V A;  3CCM I;  3S1R J;  2P5K A;  1TQI A;  2DOF A;  2V79 A;  3BZC A;  3GLL A;  3LFU A;  5CYV A;  4DOZ A;  3ECO A;  4YRV A;  1MSE C;  2VKV A;  2KHM A;  2HOT A;  1O3S A;  4L5E A;  2CGP A;  1HCR A;  1E3H A;  1QO0 D;  1HOM A;  2GXG A;  4AID A;  2V6E A;  2HZT A;  2DFH A;  1Q1V A;  4O6J A;  3FXL A;  2E1N A;  4I98 B;  3TKY A;  2Y75 A;  5DS9 A;  3PFI A;  3ZQH A;  2EA4 A;  4CCN A;  2DPU A;  3EYY A;  5L3C A;  2H6B A;  1WQ2 A;  5JI6 A;  3RPU A;  2X6W A;  1R6R A;  1SVO A;  1U9N A;  2EIN H;  1IG7 A;  4U0W A;  3IP4 B;  3G6E I;  3VYS B;  3SDG A;  3KYL A;  1X4P A;  3BTI A;  4ZYD A;  1HKQ A;  4IQJ A;  1R58 A;  3OMY A;  1D3Y A;  3TOA A;  3CMY A;  4D5F A;  3GFL A;  4RB3 C;  1FEX A;  2H09 A;  3K69 A;  2HWV A;  1E3O C;  4Y15 A;  4RAF A;  1JKP C;  2QF7 A;  4Y13 A;  3LSP A;  3ABU A;  1OKR A;  2NOJ B;  3FXJ A;  2N8G A;  2PI0 A;  4P55 A;  5IY5 H;  3KEQ A;  4U7B A;  2M8G X;  1LFU P;  2I10 A;  4PSW A;  5LEK A;  1B72 A;  2EJR A;  2L2O A;  2M30 A;  3I53 A;  3I4M J;  4DBQ A;  1Z0X A;  2VJ4 A;  2R7T A;  4RMN A;  1V3F A;  4RGR A;  3DV8 A;  3IWF A;  1W7P D;  4WCG A;  1TWA J;  3LSR A;  4XN0 A;  4EV0 A;  2PMZ N;  1F9N A;  1FMW A;  2JA5 J;  2JRT A;  1LDD A;  5LHG A;  1YLF A;  2LF8 A;  3B6C A;  2O8K A;  3JSP A;  2KIQ A;  3J7Z I;  2HYG D;  2WA0 A;  1DQU A;  4A6E A;  4JX5 A;  1FX7 A;  2HKX A;  1W5T A;  1SFE A;  1FC3 A;  1XDU A;  1MBF A;  2XUB A;  2DU9 A;  5D6E A;  2KPM A;  1WI9 A;  3DU6 A;  1YW9 A;  2D5V A;  2PN6 A;  1TTY A;  3DPT A;  1HKT A;  1MBK A;  2NNN A;  2V9V A;  2K9S A;  3TO9 A;  4UNO A;  1S5L C;  3M8F A;  2HFH A;  3A02 A;  1ENH A;  1HQC A;  2M0M A;  2E1M C;  3Q0W A;  3LSG A;  3F8M A;  4B8X A;  1EV7 A;  4FAS D;  1FT9 A;  3FHN A;  1YX3 A;  2DA6 A;  3CTA A;  1DP7 P;  3FM3 A;  5KAF C;  4EVI A;  3DEE A;  1FSE A;  3OSG A;  3BOQ A;  3G1O A;  1WKM A;  2LR8 A;  4J00 A;  2QQ8 A;  1OCT C;  1KGS A;  3O3K A;  4E6K G;  4L18 B;  3VB2 A;  3ASO H;  5L3B A;  4FE4 A;  1W4M A;  3WTS C;  1AKH A;  2QM3 A;  2Q0O A;  2E1C A;  2O6G E;  5DTD A;  2JVH A;  1T6S A;  4CYD A;  3K70 C;  3VWB A;  1WSU A;  3WTT C;  4XBF A;  3ZQI A;  2GBY A;  4DQ2 A;  4XSX F;  4OMZ A;  2IJL A;  2Y30 A;  5M5X J;  1T0F A;  1S6L A;  4A3K J;  4CA0 A;  5HLG A;  1W5S A;  2XV4 S;  3OYE A;  4BHP A;  3M4O J;  2PG4 A;  4GFB A;  2BV6 A;  3HGG A;  2DW4 A;  2R7S A;  3RZO J;  2PX9 A;  1NK3 P;  1J59 A;  3T0Y A;  1QHH D;  3H3U A;  2EZK A;  3CCV I;  4FET A;  4M9Z A;  2YPR A;  3WHC A;  4AC0 A;  3I5U A;  4NC6 A;  1GVJ A;  3FK7 A;  2CMP A;  4M3F A;  1JE8 A;  1ZEL A;  4HG2 A;  2L7Z A;  5E1Z B;  4XQF A;  3SJM A;  3GZ6 A;  1HBX G;  3U21 A;  1QHG A;  3CCQ I;  3R0A A;  4A69 C;  1B9N A;  4HNU A;  2RNJ A;  4HA8 A;  2QYO A;  3BG7 A;  1B59 A;  2IS2 A;  1G3W A;  2E7W A;  4Y52 J;  4IRI A;  2UXX A;  3OIQ A;  3SZP A;  4EJT A;  1Z7L A;  5BMZ A;  5E3L A;  4FX4 A;  2E7X A;  2H8W A;  3E97 A;  4A0Y A;  3GW2 A;  2MD5 A;  3ZRG A;  1STZ A;  5KAI C;  4DBR A;  1BL0 A;  2FJ1 A;  4UVA A;  1KU9 A;  5K7H A;  5FLM J;  3I55 I;  3HB9 A;  4PDK A;  5FRO A;  5D5V B;  2B7E A;  3IHU A;  3HYI A;  1JHH A;  1M1E B;  5K5R A;  2TCT A;  3L00 A;  4LG0 B;  2DBB A;  1OR7 A;  1ZLK A;  2NYX A;  3CCJ I;  5DUI A;  2Q2E B;  1A35 A;  2QQB A;  1EH8 A;  2VE9 A;  2EIK H;  4M6X A;  1NG7 A;  4YEL A;  3I0T A;  4A5N A;  5IYD J;  1P92 A;  5ILU A;  1Z6R A;  3J80 K;  2OCE A;  2HKO A;  3OYB A;  2STT A;  4QPO A;  1YI2 I;  4BY7 J;  3K1M A;  2LG4 A;  1KA8 A;  4UV9 A;  1SMY F;  2KLO A;  3HG9 A;  3KET A;  4RB2 C;  3QU6 A;  4XRM A;  4HLY A;  1LEB A;  4EM1 A;  1W36 C;  4R8H A;  1Z3X A;  2O8X A;  4GCV A;  3C1D A;  4ZH4 F;  2FU4 A;  2K7L A;  4RAG A;  1XTA A;  3SEZ A;  3GUD A;  5FD6 A;  4HX8 A;  5M3M J;  4G9Y A;  4KN7 X;  4KNY A;  2CJJ A;  3HOU J;  1YTY A;  4OWR B;  2QGU A;  3R61 A;  2JSC A;  3PUB A;  4A3E J;  1VQ4 I;  2XF7 A;  1KQ8 A;  2XGX A;  2DK5 A;  1TNS A;  2HOA A;  3BP8 A;  4IEJ A;  1YIT I;  2NVT J;  4LIU A;  1Z77 A;  3HHG A;  4WF2 A;  1IC8 A;  1R5H A;  4GXO A;  1A5J A;  1ACI A;  5HLH A;  2OC6 A;  2VKE A;  2IT0 A;  2L9N A;  4UVB A;  4HF0 A;  4OIO F;  2DT6 A;  1WJD A;  3CJT B;  1MBE A;  2NVY J;  4NHJ A;  2ZNZ A;  4V2F A;  3EUK L;  4XLC A;  2AHQ A;  2VBZ A;  3RPQ A;  4AIH A;  3W2A A;  5JLW A;  2IS4 A;  2OD5 A;  5K1Y A;  1XD7 A;  2UV1 A;  1G3T A;  3SZT A;  1QBJ A;  4XR6 A;  3OL4 A;  2OTL I;  2XAF A;  2EBI A;  1ZRE A;  2Z3Y A;  4LB6 B;  3ISP A;  3P5J A;  3ROU A;  3UNG C;  2VOD A;  2W84 A;  1LFB A;  2ZSH B;  1VQM I;  2KT0 A;  1ZGJ A;  3EQL F;  3Q3S A;  1I50 J;  3TDZ C;  3WTU C;  1JGS A;  3OL3 A;  3U2R A;  1VQ5 I;  4BQO A;  1YRN B;  5CVI A;  1ZGA A;  2L5Q A;  4OAY A;  4MO7 A;  2DCE A;  3I59 A;  4XLF A;  5FKN A;  3ERE D;  4D7M A;  1BA5 A;  5EGO B;  2DK8 A;  3FXK A;  3JAM K;  2HYJ A;  3OYK A;  3BG9 A;  4BGD A;  4XLP F;  3JRD A;  3K7A J;  3UR3 C;  5FGM A;  3A01 B;  3AG2 H;  1U2W A;  2HZD A;  5DCM B;  1G4D A;  2V7F A;  2ZJ2 A;  3WU0 A;  3H0D A;  4BE1 A;  3ULQ B;  3DPL C;  1SD7 A;  4LG0 A;  2BXZ A;  2GOM A;  4IF4 A;  1IXR C;  3CJQ B;  2LNB A;  2VPL A;  4FT8 A;  3DP7 A;  2M3A A;  3VYT B;  4E4H A;  3MZ8 A;  4HZF A;  4NQW B;  1PDN C;  3FBN B;  2DA4 A;  5FRN A;  4A93 J;  4FQG A;  3P9K A;  3D1N I;  2KDZ A;  1RC9 A;  2B0L A;  2XIG A;  2ME6 A;  2HDD A;  4KIB A;  1XCB A;  1FOX A;  5JHU A;  1XGM A;  1U6G A;  2OU2 A;  2E1M B;  3MZY A;  5GTI C;  2R7Z J;  3HOX J;  2WBM A;  4HAM A;  2A5W A;  5TGT A;  2LBF B;  2L0K A;  1KU3 A;  5L3D A;  4BXU A;  1UZC A;  3VDX A;  4NB5 A;  5BNG A;  1D1C A;  1UAA A;  1GDT A;  2R7W A;  3A4C A;  1Z05 A;  1LE8 A;  3HM5 A;  1XMX A;  1ZK8 A;  2VT2 A;  2ELH A;  3VPR A;  4HV5 A;  3L09 A;  3RCO A;  2WB1 N;  1BI3 A;  2ZJP F;  1BC7 C;  4GRI A;  1QZZ A;  1O7F A;  2WTE A;  1XSV A;  1IRX A;  3KP6 A;  4KDP A;  2P81 A;  4A5M A;  3GTK J;  3QAH A;  4BE2 A;  2K9L A;  2DA5 A;  2KJB A;  1R36 A;  3GO5 A;  4XKC A;  1VZ0 A;  1ZH5 A;  2NOG A;  4C3H J;  1D0Y A;  1R5I D;  4A6D A;  1Z67 A;  3S3M A;  4KT6 A;  1AOY A;  4IRH A;  3PIO F;  1JUS A;  3EUH C;  3JRE A;  5FLX K;  4PJL A;  3E0J B;  3E5U A;  3GXO A;  5J40 A;  1ETW A;  2Z5U A;  4CUG A;  1W36 D;  3A1Y A;  2YX4 A;  3O8H A;  4G12 A;  1LB2 A;  5ICE A;  2A5Y B;  3FKJ A;  4MTE A;  1S7O A;  4EMS A;  2EFW A;  1I27 A;  2PMH A;  4ZDL A;  2EZI A;  1FWZ A;  3NQO A;  2AXT C;  4AD9 A;  4Y4R A;  1J0R A;  5IYB J;  5HS9 A;  2BY2 A;  2AXL A;  2YU9 J;  1SC7 A;  2JSP A;  3CP8 A;  1MSF C;  3HOY J;  2ZFW A;  1BR4 A;  4F91 B;  4I6Z A;  3RKX A;  2R5Y A;  4I0B A;  3BTL A;  1TW2 A;  1YRN A;  5DEQ A;  2L01 A;  2XAS A;  3N05 A;  2BGC A;  1V5F A;  1VQ9 I;  1QVU A;  2AO9 A;  3QYF A;  5EGO A;  4W97 A;  4B3X A;  4X0G A;  1JUP A;  4A3F J;  3T5X A;  4EGZ A;  2DMP A;  2EQR A;  2KIM A;  3HC7 A;  4ZZD A;  2MSY A;  3K0L A;  3RPU D;  1YOV B;  5J1R A;  1Z21 A;  2M45 A;  3CDI A;  1N78 A;  3LA3 A;  2PFB A;  5BOX A;  2CH0 A;  3MFK A;  2IP2 A;  4F3Q A;  5H20 A;  2E2J J;  2BW3 B;  3HSE A;  4DZJ A;  1QPM A;  3E3V A;  4B4C A;  2Y2Z A;  4D1Q A;  3COA C;  3F72 A;  1JT6 A;  3DLL F;  3MZH A;  4G7H F;  4BJ5 C;  4PSX A;  3PSF A;  4IHV A;  2LSO A;  5IYC J;  4CYC B;  1H9T A;  3HUG B;  4IX7 A;  1T8I A;  3WE2 A;  2A6H F;  3LNQ A;  2VLA A;  1HW2 A;  5LGN A;  4EJW A;  2F2E A;  3DPU A;  1FOK A;  2ID6 A;  2R7D A;  4I02 A;  3DQV C;  3LSJ A;  2ZBK A;  3GTL J;  1D5Y A;  4RA2 A;  2EZH A;  2K5C A;  3EET A;  5BPI A;  3QOE A;  1J09 A;  3KZZ A;  1WCM J;  2R7O A;  5DCF A;  1T33 A;  2DN0 A;  2P7V B;  3KEO A;  1JXS A;  1JKO C;  3K4C A;  1F1Z A;  3BR0 A;  1NHA A;  1LVA A;  5F1J A;  2VN2 A;  4KMF A;  4P9F A;  3WE3 A;  1HW1 A;  1TP4 A;  2QLZ A;  1JJ6 C;  3S8P A;  4KIS A;  2GA2 A;  3BDD A;  3E6C C;  4MHG A;  2L9R A;  2ZFU A;  1K4S A;  2XB0 X;  1MMN A;  2DA7 A;  2WC2 A;  4CCM A;  4C9Y A;  2X1C A;  3CLQ A;  2JUC A;  4IXA A;  4XKB A;  1PUF B;  3JRF A;  3V8J A;  4A3M J;  3QYB A;  5HLI A;  2HPI A;  5IPA A;  1ZRD A;  1P7J A;  3KP3 A;  4LIT A;  1POG A;  1V5E A;  3BPX A;  4QWQ A;  3CUQ B;  5JFR A;  3TO7 A;  2MG4 A;  3JRB A;  3GME A;  4CSW A;  3JRG A;  4AYB N;  2FUG 2;  3Q0U A;  3LWF A;  3OYN A;  1DU6 A;  1IZ1 A;  5EZH A;  3QPT A;  1UMQ A;  4EJV A;  4I0A A;  3IUO A;  4G7Z F;  2OQR A;  2BEO A;  3DU5 A;  1FBS A;  1A6Q A;  1LVK A;  2M2E A;  1SFO J;  1K4T A;  2X6O A;  4HDV A;  1ONV A;  2DQL A;  4C2M J;  2COM A;  3F3X A;  1GXP A;  4AM3 A;  2CV2 A;  2G7U A;  1D8K A;  2P5L C;  1ODD A;  2W7N A;  4XLA A;  3KFW X;  3RDI A;  3OSF A;  4MLO A;  1EF4 A;  3VOD A;  3CES A;  3D0S A;  2ELJ A;  3FKI J;  1K61 A;  4JK1 X;  2BY0 A;  5E1W A;  4HLX A;  4ZDO A;  2FMY A;  2X0L A;  3FDY A;  1MMA A;  3HJE A;  3M1E A;  2Y9Z A;  4RS8 A;  5J4V A;  1R1U A;  4MFE A;  2XGE A;  4IVN A;  2IVM A;  1UHM A;  1SFU A;  3PNV A;  1OYY A;  1PP7 U;  3GTJ J;  1X3W B;  3H35 A;  3HSF A;  3VYU B;  1YJW I;  4BJ6 C;  3LSH A;  3K1N A;  1SEU A;  3HL2 A;  1XMK A;  1DUX C;  4ON0 A;  2P7C B;  2LY9 A;  3H3Z A;  4YFK F;  4J01 A;  1AHD P;  1WPK A;  1JUM A;  3E5X A;  2DPD A;  2ZB9 A;  4RB1 A;  3TED A;  5KVR A;  3BG6 A;  2K4B A;  2A6T A;  4HF1 A;  2VQH A;  1C0W A;  3BZ6 A;  1B1B A;  4E70 A;  3RZD J;  2NS7 A;  5FKK A;  5HNH A;  5EEG A;  2VJJ A;  3H9G A;  3QYE A;  1T95 A;  4LJZ F;  4X1E A;  2DTR A;  4M73 A;  5KK1 A;  1VFC A;  5EF6 A;  1J7K A;  2RNG A;  1K78 A;  3ELK A;  2DFF A;  3A03 A;  4ZJZ A;  3FMS A;  3CJN A;  2WY8 Q;  4IHX A;  3LA7 A;  5E20 A;  1VTN C;  3WTW C;  4HST A;  2R4G A;  2NS8 A;  5IP6 A;  1TQP A;  1Y39 A;  3MKZ A;  4V19 K;  1OJL A;  2VUM J;  3LQR A;  1IRG A;  4HNT A;  2DA2 A;  1U8B A;  2TRT A;  5F04 A;  1SD4 A;  2V26 A;  1PUF A;  2BXY A;  2COB A;  2GOX B;  2M1B A;  5ICF A;  1MJB A;  4IHW A;  2LH9 A;  2ZSI B;  1UFM A;  3ZMD A;  5D5W B;  4ZTF A;  2L3D A;  1MH3 A;  1X3Z B;  2CS3 A;  3F8F A;  3TO6 A;  2ZKZ A;  1R9T J;  1W1W E;  1MNE A;  2LLK A;  4HBL A;  1TBX A;  4H4K C;  4M9S A;  2Z9O A;  4CZZ A;  2ESH A;  2BVL A;  3NEU A;  2OQG A;  3M7G A;  5B3S H;  3CMA I;  1RR8 C;  3S15 J;  2FQ3 A;  4IQ4 A;  4OAZ A;  4B47 A;  2QA4 I;  3ASN H;  1LUJ B;  3TQN A;  1PUE E;  3SZG A;  1XSD A;  3W3C A;  1BI0 A;  4XKV A;  3T1B A;  3KEY A;  3ZR8 X;  2R5Z A;  1XX5 A;  1YFH A;  3WGI A;  1BC8 C;  2MLG A;  1WRJ A;  3PJR A;  4O5V A;  4A12 A;  3M8J A;  2ZO4 A;  2KZV A;  4FHT A;  2ZXJ A;  4HW0 A;  3VFZ A;  5IP7 J;  5J1Y A;  2VB6 A;  3KP7 A;  3NRV A;  5H6Q A;  1IF1 A;  2STW A;  2LOO A;  5CLS A;  2QUF A;  2DMT A;  3HXL A;  2CUJ A;  5H6R A;  5KNL A;  3ZMT A;  3MAJ A;  3H5R A;  2WAD A;  2QKM B;  2E2H J;  1JTX A;  1MJA A;  3JSO A;  1EH7 A;  3I71 A;  3HRS A;  1YE9 A;  3ML6 A;  2DOA A;  1U8R A;  2QBY B;  3HSR A;  3JCU C;  3WU1 B;  2R7X A;  4EQQ A;  3GTG J;  3CDH A;  2CUF A;  3I58 A;  3SQN A;  4XOP A;  2CSO A;  3LSM A;  1A04 A;  2R7F A;  2WAE A;  2XKP A;  2FXA A;  2E2I J;  4V2G A;  3RTR A;  3CO7 C;  5E8I A;  4S04 A;  1DPR A;  4UXN A;  4AVZ A;  2XAG A;  4MEY F;  1W0T A;  4ESJ A;  2V1X A;  4JP0 A;  4KT5 C;  5HS7 A;  1QU3 A;  2CU7 A;  2MH2 A;  4AYB A;  1G59 A;  1JT0 A;  1Z3Y A;  4ZDP A;  4K2E A;  4A3C J;  4D9J A;  4EAT A;  3K2A A;  2HOS A;  2V1D A;  1EH6 A;  3QPS A;  2F5V A;  4KA4 A;  2IGO A;  1Z1D A;  2WAF A;  5A2Q Z;  1SAX A;  4U0Y A;  3D5R C;  1IUY A;  5C44 J;  4OIQ F;  2XPW A;  3RSN A;  2DYS H;  4FTH A;  1NG6 A;  4UUV A;  1LKX A;  3S14 J;  4NNJ A;  1VQP I;  2DT5 A;  2VBX A;  3FIS A;  5GTH C;  3BR2 A;  1T98 A;  3DTE A;  2JPB A;  2DMN A;  1UG0 A;  3KZY A;  4PJJ A;  1B4A A;  3MN2 A;  4D5C A;  2XGC A;  3ZN1 A;  2OPT A;  1CQT A;  1GV5 A;  2RRE A;  2XKO A;  3BC8 A;  3EUH A;  2M4G A;  4BUP A;  5HDK A;  1J9I A;  1YW7 A;  5F0H A;  3DWL E;  4BS9 A;  2LK2 A;  3QPH A;  4UUT A;  5HDG A;  1QPI A;  4CHU A;  3HRM A;  4HX7 A;  2CW7 A;  2M87 A;  4GGG A;  3U1D A;  2DXI A;  2PJP A;  5IOY A;  1FLI A;  2KQR A;  2PBI A;  1QNT A;  4UB6 C; 
#chains in the Genus database with same CATH homology
 5FJ8 J;  4MO7 A;  3WHB A;  2CQX A;  1GUU A;  5FKN A;  4D7M A;  1BA5 A;  5EGO B;  4BBR J;  2HYJ A;  3UKG A;  3BG9 A;  1X2M A;  5GP9 A;  1IUF A;  3F0C A;  1XS9 A;  3JRD A;  2Y9Y A;  2ID3 A;  3K7A J;  1W0U A;  3A01 B;  2XSD C;  4XIC A;  4MIM A;  4DW6 A;  1VI0 A;  1B8I A;  5F0F A;  2CRG A;  4C3J J;  5C4X J;  1GVD A;  1AKH B;  2NVX J;  4A3B J;  2DMQ A;  2ME0 A;  2VPR A;  3TP0 A;  2DA4 A;  2HI3 A;  4FE7 A;  3ZQG A;  1JKR C;  3JRA A;  4A93 J;  3D1N I;  1BW6 A;  4JYK A;  2KDZ A;  2ME6 A;  2HDD A;  4LOC A;  2XGD A;  2YUS A;  4QIW N;  2JA6 J;  1ETX A;  1IRZ A;  2R7Z J;  3HOX J;  1GT0 C;  4I76 A;  2GLO A;  1FTZ A;  2L0K A;  2Y0S N;  3DEW A;  1VF9 A;  2JJ7 A;  3ZQC A;  4M3B A;  1F43 A;  4XK4 A;  2JA8 J;  3BTJ A;  5BNG A;  5GPC A;  4RDU A;  1GDT A;  5GPA A;  2O7O A;  5M3F J;  3CDL A;  1LE8 A;  3JRI A;  3S16 J;  1RET A;  3HM5 A;  3GBG A;  2M9H A;  1ZK8 A;  3VPR A;  3S1R J;  3IH2 A;  1MBG A;  3GTO J;  2WB1 N;  3FK6 A;  4W1U A;  1ETO A;  3GTQ J;  1U78 A;  1OFC X;  3BQY A;  1HLV A;  4BY1 J;  1X58 A;  2P81 A;  3GTK J;  2IBD A;  3BR1 A;  2DA5 A;  3S2D J;  2NOG A;  4C3H J;  2XRL A;  2OF7 A;  1JUS A;  3JRE A;  5EG0 A;  2G0E A;  4M3D A;  3S1Q J;  2WV1 A;  2R5Z B;  2IEK A;  3C2B A;  1UG2 A;  1FIP A;  1ETW A;  3H0G J;  3O8H A;  4NDL A;  4G12 A;  1ORK A;  3HGY A;  3HEF A;  2X9D A;  4M6V A;  4A3J J;  1NK2 P;  1ITY A;  2EZI A;  2JWT A;  2FD5 A;  2YS9 A;  5IYB J;  5IOZ A;  3B6A A;  3IH3 A;  2YU9 J;  2LD5 A;  1MSF C;  3HOY J;  2O9L A;  1FJL A;  4I6Z A;  1Y1W J;  2K9Q A;  2ECC A;  2R5Y A;  4S0H B;  3BG5 A;  3HBL A;  1QRY A;  3BTL A;  1YRN A;  1BW5 A;  1ZGW A;  1OCP A;  4BKX A;  1QVU A;  2AO9 A;  2H1K A;  4FCY A;  5EGO A;  4W97 A;  1JUP A;  1RR7 A;  1JKQ C;  1WH7 A;  4A3F J;  4XID A;  3L1P A;  3PM1 A;  5C4J J;  3MVP A;  2DMP A;  2EQR A;  1RKT A;  4IHY A;  1TWF J;  5HOD A;  2R93 J;  4EEF G;  2MSY A;  5M5W J;  4UUS B;  3OIO A;  5J1R A;  2JN6 A;  2R92 J;  1QVT A;  1U9O A;  2JA7 J;  2E2J J;  2RAE A;  2CUE A;  1UHS A;  3QQA A;  4DZJ A;  4B4C A;  3H3V K;  1H8A C;  1TC3 C;  5E3O A;  1TWG J;  1VND A;  2QCO A;  2Y2Z A;  1JT6 A;  3GTM J;  1IV6 A;  5E3M A;  5FKM A;  5K7F A;  4ABZ A;  4IHV A;  5IYC J;  5C3E J;  1MBH A;  4CYC B;  2FQ4 A;  3LNQ A;  1H89 C;  2VKV A;  1MSE C;  2L7M P;  2HOT A;  2DJN A;  5F27 A;  2LFB A;  1HF0 A;  2ID6 A;  4L5E A;  2LKX A;  3LSJ A;  1HCR A;  1FTT A;  4M3E A;  3DCF A;  3OOU A;  1HOM A;  2VI6 A;  3GTL J;  3LOC A;  2X48 A;  1D5Y A;  1Q1V A;  5DS9 A;  2EZH A;  1WGX A;  3ZQH A;  1WCM J;  3JRC A;  1T33 A;  2DN0 A;  1JKO C;  3BR0 A;  3G1L A;  1ZKG A;  5F1J A;  1U9N A;  1IG7 A;  1I6H J;  2IAI A;  2DA1 A;  1H88 C;  9ANT A;  2LP0 A;  1JJ6 C;  3SDG A;  3BTI A;  2L9R A;  3RQI A;  1F36 A;  2XB0 X;  2DA7 A;  2NVQ J;  3O8G A;  3CMY A;  4B3A A;  3JRH A;  4D5F A;  1FEX A;  1PUF B;  3JRF A;  4A3M J;  4B1R A;  5M5Y J;  1E3O C;  3HOV J;  4X6A J;  1JKP C;  5IPA A;  2QF7 A;  1P7J A;  1HDP A;  1POG A;  2M0C A;  3LSP A;  3BT9 A;  2MG4 A;  3JRB A;  3JRG A;  2N8G A;  4AYB N;  3Q0U A;  1DU6 A;  3BR3 A;  2HXO A;  2M8G X;  5EZH A;  2I10 A;  1LFU P;  1B72 A;  3CQZ J;  1K83 J;  1UMQ A;  3M3Y J;  1RES A;  2R0Q C;  3I4M J;  1Z0X A;  4A3L J;  2M2E A;  1SFO J;  4M3G A;  5F08 A;  3NAU A;  2X6O A;  2B63 J;  1MH4 A;  4C2M J;  2HQ5 A;  1TWA J;  3LSR A;  1O4X A;  1ZTR A;  2PMZ N;  2JA5 J;  4QTR A;  3B6C A;  2O8K A;  3OSF A;  4MLO A;  1IDY A;  1TWC J;  3S1N J;  1EF4 A;  1A6I A;  3FKI J;  1K61 A;  1T56 A;  4JX5 A;  1APL C;  5EDN A;  2Y9Z A;  2LVS A;  1MBF A;  4A3I J;  4MFE A;  2XGE A;  1XG1 A;  4XRS A;  2D5V A;  1Y1V J;  3GTJ J;  1ETQ A;  1MBK A;  5EZG A;  2K9S A;  1LE8 B;  3S2H J;  1ETY A;  1WH5 A;  3A02 A;  1ENH A;  2MGQ A;  5FLV A;  2LY9 A;  4D7N A;  1WI3 A;  3Q0W A;  3GTP J;  3LSG A;  1AHD P;  1WPK A;  1JUM A;  4JX6 A;  2ZB9 A;  2DMU A;  2DA6 A;  3TED A;  2JK3 A;  3A01 A;  4A3D J;  3OSG A;  3G1O A;  2LR8 A;  3BR5 A;  4A3G J;  1OCT C;  1HDD C;  3RZD J;  2NS7 A;  3BG3 A;  5FKK A;  4FE4 A;  1AKH A;  1X2N A;  4X1E A;  1XC5 A;  5DTD A;  1VFC A;  5EF6 A;  2WAQ N;  3PO3 J;  3A03 A;  2L7F P;  4IHX A;  3ZQI A;  2GBY A;  2XPV A;  2Y30 A;  5M5X J;  2NS8 A;  5IP6 A;  4A3K J;  3TW6 A;  2GM4 A;  1OJL A;  3RKQ A;  4AUX A;  2VUM J;  3M4O J;  2R5Y B;  4GFB A;  2CQQ A;  2DA2 A;  3HGG A;  1U8B A;  2Y31 A;  3RZO J;  1NK3 P;  2TRT A;  5F04 A;  2EH3 A;  1PUF A;  2COB A;  2EZK A;  1MBJ A;  1FIA A;  4AC0 A;  3WHC A;  5FKO A;  4IHW A;  3Q0V A;  3FK7 A;  1MH3 A;  4M3F A;  1ETV A;  2L7Z A;  1R9T J;  3SJM A;  2LLK A;  3SFI A;  2K9N A;  2H8R A;  1I3Q J;  4A69 C;  3JR9 A;  1BJZ A;  3S17 J;  1AU7 A;  3S15 J;  3MKL A;  4BXX J;  5F0C A;  2E1O A;  4Y52 J;  3PO2 J;  3BQZ A;  4HNV A;  3BTC A;  4XRS G;  5E3L A;  3HOW J;  2JMW A;  2XPU A;  2R5Z A;  1MNM C;  3IV5 A;  1BL0 A;  2FJ1 A;  1DU0 A;  3ZQF A;  5K7H A;  4QSH A;  5FLM J;  1IGN A;  3HB9 A;  5J1Y A;  5IP7 J;  4DZP A;  3IH4 A;  4DYC A;  1P7I A;  1B8I B;  2TCT A;  2DMT A;  1IDZ A;  3TP3 A;  2E2H J;  1JTX A;  3ZQL A;  3S1M J;  4DYR A;  3HKZ N;  1ZQ3 P;  5IYD J;  1IJW C;  2DA3 A;  3GTG J;  2CUF A;  2FX0 A;  4BBS J;  1RPW A;  4BY7 J;  3CCY A;  4MFD A;  2E2I J;  4V2G A;  4XRM A;  5J1U A;  1ZR2 A;  1ETK A;  3ZOB A;  3HDD A;  1G2H A;  4J19 A;  4UUS A;  4Y7N J;  4C3I J;  1W0T A;  4JP0 A;  2W48 A;  5M3M J;  2MW8 A;  2CU7 A;  3HOU J;  1JT0 A;  2CJJ A;  2EZL A;  4FIS A;  5JLX A;  5EEA A;  4A3C J;  1S7E A;  3FIW A;  3K2A A;  4A3E J;  5IP9 J;  2HOS A;  3E7L A;  1NTC A;  1GV2 A;  2K40 A;  2HOA A;  2XB5 A;  3QPS A;  4IEJ A;  1B72 B;  2NVT J;  1Z77 A;  1IC8 A;  3HOZ J;  4CYC A;  3I4N J;  1A5J A;  3BR6 A;  5FKL A;  2VKE A;  5K7Z A;  2E19 A;  5C44 J;  2XPW A;  4FTH A;  1MBE A;  2NVY J;  4DYQ A;  3S14 J;  3FIS A;  3BR2 A;  5EG0 B;  4JX4 A;  4V2F A;  2LTP A;  2ECB A;  2M34 A;  2AHQ A;  2DMN A;  2DTZ A;  3MN2 A;  2HXI A;  5JLW A;  5J3L A;  4D5C A;  2XGC A;  5E3N A;  2OPT A;  1CQT A;  1GV5 A;  1TWH J;  3TW7 A;  4RBO A;  2EBI A;  1JGG A;  1SAN A;  5F0H A;  3W6V A;  1JTY A;  3G1M A;  2LK2 A;  4UUT A;  1QPI A;  1LFB A;  1RKW A;  3NAR A;  3QPL A;  2KT0 A;  3Q3S A;  5IOY A;  1I50 J;  2ELK A;  1ZR4 A;  1JJ8 C;  1YRN B;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...