3GTJK

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtjK00
4A3KC 3GTKC 3HOXK 1TWFK 4C3HK 1I50K 3H3VL 3S2DK 3S1NK 2PPBA 3RZOC 2A6HA 1YNNA 3GTQK 2A6EA 2B63K 4BBRC 4QIWL 4OIQA 2PMZL 1I3QK 2R92K 3K7AK 1TWGC 4XSZA 3S14K 5FLMC 2E2IC 3HOVC 4A3GC 3S15C 1R9TK 4Y52C 3S1QC 1TWAC 3FKIC 4A3EK 4A3MK 2WB1D 4YFKA 5IP7C 2NVQK 3S1RK 2YU9K 2NVXC 1I6VA 4AYBD 3CQZC 3GTMK 3PO3K 2JA8C 4MEXA 3M3YC 5M3MK 4XSXA 3GTJC 5IYBK 4BY7C 3RZOK 4YFNA 4LK1A 2JA5K 1WCMC 5IYCC 2NVYC 3H0GK 1Y1WK 2E2JC 3S17C 1K83C 3HKZD 2JA7K 5M5YK 4A3FC 2VUMC 2E2IK 4A3GK 2WAQL 3S15K 2A69A 3HOYC 2R7ZK 3PO2K 4A3CC 4KN7A 4Y52K 3I4NK 2PA8L 1TWAK 1TWCK 1Y1VC 5IP9C 4OINA 3GTGC 4A3LC 2NVTC 2O5IA 3H3VD 5C4JK 3S16K 1YNJA 5C44C 3GTOK 4MQ9A 2JA8K 3S2HC 4QIWD 4GZYA 2R93K 4A3JC 1I6HK 2PMZD 2JA6K 3HOZC 3S1MC 4A3BK 4BY1C 3HOUK 4BXXC 4BBSC 2Y0SL 5C3EC 2O5JA 5TMFA 5M5WK 4A3KK 3GTKK 3GTPC 4C3JK 4Y7NC 2VUMK 4OIRA 4C3IK 4BBRK 5IP9K 4Q4ZA 3RZDC 1HQMA 2NVTK 5IYDC 4A3DC 4XLNA 1TWGK 3HOXC 2WB1L 5FLMK 3HOVK 1I50C 4A93C 4OIPA 4NOIA 2E2HC 3S1QK 3FKIK 4XLPA 5IP7K 4A3IC 2B63C 4QJVB 2WAQD 1I3QC 5C3EK 3K7AC 2NVXK 2A68A 3CQZK 2R92C 3S14C 2PA8D 3M3YK 4Y7NK 4QJVA 3GTJK 1ZYRA 1R9TC 5TMCA 1SFOC 4BY7K 4X6AC 5C4XC 4A3EC 5D4DA 5FJ8K 1WCMK 1BDFA 5IYCK 2NVYK 3S1RC 2E2JK 2YU9C 2NVQC 3GTLC 3I4MC 1K83K 3S17K 4G7OA 4A3DK 4C2MK 3PO3C 4A3FK 3GTMC 4KN4A 3DXJA 4A93K 4KMUA 3RZDK 3HOYK 2Y0SD 3HOWC 5IYBC 4A3CK 4LLGA 2E2HK 3M4OC 1Y1VK 2JA5C 4G7ZA 2CW0A 1TWHC 4A3IK 3GTGK 1Y1WC 4A3LK 3H0GC 1TWFC 2JA7C 5C44K 1XPPA 3S2DC 5M3FK 4ZH4A 3S2HK 4MEYA 3S1NC 4Q5SA 4A3JK 2R7ZC 3PO2C 1SFOK 4AYBL 3GTQC 3HOZK 5C4XK 3I4NC 3S1MK 4X6AK 1TWCC 4LK0A 4LJZA 4BY1K 4G7HA 4BXXK 4YG2A 4BBSK 4YFXA 5C4JC 3S16C 3GTLK 3EQLA 3I4MK 4JK1A 3GTPK 5M5XK 3GTOC 1SMYA 3WODA 3HKZL 2R93C 1I6HC 3HOWK 1IW7A 2BE5A 4A3MC 2JA6C 4OIOA 3M4OK 4A3BC 3HOUC 1TWHK 5IYDK
chains in the Genus database with same CATH superfamily
3GTKC 1I50K 3H3VL 3S1NK 3RZOC 3N0BA 5CHPA 3GTQK 1I3QK 2R92K 2E2IC 3HOVC 3S15C 4ILDA 1DD5A 1WQFA 3FKIC 4A3MK 1L0WA 4BLBA 2P8TA 5M3MK 4BY7C 2XCRB 3RZOK 4LK1A 1WCMC 2NVYC 2YU9A 4KATA 5M5YK 4A3FC 4PABA 2E2IK 2WAQL 3S15K 3CAGA 3PO2K 4KDDA 3I4NK 1TWCK 4OINA 1USMA 1WSVA 2JA5A 1J6VA 5C44C 4BLAA 4MQ9A 4QIWD 3HOZC 2R7ZA 4BXXC 5C3EC 4KAWX 1XXBA 5L46A 4KM8A 3A8IA 1B4AA 4BBRK 4G0VA 2WB1L 5FLMK 1EFWA 1VRQC 5JVOA 4QJVB 5C3EK 2A68A 4WJ4A 3M3YK 1TWGA 1F7VA 1ZVUA 3HXAA 5C4XC 2NVQC 1XZQA 2JH3A 2E2JK 2YU9C 4G7OA 3S17K 3L4KA 4C2MK 3CQZA 4KMUA 4GTFA 2Y0SD 4LLGA 3GTJA 2JA5C 1YCLA 1TWHC 2P5MA 4C3HC 4P9SA 1K83A 1O28A 3S2DC 5M3FK 3BUEA 2R7ZC 4P5BA 2GSNA 5C4XK 4LK0A 1VGXA 4GTDA 4BY1K 2E2HA 3LPXA 3TFHA 3S16C 3GTGA 1BGWA 1O25A 4JK1A 2GAGC 3L4JA 3MMLB 1I6HC 1IW7A 3HOUC 1TWHK 5IYDK 3LAPA 1XXAA 4A3KC 4C3HK 1INNA 3SZYA 3S2DK 3GTPA 3ADAC 1YNNA 4C3IC 4GTAA 4QIWL 4OIQA 1WORA 1TWGC 3GDZA 1WOOA 4RMFA 1R9TK 1O27A 4A3EK 2WB1D 2XCQA 3S1RK 2B63A 4AYBD 3CQZC 3GTMK 3T00A 4G0UA 1O24A 3GTJC 1BJTA 5IYBK 1RU0A 1SFOA 4YFNA 1Y1WK 3H0GK 1K83C 4DDQA 3IPJA 1VH2A 1PJ7A 4GTEA 2A69A 3HOYC 4A3CC 4KMAA 2GSOA 4KB4A 5IP9C 3GTGC 4GFQA 4A3LC 2O5IA 4G0WA 3BP3A 1ZBSA 2RGRA 1ZQ1C 2JA7A 4GZYA 2PMZD 2JA6K 5E68A 2Y0SL 5HL8A 5M5WK 3GTKK 3GTPC 1WQHA 4Y7NC 4OIRA 3GTOA 2FQTA 3AQPA 1BS2A 2EBBA 2R93A 5IP9K 1VLOA 3RZDC 2KWAA 3HOXC 3HOVK 1IBAA 4NOIA 1UV7A 5JFEA 1JQWA 3FKIK 4A3IC 2FQOA 2B63C 1DCOA 1EI6A 1G51A 3K7AC 3S14C 3N3YA 1O29A 3T01A 4Y7NK 1SFOC 4BY7K 1WCMK 1BDFA 1TWAA 2NVYK 1F7UA 4LQYA 3VA7A 3AH5A 3TFJA 3PO3C 4A3FK 4GTBA 2NVXA 3HOWC 3Q3QA 1IE0A 4G7ZA 4A3IK 3N0CA 2JA7C 5C44K 4MEYA 3T02A 3AD7C 1SFOK 4AYBL 3HOZK 5TJ3A 4BXXK 1Y1VA 1JOEA 5C4JC 3GTOC 1SMYA 5IOSA 1O2BA 2R93C 3HOWK 2XCOA 4A3BC 4C3JC 3AD8C 2GAHC 1XXCA 2A6HA 3AQOA 3OEPA 2PMZL 1V5VA 4WJ3M 4XSZA 1EH1A 1I50A 3S1QC 1TWAC 3OPFA 4YFKA 5IP7C 2NVQK 2YU9K 1C0AA 1F9NA 4GT9A 2NVXC 1I6VA 1I3QA 2R92A 3A8JA 2JA5K 3SZZA 5IYCC 3HKZD 3FOFA 3GTLA 1EK8A 4GTLA 1X31C 3G4CA 2R7ZK 4KN7A 1TWAK 1Y1VC 3TTGA 5EGHA 1IQ0A 3S16K 1HI9A 1TWFA 3S2HC 1ISEA 4A3JC 1I6HK 5IORA 3S1MC 3HOUK 4BBSC 1TWCA 2O5JA 5TMFA 4A3KK 1YX2A 3GEHA 4C3IK 1B4BA 2V6TA 5IOQA 4Q4ZA 1HQMA 1PJ6A 1TWGK 1I50C 3OREA 4KMDA 1DCPA 2E2HC 1O2AA 4C45A 4XLPA 4FM9A 2Y3PA 3GEEA 1I3QC 2R92C 3CQZK 2PA8D 4O2DA 4QJVA 3GTJK 1ZYRA 1WOSA 1WSRA 5D4DA 3GTLC 1K83K 4LR2A 4KN4A 3HOYK 4A3CK 1WIHA 2E2HK 3M4OC 3FHZA 2CW0A 3GTGK 4A3LK 3GIRA 1TWFC 3JSTA 1XPPA 2VUMA 3PO2C 3GEIA 3I4NC 4LOWA 1TWCC 4G7HA 4YG2A 4BKWA 3A8KA 4YFXA 3GTLK 3EQLA 3GTPK 4P5AA 1XZPB 1PJ5A 1J6WA 3WODA 3HKZL 1KQ4A 1O2FB 2BE5A 3BP8C 3NUHA 4OIOA 3M4OK 1JVIA 3RZDK 1IL2A 4J3NA 3HOXK 1TWFK 4KMHA 4KASA 4KARA 2PPBA 2A6EA 2B63K 4BBRC 4XCHA 2CFAB 1TWHA 3K7AK 3S14K 5FLMC 4A3GC 4Y52C 1O26A 1F93A 3PO3K 2JA8C 4MEXA 3M3YC 4XSXA 1R9TA 2E2JC 3S17C 2RH6A 2JA7K 4C2MC 4PAAA 2VUMC 4A3GK 4GTCA 3GTMA 2PHCB 1WQGA 3QX3A 4Y52K 4M1XA 2PA8L 2NVTC 3H3VD 1DCHA 5C4JK 1Y1WA 3H0GA 1YNJA 3GTOK 1GE9A 3G4AA 2JA8K 5EGEA 2W7VA 2R93K 4A3BK 4BY1C 4AH6A 3GTQA 1J6XA 2ZFZA 4C3JK 1IS1A 2VUMK 2V6SA 2JA6A 2NVTK 5IYDC 3S0XA 1J98A 4XLNA 4A3DC 4A93C 3GTKA 4OIPA 3S1QK 5IP7K 2WAQD 1ZXOA 3ERED 2NVXK 1R9TC 2E2IA 5TMCA 4KC6A 3V4GA 4X6AC 4A3EC 4KB2A 5FJ8K 3S1RC 1XZPA 3FKIA 5IYCK 3I4MC 4FZBA 4A3DK 3GTMC 3LAJA 3DXJA 4A93K 5CJ9A 3TFIA 5IYBC 1Y1VK 1Y1WC 3H0GC 2ZUFA 1USOA 1WCMA 2D6FC 2NVYA 2GSUA 3S2HK 4ZH4A 1WOPA 3S1NC 4Q5SA 3FOEA 4A3JK 3GTQC 4X6AK 2CFAA 4WILA 4LJZA 3S1MK 2V6UA 4BBSK 5IOTA 1VJEA 1AB4A 3I4MK 1XZQB 5M5XK 1EQRA 3AD9C 4A3MC 2JA6C 4KM9A 2ZUEA 3GSIA
chains in the Genus database with same CATH topology
4A3KC 3GTKC 3HOXK 1TWFK 4C3HK 1I50K 3H3VL 3S2DK 3S1NK 2PPBA 3RZOC 2A6HA 1YNNA 3GTQK 2A6EA 2B63K 4BBRC 4QIWL 4OIQA 2PMZL 1I3QK 2R92K 3K7AK 1TWGC 4XSZA 3S14K 5FLMC 2E2IC 3HOVC 4A3GC 3S15C 1R9TK 4Y52C 3S1QC 1TWAC 3FKIC 4A3EK 4A3MK 2WB1D 4YFKA 5IP7C 2NVQK 3S1RK 2YU9K 2NVXC 1I6VA 4AYBD 3CQZC 3GTMK 3PO3K 2JA8C 4MEXA 3M3YC 5M3MK 4XSXA 3GTJC 5IYBK 4BY7C 3RZOK 4YFNA 4LK1A 2JA5K 1WCMC 5IYCC 2NVYC 3H0GK 1Y1WK 2E2JC 3S17C 1K83C 3HKZD 2JA7K 5M5YK 4A3FC 2VUMC 2E2IK 4A3GK 2WAQL 3S15K 2A69A 3HOYC 2R7ZK 3PO2K 4A3CC 4KN7A 4Y52K 3I4NK 2PA8L 1TWAK 1TWCK 1Y1VC 5IP9C 4OINA 3GTGC 4A3LC 2NVTC 2O5IA 3H3VD 5C4JK 3S16K 1YNJA 5C44C 3GTOK 4MQ9A 2JA8K 3S2HC 4QIWD 4GZYA 2R93K 4A3JC 1I6HK 2PMZD 2JA6K 3HOZC 3S1MC 4A3BK 4BY1C 3HOUK 4BXXC 4BBSC 2Y0SL 5C3EC 2O5JA 5TMFA 5M5WK 4A3KK 3GTKK 3GTPC 4C3JK 4Y7NC 2VUMK 4OIRA 4C3IK 4BBRK 5IP9K 4Q4ZA 3RZDC 1HQMA 2NVTK 5IYDC 4A3DC 4XLNA 1TWGK 3HOXC 2WB1L 5FLMK 3HOVK 1I50C 4A93C 4OIPA 4NOIA 2E2HC 3S1QK 3FKIK 4XLPA 5IP7K 4A3IC 2B63C 4QJVB 2WAQD 1I3QC 5C3EK 3K7AC 2NVXK 2A68A 3CQZK 2R92C 3S14C 2PA8D 3M3YK 4Y7NK 4QJVA 3GTJK 1ZYRA 1R9TC 5TMCA 1SFOC 4BY7K 4X6AC 5C4XC 4A3EC 5D4DA 5FJ8K 1WCMK 1BDFA 5IYCK 2NVYK 3S1RC 2E2JK 2YU9C 2NVQC 3GTLC 3I4MC 1K83K 3S17K 4G7OA 4A3DK 4C2MK 3PO3C 4A3FK 3GTMC 4KN4A 3DXJA 4A93K 4KMUA 3RZDK 3HOYK 2Y0SD 3HOWC 5IYBC 4A3CK 4LLGA 2E2HK 3M4OC 1Y1VK 2JA5C 4G7ZA 2CW0A 1TWHC 4A3IK 3GTGK 1Y1WC 4A3LK 3H0GC 1TWFC 2JA7C 5C44K 1XPPA 3S2DC 5M3FK 4ZH4A 3S2HK 4MEYA 3S1NC 4Q5SA 4A3JK 2R7ZC 3PO2C 1SFOK 4AYBL 3GTQC 3HOZK 5C4XK 3I4NC 3S1MK 4X6AK 1TWCC 4LK0A 4LJZA 4BY1K 4G7HA 4BXXK 4YG2A 4BBSK 4YFXA 5C4JC 3S16C 3GTLK 3EQLA 3I4MK 4JK1A 3GTPK 5M5XK 3GTOC 1SMYA 3WODA 3HKZL 2R93C 1I6HC 3HOWK 1IW7A 2BE5A 4A3MC 2JA6C 4OIOA 3M4OK 4A3BC 3HOUC 1TWHK 5IYDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K C;  3GTK C;  3HOX K;  1TWF K;  4C3H K;  1I50 K;  3H3V L;  3S2D K;  3S1N K;  2PPB A;  3RZO C;  2A6H A;  1YNN A;  3GTQ K;  2A6E A;  2B63 K;  4BBR C;  4QIW L;  4OIQ A;  2PMZ L;  1I3Q K;  2R92 K;  3K7A K;  1TWG C;  4XSZ A;  3S14 K;  5FLM C;  2E2I C;  3HOV C;  4A3G C;  3S15 C;  1R9T K;  4Y52 C;  3S1Q C;  1TWA C;  3FKI C;  4A3E K;  4A3M K;  2WB1 D;  4YFK A;  5IP7 C;  2NVQ K;  3S1R K;  2YU9 K;  2NVX C;  1I6V A;  4AYB D;  3CQZ C;  3GTM K;  3PO3 K;  2JA8 C;  4MEX A;  3M3Y C;  5M3M K;  4XSX A;  3GTJ C;  5IYB K;  4BY7 C;  3RZO K;  4YFN A;  4LK1 A;  2JA5 K;  1WCM C;  5IYC C;  2NVY C;  3H0G K;  1Y1W K;  2E2J C;  3S17 C;  1K83 C;  3HKZ D;  2JA7 K;  5M5Y K;  4A3F C;  2VUM C;  2E2I K;  4A3G K;  2WAQ L;  3S15 K;  2A69 A;  3HOY C;  2R7Z K;  3PO2 K;  4A3C C;  4KN7 A;  4Y52 K;  3I4N K;  2PA8 L;  1TWA K;  1TWC K;  1Y1V C;  5IP9 C;  4OIN A;  3GTG C;  4A3L C;  2NVT C;  2O5I A;  3H3V D;  5C4J K;  3S16 K;  1YNJ A;  5C44 C;  3GTO K;  4MQ9 A;  2JA8 K;  3S2H C;  4QIW D;  4GZY A;  2R93 K;  4A3J C;  1I6H K;  2PMZ D;  2JA6 K;  3HOZ C;  3S1M C;  4A3B K;  4BY1 C;  3HOU K;  4BXX C;  4BBS C;  2Y0S L;  5C3E C;  2O5J A;  5TMF A;  5M5W K;  4A3K K;  3GTK K;  3GTP C;  4C3J K;  4Y7N C;  2VUM K;  4OIR A;  4C3I K;  4BBR K;  5IP9 K;  4Q4Z A;  3RZD C;  1HQM A;  2NVT K;  5IYD C;  4A3D C;  4XLN A;  1TWG K;  3HOX C;  2WB1 L;  5FLM K;  3HOV K;  1I50 C;  4A93 C;  4OIP A;  4NOI A;  2E2H C;  3S1Q K;  3FKI K;  4XLP A;  5IP7 K;  4A3I C;  2B63 C;  4QJV B;  2WAQ D;  1I3Q C;  5C3E K;  3K7A C;  2NVX K;  2A68 A;  3CQZ K;  2R92 C;  3S14 C;  2PA8 D;  3M3Y K;  4Y7N K;  4QJV A;  3GTJ K;  1ZYR A;  1R9T C;  5TMC A;  1SFO C;  4BY7 K;  4X6A C;  5C4X C;  4A3E C;  5D4D A;  5FJ8 K;  1WCM K;  1BDF A;  5IYC K;  2NVY K;  3S1R C;  2E2J K;  2YU9 C;  2NVQ C;  3GTL C;  3I4M C;  1K83 K;  3S17 K;  4G7O A;  4A3D K;  4C2M K;  3PO3 C;  4A3F K;  3GTM C;  4KN4 A;  3DXJ A;  4A93 K;  4KMU A;  3RZD K;  3HOY K;  2Y0S D;  3HOW C;  5IYB C;  4A3C K;  4LLG A;  2E2H K;  3M4O C;  1Y1V K;  2JA5 C;  4G7Z A;  2CW0 A;  1TWH C;  4A3I K;  3GTG K;  1Y1W C;  4A3L K;  3H0G C;  1TWF C;  2JA7 C;  5C44 K;  1XPP A;  3S2D C;  5M3F K;  4ZH4 A;  3S2H K;  4MEY A;  3S1N C;  4Q5S A;  4A3J K;  2R7Z C;  3PO2 C;  1SFO K;  4AYB L;  3GTQ C;  3HOZ K;  5C4X K;  3I4N C;  3S1M K;  4X6A K;  1TWC C;  4LK0 A;  4LJZ A;  4BY1 K;  4G7H A;  4BXX K;  4YG2 A;  4BBS K;  4YFX A;  5C4J C;  3S16 C;  3GTL K;  3EQL A;  3I4M K;  4JK1 A;  3GTP K;  5M5X K;  3GTO C;  1SMY A;  3WOD A;  3HKZ L;  2R93 C;  1I6H C;  3HOW K;  1IW7 A;  2BE5 A;  4A3M C;  2JA6 C;  4OIO A;  3M4O K;  4A3B C;  3HOU C;  1TWH K;  5IYD K; 
#chains in the Genus database with same CATH topology
 3GTK C;  1I50 K;  3H3V L;  3S1N K;  3RZO C;  3N0B A;  5CHP A;  3GTQ K;  1I3Q K;  2R92 K;  2E2I C;  3HOV C;  3S15 C;  4ILD A;  1DD5 A;  1WQF A;  3FKI C;  4A3M K;  1L0W A;  4BLB A;  2P8T A;  5M3M K;  4BY7 C;  2XCR B;  3RZO K;  4LK1 A;  1WCM C;  2NVY C;  2YU9 A;  4KAT A;  5M5Y K;  4A3F C;  4PAB A;  2E2I K;  2WAQ L;  3S15 K;  3CAG A;  3PO2 K;  4KDD A;  3I4N K;  1TWC K;  4OIN A;  1USM A;  1WSV A;  2JA5 A;  1J6V A;  5C44 C;  4BLA A;  4MQ9 A;  4QIW D;  3HOZ C;  2R7Z A;  4BXX C;  5C3E C;  4KAW X;  1XXB A;  5L46 A;  4KM8 A;  3A8I A;  1B4A A;  4BBR K;  4G0V A;  2WB1 L;  5FLM K;  1EFW A;  1VRQ C;  5JVO A;  4QJV B;  5C3E K;  2A68 A;  4WJ4 A;  3M3Y K;  1TWG A;  1F7V A;  1ZVU A;  3HXA A;  5C4X C;  2NVQ C;  1XZQ A;  2JH3 A;  2E2J K;  2YU9 C;  4G7O A;  3S17 K;  3L4K A;  4C2M K;  3CQZ A;  4KMU A;  4GTF A;  2Y0S D;  4LLG A;  3GTJ A;  2JA5 C;  1YCL A;  1TWH C;  2P5M A;  4C3H C;  4P9S A;  1K83 A;  1O28 A;  3S2D C;  5M3F K;  3BUE A;  2R7Z C;  4P5B A;  2GSN A;  5C4X K;  4LK0 A;  1VGX A;  4GTD A;  4BY1 K;  2E2H A;  3LPX A;  3TFH A;  3S16 C;  3GTG A;  1BGW A;  1O25 A;  4JK1 A;  2GAG C;  3L4J A;  3MML B;  1I6H C;  1IW7 A;  3HOU C;  1TWH K;  5IYD K;  3LAP A;  1XXA A;  4A3K C;  4C3H K;  1INN A;  3SZY A;  3S2D K;  3GTP A;  3ADA C;  1YNN A;  4C3I C;  4GTA A;  4QIW L;  4OIQ A;  1WOR A;  1TWG C;  3GDZ A;  1WOO A;  4RMF A;  1R9T K;  1O27 A;  4A3E K;  2WB1 D;  2XCQ A;  3S1R K;  2B63 A;  4AYB D;  3CQZ C;  3GTM K;  3T00 A;  4G0U A;  1O24 A;  3GTJ C;  1BJT A;  5IYB K;  1RU0 A;  1SFO A;  4YFN A;  1Y1W K;  3H0G K;  1K83 C;  4DDQ A;  3IPJ A;  1VH2 A;  1PJ7 A;  4GTE A;  2A69 A;  3HOY C;  4A3C C;  4KMA A;  2GSO A;  4KB4 A;  5IP9 C;  3GTG C;  4GFQ A;  4A3L C;  2O5I A;  4G0W A;  3BP3 A;  1ZBS A;  2RGR A;  1ZQ1 C;  2JA7 A;  4GZY A;  2PMZ D;  2JA6 K;  5E68 A;  2Y0S L;  5HL8 A;  5M5W K;  3GTK K;  3GTP C;  1WQH A;  4Y7N C;  4OIR A;  3GTO A;  2FQT A;  3AQP A;  1BS2 A;  2EBB A;  2R93 A;  5IP9 K;  1VLO A;  3RZD C;  2KWA A;  3HOX C;  3HOV K;  1IBA A;  4NOI A;  1UV7 A;  5JFE A;  1JQW A;  3FKI K;  4A3I C;  2FQO A;  2B63 C;  1DCO A;  1EI6 A;  1G51 A;  3K7A C;  3S14 C;  3N3Y A;  1O29 A;  3T01 A;  4Y7N K;  1SFO C;  4BY7 K;  1WCM K;  1BDF A;  1TWA A;  2NVY K;  1F7U A;  4LQY A;  3VA7 A;  3AH5 A;  3TFJ A;  3PO3 C;  4A3F K;  4GTB A;  2NVX A;  3HOW C;  3Q3Q A;  1IE0 A;  4G7Z A;  4A3I K;  3N0C A;  2JA7 C;  5C44 K;  4MEY A;  3T02 A;  3AD7 C;  1SFO K;  4AYB L;  3HOZ K;  5TJ3 A;  4BXX K;  1Y1V A;  1JOE A;  5C4J C;  3GTO C;  1SMY A;  5IOS A;  1O2B A;  2R93 C;  3HOW K;  2XCO A;  4A3B C;  4C3J C;  3AD8 C;  2GAH C;  1XXC A;  2A6H A;  3AQO A;  3OEP A;  2PMZ L;  1V5V A;  4WJ3 M;  4XSZ A;  1EH1 A;  1I50 A;  3S1Q C;  1TWA C;  3OPF A;  4YFK A;  5IP7 C;  2NVQ K;  2YU9 K;  1C0A A;  1F9N A;  4GT9 A;  2NVX C;  1I6V A;  1I3Q A;  2R92 A;  3A8J A;  2JA5 K;  3SZZ A;  5IYC C;  3HKZ D;  3FOF A;  3GTL A;  1EK8 A;  4GTL A;  1X31 C;  3G4C A;  2R7Z K;  4KN7 A;  1TWA K;  1Y1V C;  3TTG A;  5EGH A;  1IQ0 A;  3S16 K;  1HI9 A;  1TWF A;  3S2H C;  1ISE A;  4A3J C;  1I6H K;  5IOR A;  3S1M C;  3HOU K;  4BBS C;  1TWC A;  2O5J A;  5TMF A;  4A3K K;  1YX2 A;  3GEH A;  4C3I K;  1B4B A;  2V6T A;  5IOQ A;  4Q4Z A;  1HQM A;  1PJ6 A;  1TWG K;  1I50 C;  3ORE A;  4KMD A;  1DCP A;  2E2H C;  1O2A A;  4C45 A;  4XLP A;  4FM9 A;  2Y3P A;  3GEE A;  1I3Q C;  2R92 C;  3CQZ K;  2PA8 D;  4O2D A;  4QJV A;  3GTJ K;  1ZYR A;  1WOS A;  1WSR A;  5D4D A;  3GTL C;  1K83 K;  4LR2 A;  4KN4 A;  3HOY K;  4A3C K;  1WIH A;  2E2H K;  3M4O C;  3FHZ A;  2CW0 A;  3GTG K;  4A3L K;  3GIR A;  1TWF C;  3JST A;  1XPP A;  2VUM A;  3PO2 C;  3GEI A;  3I4N C;  4LOW A;  1TWC C;  4G7H A;  4YG2 A;  4BKW A;  3A8K A;  4YFX A;  3GTL K;  3EQL A;  3GTP K;  4P5A A;  1XZP B;  1PJ5 A;  1J6W A;  3WOD A;  3HKZ L;  1KQ4 A;  1O2F B;  2BE5 A;  3BP8 C;  3NUH A;  4OIO A;  3M4O K;  1JVI A;  3RZD K;  1IL2 A;  4J3N A;  3HOX K;  1TWF K;  4KMH A;  4KAS A;  4KAR A;  2PPB A;  2A6E A;  2B63 K;  4BBR C;  4XCH A;  2CFA B;  1TWH A;  3K7A K;  3S14 K;  5FLM C;  4A3G C;  4Y52 C;  1O26 A;  1F93 A;  3PO3 K;  2JA8 C;  4MEX A;  3M3Y C;  4XSX A;  1R9T A;  2E2J C;  3S17 C;  2RH6 A;  2JA7 K;  4C2M C;  4PAA A;  2VUM C;  4A3G K;  4GTC A;  3GTM A;  2PHC B;  1WQG A;  3QX3 A;  4Y52 K;  4M1X A;  2PA8 L;  2NVT C;  3H3V D;  1DCH A;  5C4J K;  1Y1W A;  3H0G A;  1YNJ A;  3GTO K;  1GE9 A;  3G4A A;  2JA8 K;  5EGE A;  2W7V A;  2R93 K;  4A3B K;  4BY1 C;  4AH6 A;  3GTQ A;  1J6X A;  2ZFZ A;  4C3J K;  1IS1 A;  2VUM K;  2V6S A;  2JA6 A;  2NVT K;  5IYD C;  3S0X A;  1J98 A;  4XLN A;  4A3D C;  4A93 C;  3GTK A;  4OIP A;  3S1Q K;  5IP7 K;  2WAQ D;  1ZXO A;  3ERE D;  2NVX K;  1R9T C;  2E2I A;  5TMC A;  4KC6 A;  3V4G A;  4X6A C;  4A3E C;  4KB2 A;  5FJ8 K;  3S1R C;  1XZP A;  3FKI A;  5IYC K;  3I4M C;  4FZB A;  4A3D K;  3GTM C;  3LAJ A;  3DXJ A;  4A93 K;  5CJ9 A;  3TFI A;  5IYB C;  1Y1V K;  1Y1W C;  3H0G C;  2ZUF A;  1USO A;  1WCM A;  2D6F C;  2NVY A;  2GSU A;  3S2H K;  4ZH4 A;  1WOP A;  3S1N C;  4Q5S A;  3FOE A;  4A3J K;  3GTQ C;  4X6A K;  2CFA A;  4WIL A;  4LJZ A;  3S1M K;  2V6U A;  4BBS K;  5IOT A;  1VJE A;  1AB4 A;  3I4M K;  1XZQ B;  5M5X K;  1EQR A;  3AD9 C;  4A3M C;  2JA6 C;  4KM9 A;  2ZUE A;  3GSI A; 
#chains in the Genus database with same CATH homology
 4A3K C;  3GTK C;  3HOX K;  1TWF K;  4C3H K;  1I50 K;  3H3V L;  3S2D K;  3S1N K;  2PPB A;  3RZO C;  2A6H A;  1YNN A;  3GTQ K;  2A6E A;  2B63 K;  4BBR C;  4QIW L;  4OIQ A;  2PMZ L;  1I3Q K;  2R92 K;  3K7A K;  1TWG C;  4XSZ A;  3S14 K;  5FLM C;  2E2I C;  3HOV C;  4A3G C;  3S15 C;  1R9T K;  4Y52 C;  3S1Q C;  1TWA C;  3FKI C;  4A3E K;  4A3M K;  2WB1 D;  4YFK A;  5IP7 C;  2NVQ K;  3S1R K;  2YU9 K;  2NVX C;  1I6V A;  4AYB D;  3CQZ C;  3GTM K;  3PO3 K;  2JA8 C;  4MEX A;  3M3Y C;  5M3M K;  4XSX A;  3GTJ C;  5IYB K;  4BY7 C;  3RZO K;  4YFN A;  4LK1 A;  2JA5 K;  1WCM C;  5IYC C;  2NVY C;  3H0G K;  1Y1W K;  2E2J C;  3S17 C;  1K83 C;  3HKZ D;  2JA7 K;  5M5Y K;  4A3F C;  2VUM C;  2E2I K;  4A3G K;  2WAQ L;  3S15 K;  2A69 A;  3HOY C;  2R7Z K;  3PO2 K;  4A3C C;  4KN7 A;  4Y52 K;  3I4N K;  2PA8 L;  1TWA K;  1TWC K;  1Y1V C;  5IP9 C;  4OIN A;  3GTG C;  4A3L C;  2NVT C;  2O5I A;  3H3V D;  5C4J K;  3S16 K;  1YNJ A;  5C44 C;  3GTO K;  4MQ9 A;  2JA8 K;  3S2H C;  4QIW D;  4GZY A;  2R93 K;  4A3J C;  1I6H K;  2PMZ D;  2JA6 K;  3HOZ C;  3S1M C;  4A3B K;  4BY1 C;  3HOU K;  4BXX C;  4BBS C;  2Y0S L;  5C3E C;  2O5J A;  5TMF A;  5M5W K;  4A3K K;  3GTK K;  3GTP C;  4C3J K;  4Y7N C;  2VUM K;  4OIR A;  4C3I K;  4BBR K;  5IP9 K;  4Q4Z A;  3RZD C;  1HQM A;  2NVT K;  5IYD C;  4A3D C;  4XLN A;  1TWG K;  3HOX C;  2WB1 L;  5FLM K;  3HOV K;  1I50 C;  4A93 C;  4OIP A;  4NOI A;  2E2H C;  3S1Q K;  3FKI K;  4XLP A;  5IP7 K;  4A3I C;  2B63 C;  4QJV B;  2WAQ D;  1I3Q C;  5C3E K;  3K7A C;  2NVX K;  2A68 A;  3CQZ K;  2R92 C;  3S14 C;  2PA8 D;  3M3Y K;  4Y7N K;  4QJV A;  3GTJ K;  1ZYR A;  1R9T C;  5TMC A;  1SFO C;  4BY7 K;  4X6A C;  5C4X C;  4A3E C;  5D4D A;  5FJ8 K;  1WCM K;  1BDF A;  5IYC K;  2NVY K;  3S1R C;  2E2J K;  2YU9 C;  2NVQ C;  3GTL C;  3I4M C;  1K83 K;  3S17 K;  4G7O A;  4A3D K;  4C2M K;  3PO3 C;  4A3F K;  3GTM C;  4KN4 A;  3DXJ A;  4A93 K;  4KMU A;  3RZD K;  3HOY K;  2Y0S D;  3HOW C;  5IYB C;  4A3C K;  4LLG A;  2E2H K;  3M4O C;  1Y1V K;  2JA5 C;  4G7Z A;  2CW0 A;  1TWH C;  4A3I K;  3GTG K;  1Y1W C;  4A3L K;  3H0G C;  1TWF C;  2JA7 C;  5C44 K;  1XPP A;  3S2D C;  5M3F K;  4ZH4 A;  3S2H K;  4MEY A;  3S1N C;  4Q5S A;  4A3J K;  2R7Z C;  3PO2 C;  1SFO K;  4AYB L;  3GTQ C;  3HOZ K;  5C4X K;  3I4N C;  3S1M K;  4X6A K;  1TWC C;  4LK0 A;  4LJZ A;  4BY1 K;  4G7H A;  4BXX K;  4YG2 A;  4BBS K;  4YFX A;  5C4J C;  3S16 C;  3GTL K;  3EQL A;  3I4M K;  4JK1 A;  3GTP K;  5M5X K;  3GTO C;  1SMY A;  3WOD A;  3HKZ L;  2R93 C;  1I6H C;  3HOW K;  1IW7 A;  2BE5 A;  4A3M C;  2JA6 C;  4OIO A;  3M4O K;  4A3B C;  3HOU C;  1TWH K;  5IYD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...