3GTJK

Backtracked rna polymerase ii complex with 13mer rna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtjK00
4A3BC 4A3EK 1WCMC 3S2HC 4LJZA 1SMYA 5C4JC 4G7HA 4OIOA 2JA8C 2NVXK 5M5XK 3HOXC 2A6EA 2JA8K 5C4JK 4QJVA 4YFKA 1I50K 3H3VD 4LLGA 4AYBD 3S2HK 4A3CC 1WCMK 4YFNA 3CQZK 1I50C 3S2DC 3EQLA 4G7OA 1Y1WK 3S1NC 4A93C 4C3IK 2NVXC 3S1NK 4A93K 1Y1WC 4MEXA 4C3JK 3M4OK 4XSZA 2O5IA 3HOYC 3M3YC 1Y1VK 2A69A 5M5YK 2R92K 3GTKK 4A3CK 4A3EC 4Y52C 4A3BK 1BDFA 4C2MK 2PA8L 3I4NK 5TMCA 4KN7A 3GTOC 2JA7C 2A68A 3GTGC 5IP7K 4A3GK 5TMFA 3H0GC 2PA8D 4BY7K 3HOWK 3GTLC 1R9TC 2WAQD 4BBSC 1I3QK 2PMZD 4LK0A 3S15K 4LK1A 4A3DC 2B63K 4AYBL 2NVQC 1TWGC 5IYDC 1TWCK 4Y7NC 3PO2K 3GTMK 1HQMA 5IYBK 2NVYK 4QJVB 5FLMK 2YU9K 5FJ8K 3S17C 1TWHC 3PO3K 5IP9C 4A3IC 4BY1C 3HOZK 3S1MC 2WB1D 5M5WK 5C3EK 3FKIC 5C44C 5IYCK 2E2HC 3GTJC 4KN4A 2VUMC 4A3JK 4A3MC 3HOUK 3S14K 3S16K 4BXXC 4A3KC 2E2IK 1I6HK 2NVTK 4X6AK 1SFOK 2R7ZC 3GTPC 3S1RK 3RZDC 4QIWD 4A3LK 3S1QK 4X6AC 3K7AC 2CW0A 3I4MK 2Y0SD 3RZOK 1TWFC 1K83C 3GTPK 3HKZD 4A3LC 2R93C 2E2JC 1XPPA 3GTQK 5C4XK 2PPBA 2JA5C 3H3VL 4G7ZA 2JA5K 4A3KK 2E2IC 3HKZL 2JA6K 3GTQC 3S16C 1I6HC 4KMUA 4A3FC 4A3MK 3HOUC 4A3JC 2A6HA 4OIQA 4NOIA 3I4MC 4BBRK 3K7AK 5M3MK 3S1RC 5IYCC 1SFOC 5M3FK 3FKIK 5C44K 2E2HK 3HOVC 2R7ZK 1TWAK 3S1QC 4Q5SA 4MQ9A 1TWAC 4BXXK 1ZYRA 3HOVK 3S14C 2E2JK 3WODA 3GTMC 1TWFK 4Y7NK 4MEYA 5D4DA 4BBRC 1TWGK 4XLNA 3RZDK 4A3DK 4A3FK 3DXJA 2JA6C 3HOZC 2PMZL 4BBSK 4GZYA 2WAQL 3GTLK 5IP9K 4A3IK 3HOWC 1TWHK 1YNNA 3PO3C 4JK1A 5C4XC 4BY7C 2NVYC 4XLPA 3GTGK 4A3GC 1K83K 2R93K 3RZOC 2VUMK 5IYDK 2O5JA 4QIWL 2B63C 4Y52K 2BE5A 2R92C 1Y1VC 2NVTC 4OINA 4XSXA 4BY1K 3H0GK 5IP7C 2YU9C 3S17K 4OIRA 3PO2C 3GTOK 3GTJK 3I4NC 1I6VA 3CQZC 3S15C 3GTKC 5C3EC 2WB1L 1I3QC 4OIPA 3S1MK 4YG2A 3HOYK 1R9TK 3M3YK 3M4OC 4Q4ZA 4ZH4A 5IYBC 5FLMC 4C3HK 3HOXK 2Y0SL 1TWCC 2JA7K 1IW7A 1YNJA 2NVQK 3S2DK 4YFXA
chains in the Genus database with same CATH superfamily
3NUHA 4A3EK 5JFEA 3GTJA 4LR2A 5M5XK 1YCLA 5C4JK 1RU0A 4C2MC 3S2HK 4A3CC 3AD7C 3FHZA 3S2DC 3EQLA 4G7OA 3CAGA 1Y1WC 1K83A 1B4AA 1O24A 3HOYC 1Y1VK 4A3CK 2R92K 3AD9C 4Y52C 4C2MK 2ZUFA 2PA8L 5TMCA 2R7ZA 3L4KA 2JA7C 1USOA 2A68A 4C3HC 5IP7K 1O26A 3GTLC 4BBSC 1GE9A 4BKWA 1TWAA 5IOTA 4A3DC 4AYBL 2NVQC 3OPFA 5FJ8K 3GEEA 4A3IC 1BJTA 1O28A 2W7VA 5M5WK 5C44C 1DD5A 3N3YA 4A3JK 3ERED 1EFWA 2GSNA 3OEPA 1ZXOA 1SFOK 2R7ZC 3S1QK 1JVIA 3SZYA 4RMFA 2Y0SD 1TWFC 1K83C 4WJ3M 2E2JC 3GTQK 2PPBA 3SZZA 3HXAA 2JA5K 3S16C 4A3FC 2Y3PA 4GFQA 5IORA 3K7AK 3G4CA 5C44K 1TWAK 3TFIA 1O2AA 3QX3A 4Q5SA 1F7VA 3S14C 4GTAA 2E2JK 3WODA 4MEYA 1DCOA 2KWAA 4A3DK 4GTLA 3Q3QA 3V4GA 2JA6C 3HOZC 3LPXA 3GTLK 1TWHK 3PO3C 5JVOA 1Y1WA 5IYDK 2O5JA 3AD8C 1EI6A 1VGXA 4QIWL 2B63C 2R92A 1J6VA 2D6FC 2R92C 5E68A 4OINA 3GTJK 1BS2A 4WJ4A 4OIPA 1I3QC 5EGHA 1I3QA 3M4OC 4KM9A 1IE0A 1XXAA 4KASA 1VJEA 5IYBC 2NVXA 4C3HK 2Y0SL 2JA7K 2JA6A 4P5BA 4YFXA 4A3BC 1WQGA 1Y1VA 3GSIA 1SMYA 1VLOA 1XZQB 2JA8C 4C3IC 3HOXC 3AH5A 2A6EA 2JA8K 1XZPB 4YFKA 1L0WA 1I50K 3BUEA 3H3VD 4LLGA 4AYBD 1TWHA 3N0CA 2ZUEA 1O25A 4AH6A 1PJ6A 4C3JK 2B63A 3M4OK 4XSZA 2NVYA 1WCMA 3FKIA 1BDFA 4C45A 3I4NK 1JOEA 4KN7A 2P8TA 5CHPA 4G0UA 3GEIA 2PA8D 3H0GC 4GTDA 4BY7K 1R9TC 2WAQD 2V6UA 2PMZD 1WOSA 1TWGA 2B63K 2E2IA 1TWGC 3T01A 3IPJA 3S17C 5FLMK 2NVYK 1TWHC 3PO3K 1IS1A 1J6XA 2RH6A 4KMAA 4KB4A 4O2DA 4A3MC 1ISEA 3HOUK 4A3KC 2E2IK 4KM8A 1DCHA 4LOWA 3A8IA 2XCQA 4X6AC 3RZDC 3K7AC 2GSOA 1YX2A 3HKZD 2R93C 2JA5C 4A3KK 2E2IC 4G0VA 3GTQC 3GEHA 4A3MK 3HOUC 1X31C 4NOIA 4BBRK 4KC6A 5M3FK 3HOVC 2ZFZA 3BP3A 4Y7NK 1TWGK 1G51A 3DXJA 4J3NA 1WIHA 2PMZL 2GAHC 5TJ3A 1WQFA 2V6SA 1YNNA 5C4XC 1I50A 4BY7C 2VUMK 1V5VA 2BE5A 3OREA 1F9NA 1PJ7A 1O29A 3A8KA 5IP7C 3S17K 3GTPA 3PO2C 1KQ4A 4WILA 1I6VA 4BLBA 2RGRA 2JA5A 2WB1L 4GTFA 1WSVA 1R9TK 3HOYK 3BP8C 2FQTA 1C0AA 4KMDA 2CFAA 3S2HC 4KATA 1VH2A 1WOOA 1ZQ1C 4LJZA 4G7HA 5C4JC 2NVXK 1SFOA 4QJVA 3AQOA 3GTLA 4YFNA 4KAWX 1I50C 1WSRA 1Y1WK 3S1NC 4A93C 4C3IK 3S1NK 2P5MA 4A93K 2R93A 4DDQA 3M3YC 3GTKK 2E2HA 3A8JA 4GTCA 4A3BK 4M1XA 1HI9A 1I3QK 4LK0A 4LK1A 1PJ5A 1WORA 1TWFA 2YU9K 4QJVB 3S1MC 1B4BA 5IYCK 4KARA 3GDZA 1IBAA 3S16K 2NVTK 4BLAA 3GTPC 3S1RK 4QIWD 4XCHA 3I4MK 1BGWA 3GTPK 5C4XK 4PAAA 3H3VL 4G7ZA 3HKZL 4KMUA 1ZBSA 3S0XA 4A3JC 2A6HA 4OIQA 2XCOA 4GT9A 5IYCC 3GTGA 4X6AK 4KDDA 4BXXK 1ZYRA 3HOVK 1TWFK 4BBRC 4FZBA 5IOQA 3CQZA 4BBSK 3TFJA 2WAQL 4P9SA 5IP9K 1INNA 2NVYC 4XLPA 2R93K 3LAPA 3RZOC 5HL8A 4Y52K 1Y1VC 1VRQC 5L46A 4KB2A 1USMA 3H0GK 2YU9C 3GTOK 3N0BA 3I4NC 5C3EC 3FOFA 3VA7A 4ZH4A 1WQHA 5FLMC 2V6TA 5IOSA 1TWCC 1YNJA 3ADAC 1TWCA 1J98A 1WCMC 1O2FB 2XCRB 4OIOA 1R9TA 4G0WA 1WCMK 3CQZK 5EGEA 4C3JC 2NVXC 3AQPA 3LAJA 4MEXA 2O5IA 1AB4A 2A69A 5M5YK 4A3EC 2GAGC 3L4JA 3GTOA 3GTOC 3G4AA 3GTGC 4A3GK 1EH1A 1O27A 5TMFA 3HOWK 3GTKA 3S15K 5CJ9A 5IYDC 1TWCK 4KMHA 4Y7NC 3PO2K 3GTMK 1HQMA 5IYBK 1XZPA 2EBBA 5IP9C 4BY1C 3HOZK 2WB1D 3GIRA 3FKIC 1J6WA 5C3EK 2E2HC 1IL2A 4LQYA 3GTQA 2FQOA 3GTJC 4KN4A 2VUMC 3GTMA 3S14K 4BXXC 1I6HK 3H0GA 2PHCB 4P5AA 1WOPA 2YU9A 4A3LK 2CW0A 3RZOK 4A3LC 1XPPA 1XXCA 1ZVUA 4FM9A 1I6HC 2JA6K 3TFHA 2JH3A 3I4MC 4ILDA 1EK8A 5M3MK 3S1RC 1SFOC 2E2HK 3FKIK 2R7ZK 3S1QC 4PABA 1UV7A 4MQ9A 1TWAC 3GTMC 2VUMA 5D4DA 2CFAB 4XLNA 3RZDK 1F93A 4A3FK 4GZYA 4A3IK 3HOWC 4JK1A 3T02A 4GTBA 3GTGK 1K83K 4A3GC 1EQRA 1IQ0A 2GSUA 3T00A 1F7UA 2NVTC 4XSXA 4BY1K 1XZQA 3FOEA 4OIRA 1JQWA 2JA7A 3TTGA 3CQZC 3S15C 3GTKC 3S1MK 4YG2A 3JSTA 3M3YK 1DCPA 4Q4ZA 1XXBA 4GTEA 3MMLB 3HOXK 1IW7A 2NVQK 3S2DK 1O2BA
chains in the Genus database with same CATH topology
4A3BC 4A3EK 1WCMC 3S2HC 4LJZA 1SMYA 5C4JC 4G7HA 4OIOA 2JA8C 2NVXK 5M5XK 3HOXC 2A6EA 2JA8K 5C4JK 4QJVA 4YFKA 1I50K 3H3VD 4LLGA 4AYBD 3S2HK 4A3CC 1WCMK 4YFNA 3CQZK 1I50C 3S2DC 3EQLA 4G7OA 1Y1WK 3S1NC 4A93C 4C3IK 2NVXC 3S1NK 4A93K 1Y1WC 4MEXA 4C3JK 3M4OK 4XSZA 2O5IA 3HOYC 3M3YC 1Y1VK 2A69A 5M5YK 2R92K 3GTKK 4A3CK 4A3EC 4Y52C 4A3BK 1BDFA 4C2MK 2PA8L 3I4NK 5TMCA 4KN7A 3GTOC 2JA7C 2A68A 3GTGC 5IP7K 4A3GK 5TMFA 3H0GC 2PA8D 4BY7K 3HOWK 3GTLC 1R9TC 2WAQD 4BBSC 1I3QK 2PMZD 4LK0A 3S15K 4LK1A 4A3DC 2B63K 4AYBL 2NVQC 1TWGC 5IYDC 1TWCK 4Y7NC 3PO2K 3GTMK 1HQMA 5IYBK 2NVYK 4QJVB 5FLMK 2YU9K 5FJ8K 3S17C 1TWHC 3PO3K 5IP9C 4A3IC 4BY1C 3HOZK 3S1MC 2WB1D 5M5WK 5C3EK 3FKIC 5C44C 5IYCK 2E2HC 3GTJC 4KN4A 2VUMC 4A3JK 4A3MC 3HOUK 3S14K 3S16K 4BXXC 4A3KC 2E2IK 1I6HK 2NVTK 4X6AK 1SFOK 2R7ZC 3GTPC 3S1RK 3RZDC 4QIWD 4A3LK 3S1QK 4X6AC 3K7AC 2CW0A 3I4MK 2Y0SD 3RZOK 1TWFC 1K83C 3GTPK 3HKZD 4A3LC 2R93C 2E2JC 1XPPA 3GTQK 5C4XK 2PPBA 2JA5C 3H3VL 4G7ZA 2JA5K 4A3KK 2E2IC 3HKZL 2JA6K 3GTQC 3S16C 1I6HC 4KMUA 4A3FC 4A3MK 3HOUC 4A3JC 2A6HA 4OIQA 4NOIA 3I4MC 4BBRK 3K7AK 5M3MK 3S1RC 5IYCC 1SFOC 5M3FK 3FKIK 5C44K 2E2HK 3HOVC 2R7ZK 1TWAK 3S1QC 4Q5SA 4MQ9A 1TWAC 4BXXK 1ZYRA 3HOVK 3S14C 2E2JK 3WODA 3GTMC 1TWFK 4Y7NK 4MEYA 5D4DA 4BBRC 1TWGK 4XLNA 3RZDK 4A3DK 4A3FK 3DXJA 2JA6C 3HOZC 2PMZL 4BBSK 4GZYA 2WAQL 3GTLK 5IP9K 4A3IK 3HOWC 1TWHK 1YNNA 3PO3C 4JK1A 5C4XC 4BY7C 2NVYC 4XLPA 3GTGK 4A3GC 1K83K 2R93K 3RZOC 2VUMK 5IYDK 2O5JA 4QIWL 2B63C 4Y52K 2BE5A 2R92C 1Y1VC 2NVTC 4OINA 4XSXA 4BY1K 3H0GK 5IP7C 2YU9C 3S17K 4OIRA 3PO2C 3GTOK 3GTJK 3I4NC 1I6VA 3CQZC 3S15C 3GTKC 5C3EC 2WB1L 1I3QC 4OIPA 3S1MK 4YG2A 3HOYK 1R9TK 3M3YK 3M4OC 4Q4ZA 4ZH4A 5IYBC 5FLMC 4C3HK 3HOXK 2Y0SL 1TWCC 2JA7K 1IW7A 1YNJA 2NVQK 3S2DK 4YFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B C;  4A3E K;  1WCM C;  3S2H C;  4LJZ A;  1SMY A;  5C4J C;  4G7H A;  4OIO A;  2JA8 C;  2NVX K;  5M5X K;  3HOX C;  2A6E A;  2JA8 K;  5C4J K;  4QJV A;  4YFK A;  1I50 K;  3H3V D;  4LLG A;  4AYB D;  3S2H K;  4A3C C;  1WCM K;  4YFN A;  3CQZ K;  1I50 C;  3S2D C;  3EQL A;  4G7O A;  1Y1W K;  3S1N C;  4A93 C;  4C3I K;  2NVX C;  3S1N K;  4A93 K;  1Y1W C;  4MEX A;  4C3J K;  3M4O K;  4XSZ A;  2O5I A;  3HOY C;  3M3Y C;  1Y1V K;  2A69 A;  5M5Y K;  2R92 K;  3GTK K;  4A3C K;  4A3E C;  4Y52 C;  4A3B K;  1BDF A;  4C2M K;  2PA8 L;  3I4N K;  5TMC A;  4KN7 A;  3GTO C;  2JA7 C;  2A68 A;  3GTG C;  5IP7 K;  4A3G K;  5TMF A;  3H0G C;  2PA8 D;  4BY7 K;  3HOW K;  3GTL C;  1R9T C;  2WAQ D;  4BBS C;  1I3Q K;  2PMZ D;  4LK0 A;  3S15 K;  4LK1 A;  4A3D C;  2B63 K;  4AYB L;  2NVQ C;  1TWG C;  5IYD C;  1TWC K;  4Y7N C;  3PO2 K;  3GTM K;  1HQM A;  5IYB K;  2NVY K;  4QJV B;  5FLM K;  2YU9 K;  5FJ8 K;  3S17 C;  1TWH C;  3PO3 K;  5IP9 C;  4A3I C;  4BY1 C;  3HOZ K;  3S1M C;  2WB1 D;  5M5W K;  5C3E K;  3FKI C;  5C44 C;  5IYC K;  2E2H C;  3GTJ C;  4KN4 A;  2VUM C;  4A3J K;  4A3M C;  3HOU K;  3S14 K;  3S16 K;  4BXX C;  4A3K C;  2E2I K;  1I6H K;  2NVT K;  4X6A K;  1SFO K;  2R7Z C;  3GTP C;  3S1R K;  3RZD C;  4QIW D;  4A3L K;  3S1Q K;  4X6A C;  3K7A C;  2CW0 A;  3I4M K;  2Y0S D;  3RZO K;  1TWF C;  1K83 C;  3GTP K;  3HKZ D;  4A3L C;  2R93 C;  2E2J C;  1XPP A;  3GTQ K;  5C4X K;  2PPB A;  2JA5 C;  3H3V L;  4G7Z A;  2JA5 K;  4A3K K;  2E2I C;  3HKZ L;  2JA6 K;  3GTQ C;  3S16 C;  1I6H C;  4KMU A;  4A3F C;  4A3M K;  3HOU C;  4A3J C;  2A6H A;  4OIQ A;  4NOI A;  3I4M C;  4BBR K;  3K7A K;  5M3M K;  3S1R C;  5IYC C;  1SFO C;  5M3F K;  3FKI K;  5C44 K;  2E2H K;  3HOV C;  2R7Z K;  1TWA K;  3S1Q C;  4Q5S A;  4MQ9 A;  1TWA C;  4BXX K;  1ZYR A;  3HOV K;  3S14 C;  2E2J K;  3WOD A;  3GTM C;  1TWF K;  4Y7N K;  4MEY A;  5D4D A;  4BBR C;  1TWG K;  4XLN A;  3RZD K;  4A3D K;  4A3F K;  3DXJ A;  2JA6 C;  3HOZ C;  2PMZ L;  4BBS K;  4GZY A;  2WAQ L;  3GTL K;  5IP9 K;  4A3I K;  3HOW C;  1TWH K;  1YNN A;  3PO3 C;  4JK1 A;  5C4X C;  4BY7 C;  2NVY C;  4XLP A;  3GTG K;  4A3G C;  1K83 K;  2R93 K;  3RZO C;  2VUM K;  5IYD K;  2O5J A;  4QIW L;  2B63 C;  4Y52 K;  2BE5 A;  2R92 C;  1Y1V C;  2NVT C;  4OIN A;  4XSX A;  4BY1 K;  3H0G K;  5IP7 C;  2YU9 C;  3S17 K;  4OIR A;  3PO2 C;  3GTO K;  3GTJ K;  3I4N C;  1I6V A;  3CQZ C;  3S15 C;  3GTK C;  5C3E C;  2WB1 L;  1I3Q C;  4OIP A;  3S1M K;  4YG2 A;  3HOY K;  1R9T K;  3M3Y K;  3M4O C;  4Q4Z A;  4ZH4 A;  5IYB C;  5FLM C;  4C3H K;  3HOX K;  2Y0S L;  1TWC C;  2JA7 K;  1IW7 A;  1YNJ A;  2NVQ K;  3S2D K;  4YFX A; 
#chains in the Genus database with same CATH topology
 3NUH A;  4A3E K;  5JFE A;  3GTJ A;  4LR2 A;  5M5X K;  1YCL A;  5C4J K;  1RU0 A;  4C2M C;  3S2H K;  4A3C C;  3AD7 C;  3FHZ A;  3S2D C;  3EQL A;  4G7O A;  3CAG A;  1Y1W C;  1K83 A;  1B4A A;  1O24 A;  3HOY C;  1Y1V K;  4A3C K;  2R92 K;  3AD9 C;  4Y52 C;  4C2M K;  2ZUF A;  2PA8 L;  5TMC A;  2R7Z A;  3L4K A;  2JA7 C;  1USO A;  2A68 A;  4C3H C;  5IP7 K;  1O26 A;  3GTL C;  4BBS C;  1GE9 A;  4BKW A;  1TWA A;  5IOT A;  4A3D C;  4AYB L;  2NVQ C;  3OPF A;  5FJ8 K;  3GEE A;  4A3I C;  1BJT A;  1O28 A;  2W7V A;  5M5W K;  5C44 C;  1DD5 A;  3N3Y A;  4A3J K;  3ERE D;  1EFW A;  2GSN A;  3OEP A;  1ZXO A;  1SFO K;  2R7Z C;  3S1Q K;  1JVI A;  3SZY A;  4RMF A;  2Y0S D;  1TWF C;  1K83 C;  4WJ3 M;  2E2J C;  3GTQ K;  2PPB A;  3SZZ A;  3HXA A;  2JA5 K;  3S16 C;  4A3F C;  2Y3P A;  4GFQ A;  5IOR A;  3K7A K;  3G4C A;  5C44 K;  1TWA K;  3TFI A;  1O2A A;  3QX3 A;  4Q5S A;  1F7V A;  3S14 C;  4GTA A;  2E2J K;  3WOD A;  4MEY A;  1DCO A;  2KWA A;  4A3D K;  4GTL A;  3Q3Q A;  3V4G A;  2JA6 C;  3HOZ C;  3LPX A;  3GTL K;  1TWH K;  3PO3 C;  5JVO A;  1Y1W A;  5IYD K;  2O5J A;  3AD8 C;  1EI6 A;  1VGX A;  4QIW L;  2B63 C;  2R92 A;  1J6V A;  2D6F C;  2R92 C;  5E68 A;  4OIN A;  3GTJ K;  1BS2 A;  4WJ4 A;  4OIP A;  1I3Q C;  5EGH A;  1I3Q A;  3M4O C;  4KM9 A;  1IE0 A;  1XXA A;  4KAS A;  1VJE A;  5IYB C;  2NVX A;  4C3H K;  2Y0S L;  2JA7 K;  2JA6 A;  4P5B A;  4YFX A;  4A3B C;  1WQG A;  1Y1V A;  3GSI A;  1SMY A;  1VLO A;  1XZQ B;  2JA8 C;  4C3I C;  3HOX C;  3AH5 A;  2A6E A;  2JA8 K;  1XZP B;  4YFK A;  1L0W A;  1I50 K;  3BUE A;  3H3V D;  4LLG A;  4AYB D;  1TWH A;  3N0C A;  2ZUE A;  1O25 A;  4AH6 A;  1PJ6 A;  4C3J K;  2B63 A;  3M4O K;  4XSZ A;  2NVY A;  1WCM A;  3FKI A;  1BDF A;  4C45 A;  3I4N K;  1JOE A;  4KN7 A;  2P8T A;  5CHP A;  4G0U A;  3GEI A;  2PA8 D;  3H0G C;  4GTD A;  4BY7 K;  1R9T C;  2WAQ D;  2V6U A;  2PMZ D;  1WOS A;  1TWG A;  2B63 K;  2E2I A;  1TWG C;  3T01 A;  3IPJ A;  3S17 C;  5FLM K;  2NVY K;  1TWH C;  3PO3 K;  1IS1 A;  1J6X A;  2RH6 A;  4KMA A;  4KB4 A;  4O2D A;  4A3M C;  1ISE A;  3HOU K;  4A3K C;  2E2I K;  4KM8 A;  1DCH A;  4LOW A;  3A8I A;  2XCQ A;  4X6A C;  3RZD C;  3K7A C;  2GSO A;  1YX2 A;  3HKZ D;  2R93 C;  2JA5 C;  4A3K K;  2E2I C;  4G0V A;  3GTQ C;  3GEH A;  4A3M K;  3HOU C;  1X31 C;  4NOI A;  4BBR K;  4KC6 A;  5M3F K;  3HOV C;  2ZFZ A;  3BP3 A;  4Y7N K;  1TWG K;  1G51 A;  3DXJ A;  4J3N A;  1WIH A;  2PMZ L;  2GAH C;  5TJ3 A;  1WQF A;  2V6S A;  1YNN A;  5C4X C;  1I50 A;  4BY7 C;  2VUM K;  1V5V A;  2BE5 A;  3ORE A;  1F9N A;  1PJ7 A;  1O29 A;  3A8K A;  5IP7 C;  3S17 K;  3GTP A;  3PO2 C;  1KQ4 A;  4WIL A;  1I6V A;  4BLB A;  2RGR A;  2JA5 A;  2WB1 L;  4GTF A;  1WSV A;  1R9T K;  3HOY K;  3BP8 C;  2FQT A;  1C0A A;  4KMD A;  2CFA A;  3S2H C;  4KAT A;  1VH2 A;  1WOO A;  1ZQ1 C;  4LJZ A;  4G7H A;  5C4J C;  2NVX K;  1SFO A;  4QJV A;  3AQO A;  3GTL A;  4YFN A;  4KAW X;  1I50 C;  1WSR A;  1Y1W K;  3S1N C;  4A93 C;  4C3I K;  3S1N K;  2P5M A;  4A93 K;  2R93 A;  4DDQ A;  3M3Y C;  3GTK K;  2E2H A;  3A8J A;  4GTC A;  4A3B K;  4M1X A;  1HI9 A;  1I3Q K;  4LK0 A;  4LK1 A;  1PJ5 A;  1WOR A;  1TWF A;  2YU9 K;  4QJV B;  3S1M C;  1B4B A;  5IYC K;  4KAR A;  3GDZ A;  1IBA A;  3S16 K;  2NVT K;  4BLA A;  3GTP C;  3S1R K;  4QIW D;  4XCH A;  3I4M K;  1BGW A;  3GTP K;  5C4X K;  4PAA A;  3H3V L;  4G7Z A;  3HKZ L;  4KMU A;  1ZBS A;  3S0X A;  4A3J C;  2A6H A;  4OIQ A;  2XCO A;  4GT9 A;  5IYC C;  3GTG A;  4X6A K;  4KDD A;  4BXX K;  1ZYR A;  3HOV K;  1TWF K;  4BBR C;  4FZB A;  5IOQ A;  3CQZ A;  4BBS K;  3TFJ A;  2WAQ L;  4P9S A;  5IP9 K;  1INN A;  2NVY C;  4XLP A;  2R93 K;  3LAP A;  3RZO C;  5HL8 A;  4Y52 K;  1Y1V C;  1VRQ C;  5L46 A;  4KB2 A;  1USM A;  3H0G K;  2YU9 C;  3GTO K;  3N0B A;  3I4N C;  5C3E C;  3FOF A;  3VA7 A;  4ZH4 A;  1WQH A;  5FLM C;  2V6T A;  5IOS A;  1TWC C;  1YNJ A;  3ADA C;  1TWC A;  1J98 A;  1WCM C;  1O2F B;  2XCR B;  4OIO A;  1R9T A;  4G0W A;  1WCM K;  3CQZ K;  5EGE A;  4C3J C;  2NVX C;  3AQP A;  3LAJ A;  4MEX A;  2O5I A;  1AB4 A;  2A69 A;  5M5Y K;  4A3E C;  2GAG C;  3L4J A;  3GTO A;  3GTO C;  3G4A A;  3GTG C;  4A3G K;  1EH1 A;  1O27 A;  5TMF A;  3HOW K;  3GTK A;  3S15 K;  5CJ9 A;  5IYD C;  1TWC K;  4KMH A;  4Y7N C;  3PO2 K;  3GTM K;  1HQM A;  5IYB K;  1XZP A;  2EBB A;  5IP9 C;  4BY1 C;  3HOZ K;  2WB1 D;  3GIR A;  3FKI C;  1J6W A;  5C3E K;  2E2H C;  1IL2 A;  4LQY A;  3GTQ A;  2FQO A;  3GTJ C;  4KN4 A;  2VUM C;  3GTM A;  3S14 K;  4BXX C;  1I6H K;  3H0G A;  2PHC B;  4P5A A;  1WOP A;  2YU9 A;  4A3L K;  2CW0 A;  3RZO K;  4A3L C;  1XPP A;  1XXC A;  1ZVU A;  4FM9 A;  1I6H C;  2JA6 K;  3TFH A;  2JH3 A;  3I4M C;  4ILD A;  1EK8 A;  5M3M K;  3S1R C;  1SFO C;  2E2H K;  3FKI K;  2R7Z K;  3S1Q C;  4PAB A;  1UV7 A;  4MQ9 A;  1TWA C;  3GTM C;  2VUM A;  5D4D A;  2CFA B;  4XLN A;  3RZD K;  1F93 A;  4A3F K;  4GZY A;  4A3I K;  3HOW C;  4JK1 A;  3T02 A;  4GTB A;  3GTG K;  1K83 K;  4A3G C;  1EQR A;  1IQ0 A;  2GSU A;  3T00 A;  1F7U A;  2NVT C;  4XSX A;  4BY1 K;  1XZQ A;  3FOE A;  4OIR A;  1JQW A;  2JA7 A;  3TTG A;  3CQZ C;  3S15 C;  3GTK C;  3S1M K;  4YG2 A;  3JST A;  3M3Y K;  1DCP A;  4Q4Z A;  1XXB A;  4GTE A;  3MML B;  3HOX K;  1IW7 A;  2NVQ K;  3S2D K;  1O2B A; 
#chains in the Genus database with same CATH homology
 4A3B C;  4A3E K;  1WCM C;  3S2H C;  4LJZ A;  1SMY A;  5C4J C;  4G7H A;  4OIO A;  2JA8 C;  2NVX K;  5M5X K;  3HOX C;  2A6E A;  2JA8 K;  5C4J K;  4QJV A;  4YFK A;  1I50 K;  3H3V D;  4LLG A;  4AYB D;  3S2H K;  4A3C C;  1WCM K;  4YFN A;  3CQZ K;  1I50 C;  3S2D C;  3EQL A;  4G7O A;  1Y1W K;  3S1N C;  4A93 C;  4C3I K;  2NVX C;  3S1N K;  4A93 K;  1Y1W C;  4MEX A;  4C3J K;  3M4O K;  4XSZ A;  2O5I A;  3HOY C;  3M3Y C;  1Y1V K;  2A69 A;  5M5Y K;  2R92 K;  3GTK K;  4A3C K;  4A3E C;  4Y52 C;  4A3B K;  1BDF A;  4C2M K;  2PA8 L;  3I4N K;  5TMC A;  4KN7 A;  3GTO C;  2JA7 C;  2A68 A;  3GTG C;  5IP7 K;  4A3G K;  5TMF A;  3H0G C;  2PA8 D;  4BY7 K;  3HOW K;  3GTL C;  1R9T C;  2WAQ D;  4BBS C;  1I3Q K;  2PMZ D;  4LK0 A;  3S15 K;  4LK1 A;  4A3D C;  2B63 K;  4AYB L;  2NVQ C;  1TWG C;  5IYD C;  1TWC K;  4Y7N C;  3PO2 K;  3GTM K;  1HQM A;  5IYB K;  2NVY K;  4QJV B;  5FLM K;  2YU9 K;  5FJ8 K;  3S17 C;  1TWH C;  3PO3 K;  5IP9 C;  4A3I C;  4BY1 C;  3HOZ K;  3S1M C;  2WB1 D;  5M5W K;  5C3E K;  3FKI C;  5C44 C;  5IYC K;  2E2H C;  3GTJ C;  4KN4 A;  2VUM C;  4A3J K;  4A3M C;  3HOU K;  3S14 K;  3S16 K;  4BXX C;  4A3K C;  2E2I K;  1I6H K;  2NVT K;  4X6A K;  1SFO K;  2R7Z C;  3GTP C;  3S1R K;  3RZD C;  4QIW D;  4A3L K;  3S1Q K;  4X6A C;  3K7A C;  2CW0 A;  3I4M K;  2Y0S D;  3RZO K;  1TWF C;  1K83 C;  3GTP K;  3HKZ D;  4A3L C;  2R93 C;  2E2J C;  1XPP A;  3GTQ K;  5C4X K;  2PPB A;  2JA5 C;  3H3V L;  4G7Z A;  2JA5 K;  4A3K K;  2E2I C;  3HKZ L;  2JA6 K;  3GTQ C;  3S16 C;  1I6H C;  4KMU A;  4A3F C;  4A3M K;  3HOU C;  4A3J C;  2A6H A;  4OIQ A;  4NOI A;  3I4M C;  4BBR K;  3K7A K;  5M3M K;  3S1R C;  5IYC C;  1SFO C;  5M3F K;  3FKI K;  5C44 K;  2E2H K;  3HOV C;  2R7Z K;  1TWA K;  3S1Q C;  4Q5S A;  4MQ9 A;  1TWA C;  4BXX K;  1ZYR A;  3HOV K;  3S14 C;  2E2J K;  3WOD A;  3GTM C;  1TWF K;  4Y7N K;  4MEY A;  5D4D A;  4BBR C;  1TWG K;  4XLN A;  3RZD K;  4A3D K;  4A3F K;  3DXJ A;  2JA6 C;  3HOZ C;  2PMZ L;  4BBS K;  4GZY A;  2WAQ L;  3GTL K;  5IP9 K;  4A3I K;  3HOW C;  1TWH K;  1YNN A;  3PO3 C;  4JK1 A;  5C4X C;  4BY7 C;  2NVY C;  4XLP A;  3GTG K;  4A3G C;  1K83 K;  2R93 K;  3RZO C;  2VUM K;  5IYD K;  2O5J A;  4QIW L;  2B63 C;  4Y52 K;  2BE5 A;  2R92 C;  1Y1V C;  2NVT C;  4OIN A;  4XSX A;  4BY1 K;  3H0G K;  5IP7 C;  2YU9 C;  3S17 K;  4OIR A;  3PO2 C;  3GTO K;  3GTJ K;  3I4N C;  1I6V A;  3CQZ C;  3S15 C;  3GTK C;  5C3E C;  2WB1 L;  1I3Q C;  4OIP A;  3S1M K;  4YG2 A;  3HOY K;  1R9T K;  3M3Y K;  3M4O C;  4Q4Z A;  4ZH4 A;  5IYB C;  5FLM C;  4C3H K;  3HOX K;  2Y0S L;  1TWC C;  2JA7 K;  1IW7 A;  1YNJ A;  2NVQ K;  3S2D K;  4YFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...