3GTJK

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtjK00
2E2IC 2E2JC 2WB1D 2PMZD 3I4NC 4C3JK 5FLMC 3GTMK 4A3CK 4C3HK 1Y1VK 1YNNA 4A3FC 3H0GK 4BY7C 2A6EA 2JA6C 4A3LK 4C3IK 3GTJK 2VUMC 3S1MC 1SMYA 1R9TC 4GZYA 2Y0SL 3M3YC 3RZDK 1I6HC 3HOUK 4JK1A 3FKIC 4C2MK 3GTOK 5IYBC 4OIOA 4A3CC 4QJVA 3I4MC 1Y1VC 4A3FK 1TWCK 4A3DC 1K83C 2R93K 4LK0A 4YG2A 4BBRK 3WODA 5IP7K 2E2HC 2B63C 5IP9C 1SFOC 4A3MC 3K7AC 3RZOC 4BBSK 3FKIK 3GTOC 4YFNA 1Y1WK 4Y7NK 1TWHC 4A3IK 4MEYA 4Y52C 1XPPA 3S1NK 3S2HC 5M5XK 3CQZK 2JA6K 3GTJC 2VUMK 4A3LC 3HKZD 3DXJA 5C4XK 2JA7K 3HOYC 3S14C 4XSZA 5IYCC 3HOZK 3M4OK 4OIRA 3PO3K 5FJ8K 5D4DA 4MQ9A 3HOUC 3GTMC 4BBSC 2R92C 1I50C 1I6VA 1ZYRA 1Y1WC 1TWGC 4ZH4A 3H0GC 3H3VD 3S16C 3S15C 3GTKC 3HOVK 3CQZC 5C3EC 2JA5C 2E2HK 3GTGK 3S2DK 4A3GC 2E2JK 3S1RC 2E2IK 3PO3C 4LK1A 4BXXC 5IYBK 2NVXC 4A3KK 3I4MK 2R92K 2PA8L 5TMFA 3S15K 1TWGK 3S16K 2NVQK 4Y52K 3S1NC 5M3MK 5C44C 2YU9K 3S17K 2NVYC 4BBRC 3GTLK 3RZDC 4A93C 2O5IA 2JA7C 1TWAC 4Q4ZA 5IYCK 2PA8D 4G7ZA 4A3EK 4BY1K 3HOYK 3M4OC 3K7AK 4YFKA 5M3FK 3HOXC 4NOIA 2R7ZK 4Y7NC 4QIWL 4G7HA 4G7OA 1HQMA 3S2HK 1TWFK 4OINA 2A6HA 2Y0SD 5C4JC 4XSXA 4A3JC 2NVQC 4A3BK 3HOVC 5C3EK 2A68A 1SFOK 3H3VL 1I3QC 4A3MK 4BY1C 2O5JA 3S1QK 2A69A 4LJZA 5FLMK 4QJVB 1I50K 2R7ZC 2JA8K 3GTPK 3EQLA 2WAQL 4BY7K 4QIWD 3S14K 3GTQK 4YFXA 3HOWK 1TWAK 4XLNA 3PO2K 4A3EC 3M3YK 1I6HK 3S1QC 5IYDC 4KMUA 1IW7A 4KN4A 4A3KC 2JA8C 2NVTC 3GTPC 4A3BC 4Q5SA 5C4JK 4A3JK 1TWCC 4KN7A 2JA5K 3GTGC 4A93K 3S2DC 4A3DK 4A3GK 3S1RK 4X6AK 1I3QK 3I4NK 2WAQD 1YNJA 3HOXK 3RZOK 2NVXK 5IYDK 1WCMC 1TWHK 1TWFC 5C44K 4A3IC 4XLPA 2NVYK 2YU9C 4OIQA 3GTLC 1K83K 1R9TK 3S17C 3S1MK 2R93C 3GTQC 3HOWC 4LLGA 2PPBA 3PO2C 3HOZC 2CW0A 5M5WK 4MEXA 3HKZL 4AYBL 2PMZL 2WB1L 1BDFA 1WCMK 4OIPA 2NVTK 3GTKK 2BE5A 4BXXK 5IP7C 5C4XC 2B63K 5M5YK 5IP9K 4AYBD 5TMCA 4X6AC
chains in the Genus database with same CATH superfamily
2E2JC 3I4NC 1VH2A 3GTMK 4C3HK 4FM9A 2JA7A 3H0GK 4BY7C 2A6EA 4PABA 2JA6C 5IORA 1SMYA 1R9TC 1O24A 3LAPA 3GSIA 3M3YC 1IS1A 1J6XA 3GTOK 1WOPA 1J6WA 4A3CC 1Y1VC 4A3FK 1K83A 2R93K 4LK0A 4YG2A 2NVXA 3K7AC 1O28A 3SZYA 1TWHC 1VJEA 4WILA 3GTJC 3HKZD 4XSZA 3G4CA 3PO3K 3BP8C 4LR2A 1I50C 1XXCA 1Y1WC 1TWGC 2V6TA 3S16C 3GTKC 2XCOA 3H0GA 4KARA 2E2HK 3GTMA 1O2BA 4A3KK 3I4MK 1SFOA 2V6SA 4Y52K 2NVQK 3OREA 3OPFA 5IOTA 2YU9K 3S17K 3GTLK 3GTLA 1PJ6A 3M4OC 5IYCK 2FQTA 1PJ5A 4GTEA 2R7ZK 1EQRA 1HQMA 4A3BK 5C4JC 2A68A 3FHZA 2EBBA 2A69A 3GEIA 3AD7C 3LPXA 1I50K 4KB4A 1DCHA 1I50A 3M3YK 2ZFZA 2GAHC 1ISEA 4KMUA 4KN4A 2GSUA 3AD8C 2NVTC 4Q5SA 4A3JK 2P5MA 5CJ9A 1USMA 2D6FC 5IYDK 2FQOA 1WCMC 1TWFC 2YU9C 3S17C 3S1MK 3GIRA 4LLGA 3HOZC 3A8JA 1ZQ1C 4GTDA 3HKZL 4M1XA 4AYBL 3AH5A 4BXXK 4OIPA 3GTKK 1WCMA 5C4XC 1EK8A 4X6AC 1O29A 5FLMC 4WJ4A 4A3CK 2E2HA 1Y1VK 1YNNA 1WQHA 4KM8A 4A3LK 1DCPA 3GEHA 2PHCB 3CAGA 5IYBC 1XXAA 5IOQA 1J6VA 4WJ3M 2JA6A 4ILDA 5E68A 2NVYA 1WSVA 3WODA 5IP7K 2Y3PA 2B63C 5IP9C 4A3MC 4KATA 4BBSK 3FKIK 4Y7NK 3L4JA 1VRQC 3A8IA 2JA6K 4C3IC 2VUMK 4KC6A 3DXJA 3HOYC 3HOZK 3HOUC 3GTMC 1O26A 1ZYRA 3S15C 3H0GC 3IPJA 3NUHA 2ZUFA 1BGWA 3N0CA 2XCRB 2JA5C 1GE9A 4KMHA 4LK1A 2R92K 2PA8L 1IE0A 4PAAA 5C44C 3TFJA 4C45A 4KAWX 4P5AA 1TWFA 4A93C 2W7VA 1O2FB 4A3EK 1XZPB 3TFIA 4BLBA 3K7AK 4KM9A 3TTGA 4QIWL 4G7HA 3HOVC 1RU0A 4P5BA 4BLAA 4A3MK 4BY1C 1C0AA 3SZZA 4G0VA 1F93A 4C3JC 5FLMK 4BKWA 1VGXA 3EQLA 2RH6A 2WAQL 3AD9C 4YFXA 3PO2K 1TWAK 3GDZA 3S1QC 5IYDC 1EI6A 1EH1A 4A3KC 3T02A 4GTAA 2JA8C 3GTPC 3CQZA 5C4JK 1TWCC 4A3DK 2JA5K 1ZVUA 4A93K 2R93A 3A8KA 1I3QK 3GEEA 3RZOK 4BXXC 4A3IC 5C44K 2NVYK 1K83K 2GSNA 3HOWC 2GAGC 5M5WK 4FZBA 1DCOA 1B4AA 1BDFA 3T01A 1WQGA 1Y1VA 5TMCA 2WB1D 2PMZD 4C3JK 2E2IA 4KMDA 4A3FC 3JSTA 3GTJK 1DD5A 1ZBSA 1J98A 3FKIC 4C2MK 2XCQA 4KMAA 4C3HC 4QJVA 4XCHA 1WOSA 1TWCK 4A3DC 1K83C 4BBRK 2E2HC 1F7VA 1VLOA 3RZOC 3FOEA 1Y1WK 3L4KA 4A3IK 4Y52C 3S2HC 3S1NK 2JA5A 5M5XK 4A3LC 5C4XK 2JA7K 5IYCC 3GTOA 1JQWA 5FJ8K 4MQ9A 2R92C 1WIHA 1TWAA 2B63A 3H3VD 3ADAC 3CQZC 5C3EC 3GTPA 3GTGK 4A3GC 2E2IK 1JOEA 3S1RC 3PO3C 1YCLA 5IYBK 1BS2A 1WQFA 2ZUEA 2NVYC 4BBRC 1INNA 1F7UA 3N3YA 2O5IA 2P8TA 1X31C 4Q4ZA 4BY1K 3HOYK 4LOWA 2V6UA 3HOXC 3V4GA 4Y7NC 3S2HK 4XSXA 2NVQC 3H3VL 1O25A 2O5JA 4LJZA 5EGEA 4QJVB 2R7ZC 2JA8K 1L0WA 3GTPK 3GTQK 4XLNA 4A3EC 1I6HK 1PJ7A 1IW7A 4A3BC 2VUMA 3GTGC 4A3GK 3Q3QA 3S2DC 3S1RK 3OEPA 4X6AK 3I4NK 2WAQD 1YNJA 5L46A 4GTCA 4XLPA 2YU9A 1TWGA 1R9TK 2R92A 2PPBA 4MEXA 1JVIA 2JH3A 3VA7A 3BUEA 2NVTK 3TFHA 4GTBA 4G0WA 2B63K 4KDDA 1UV7A 4AYBD 2E2IC 1XZPA 4C3IK 2VUMC 3S1MC 1O27A 4GZYA 2Y0SL 3RZDK 1I6HC 3FKIA 1V5VA 2RGRA 3HOUK 4JK1A 4RMFA 5JFEA 1IQ0A 4OIOA 3I4MC 1ZXOA 1Y1WA 5IOSA 1SFOC 3GTOC 4YFNA 1O2AA 4MEYA 3BP3A 1XPPA 1XZQA 3CQZK 3M4OK 3S14C 2GSOA 3LAJA 4OIRA 5HL8A 5D4DA 1YX2A 1B4BA 4BBSC 1I6VA 4ZH4A 3GTKA 1XXBA 2CFAA 3HOVK 3S2DK 2E2JK 1IBAA 3S0XA 1BJTA 2NVXC 5TMFA 2KWAA 3S15K 1TWGK 1R9TA 3S16K 3S1NC 5M3MK 3N0BA 1TWHA 3RZDC 2JA7C 1TWAC 4AH6A 4G7ZA 2PA8D 4KB2A 3QX3A 5EGHA 4YFKA 2R7ZA 5M3FK 4NOIA 4G7OA 3GTGA 1TWFK 4OINA 2A6HA 2Y0SD 4A3JC 4DDQA 1IL2A 5C3EK 1SFOK 1AB4A 4J3NA 1I3QC 3FOFA 3S1QK 1I3QA 1KQ4A 1F9NA 3T00A 4GTFA 3GTQA 1HI9A 4BY7K 4QIWD 3S14K 4KASA 3HOWK 1WOOA 4GTLA 1USOA 3G4AA 4KN7A 4LQYA 3AQOA 3ERED 5CHPA 3HOXK 1G51A 2NVXK 1WORA 1TWHK 4P9SA 3GTLC 4OIQA 1TWCA 2R93C 3GTJA 2CFAB 3HXAA 3GTQC 3PO2C 4GFQA 1EFWA 3AQPA 5TJ3A 2CW0A 4C2MC 4GT9A 3MMLB 5JVOA 4G0UA 2PMZL 2WB1L 1WCMK 4O2DA 2BE5A 1WSRA 5IP7C 5M5YK 5IP9K 1XZQB
chains in the Genus database with same CATH topology
2E2IC 2E2JC 2WB1D 2PMZD 3I4NC 4C3JK 5FLMC 3GTMK 4A3CK 4C3HK 1Y1VK 1YNNA 4A3FC 3H0GK 4BY7C 2A6EA 2JA6C 4A3LK 4C3IK 3GTJK 2VUMC 3S1MC 1SMYA 1R9TC 4GZYA 2Y0SL 3M3YC 3RZDK 1I6HC 3HOUK 4JK1A 3FKIC 4C2MK 3GTOK 5IYBC 4OIOA 4A3CC 4QJVA 3I4MC 1Y1VC 4A3FK 1TWCK 4A3DC 1K83C 2R93K 4LK0A 4YG2A 4BBRK 3WODA 5IP7K 2E2HC 2B63C 5IP9C 1SFOC 4A3MC 3K7AC 3RZOC 4BBSK 3FKIK 3GTOC 4YFNA 1Y1WK 4Y7NK 1TWHC 4A3IK 4MEYA 4Y52C 1XPPA 3S1NK 3S2HC 5M5XK 3CQZK 2JA6K 3GTJC 2VUMK 4A3LC 3HKZD 3DXJA 5C4XK 2JA7K 3HOYC 3S14C 4XSZA 5IYCC 3HOZK 3M4OK 4OIRA 3PO3K 5FJ8K 5D4DA 4MQ9A 3HOUC 3GTMC 4BBSC 2R92C 1I50C 1I6VA 1ZYRA 1Y1WC 1TWGC 4ZH4A 3H0GC 3H3VD 3S16C 3S15C 3GTKC 3HOVK 3CQZC 5C3EC 2JA5C 2E2HK 3GTGK 3S2DK 4A3GC 2E2JK 3S1RC 2E2IK 3PO3C 4LK1A 4BXXC 5IYBK 2NVXC 4A3KK 3I4MK 2R92K 2PA8L 5TMFA 3S15K 1TWGK 3S16K 2NVQK 4Y52K 3S1NC 5M3MK 5C44C 2YU9K 3S17K 2NVYC 4BBRC 3GTLK 3RZDC 4A93C 2O5IA 2JA7C 1TWAC 4Q4ZA 5IYCK 2PA8D 4G7ZA 4A3EK 4BY1K 3HOYK 3M4OC 3K7AK 4YFKA 5M3FK 3HOXC 4NOIA 2R7ZK 4Y7NC 4QIWL 4G7HA 4G7OA 1HQMA 3S2HK 1TWFK 4OINA 2A6HA 2Y0SD 5C4JC 4XSXA 4A3JC 2NVQC 4A3BK 3HOVC 5C3EK 2A68A 1SFOK 3H3VL 1I3QC 4A3MK 4BY1C 2O5JA 3S1QK 2A69A 4LJZA 5FLMK 4QJVB 1I50K 2R7ZC 2JA8K 3GTPK 3EQLA 2WAQL 4BY7K 4QIWD 3S14K 3GTQK 4YFXA 3HOWK 1TWAK 4XLNA 3PO2K 4A3EC 3M3YK 1I6HK 3S1QC 5IYDC 4KMUA 1IW7A 4KN4A 4A3KC 2JA8C 2NVTC 3GTPC 4A3BC 4Q5SA 5C4JK 4A3JK 1TWCC 4KN7A 2JA5K 3GTGC 4A93K 3S2DC 4A3DK 4A3GK 3S1RK 4X6AK 1I3QK 3I4NK 2WAQD 1YNJA 3HOXK 3RZOK 2NVXK 5IYDK 1WCMC 1TWHK 1TWFC 5C44K 4A3IC 4XLPA 2NVYK 2YU9C 4OIQA 3GTLC 1K83K 1R9TK 3S17C 3S1MK 2R93C 3GTQC 3HOWC 4LLGA 2PPBA 3PO2C 3HOZC 2CW0A 5M5WK 4MEXA 3HKZL 4AYBL 2PMZL 2WB1L 1BDFA 1WCMK 4OIPA 2NVTK 3GTKK 2BE5A 4BXXK 5IP7C 5C4XC 2B63K 5M5YK 5IP9K 4AYBD 5TMCA 4X6AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I C;  2E2J C;  2WB1 D;  2PMZ D;  3I4N C;  4C3J K;  5FLM C;  3GTM K;  4A3C K;  4C3H K;  1Y1V K;  1YNN A;  4A3F C;  3H0G K;  4BY7 C;  2A6E A;  2JA6 C;  4A3L K;  4C3I K;  3GTJ K;  2VUM C;  3S1M C;  1SMY A;  1R9T C;  4GZY A;  2Y0S L;  3M3Y C;  3RZD K;  1I6H C;  3HOU K;  4JK1 A;  3FKI C;  4C2M K;  3GTO K;  5IYB C;  4OIO A;  4A3C C;  4QJV A;  3I4M C;  1Y1V C;  4A3F K;  1TWC K;  4A3D C;  1K83 C;  2R93 K;  4LK0 A;  4YG2 A;  4BBR K;  3WOD A;  5IP7 K;  2E2H C;  2B63 C;  5IP9 C;  1SFO C;  4A3M C;  3K7A C;  3RZO C;  4BBS K;  3FKI K;  3GTO C;  4YFN A;  1Y1W K;  4Y7N K;  1TWH C;  4A3I K;  4MEY A;  4Y52 C;  1XPP A;  3S1N K;  3S2H C;  5M5X K;  3CQZ K;  2JA6 K;  3GTJ C;  2VUM K;  4A3L C;  3HKZ D;  3DXJ A;  5C4X K;  2JA7 K;  3HOY C;  3S14 C;  4XSZ A;  5IYC C;  3HOZ K;  3M4O K;  4OIR A;  3PO3 K;  5FJ8 K;  5D4D A;  4MQ9 A;  3HOU C;  3GTM C;  4BBS C;  2R92 C;  1I50 C;  1I6V A;  1ZYR A;  1Y1W C;  1TWG C;  4ZH4 A;  3H0G C;  3H3V D;  3S16 C;  3S15 C;  3GTK C;  3HOV K;  3CQZ C;  5C3E C;  2JA5 C;  2E2H K;  3GTG K;  3S2D K;  4A3G C;  2E2J K;  3S1R C;  2E2I K;  3PO3 C;  4LK1 A;  4BXX C;  5IYB K;  2NVX C;  4A3K K;  3I4M K;  2R92 K;  2PA8 L;  5TMF A;  3S15 K;  1TWG K;  3S16 K;  2NVQ K;  4Y52 K;  3S1N C;  5M3M K;  5C44 C;  2YU9 K;  3S17 K;  2NVY C;  4BBR C;  3GTL K;  3RZD C;  4A93 C;  2O5I A;  2JA7 C;  1TWA C;  4Q4Z A;  5IYC K;  2PA8 D;  4G7Z A;  4A3E K;  4BY1 K;  3HOY K;  3M4O C;  3K7A K;  4YFK A;  5M3F K;  3HOX C;  4NOI A;  2R7Z K;  4Y7N C;  4QIW L;  4G7H A;  4G7O A;  1HQM A;  3S2H K;  1TWF K;  4OIN A;  2A6H A;  2Y0S D;  5C4J C;  4XSX A;  4A3J C;  2NVQ C;  4A3B K;  3HOV C;  5C3E K;  2A68 A;  1SFO K;  3H3V L;  1I3Q C;  4A3M K;  4BY1 C;  2O5J A;  3S1Q K;  2A69 A;  4LJZ A;  5FLM K;  4QJV B;  1I50 K;  2R7Z C;  2JA8 K;  3GTP K;  3EQL A;  2WAQ L;  4BY7 K;  4QIW D;  3S14 K;  3GTQ K;  4YFX A;  3HOW K;  1TWA K;  4XLN A;  3PO2 K;  4A3E C;  3M3Y K;  1I6H K;  3S1Q C;  5IYD C;  4KMU A;  1IW7 A;  4KN4 A;  4A3K C;  2JA8 C;  2NVT C;  3GTP C;  4A3B C;  4Q5S A;  5C4J K;  4A3J K;  1TWC C;  4KN7 A;  2JA5 K;  3GTG C;  4A93 K;  3S2D C;  4A3D K;  4A3G K;  3S1R K;  4X6A K;  1I3Q K;  3I4N K;  2WAQ D;  1YNJ A;  3HOX K;  3RZO K;  2NVX K;  5IYD K;  1WCM C;  1TWH K;  1TWF C;  5C44 K;  4A3I C;  4XLP A;  2NVY K;  2YU9 C;  4OIQ A;  3GTL C;  1K83 K;  1R9T K;  3S17 C;  3S1M K;  2R93 C;  3GTQ C;  3HOW C;  4LLG A;  2PPB A;  3PO2 C;  3HOZ C;  2CW0 A;  5M5W K;  4MEX A;  3HKZ L;  4AYB L;  2PMZ L;  2WB1 L;  1BDF A;  1WCM K;  4OIP A;  2NVT K;  3GTK K;  2BE5 A;  4BXX K;  5IP7 C;  5C4X C;  2B63 K;  5M5Y K;  5IP9 K;  4AYB D;  5TMC A;  4X6A C; 
#chains in the Genus database with same CATH topology
 2E2J C;  3I4N C;  1VH2 A;  3GTM K;  4C3H K;  4FM9 A;  2JA7 A;  3H0G K;  4BY7 C;  2A6E A;  4PAB A;  2JA6 C;  5IOR A;  1SMY A;  1R9T C;  1O24 A;  3LAP A;  3GSI A;  3M3Y C;  1IS1 A;  1J6X A;  3GTO K;  1WOP A;  1J6W A;  4A3C C;  1Y1V C;  4A3F K;  1K83 A;  2R93 K;  4LK0 A;  4YG2 A;  2NVX A;  3K7A C;  1O28 A;  3SZY A;  1TWH C;  1VJE A;  4WIL A;  3GTJ C;  3HKZ D;  4XSZ A;  3G4C A;  3PO3 K;  3BP8 C;  4LR2 A;  1I50 C;  1XXC A;  1Y1W C;  1TWG C;  2V6T A;  3S16 C;  3GTK C;  2XCO A;  3H0G A;  4KAR A;  2E2H K;  3GTM A;  1O2B A;  4A3K K;  3I4M K;  1SFO A;  2V6S A;  4Y52 K;  2NVQ K;  3ORE A;  3OPF A;  5IOT A;  2YU9 K;  3S17 K;  3GTL K;  3GTL A;  1PJ6 A;  3M4O C;  5IYC K;  2FQT A;  1PJ5 A;  4GTE A;  2R7Z K;  1EQR A;  1HQM A;  4A3B K;  5C4J C;  2A68 A;  3FHZ A;  2EBB A;  2A69 A;  3GEI A;  3AD7 C;  3LPX A;  1I50 K;  4KB4 A;  1DCH A;  1I50 A;  3M3Y K;  2ZFZ A;  2GAH C;  1ISE A;  4KMU A;  4KN4 A;  2GSU A;  3AD8 C;  2NVT C;  4Q5S A;  4A3J K;  2P5M A;  5CJ9 A;  1USM A;  2D6F C;  5IYD K;  2FQO A;  1WCM C;  1TWF C;  2YU9 C;  3S17 C;  3S1M K;  3GIR A;  4LLG A;  3HOZ C;  3A8J A;  1ZQ1 C;  4GTD A;  3HKZ L;  4M1X A;  4AYB L;  3AH5 A;  4BXX K;  4OIP A;  3GTK K;  1WCM A;  5C4X C;  1EK8 A;  4X6A C;  1O29 A;  5FLM C;  4WJ4 A;  4A3C K;  2E2H A;  1Y1V K;  1YNN A;  1WQH A;  4KM8 A;  4A3L K;  1DCP A;  3GEH A;  2PHC B;  3CAG A;  5IYB C;  1XXA A;  5IOQ A;  1J6V A;  4WJ3 M;  2JA6 A;  4ILD A;  5E68 A;  2NVY A;  1WSV A;  3WOD A;  5IP7 K;  2Y3P A;  2B63 C;  5IP9 C;  4A3M C;  4KAT A;  4BBS K;  3FKI K;  4Y7N K;  3L4J A;  1VRQ C;  3A8I A;  2JA6 K;  4C3I C;  2VUM K;  4KC6 A;  3DXJ A;  3HOY C;  3HOZ K;  3HOU C;  3GTM C;  1O26 A;  1ZYR A;  3S15 C;  3H0G C;  3IPJ A;  3NUH A;  2ZUF A;  1BGW A;  3N0C A;  2XCR B;  2JA5 C;  1GE9 A;  4KMH A;  4LK1 A;  2R92 K;  2PA8 L;  1IE0 A;  4PAA A;  5C44 C;  3TFJ A;  4C45 A;  4KAW X;  4P5A A;  1TWF A;  4A93 C;  2W7V A;  1O2F B;  4A3E K;  1XZP B;  3TFI A;  4BLB A;  3K7A K;  4KM9 A;  3TTG A;  4QIW L;  4G7H A;  3HOV C;  1RU0 A;  4P5B A;  4BLA A;  4A3M K;  4BY1 C;  1C0A A;  3SZZ A;  4G0V A;  1F93 A;  4C3J C;  5FLM K;  4BKW A;  1VGX A;  3EQL A;  2RH6 A;  2WAQ L;  3AD9 C;  4YFX A;  3PO2 K;  1TWA K;  3GDZ A;  3S1Q C;  5IYD C;  1EI6 A;  1EH1 A;  4A3K C;  3T02 A;  4GTA A;  2JA8 C;  3GTP C;  3CQZ A;  5C4J K;  1TWC C;  4A3D K;  2JA5 K;  1ZVU A;  4A93 K;  2R93 A;  3A8K A;  1I3Q K;  3GEE A;  3RZO K;  4BXX C;  4A3I C;  5C44 K;  2NVY K;  1K83 K;  2GSN A;  3HOW C;  2GAG C;  5M5W K;  4FZB A;  1DCO A;  1B4A A;  1BDF A;  3T01 A;  1WQG A;  1Y1V A;  5TMC A;  2WB1 D;  2PMZ D;  4C3J K;  2E2I A;  4KMD A;  4A3F C;  3JST A;  3GTJ K;  1DD5 A;  1ZBS A;  1J98 A;  3FKI C;  4C2M K;  2XCQ A;  4KMA A;  4C3H C;  4QJV A;  4XCH A;  1WOS A;  1TWC K;  4A3D C;  1K83 C;  4BBR K;  2E2H C;  1F7V A;  1VLO A;  3RZO C;  3FOE A;  1Y1W K;  3L4K A;  4A3I K;  4Y52 C;  3S2H C;  3S1N K;  2JA5 A;  5M5X K;  4A3L C;  5C4X K;  2JA7 K;  5IYC C;  3GTO A;  1JQW A;  5FJ8 K;  4MQ9 A;  2R92 C;  1WIH A;  1TWA A;  2B63 A;  3H3V D;  3ADA C;  3CQZ C;  5C3E C;  3GTP A;  3GTG K;  4A3G C;  2E2I K;  1JOE A;  3S1R C;  3PO3 C;  1YCL A;  5IYB K;  1BS2 A;  1WQF A;  2ZUE A;  2NVY C;  4BBR C;  1INN A;  1F7U A;  3N3Y A;  2O5I A;  2P8T A;  1X31 C;  4Q4Z A;  4BY1 K;  3HOY K;  4LOW A;  2V6U A;  3HOX C;  3V4G A;  4Y7N C;  3S2H K;  4XSX A;  2NVQ C;  3H3V L;  1O25 A;  2O5J A;  4LJZ A;  5EGE A;  4QJV B;  2R7Z C;  2JA8 K;  1L0W A;  3GTP K;  3GTQ K;  4XLN A;  4A3E C;  1I6H K;  1PJ7 A;  1IW7 A;  4A3B C;  2VUM A;  3GTG C;  4A3G K;  3Q3Q A;  3S2D C;  3S1R K;  3OEP A;  4X6A K;  3I4N K;  2WAQ D;  1YNJ A;  5L46 A;  4GTC A;  4XLP A;  2YU9 A;  1TWG A;  1R9T K;  2R92 A;  2PPB A;  4MEX A;  1JVI A;  2JH3 A;  3VA7 A;  3BUE A;  2NVT K;  3TFH A;  4GTB A;  4G0W A;  2B63 K;  4KDD A;  1UV7 A;  4AYB D;  2E2I C;  1XZP A;  4C3I K;  2VUM C;  3S1M C;  1O27 A;  4GZY A;  2Y0S L;  3RZD K;  1I6H C;  3FKI A;  1V5V A;  2RGR A;  3HOU K;  4JK1 A;  4RMF A;  5JFE A;  1IQ0 A;  4OIO A;  3I4M C;  1ZXO A;  1Y1W A;  5IOS A;  1SFO C;  3GTO C;  4YFN A;  1O2A A;  4MEY A;  3BP3 A;  1XPP A;  1XZQ A;  3CQZ K;  3M4O K;  3S14 C;  2GSO A;  3LAJ A;  4OIR A;  5HL8 A;  5D4D A;  1YX2 A;  1B4B A;  4BBS C;  1I6V A;  4ZH4 A;  3GTK A;  1XXB A;  2CFA A;  3HOV K;  3S2D K;  2E2J K;  1IBA A;  3S0X A;  1BJT A;  2NVX C;  5TMF A;  2KWA A;  3S15 K;  1TWG K;  1R9T A;  3S16 K;  3S1N C;  5M3M K;  3N0B A;  1TWH A;  3RZD C;  2JA7 C;  1TWA C;  4AH6 A;  4G7Z A;  2PA8 D;  4KB2 A;  3QX3 A;  5EGH A;  4YFK A;  2R7Z A;  5M3F K;  4NOI A;  4G7O A;  3GTG A;  1TWF K;  4OIN A;  2A6H A;  2Y0S D;  4A3J C;  4DDQ A;  1IL2 A;  5C3E K;  1SFO K;  1AB4 A;  4J3N A;  1I3Q C;  3FOF A;  3S1Q K;  1I3Q A;  1KQ4 A;  1F9N A;  3T00 A;  4GTF A;  3GTQ A;  1HI9 A;  4BY7 K;  4QIW D;  3S14 K;  4KAS A;  3HOW K;  1WOO A;  4GTL A;  1USO A;  3G4A A;  4KN7 A;  4LQY A;  3AQO A;  3ERE D;  5CHP A;  3HOX K;  1G51 A;  2NVX K;  1WOR A;  1TWH K;  4P9S A;  3GTL C;  4OIQ A;  1TWC A;  2R93 C;  3GTJ A;  2CFA B;  3HXA A;  3GTQ C;  3PO2 C;  4GFQ A;  1EFW A;  3AQP A;  5TJ3 A;  2CW0 A;  4C2M C;  4GT9 A;  3MML B;  5JVO A;  4G0U A;  2PMZ L;  2WB1 L;  1WCM K;  4O2D A;  2BE5 A;  1WSR A;  5IP7 C;  5M5Y K;  5IP9 K;  1XZQ B; 
#chains in the Genus database with same CATH homology
 2E2I C;  2E2J C;  2WB1 D;  2PMZ D;  3I4N C;  4C3J K;  5FLM C;  3GTM K;  4A3C K;  4C3H K;  1Y1V K;  1YNN A;  4A3F C;  3H0G K;  4BY7 C;  2A6E A;  2JA6 C;  4A3L K;  4C3I K;  3GTJ K;  2VUM C;  3S1M C;  1SMY A;  1R9T C;  4GZY A;  2Y0S L;  3M3Y C;  3RZD K;  1I6H C;  3HOU K;  4JK1 A;  3FKI C;  4C2M K;  3GTO K;  5IYB C;  4OIO A;  4A3C C;  4QJV A;  3I4M C;  1Y1V C;  4A3F K;  1TWC K;  4A3D C;  1K83 C;  2R93 K;  4LK0 A;  4YG2 A;  4BBR K;  3WOD A;  5IP7 K;  2E2H C;  2B63 C;  5IP9 C;  1SFO C;  4A3M C;  3K7A C;  3RZO C;  4BBS K;  3FKI K;  3GTO C;  4YFN A;  1Y1W K;  4Y7N K;  1TWH C;  4A3I K;  4MEY A;  4Y52 C;  1XPP A;  3S1N K;  3S2H C;  5M5X K;  3CQZ K;  2JA6 K;  3GTJ C;  2VUM K;  4A3L C;  3HKZ D;  3DXJ A;  5C4X K;  2JA7 K;  3HOY C;  3S14 C;  4XSZ A;  5IYC C;  3HOZ K;  3M4O K;  4OIR A;  3PO3 K;  5FJ8 K;  5D4D A;  4MQ9 A;  3HOU C;  3GTM C;  4BBS C;  2R92 C;  1I50 C;  1I6V A;  1ZYR A;  1Y1W C;  1TWG C;  4ZH4 A;  3H0G C;  3H3V D;  3S16 C;  3S15 C;  3GTK C;  3HOV K;  3CQZ C;  5C3E C;  2JA5 C;  2E2H K;  3GTG K;  3S2D K;  4A3G C;  2E2J K;  3S1R C;  2E2I K;  3PO3 C;  4LK1 A;  4BXX C;  5IYB K;  2NVX C;  4A3K K;  3I4M K;  2R92 K;  2PA8 L;  5TMF A;  3S15 K;  1TWG K;  3S16 K;  2NVQ K;  4Y52 K;  3S1N C;  5M3M K;  5C44 C;  2YU9 K;  3S17 K;  2NVY C;  4BBR C;  3GTL K;  3RZD C;  4A93 C;  2O5I A;  2JA7 C;  1TWA C;  4Q4Z A;  5IYC K;  2PA8 D;  4G7Z A;  4A3E K;  4BY1 K;  3HOY K;  3M4O C;  3K7A K;  4YFK A;  5M3F K;  3HOX C;  4NOI A;  2R7Z K;  4Y7N C;  4QIW L;  4G7H A;  4G7O A;  1HQM A;  3S2H K;  1TWF K;  4OIN A;  2A6H A;  2Y0S D;  5C4J C;  4XSX A;  4A3J C;  2NVQ C;  4A3B K;  3HOV C;  5C3E K;  2A68 A;  1SFO K;  3H3V L;  1I3Q C;  4A3M K;  4BY1 C;  2O5J A;  3S1Q K;  2A69 A;  4LJZ A;  5FLM K;  4QJV B;  1I50 K;  2R7Z C;  2JA8 K;  3GTP K;  3EQL A;  2WAQ L;  4BY7 K;  4QIW D;  3S14 K;  3GTQ K;  4YFX A;  3HOW K;  1TWA K;  4XLN A;  3PO2 K;  4A3E C;  3M3Y K;  1I6H K;  3S1Q C;  5IYD C;  4KMU A;  1IW7 A;  4KN4 A;  4A3K C;  2JA8 C;  2NVT C;  3GTP C;  4A3B C;  4Q5S A;  5C4J K;  4A3J K;  1TWC C;  4KN7 A;  2JA5 K;  3GTG C;  4A93 K;  3S2D C;  4A3D K;  4A3G K;  3S1R K;  4X6A K;  1I3Q K;  3I4N K;  2WAQ D;  1YNJ A;  3HOX K;  3RZO K;  2NVX K;  5IYD K;  1WCM C;  1TWH K;  1TWF C;  5C44 K;  4A3I C;  4XLP A;  2NVY K;  2YU9 C;  4OIQ A;  3GTL C;  1K83 K;  1R9T K;  3S17 C;  3S1M K;  2R93 C;  3GTQ C;  3HOW C;  4LLG A;  2PPB A;  3PO2 C;  3HOZ C;  2CW0 A;  5M5W K;  4MEX A;  3HKZ L;  4AYB L;  2PMZ L;  2WB1 L;  1BDF A;  1WCM K;  4OIP A;  2NVT K;  3GTK K;  2BE5 A;  4BXX K;  5IP7 C;  5C4X C;  2B63 K;  5M5Y K;  5IP9 K;  4AYB D;  5TMC A;  4X6A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...