3GTJK

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtjK00
4XSXA 1R9TK 3S1NK 1SFOK 4OINA 4A3KC 3GTQC 3WODA 5IYCC 2NVXK 1I3QK 2CW0A 2WAQD 2E2IC 3K7AK 2NVTK 3S1MK 4GZYA 4BBRC 3HOXK 2E2JC 3HKZL 1TWAC 1TWHK 4JK1A 1I50K 3HKZD 4QJVA 4G7HA 1WCMC 4C2MK 3HOXC 4A3MK 2VUMK 2R93K 1TWCC 1Y1WK 3S2HK 3S1QK 4X6AK 3S14K 4BY7K 5IP9C 4KMUA 5IP7K 4A3IC 4YG2A 5M5YK 1TWGC 3RZOC 3GTOK 4Y7NC 4A93C 4XLPA 5C4JC 3GTPC 2R7ZK 2A68A 5IYDC 4BXXK 3HOYK 3PO2K 4BXXC 2O5JA 4AYBL 3S16K 1SMYA 3HOZC 1TWFK 4QIWL 4A3FC 3H0GC 4A3LK 1YNJA 4BBSC 4A3CC 3S16C 4Q5SA 3PO3K 4A3GK 2PMZL 5FLMK 2JA7C 3S1RC 3GTLC 3S1NC 2Y0SL 1R9TC 4OIPA 1SFOC 4LLGA 2JA5K 2NVXC 5FLMC 2JA8K 1I3QC 4X6AC 2NVTC 3K7AC 4AYBD 3HOWK 3S1MC 1IW7A 5M5WK 2NVQK 4QIWD 3FKIK 3HOVK 1TWHC 3HOUK 1I50C 2PMZD 2A69A 5M5XK 2VUMC 2R93C 2Y0SD 4YFXA 4A3MC 1Y1WC 3GTMK 3GTKK 3S2HC 3S2DK 3S1QC 4G7OA 2B63K 4Y52K 5M3FK 3S14C 4BY7C 5IP7C 4C3IK 4MEYA 3S15K 4A3EK 1Y1VK 4G7ZA 4ZH4A 3GTOC 3RZDK 4KN4A 5C4XK 2R7ZC 2BE5A 5IYBK 2WB1L 2NVYK 3HOYC 4BY1K 3CQZK 5C44K 4A3DK 2A6EA 1K83K 5TMFA 2E2HK 3PO2C 4QJVB 3M4OK 4C3JK 5TMCA 5C3EK 1TWFC 2E2HC 4A3LC 4C3HK 3GTJK 3PO3C 3I4MK 3I4NK 3M3YK 4A3GC 4Q4ZA 2JA5C 4YFKA 2WB1D 3DXJA 4OIOA 2JA6K 2JA8C 4A3JK 1I6HK 3HOWC 3S17K 2NVQC 2A6HA 2R92K 3FKIC 4OIRA 3GTGK 2YU9K 3HOVC 5D4DA 3HOUC 4A3BK 2PA8L 3GTKC 3S2DC 3GTMC 4A3KK 1XPPA 3GTQK 5IYCK 2B63C 4LK0A 2E2IK 4BBRK 3S15C 4A3EC 1Y1VC 2E2JK 1TWAK 3RZDC 1ZYRA 3H3VL 5C4XC 1WCMK 1HQMA 2PA8D 5IYBC 2NVYC 4KN7A 1TWCK 3CQZC 1BDFA 4Y52C 5C44C 1K83C 4BY1C 4A3DC 3M4OC 2PPBA 4OIQA 5IP9K 5C3EC 4A3IK 4LJZA 4MEXA 1YNNA 1TWGK 4XLNA 3GTJC 2O5IA 3RZOK 4Y7NK 4A93K 3I4MC 3M3YC 3I4NC 5C4JK 3GTLK 3GTPK 3H3VD 5IYDK 4NOIA 2JA6C 4LK1A 5M3MK 4A3JC 2WAQL 1I6HC 3S17C 2R92C 3HOZK 4MQ9A 4A3FK 1I6VA 3H0GK 5FJ8K 2YU9C 3GTGC 4A3CK 4BBSK 4XSZA 3EQLA 4YFNA 4A3BC 2JA7K 3S1RK
chains in the Genus database with same CATH superfamily
4GTBA 4XSXA 3LAPA 3S1NK 4OINA 1EK8A 2WAQD 1HI9A 5EGHA 1VJEA 1TWHK 3HKZD 2JA7A 4C2MK 3HOXC 3BP3A 3S1QK 2NVXA 1I3QA 1JVIA 4C45A 4KMUA 5IP7K 5M5YK 1JQWA 1ISEA 2RH6A 2ZFZA 4BKWA 4XLPA 3GTPC 5IYDC 1Y1WA 3HOYK 1GE9A 2P8TA 1SMYA 4BBSC 1YNJA 3GTOA 4Q5SA 2JA7C 4RMFA 4G0UA 2NVXC 1I3QC 3A8KA 2KWAA 2W7VA 3BUEA 3K7AC 1WSVA 4GTEA 5M5WK 1K83A 2E2HA 4AH6A 4KMHA 3FHZA 4KATA 1Y1WC 2JA6A 4P5BA 3GTOC 2CFAB 4KN4A 2BE5A 1PJ7A 5IYBK 2WB1L 2NVYK 4KM9A 4BY1K 3CQZK 3GTKA 1O2FB 2B63A 3PO2C 1XZPB 4C3JK 4A3LC 2E2HC 3GEHA 1WOOA 4KM8A 3I4NK 1DCPA 2D6FC 3S0XA 1J98A 2JA5C 4YFKA 2WB1D 1EH1A 3DXJA 1WORA 2ZUEA 3A8IA 2NVQC 1F7UA 4GT9A 4ILDA 5D4DA 3HOUC 3GTKC 1IE0A 4GTDA 3GTQK 1IS1A 2B63C 4LK0A 1L0WA 2E2IK 4C3IC 4A3EC 3GTGA 1TWAK 1ZYRA 4KN7A 2GSUA 4LJZA 3RZOK 3M3YC 5C4JK 1WCMA 1TWCA 3AQOA 3G4CA 4BLBA 4A3JC 1I6HC 1B4BA 1TWGA 5FJ8K 3GTGC 3EQLA 4A3BC 3GTLK 1R9TK 3AQPA 1SFOK 3T00A 4A3KC 3WODA 5IYCC 3CAGA 3S1MK 1YCLA 4P9SA 4BBRC 4LQYA 3T02A 5IOTA 1I50K 1XZPA 4GFQA 1WCMC 4G0VA 1TWCC 2XCQA 3TFHA 1O26A 5IP9C 1DCOA 3TFIA 4A3IC 1TWGC 3FOFA 4Y7NC 1DD5A 2R7ZK 1AB4A 2A68A 4P5AA 2R93A 2VUMA 1BGWA 1YX2A 3SZZA 3HOZC 1ZBSA 1TWFK 3HXAA 4QIWL 1XXAA 1USOA 1X31C 3N3YA 5CJ9A 2NVTC 3HOWK 1IW7A 4QIWD 5M5XK 2VUMC 2R93C 4A3MC 4G7OA 4X6AC 3S2HC 3S14C 4BY7C 1EQRA 1VLOA 4MEYA 1O24A 3FKIA 4G7ZA 4ZH4A 3RZDK 5C4XK 3GTMA 4A3DK 1WQGA 1B4AA 5C44K 4KC6A 4QJVB 3TFJA 3M4OK 5TMCA 1Y1VA 4C3HK 3GTJK 2V6SA 2E2IA 3PO3C 1J6WA 4A3GC 1O28A 1O29A 1USMA 4Q4ZA 3A8JA 1F93A 2JA8C 1INNA 3N0BA 2A6HA 1EI6A 3FKIC 3V4GA 2YU9K 3HOVC 2XCOA 2PA8L 3S2DC 3GTMC 4PABA 1ZXOA 4KDDA 3ERED 2R92A 3S15C 1Y1VC 2Y3PA 3H3VL 3LPXA 3HOXK 2PA8D 4Y52C 1BS2A 1BDFA 1K83C 4OIQA 5C3EC 4MEXA 3FOEA 4XLNA 3GIRA 2O5IA 3I4MC 3TTGA 5L46A 3GTPK 3OEPA 3H3VD 5IYDK 4NOIA 2JA6C 4LK1A 5M3MK 3S17C 2R92C 1I6VA 4BBSK 1BJTA 3GEIA 2JA7K 3AH5A 2NVXK 1I3QK 1UV7A 4FZBA 4GZYA 3K7AK 3H0GA 2E2JC 3HKZL 4M1XA 4G7HA 4QJVA 1VRQC 1Y1WK 1J6XA 1XXBA 3T01A 4WJ3M 1JOEA 1O2BA 3GTOK 4A93C 1TWHA 4FM9A 4BXXK 1VGXA 1PJ6A 3PO2K 2O5JA 4AYBL 3S16K 4A3LK 4A3FC 3H0GC 3GSIA 4A3CC 5FLMK 3S1RC 3S1NC 2CFAA 4OIPA 2JA5K 1IBAA 1G51A 5IOSA 3AD7C 4KASA 4AYBD 2NVQK 4KMAA 4GTCA 1TWHC 2GAHC 5TJ3A 3HOUK 4C2MC 3GTKK 3S1QC 2B63K 5M3FK 5IP7C 4C3IK 1V5VA 1O2AA 4A3EK 5EGEA 3G4AA 4PAAA 4G0WA 3HOYC 4J3NA 5TMFA 5IORA 1IL2A 3M3YK 2NVYA 4KAWX 3CQZA 5JFEA 4A3JK 1I6HK 3MMLB 2FQOA 4OIRA 3GTGK 3AD8C 5JVOA 2GSNA 4A3BK 3L4JA 3LAJA 4A3KK 1XPPA 5IYCK 3GDZA 4GTAA 3L4KA 4O2DA 4BBRK 1WCMK 5IYBC 2V6TA 2NVYC 1TWCK 3CQZC 4BY1C 3GTQA 4BLAA 4C3JC 1WQFA 5IP9K 4A3IK 1TWGK 1TWAA 4Y7NK 3I4NC 1F7VA 1J6VA 1PJ5A 2GAGC 4KMDA 3QX3A 4KARA 3HOZK 4MQ9A 4GTLA 3ADAC 2PHCB 3GTQC 2CW0A 2E2IC 2NVTK 3AD9C 1TWAC 2ZUFA 4KB2A 4JK1A 1ZQ1C 3IPJA 3GTLA 1R9TA 2VUMK 1SFOA 4A3MK 2R93K 4X6AK 3S2HK 3GEEA 3S14K 4BY7K 2JA5A 4YG2A 3RZOC 4LOWA 1ZVUA 1I50A 5C4JC 4BXXC 2XCRB 1WOPA 3BP8C 4WILA 3SZYA 4GTFA 3S16C 3PO3K 4A3GK 2PMZL 2R7ZA 3GTLC 3OPFA 1DCHA 1XZQB 2Y0SL 1RU0A 1WQHA 4LLGA 1R9TC 1SFOC 5CHPA 5FLMC 2JA8K 3S1MC 1TWFA 3FKIK 1EFWA 3VA7A 1WIHA 3HOVK 1I50C 1WOSA 2A69A 2PMZD 1C0AA 2Y0SD 4YFXA 3S2DK 3JSTA 3GTMK 1IQ0A 4DDQA 3S15K 1Y1VK 2RGRA 1O25A 2R7ZC 1VH2A 4Y52K 1O27A 3N0CA 2A6EA 1K83K 4LR2A 2E2HK 5HL8A 5C3EK 1TWFC 2JH3A 2FQTA 3I4MK 4WJ4A 5E68A 2JA6K 4OIOA 3NUHA 3HOWC 3S17K 2GSOA 2R92K 3GTJA 2EBBA 4XCHA 3Q3QA 2YU9A 2E2JK 3RZDC 5C4XC 1HQMA 5IOQA 4KB4A 4A3DC 1KQ4A 5C44C 2V6UA 3M4OC 2PPBA 1XZQA 1YNNA 1XXCA 2P5MA 4C3HC 3GTJC 4A93K 1F9NA 2WAQL 4A3FK 3H0GK 2YU9C 1WSRA 4A3CK 4XSZA 3OREA 4YFNA 3GTPA 3S1RK
chains in the Genus database with same CATH topology
4XSXA 1R9TK 3S1NK 1SFOK 4OINA 4A3KC 3GTQC 3WODA 5IYCC 2NVXK 1I3QK 2CW0A 2WAQD 2E2IC 3K7AK 2NVTK 3S1MK 4GZYA 4BBRC 3HOXK 2E2JC 3HKZL 1TWAC 1TWHK 4JK1A 1I50K 3HKZD 4QJVA 4G7HA 1WCMC 4C2MK 3HOXC 4A3MK 2VUMK 2R93K 1TWCC 1Y1WK 3S2HK 3S1QK 4X6AK 3S14K 4BY7K 5IP9C 4KMUA 5IP7K 4A3IC 4YG2A 5M5YK 1TWGC 3RZOC 3GTOK 4Y7NC 4A93C 4XLPA 5C4JC 3GTPC 2R7ZK 2A68A 5IYDC 4BXXK 3HOYK 3PO2K 4BXXC 2O5JA 4AYBL 3S16K 1SMYA 3HOZC 1TWFK 4QIWL 4A3FC 3H0GC 4A3LK 1YNJA 4BBSC 4A3CC 3S16C 4Q5SA 3PO3K 4A3GK 2PMZL 5FLMK 2JA7C 3S1RC 3GTLC 3S1NC 2Y0SL 1R9TC 4OIPA 1SFOC 4LLGA 2JA5K 2NVXC 5FLMC 2JA8K 1I3QC 4X6AC 2NVTC 3K7AC 4AYBD 3HOWK 3S1MC 1IW7A 5M5WK 2NVQK 4QIWD 3FKIK 3HOVK 1TWHC 3HOUK 1I50C 2PMZD 2A69A 5M5XK 2VUMC 2R93C 2Y0SD 4YFXA 4A3MC 1Y1WC 3GTMK 3GTKK 3S2HC 3S2DK 3S1QC 4G7OA 2B63K 4Y52K 5M3FK 3S14C 4BY7C 5IP7C 4C3IK 4MEYA 3S15K 4A3EK 1Y1VK 4G7ZA 4ZH4A 3GTOC 3RZDK 4KN4A 5C4XK 2R7ZC 2BE5A 5IYBK 2WB1L 2NVYK 3HOYC 4BY1K 3CQZK 5C44K 4A3DK 2A6EA 1K83K 5TMFA 2E2HK 3PO2C 4QJVB 3M4OK 4C3JK 5TMCA 5C3EK 1TWFC 2E2HC 4A3LC 4C3HK 3GTJK 3PO3C 3I4MK 3I4NK 3M3YK 4A3GC 4Q4ZA 2JA5C 4YFKA 2WB1D 3DXJA 4OIOA 2JA6K 2JA8C 4A3JK 1I6HK 3HOWC 3S17K 2NVQC 2A6HA 2R92K 3FKIC 4OIRA 3GTGK 2YU9K 3HOVC 5D4DA 3HOUC 4A3BK 2PA8L 3GTKC 3S2DC 3GTMC 4A3KK 1XPPA 3GTQK 5IYCK 2B63C 4LK0A 2E2IK 4BBRK 3S15C 4A3EC 1Y1VC 2E2JK 1TWAK 3RZDC 1ZYRA 3H3VL 5C4XC 1WCMK 1HQMA 2PA8D 5IYBC 2NVYC 4KN7A 1TWCK 3CQZC 1BDFA 4Y52C 5C44C 1K83C 4BY1C 4A3DC 3M4OC 2PPBA 4OIQA 5IP9K 5C3EC 4A3IK 4LJZA 4MEXA 1YNNA 1TWGK 4XLNA 3GTJC 2O5IA 3RZOK 4Y7NK 4A93K 3I4MC 3M3YC 3I4NC 5C4JK 3GTLK 3GTPK 3H3VD 5IYDK 4NOIA 2JA6C 4LK1A 5M3MK 4A3JC 2WAQL 1I6HC 3S17C 2R92C 3HOZK 4MQ9A 4A3FK 1I6VA 3H0GK 5FJ8K 2YU9C 3GTGC 4A3CK 4BBSK 4XSZA 3EQLA 4YFNA 4A3BC 2JA7K 3S1RK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSX A;  1R9T K;  3S1N K;  1SFO K;  4OIN A;  4A3K C;  3GTQ C;  3WOD A;  5IYC C;  2NVX K;  1I3Q K;  2CW0 A;  2WAQ D;  2E2I C;  3K7A K;  2NVT K;  3S1M K;  4GZY A;  4BBR C;  3HOX K;  2E2J C;  3HKZ L;  1TWA C;  1TWH K;  4JK1 A;  1I50 K;  3HKZ D;  4QJV A;  4G7H A;  1WCM C;  4C2M K;  3HOX C;  4A3M K;  2VUM K;  2R93 K;  1TWC C;  1Y1W K;  3S2H K;  3S1Q K;  4X6A K;  3S14 K;  4BY7 K;  5IP9 C;  4KMU A;  5IP7 K;  4A3I C;  4YG2 A;  5M5Y K;  1TWG C;  3RZO C;  3GTO K;  4Y7N C;  4A93 C;  4XLP A;  5C4J C;  3GTP C;  2R7Z K;  2A68 A;  5IYD C;  4BXX K;  3HOY K;  3PO2 K;  4BXX C;  2O5J A;  4AYB L;  3S16 K;  1SMY A;  3HOZ C;  1TWF K;  4QIW L;  4A3F C;  3H0G C;  4A3L K;  1YNJ A;  4BBS C;  4A3C C;  3S16 C;  4Q5S A;  3PO3 K;  4A3G K;  2PMZ L;  5FLM K;  2JA7 C;  3S1R C;  3GTL C;  3S1N C;  2Y0S L;  1R9T C;  4OIP A;  1SFO C;  4LLG A;  2JA5 K;  2NVX C;  5FLM C;  2JA8 K;  1I3Q C;  4X6A C;  2NVT C;  3K7A C;  4AYB D;  3HOW K;  3S1M C;  1IW7 A;  5M5W K;  2NVQ K;  4QIW D;  3FKI K;  3HOV K;  1TWH C;  3HOU K;  1I50 C;  2PMZ D;  2A69 A;  5M5X K;  2VUM C;  2R93 C;  2Y0S D;  4YFX A;  4A3M C;  1Y1W C;  3GTM K;  3GTK K;  3S2H C;  3S2D K;  3S1Q C;  4G7O A;  2B63 K;  4Y52 K;  5M3F K;  3S14 C;  4BY7 C;  5IP7 C;  4C3I K;  4MEY A;  3S15 K;  4A3E K;  1Y1V K;  4G7Z A;  4ZH4 A;  3GTO C;  3RZD K;  4KN4 A;  5C4X K;  2R7Z C;  2BE5 A;  5IYB K;  2WB1 L;  2NVY K;  3HOY C;  4BY1 K;  3CQZ K;  5C44 K;  4A3D K;  2A6E A;  1K83 K;  5TMF A;  2E2H K;  3PO2 C;  4QJV B;  3M4O K;  4C3J K;  5TMC A;  5C3E K;  1TWF C;  2E2H C;  4A3L C;  4C3H K;  3GTJ K;  3PO3 C;  3I4M K;  3I4N K;  3M3Y K;  4A3G C;  4Q4Z A;  2JA5 C;  4YFK A;  2WB1 D;  3DXJ A;  4OIO A;  2JA6 K;  2JA8 C;  4A3J K;  1I6H K;  3HOW C;  3S17 K;  2NVQ C;  2A6H A;  2R92 K;  3FKI C;  4OIR A;  3GTG K;  2YU9 K;  3HOV C;  5D4D A;  3HOU C;  4A3B K;  2PA8 L;  3GTK C;  3S2D C;  3GTM C;  4A3K K;  1XPP A;  3GTQ K;  5IYC K;  2B63 C;  4LK0 A;  2E2I K;  4BBR K;  3S15 C;  4A3E C;  1Y1V C;  2E2J K;  1TWA K;  3RZD C;  1ZYR A;  3H3V L;  5C4X C;  1WCM K;  1HQM A;  2PA8 D;  5IYB C;  2NVY C;  4KN7 A;  1TWC K;  3CQZ C;  1BDF A;  4Y52 C;  5C44 C;  1K83 C;  4BY1 C;  4A3D C;  3M4O C;  2PPB A;  4OIQ A;  5IP9 K;  5C3E C;  4A3I K;  4LJZ A;  4MEX A;  1YNN A;  1TWG K;  4XLN A;  3GTJ C;  2O5I A;  3RZO K;  4Y7N K;  4A93 K;  3I4M C;  3M3Y C;  3I4N C;  5C4J K;  3GTL K;  3GTP K;  3H3V D;  5IYD K;  4NOI A;  2JA6 C;  4LK1 A;  5M3M K;  4A3J C;  2WAQ L;  1I6H C;  3S17 C;  2R92 C;  3HOZ K;  4MQ9 A;  4A3F K;  1I6V A;  3H0G K;  5FJ8 K;  2YU9 C;  3GTG C;  4A3C K;  4BBS K;  4XSZ A;  3EQL A;  4YFN A;  4A3B C;  2JA7 K;  3S1R K; 
#chains in the Genus database with same CATH topology
 4GTB A;  4XSX A;  3LAP A;  3S1N K;  4OIN A;  1EK8 A;  2WAQ D;  1HI9 A;  5EGH A;  1VJE A;  1TWH K;  3HKZ D;  2JA7 A;  4C2M K;  3HOX C;  3BP3 A;  3S1Q K;  2NVX A;  1I3Q A;  1JVI A;  4C45 A;  4KMU A;  5IP7 K;  5M5Y K;  1JQW A;  1ISE A;  2RH6 A;  2ZFZ A;  4BKW A;  4XLP A;  3GTP C;  5IYD C;  1Y1W A;  3HOY K;  1GE9 A;  2P8T A;  1SMY A;  4BBS C;  1YNJ A;  3GTO A;  4Q5S A;  2JA7 C;  4RMF A;  4G0U A;  2NVX C;  1I3Q C;  3A8K A;  2KWA A;  2W7V A;  3BUE A;  3K7A C;  1WSV A;  4GTE A;  5M5W K;  1K83 A;  2E2H A;  4AH6 A;  4KMH A;  3FHZ A;  4KAT A;  1Y1W C;  2JA6 A;  4P5B A;  3GTO C;  2CFA B;  4KN4 A;  2BE5 A;  1PJ7 A;  5IYB K;  2WB1 L;  2NVY K;  4KM9 A;  4BY1 K;  3CQZ K;  3GTK A;  1O2F B;  2B63 A;  3PO2 C;  1XZP B;  4C3J K;  4A3L C;  2E2H C;  3GEH A;  1WOO A;  4KM8 A;  3I4N K;  1DCP A;  2D6F C;  3S0X A;  1J98 A;  2JA5 C;  4YFK A;  2WB1 D;  1EH1 A;  3DXJ A;  1WOR A;  2ZUE A;  3A8I A;  2NVQ C;  1F7U A;  4GT9 A;  4ILD A;  5D4D A;  3HOU C;  3GTK C;  1IE0 A;  4GTD A;  3GTQ K;  1IS1 A;  2B63 C;  4LK0 A;  1L0W A;  2E2I K;  4C3I C;  4A3E C;  3GTG A;  1TWA K;  1ZYR A;  4KN7 A;  2GSU A;  4LJZ A;  3RZO K;  3M3Y C;  5C4J K;  1WCM A;  1TWC A;  3AQO A;  3G4C A;  4BLB A;  4A3J C;  1I6H C;  1B4B A;  1TWG A;  5FJ8 K;  3GTG C;  3EQL A;  4A3B C;  3GTL K;  1R9T K;  3AQP A;  1SFO K;  3T00 A;  4A3K C;  3WOD A;  5IYC C;  3CAG A;  3S1M K;  1YCL A;  4P9S A;  4BBR C;  4LQY A;  3T02 A;  5IOT A;  1I50 K;  1XZP A;  4GFQ A;  1WCM C;  4G0V A;  1TWC C;  2XCQ A;  3TFH A;  1O26 A;  5IP9 C;  1DCO A;  3TFI A;  4A3I C;  1TWG C;  3FOF A;  4Y7N C;  1DD5 A;  2R7Z K;  1AB4 A;  2A68 A;  4P5A A;  2R93 A;  2VUM A;  1BGW A;  1YX2 A;  3SZZ A;  3HOZ C;  1ZBS A;  1TWF K;  3HXA A;  4QIW L;  1XXA A;  1USO A;  1X31 C;  3N3Y A;  5CJ9 A;  2NVT C;  3HOW K;  1IW7 A;  4QIW D;  5M5X K;  2VUM C;  2R93 C;  4A3M C;  4G7O A;  4X6A C;  3S2H C;  3S14 C;  4BY7 C;  1EQR A;  1VLO A;  4MEY A;  1O24 A;  3FKI A;  4G7Z A;  4ZH4 A;  3RZD K;  5C4X K;  3GTM A;  4A3D K;  1WQG A;  1B4A A;  5C44 K;  4KC6 A;  4QJV B;  3TFJ A;  3M4O K;  5TMC A;  1Y1V A;  4C3H K;  3GTJ K;  2V6S A;  2E2I A;  3PO3 C;  1J6W A;  4A3G C;  1O28 A;  1O29 A;  1USM A;  4Q4Z A;  3A8J A;  1F93 A;  2JA8 C;  1INN A;  3N0B A;  2A6H A;  1EI6 A;  3FKI C;  3V4G A;  2YU9 K;  3HOV C;  2XCO A;  2PA8 L;  3S2D C;  3GTM C;  4PAB A;  1ZXO A;  4KDD A;  3ERE D;  2R92 A;  3S15 C;  1Y1V C;  2Y3P A;  3H3V L;  3LPX A;  3HOX K;  2PA8 D;  4Y52 C;  1BS2 A;  1BDF A;  1K83 C;  4OIQ A;  5C3E C;  4MEX A;  3FOE A;  4XLN A;  3GIR A;  2O5I A;  3I4M C;  3TTG A;  5L46 A;  3GTP K;  3OEP A;  3H3V D;  5IYD K;  4NOI A;  2JA6 C;  4LK1 A;  5M3M K;  3S17 C;  2R92 C;  1I6V A;  4BBS K;  1BJT A;  3GEI A;  2JA7 K;  3AH5 A;  2NVX K;  1I3Q K;  1UV7 A;  4FZB A;  4GZY A;  3K7A K;  3H0G A;  2E2J C;  3HKZ L;  4M1X A;  4G7H A;  4QJV A;  1VRQ C;  1Y1W K;  1J6X A;  1XXB A;  3T01 A;  4WJ3 M;  1JOE A;  1O2B A;  3GTO K;  4A93 C;  1TWH A;  4FM9 A;  4BXX K;  1VGX A;  1PJ6 A;  3PO2 K;  2O5J A;  4AYB L;  3S16 K;  4A3L K;  4A3F C;  3H0G C;  3GSI A;  4A3C C;  5FLM K;  3S1R C;  3S1N C;  2CFA A;  4OIP A;  2JA5 K;  1IBA A;  1G51 A;  5IOS A;  3AD7 C;  4KAS A;  4AYB D;  2NVQ K;  4KMA A;  4GTC A;  1TWH C;  2GAH C;  5TJ3 A;  3HOU K;  4C2M C;  3GTK K;  3S1Q C;  2B63 K;  5M3F K;  5IP7 C;  4C3I K;  1V5V A;  1O2A A;  4A3E K;  5EGE A;  3G4A A;  4PAA A;  4G0W A;  3HOY C;  4J3N A;  5TMF A;  5IOR A;  1IL2 A;  3M3Y K;  2NVY A;  4KAW X;  3CQZ A;  5JFE A;  4A3J K;  1I6H K;  3MML B;  2FQO A;  4OIR A;  3GTG K;  3AD8 C;  5JVO A;  2GSN A;  4A3B K;  3L4J A;  3LAJ A;  4A3K K;  1XPP A;  5IYC K;  3GDZ A;  4GTA A;  3L4K A;  4O2D A;  4BBR K;  1WCM K;  5IYB C;  2V6T A;  2NVY C;  1TWC K;  3CQZ C;  4BY1 C;  3GTQ A;  4BLA A;  4C3J C;  1WQF A;  5IP9 K;  4A3I K;  1TWG K;  1TWA A;  4Y7N K;  3I4N C;  1F7V A;  1J6V A;  1PJ5 A;  2GAG C;  4KMD A;  3QX3 A;  4KAR A;  3HOZ K;  4MQ9 A;  4GTL A;  3ADA C;  2PHC B;  3GTQ C;  2CW0 A;  2E2I C;  2NVT K;  3AD9 C;  1TWA C;  2ZUF A;  4KB2 A;  4JK1 A;  1ZQ1 C;  3IPJ A;  3GTL A;  1R9T A;  2VUM K;  1SFO A;  4A3M K;  2R93 K;  4X6A K;  3S2H K;  3GEE A;  3S14 K;  4BY7 K;  2JA5 A;  4YG2 A;  3RZO C;  4LOW A;  1ZVU A;  1I50 A;  5C4J C;  4BXX C;  2XCR B;  1WOP A;  3BP8 C;  4WIL A;  3SZY A;  4GTF A;  3S16 C;  3PO3 K;  4A3G K;  2PMZ L;  2R7Z A;  3GTL C;  3OPF A;  1DCH A;  1XZQ B;  2Y0S L;  1RU0 A;  1WQH A;  4LLG A;  1R9T C;  1SFO C;  5CHP A;  5FLM C;  2JA8 K;  3S1M C;  1TWF A;  3FKI K;  1EFW A;  3VA7 A;  1WIH A;  3HOV K;  1I50 C;  1WOS A;  2A69 A;  2PMZ D;  1C0A A;  2Y0S D;  4YFX A;  3S2D K;  3JST A;  3GTM K;  1IQ0 A;  4DDQ A;  3S15 K;  1Y1V K;  2RGR A;  1O25 A;  2R7Z C;  1VH2 A;  4Y52 K;  1O27 A;  3N0C A;  2A6E A;  1K83 K;  4LR2 A;  2E2H K;  5HL8 A;  5C3E K;  1TWF C;  2JH3 A;  2FQT A;  3I4M K;  4WJ4 A;  5E68 A;  2JA6 K;  4OIO A;  3NUH A;  3HOW C;  3S17 K;  2GSO A;  2R92 K;  3GTJ A;  2EBB A;  4XCH A;  3Q3Q A;  2YU9 A;  2E2J K;  3RZD C;  5C4X C;  1HQM A;  5IOQ A;  4KB4 A;  4A3D C;  1KQ4 A;  5C44 C;  2V6U A;  3M4O C;  2PPB A;  1XZQ A;  1YNN A;  1XXC A;  2P5M A;  4C3H C;  3GTJ C;  4A93 K;  1F9N A;  2WAQ L;  4A3F K;  3H0G K;  2YU9 C;  1WSR A;  4A3C K;  4XSZ A;  3ORE A;  4YFN A;  3GTP A;  3S1R K; 
#chains in the Genus database with same CATH homology
 4XSX A;  1R9T K;  3S1N K;  1SFO K;  4OIN A;  4A3K C;  3GTQ C;  3WOD A;  5IYC C;  2NVX K;  1I3Q K;  2CW0 A;  2WAQ D;  2E2I C;  3K7A K;  2NVT K;  3S1M K;  4GZY A;  4BBR C;  3HOX K;  2E2J C;  3HKZ L;  1TWA C;  1TWH K;  4JK1 A;  1I50 K;  3HKZ D;  4QJV A;  4G7H A;  1WCM C;  4C2M K;  3HOX C;  4A3M K;  2VUM K;  2R93 K;  1TWC C;  1Y1W K;  3S2H K;  3S1Q K;  4X6A K;  3S14 K;  4BY7 K;  5IP9 C;  4KMU A;  5IP7 K;  4A3I C;  4YG2 A;  5M5Y K;  1TWG C;  3RZO C;  3GTO K;  4Y7N C;  4A93 C;  4XLP A;  5C4J C;  3GTP C;  2R7Z K;  2A68 A;  5IYD C;  4BXX K;  3HOY K;  3PO2 K;  4BXX C;  2O5J A;  4AYB L;  3S16 K;  1SMY A;  3HOZ C;  1TWF K;  4QIW L;  4A3F C;  3H0G C;  4A3L K;  1YNJ A;  4BBS C;  4A3C C;  3S16 C;  4Q5S A;  3PO3 K;  4A3G K;  2PMZ L;  5FLM K;  2JA7 C;  3S1R C;  3GTL C;  3S1N C;  2Y0S L;  1R9T C;  4OIP A;  1SFO C;  4LLG A;  2JA5 K;  2NVX C;  5FLM C;  2JA8 K;  1I3Q C;  4X6A C;  2NVT C;  3K7A C;  4AYB D;  3HOW K;  3S1M C;  1IW7 A;  5M5W K;  2NVQ K;  4QIW D;  3FKI K;  3HOV K;  1TWH C;  3HOU K;  1I50 C;  2PMZ D;  2A69 A;  5M5X K;  2VUM C;  2R93 C;  2Y0S D;  4YFX A;  4A3M C;  1Y1W C;  3GTM K;  3GTK K;  3S2H C;  3S2D K;  3S1Q C;  4G7O A;  2B63 K;  4Y52 K;  5M3F K;  3S14 C;  4BY7 C;  5IP7 C;  4C3I K;  4MEY A;  3S15 K;  4A3E K;  1Y1V K;  4G7Z A;  4ZH4 A;  3GTO C;  3RZD K;  4KN4 A;  5C4X K;  2R7Z C;  2BE5 A;  5IYB K;  2WB1 L;  2NVY K;  3HOY C;  4BY1 K;  3CQZ K;  5C44 K;  4A3D K;  2A6E A;  1K83 K;  5TMF A;  2E2H K;  3PO2 C;  4QJV B;  3M4O K;  4C3J K;  5TMC A;  5C3E K;  1TWF C;  2E2H C;  4A3L C;  4C3H K;  3GTJ K;  3PO3 C;  3I4M K;  3I4N K;  3M3Y K;  4A3G C;  4Q4Z A;  2JA5 C;  4YFK A;  2WB1 D;  3DXJ A;  4OIO A;  2JA6 K;  2JA8 C;  4A3J K;  1I6H K;  3HOW C;  3S17 K;  2NVQ C;  2A6H A;  2R92 K;  3FKI C;  4OIR A;  3GTG K;  2YU9 K;  3HOV C;  5D4D A;  3HOU C;  4A3B K;  2PA8 L;  3GTK C;  3S2D C;  3GTM C;  4A3K K;  1XPP A;  3GTQ K;  5IYC K;  2B63 C;  4LK0 A;  2E2I K;  4BBR K;  3S15 C;  4A3E C;  1Y1V C;  2E2J K;  1TWA K;  3RZD C;  1ZYR A;  3H3V L;  5C4X C;  1WCM K;  1HQM A;  2PA8 D;  5IYB C;  2NVY C;  4KN7 A;  1TWC K;  3CQZ C;  1BDF A;  4Y52 C;  5C44 C;  1K83 C;  4BY1 C;  4A3D C;  3M4O C;  2PPB A;  4OIQ A;  5IP9 K;  5C3E C;  4A3I K;  4LJZ A;  4MEX A;  1YNN A;  1TWG K;  4XLN A;  3GTJ C;  2O5I A;  3RZO K;  4Y7N K;  4A93 K;  3I4M C;  3M3Y C;  3I4N C;  5C4J K;  3GTL K;  3GTP K;  3H3V D;  5IYD K;  4NOI A;  2JA6 C;  4LK1 A;  5M3M K;  4A3J C;  2WAQ L;  1I6H C;  3S17 C;  2R92 C;  3HOZ K;  4MQ9 A;  4A3F K;  1I6V A;  3H0G K;  5FJ8 K;  2YU9 C;  3GTG C;  4A3C K;  4BBS K;  4XSZ A;  3EQL A;  4YFN A;  4A3B C;  2JA7 K;  3S1R K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...