3GTLH

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtlH00
4DUYL 1KD1C 4LF4L 4TQUS 3HOVH 2UXDL 4LF8L 2ZTDA 3H15A 4A3IG 4IFDI 5IP7H 3UDFA 1S72A 5FLXc 1HNWQ 3ULPA 1EYGA 4YY3Q 5FLMG 4A4IA 1XPOA 2FXQA 1QZHA 3S15H 3PUVA 1JB7A 3BZCA 3KYHC 3A5UA 3TRZA 1Y1VG 4HJ7A 3KF6A 1SLJA 4LFBQ 1LM0A 1NTGA 1M90C 4YCWA 1A0IA 2K14A 1CKNB 4OONA 1KRSA 1WFQA 2UUCL 3M4QA 3IRBA 4JI4Q 4GKKQ 3E9IA 3U4VA 3CP0A 4UP9A 1Q8KA 2JA5G 4UY8C 4DV3Q 2QEXA 1E1OA 3CW2C 4HJ9A 1HNWL 4OO1I 1TWGH 4A3LH 4YY3L 5M3MH 4JBMA 1PH5A 4BBSG 1NY4A 2WP8J 3I4OA 4X65Q 4JI5L 1KL9A 1LTLA 1UE7A 3PCOB 4LUVA 4GKJQ 4A3DH 4DR2Q 4TVAB 2WAQE 2IT1A 3PV0A 4O0AA 3KOJA 4R1JA 1MJEA 2I5LX 4A3JH 1SMXA 1EQQA 4JI4L 2PQAB 1N32Q 3M4OH 5JJIA 1CKNA 4MTNA 3TREA 4DV3L 3PF5A 1X9NA 2B63H 1IXRA 2R7ZH 3I4NH 3CCQA 2UUAL 4HIDA 2MNAA 4JCVE 4R4QA 2OQKA 5GAEC 2Z0SA 3CPWA 1VQBA 2RHQB 1HNXQ 1HZAA 3OTOQ 1PYSB 3K80C 2JK8A 4DR1Q 3BZKA 2Q2HA 3UE1A 1J6QA 1V43A 5M5WH 4X65L 3I4MG 5JJLA 1HR0W 4LFCQ 1HZBA 2DUDA 5C3EH 4IPHA 4DV2L 1TWFH 4DR2L 4BBRH 3RLNA 1E22A 1OTCA 2E2IH 4L5SA 1VQPA 4DV1Q 1KIXA 2IX0A 3DLLA 4A3KH 1HZ9A 4LUOA 1PH2A 4LNQA 1P8LA 3H0GH 1N34L 2PQAA 1HNXL 1XNRQ 2F3IA 1I94Q 2YYZA 3S24A 3PIOA 3OTOL 1VQ6A 2MFIA 1PH8A 4DR1L 2ZJPA 3H3VH 1BVSA 1B70B 2B29A 3L0OA 3PIPA 4DR4Q 1E1TA 5LMUL 1ASZA 1WCMG 5IYDG 1X56A 2LXKA 4APVA 1IBLL 4KHPQ 4P74A 4C3HH 3BJUA 2YTVA 1U0LA 4DV1L 1HJPA 2ZTCA 4LF5Q 4AH6A 3KFUA 4NXNL 4HJ8A 4JOIC 2JA9A 2K5HA 2K5VA 2VW9A 2VQEQ 4DR5Q 3TS0A 1BBUA 4BXXH 1I5FA 4GNXB 1PH1A 3CCUA 3JC66 4B3TL 1XNRL 4JOIA 4YWLA 2OWOA 4IJLA 4JI1Q 1CUKA 4PG3A 4L5TA 1KRTA 1K73C 1L1OB 4LF9L 4DR4L 2MQHA 1JJGA 1MKHA 1YJWA 1XPRA 1YIJA 4KHPL 4XIGS 3GTPH 1GO3E 1VQHA 3HKSA 4OWTB 4LF5L 4DR6Q 3GDEA 2VQEL 3RN2A 4DR5L 3STBD 4P73A 2YTYA 3F2CA 1YVCA 3HOVG 2OQ0A 4KI0A 2PI2A 1VQ5A 3S1QH 1PFSA 3BU2A 5IP7G 2JJQA 3CCSA 3I55A 1KHIA 1O7IA 5IY0A 2NVXH 4QIWE 3CD6A 1BBWA 1Q7YC 5LMNL 4LFAL 4DAYB 1Q82C 2R92G 1N8RC 5BR8Q 1Z9FA 4DK6C 1FJGQ 5ELNA 2ATWA 3NEMA 1X54A 2IHFA 2K75A 3L7ZC 4JI7Q 3JAMi 3PO2H 1SN8A 4OWXB 4DR6L 3NBHB 2BA0A 4B3RQ 3RZDH 2Q2UA 2VUMH 3B6YA 4GN3B 5C44H 3U58A 1QVGA 2NVQH 1XMOQ 3S2DH 1V9PA 2RHSB 3MXNB 4IFDG 4NPSA 1UE1A 1C7YA 2CCZA 4A3LG 2AKWB 5M3MG 3CCJA 1W2BA 4R4TA 3G71A 2WAQG 3FKIH 1IBMQ 5C0XG 2JEAI 1CKOA 4X62L 5BR8L 4DV4Q 1IL2A 1FJGL 3G4SA 1Z47A 3D0FA 4JBJA 4UP7A 1KQSA 1I50H 4WJ3M 1GM5A 4QGUA 2UU9Q 5M3FH 3ZJYC 4DNIA 4QQBX 1N33Q 4A3JG 3CXCA 3CCEA 2E8GA 3GTOH 2B3GA 5JJKA 3J81c 1XMOL 3J7ZC 3HOUH 2N49A 1GVPA 1X3GA 2Q2IA 2WFWA 3K81C 4ALPA 1PV4A 3I4NG 4IPCA 4OX9L 3HOZG 4OO1G 4X6AH 2E5LQ 1EQRA 4X64Q 3E9HA 1M1KC 1XNQL 3RLFA 3WWVA 1YNXA 3T1YL 1IBML 3FHWA 1UE5A 2VQFQ 5C0XI 1OXUA 4BY1H 3T1HL 4BA1I 3OW2A 1J5EQ 3CC2A 2A19A 5C3EG 4GN5A 2JA6H 3ICEA 3NELA 4YHHQ 1A63A 4JI6L 2XGTA 1AE3A 1PYBA 1YI2A 4POGA 1XMQQ 4MNOA 4IOCA 2HHHQ 1N33L 5HY6A 4GLXA 1PHJA 1HNZQ 2ASBA 1FL0A 1NE3A 1VQJA 4A3KG 4GOPB 4A93H 2NVTH 2XTIA 3H0GG 1K8GA 1EOVA 2H5XA 4PMWA 3AYHB 5IWAQ 1PH6A 3CPFA 2JEBI 5IP9H 1U5KA 5JEAG 2KHJA 3S17H 1V1QA 3K7AH 2HIVA 1J5EL 2KBNA 4LFBL 4A3MH 1I6HH 3U4ZA 2VL6A 3RR5A 5IYBG 5C4JH 1K3RA 1WI5A 3K8AA 4LW1A 2HHHL 3TEHB 3CMEA 1JJCB 2Z6KA 1ASYA 1HNZL 5GAHC 5GQOA 2GVAA 2LXJA 5H1SE 4GKKL 1HR0Q 5M5YH 4R4IA 2JA7H 2ALYB 4BXXG 4P72A 3CCVA 1VQAA 1PH3A 5IWAL 5C4XH 5EAYA 3J81i 4GOPA 1R9TH 3H3VI 3F2DA 3PO3H 3I56A 1Y1WH 2YU9H 4GKJL 4POFA 4B3SQ 4BA2I 4DAMA 2RCNA 1L0WA 1EFWA 4OWWB 5IT9c 1WOCA 1N32L 1WYDA 1IBKQ 4YWKA 5GROA 2Y0SE 1A8VA 2BA1A 4UP8A 4DKAC 3HOYH 4WJ4A 4PZ7A 1HR0L 1HH2P 4JI0Q 3HOXH 1E7ZA 4JBWA 3I7FA 4L5QA 4LUZA 3SGIA 1JMCA 5FLMH 4HIKA 4JV5Q 1VQ9A 4C3IH 3JAMc 3GTQH 4LFCL 1UEBA 4DV5Q 1SFOH 4GLVB 4EX5A 1Y1VH 4JC0A 1NJIC 5ELOA 5GAGC 2YTXA 2VS1A 3K7UC 4DV7Q 1Q1BA 1K9MC 2VUMG 4K0KQ 1I94L 2EIFA 1E3PA 3D31A 1VQDA 1RL2A 4NXMQ 1VQFA 1X55A 3TS2A 3KJPA 5IE8A 2MO0A 5FJ8H 3PF4A 2ES2A 1XTDA 2CKZB 1AH9A 1EIYB 4DV5L 3FKIG 4LF6Q 4UPAA 3CF5A 4IFDJ 4A3GG 2GVBA 1VQMA 1NMFA 3ER0A 1B7YB 4DK3C 4DV7L 1QUQB 1Q46A 1YJ9A 4A3FH 4GNXC 4A3BH 4K0KL 3LGJA 3ULJA 2JE6I 4NXML 4JI1L 4GNXA 1XPUA 1EWIA 3I2ZA 1NMGA 3UDXA 1KAWA 4Y7NH 1YITA 1YHQA 2AMCB 3PUZA 1L1OC 1Q12A 4AQYQ 3GD7A 3I4MH 4DR7Q 3U50C 1L1OA 4A76A 4B3MQ 2NZOA 4FDBA 3RLOA 2GN5A 4GLAC 4LWCA 1K83H 1VQGA 1OXTA 4OXPA 3F2BA 4O2DA 3UDIA 3F8TA 3NENA 4RMFA 2NVYH 1QVCA 3J7A5 3KJOA 3RZOH 1VQKA 3S1RH 4C2MH 5LMNW 3S2HH 1PA6A 2F4VQ 4A93G 4IJHA 2A1AA 2EXDA 3J80i 3GTLH 1I3QH 5IP9G 4GN4B 2I5HA 4B3ML 2K52A 2I0QA 1PH7A 3HKZE 4DUZQ 3M7NA 4A3MG 4A3DG 5IYDH 4JI7L 1D7QA 4DR3Q 1TXYA 1VQIA 1YHBA 4B3RL 3HOWH 4RG1A 1B8AA 3G6EA 2OCEA 4MZ9A 2UXBQ 1JT8A 4KLKA 1GKHA 1Q81C 2OTLA 3CC7A 4AIMA 1P16A 2R7ZG 2JA7G 2B63G 3CCLA 2KHIA 2UXDQ 2A8VA 1JE5A 1SRUA 4LF8Q 2WB1E 4R4OA 4JG2A 5C4XG 4YCUA 4R4CA 1CSPA 5IYCH 3M4PA 3KF6B 3PUWA 1Y1WG 3PO3G 3W1GA 4DV4L 1NBWA 1YZ6A 3W5OA 4GS3A 4DUZL 3GTJH 1Q1EA 3AFQA 2KCTA 2Y0SG 4DR3L 4BBRG 3CMAA 2PI2E 2UUBQ 1AE2A 2UU9L 1XJVA 5M5XH 2K5NA 3HOYG 4C3JH 2K50A 3CQZH 5J3BA 4IO9A 1YHAA 3PUXA 4HIMA 3UDGA 3HOXG 2ID0A 4X64L 1PH4A 4NB3A 2E5LL 2JQOA 2AWNA 1MIUA 2VQFL 2VNUD 3PUYA 4A3EH 2HT1A 1PVOA 4J15A 2K4KA 3M9BA 4JI5Q 4YHHL 2R92H 1X3EA 2UXCQ 2UUBL 2Z6KC 1OXXK 1XMQL 2ZJQA 1VQEA 4P71A 3DM3A 3AQQA 1S40A 1VQLA 4DPGA 1VQCA 1EIFA 3GO5A 2V1CC 4IPGA 4L5RC 4GOPC 1HZCA 3G48A 4H02A 2UUAQ 4A3CH 1DGSA 3STBC 3W1BA 4AYBE 5K36G 3RNUA 3OYYA 5FJ8G 1E24A 1JJ2A 1G6PA 1CSQA 1X3FA 4BY7H 1WJJA 2NN6G 1EUJA 5HGQA 2UXCL 4JI2Q 3A5ZB 3TQYA 2JA8H 2R7DA 4DV2Q 1D8LA 3AEVA 2KCMA 4IPDA 4XTCS 1LYLA 1FGUA 2R93H 4IOAA 3J81j 3GTGH 4HIOA 1IYJB 1TWCH 2CQOA 3A0JA 1CKMA 4A3IH 4A3FG 1FVIA 2MO1A 1QZGA 4A3BG 4Y52H 1SE8A 2D0PA 2F52A 1N34Q 3HOZH 3UE0A 4LF7Q 2AWOA 2CWAA 4JI8Q 3CC4A 1MJCA 1Y14B 2E2HH 3VDYA 2C35B 2NN6I 2KENA 2DGYA 2HIXA 5LMUQ 4B3SL 1UE6A 4JI2L 2N78A 1TWHH 1IBKL 1IBLQ 2QGQA 4X66Q 1VQ8A 3K0XA 4EQ5A 3PO2G 1QVFA 3EN2A 3GTKH 1YEZA 2HQLA 4JI3L 3J80c 2JA5H 5C44G 1BKBA 5AJ3Q 4JI0L 4NXNQ 2PNHA 2CWPA 1G51A 1H95A 1L2FA 4QL5A 4B3TQ 2PMZE 1OXSC 3CAMA 1G291 4DV0Q 4JI8L 4LF7L 3KF8B 1T9HA 1Q86C 4JV5L 4BBSH 4PZ6A 3HKZG 2E2JH 4LF9Q 3L2PA 1K8AC 1GD7A 1VCIA 3AFPA 3S1NH 1X65A 2CFMA 5DLQE 1YJNA 1W3SA 2D0OA 2R7FA 5IYBH 4X66L 3GTMH 1VS0A 4QY7A 2N8NA 1C9OA 1RIPA 2NZHA 2EQSA 3HFZB 5M3FG 1KC8C 3HOWG 4PZ8A 5C0XJ 2IY5B 5AJ3L 2WB1G 3HOUG 3ERSX 4JBKA 2ZJRA 3MEFA 4DV0L 1PH9A 3KLWA 3FP9A 3PSIA 4KHZA 2ZM6Q 1N36Q 4LF6L 5IYCG 1VQNA 1SR3A 3CCMA 4BY1G 4LFAQ 5LMNQ 2IX1A 2JA6G 3M3YH 2BH2A 2RF4A 4HJAA 3A74A 1VQ7A 2D62A 2Q2TA 4DV6Q 1VQOA 3S14H 3EIVA 3M85A 3S16H 1IZ6A 2BH8A 1SROA 1QUQA 1S3OA 3F1ZA 3ULLA 2I5MX 1UWVA 2VY3A 2ZM6L 1N36L 4JI3Q 4AQYL 4DR7L 2AHOB 1WCMH 4A3EG 2VZAA 2YV5A 3KDFB 1N9WA 4X62Q 1A62A 1OXVA 1X6OA 4YCVA 4DV6L 1KXLA 2QA4A 5JEAJ 2ZTEA 4JYAQ 2OTJA 3E0EA 4DUYQ 4A75A 4LF4Q 2F4VL 3RN5A 4AYBG 2LSSA 1YBYA 2R6GA 3Q8DA 1VQ4A 4HJ5A 1TWAH 2N3SA 5E7NA 3CCRA 4OX9Q 4A3CG 1XNQQ 4P75A 3S1MH 3EBEA 3PGZA 3T1YQ 4BY7G 2L15A 5GADC 2IHEA 3T1HQ 4A3GH 2JA8G 1LUZA 4QJFA 1C0AA 4JI6Q 1K0RA 2UXBL 3KDFA 2UUCQ 4ME3A 4YWMA 4JYAL 2R93G
chains in the Genus database with same CATH superfamily
4M1UB 2K04A 2UXDL 1I4HA 4LF8L 2CH4A 2ZTDA 4DFAA 3MEHA 3FPUB 5IP7H 5FLXc 3ULPA 5FKAC 4YY3Q 2N88A 5L37A 2FXQA 1QZHA 1ONLA 3S15H 2F4IA 1JB7A 2PPBC 1SSOA 3A5UA 1NR4A 4RGMA 3VR6A 1MGSA 1S5FD 4R9WA 3H3VC 1H9JA 3QIAA 1F77A 4JI4Q 4DV3Q 4HJ9A 4YY3L 1PH5A 4BBSG 1NY4A 5C0XH 3I4OA 1KL9A 1D1KA 2BE5C 4LUVA 3KOJA 3RUZA 1SMXA 4JI4L 5JJIA 3I4MB 5C6AA 4MTNA 2R7ZH 3VYSA 4DV3L 1X9NA 2B63H 3S2HH 4OO1H 4IUNA 2MNAA 4JCVE 4R4QA 2OQKA 4IQZA 1JOOA 5GAEC 3J7AV 1DD2A 4B9WA 2Q2HA 2LS01 2H4OA 3RZOB 1F9SA 5TSSA 4F8MA 5I2YA 3S1RB 4C2MB 1HR0W 3I4MG 1JOQA 4TSSA 1EY8A 3RLNA 1OTCA 2E2IH 1YNND 3GTLB 3VR2A 2IX0A 2TMPA 2GA4B 4LNQA 1P8LA 1XNRQ 5JAVA 1F9QA 3QWNA 3PIOA 3L0OA 3VYUA 3PIPA 3HGBA 1E1TA 4HN7A 2LXKA 1IBLL 4CJ1B 4LF5Q 4HJ8A 2JA9A 4DR5Q 2K5VA 2Z8LA 4ZKCB 1BBUA 2NUCA 3GTJB 3JC66 3K5NA 1XNRL 5C5MA 4X3KA 4YWLA 1FNWA 3TP7A 1CUKA 2CHBD 2WIIB 1K73C 1L1OB 4LF9L 1YJWA 4C56C 1GO3E 5IGFA 4OWTB 4LF5L 4DR6Q 1Y8OB 2DY8A 2L1BA 4DR5L 3F2CA 3GTQB 1PTOF 3HOVG 2CH4W 3OHXC 3BU2A 3CCSA 1KHIA 2A68D 3CD6A 4CHTB 3NEMA 4DR6L 3RD4A 4BY7B 2VUMH 4F87A 3M4YA 1QVGA 2RHSB 4IFDG 2XSCA 3TP6A 4A3LG 3CCJA 1W2BA 4R4TA 3GTGB 3FKIH 1IBMQ 4WJWA 2JEAI 2A5HA 1Z47A 1KQSA 4DK1A 4WJ3M 1ZYRC 3E3XA 4DNIA 4QQBX 1STGA 1N33Q 4DA2A 5M5WB 5JJKA 3J81c 2EY2A 1BR9A 3HOUH 1GVPA 1X3GA 2Q2IA 3K5MA 3I4NG 4KKTA 1XNQL 3A56A 2RSNA 2PMZB 1IBML 5C0XI 1DM0B 3T1HL 4BA1I 4BY1H 1J5EQ 3PMFA 1YI2A 2X6GA 4JI6L 1XMQQ 1N33L 2ASBA 3NPPA 1FL0A 3K6OA 1HQMC 4HEDA 4A3KG 1ENAA 5ELCA 2IWHA 2XTIA 4PMWA 3CPFA 5IP9H 5JEAG 1PFMA 1V1QA 1Y8NB 2HIVA 1J5EL 1S5CD 3AB9A 5IYBG 2VL6A 5BN4A 3C1EA 3TEHB 1JJCB 2Z6KA 5GAHC 2XN9C 2XRQD 3EFXD 2ALYB 1QE6A 4FO2A 3Q23A 4BXXG 4U673 1SNQA 1PTOC 1NAPA 4EQNA 4RCOA 3J81i 3S16B 3F2DA 5J22A 3DM1A 1ET6A 4POFA 4QIWB 4DAMA 2RCNA 4OWWB 1WOCA 4XT3B 4YWKA 5GROA 3HOYH 1IYVA 4DKAC 2DN8A 3OWEB 1ICFB 3W2DA 1E7ZA 1PRTB 1G6ZA 1DONA 4ZUIA 4JV5Q 3JAMc 3GTQH 4DV5Q 4GLVB 3NE5B 1SNMA 2VS1A 2EPBA 4DV7Q 3IAYA 2Z1CA 2K28A 2MJ8A 2O5IC 4RKBA 3UI2A 1K8OA 4K0KQ 1I94L 5K36H 1FYCA 2EY5A 4DV5L 2NN6H 1EIYB 4LF6Q 3CF5A 4IZ8A 2GVBA 4FP5D 4JW0A 1FR3A 2L5TA 5G3LF 4DV7L 1C48A 1LTRD 4GNXC 4K0KL 2BE5D 2IJ0A 3CKIB 4NP5A 4OEMB 3I2ZA 4E6IA 4GNXA 1YHQA 2PW5A 5EGTA 2EXZA 1Q12A 4AQYQ 3I4MH 2NZOA 1TWGB 4GLAC 1OXTA 4QB4A 3F2BA 1I4GA 1A2TA 4KJNA 1I4XA 4RMFA 1KLUD 4DNTB 1QVCA 1B9NA 3J7A5 3RZOH 2CW0C 1FNUA 1VQKA 3S1RH 3FMCA 4C2MH 4EQPA 2EYPA 4A93G 3DMUA 4IJHA 2EXDA 2F0PA 4A3JB 2CVRA 3GTLH 1TT2A 1B2TA 5ELEA 1PZKD 4DUZQ 1D7QA 1HFGA 4A3MG 1WD0A 3I4LA 3PIP3 4RG1A 3VA7A 1J9OA 1Y1WB 4QUCA 4AIMA 5C3EB 4CKEA 4BBRB 2KHIA 1JE5A 1SRUA 1SDFA 4K5WA 1D2BA 1EWHA 2K7VA 4MTKA 3M4PA 3SXHA 1Y1WG 3PO3G 2PNRC 1NBWA 3W5OA 4DUZL 3GTJH 3AFQA 1EIGA 2KCTA 3FDTA 4BBRG 2PI2E 2UU9L 3BZDB 1WTPA 1XJVA 5DNFA 1PMRA 2K5DA 3CQZH 2QF7A 2K5WA 1DOKA 5I9PA 2QILA 4C3HB 2ID0A 3HOXG 3D8GA 4NB3A 1S4ZA 3KLSX 4YHHL 2UXCQ 2PYKA 1OXXK 4ZQ3A 1VQEA 2A73B 3DM3A 4IUTA 2V1CC 2C5CA 3BYTB 4L5RC 4IFDH 2UUAQ 2F0VA 4FF3A 3W1BA 3H6MA 1F2MA 5LHY1 4KHVA 2Z4HA 3ERQA 4BY7H 1WJJA 4UHVA 4JI2Q 2UXCL 4DV2Q 2NZ1D 3WOFA 2KEEA 1LYLA 2EYFA 2ZXRA 4IOAA 3GTGH 2O2LD 4KY5A 2B2WC 4A3BG 1FVIA 3C46A 2D0PA 3TN2A 1WD1A 1N34Q 2OXPA 2HDLA 5C4ZA 2I07B 2F3WA 3RZDB 2NVQB 1ZYRD 2NN6I 4JI2L 2HIXA 5CR3A 1SEBD 2A6EC 2EOTA 3IKJA 3NQTA 4EQ5A 2EYOA 3TP8A 1TQOA 1SNPA 1BKBA 3IFDA 2NTTA 1L2FA 4B3TQ 2PMZE 1I50B 3CAMA 4PZ6A 1TKWB 3HKZG 1WTXA 1K8AC 2DJFC 1W3SA 1B44D 5IYBH 2R7FA 3Q24A 1C9OA 1AN8A 3HOWG 4G7HC 2QDLA 3KBXA 2XWJB 3QOJA 1AP0A 4JBKA 3NBIA 1LTGD 1PH9A 3L3OC 4KHZA 1TS2A 2D2CC 4L63B 1K0SA 4LFAQ 2LY7A 2RQXA 5LMNQ 1E2VA 1LLRD 4H44C 1VQ7A 2JXMB 1PTOD 3T13A 2SNMA 5KNCA 3DWPA 3S16H 3CRLC 1SROA 1QUQA 4GZYC 1I6HB 1TS4A 2I5MX 3D3RA 1DCZA 1ESFA 4DR7L 2JA7B 2VZAA 3DWAA 2YV5A 4NKLA 4X62Q 1A62A 5C4XB 3NSWA 3MFYA 1GUSA 5JEAJ 2EE1A 2ZTEA 2OTJA 3E0EA 5EBDA 1WTQA 2F4VL 4DXFA 4F7XA 3OIPA 5FLXL 1EY4A 1TWAH 5IGGA 4A3CG 4V190 5ELBA 3MC0B 3T1YQ 1SXTA 1NCVA 2L15A 2IHEA 3SK4A 3V2TA 3JAME 4QJFA 2UXBL 3KDFA 2RKSA 1CQVA 4C3IB 1O78A 1KD1C 4TQUS 3H15A 4IFDI 1D6EC 1S72A 1XXGA 4XQJA 4K14A 2KQ3A 5HGTA 1HQRD 3GV6A 4HJ7A 1SLJA 4LFBQ 1LM0A 3E5SA 1A0IA 2K14A 4OONA 1PZID 1VDZA 3P7JA 3IRBA 2E2JB 4GKKQ 3CP0A 4UP9A 1Q8KA 4UY8C 4OIKA 1STBA 1CFMA 1PTOB 1TWGH 1CK1A 5M3MH 4JBMA 3SK5A 1ENCA 5CV6A 4EQOA 1UE7A 3PCOB 5JVG3 4DR2Q 4TVAB 2CW0D 4FNFA 2IT1A 3MTSA 4O0AA 5IIFA 3P1HA 1MJEA 1N32Q 4A3JH 1A2UA 1CKNA 3PF5A 1IXRA 1S5ED 1PH8A 1K83B 2Z0SA 1PYSB 2L12A 4DR1Q 3UE1A 3R93A 3CRKC 3F2UA 1PZJD 3A8JE 4CDFC 1I4QA 2DUDA 1QWYA 3D4RA 5C3EH 2Q8RE 4DR2L 4LFCQ 3OOCA 4BBRH 3A55A 1I3QB 4LUOA 1II3A 3H0GH 2PQAA 2F3IA 1KDAA 1LT4D 4HCEA 1VQ6A 1I4PA 4DR1L 3H3VH 3T16A 1T5XD 5LMUL 2R3ZA 3FEWX 5IYDG 1X56A 3E0JA 4KHPQ 4C3HH 1GUGA 1U0LA 1HJPA 2ZTCA 3TDQA 3KFUA 4NXNL 4JOIC 3TS0A 2K5HA 3D4WA 4GNXB 3CCUA 4XQQA 1SJHD 2E76C 4JOIA 1U4LA 2A6HC 4JI1Q 1RJTA 2BDOA 4KKUA 1EYCA 5M5XB 3E6ZX 4PG3A 1DXMA 1QB5D 1JJGA 3FVQA 1MKHA 4N8FA 1O7YA 4XIGS 4KHPL 2M2LA 4QCLA 1JWSD 1HCZA 1V1PA 3GDEA 2RA4A 3NWSA 2KEDA 3RN2A 2E74C 1PFSA 2JP1A 2NB0A 2JJQA 5KYLA 2QKIC 3VR3A 2DY7A 1BBWA 4AYBB 1Q82C 5C3XA 1ENFA 4DK6C 4K2KA 4JI7Q 3L7ZC 2X6LA 1EQTA 2WAQB 3RZDH 2Z4IA 2B2UA 2ENBA 2Q2UA 4TKOB 2NVQH 5I4DA 3J81L 3U58A 1XMOQ 2JA8B 1EY7A 1V9PA 2WACA 1H9SB 2A6ED 4IUUA 2CCZA 1HTPA 2WAQG 3DEOA 1TWCB 3M4OB 3SE0A 4QUFA 3QOLA 3D0FA 4DAYA 4JBJA 2F03A 1I50H 2RDHA 1GM5A 4QGUA 5DM73 3ZJYC 2E2HB 3GTOH 3CXCA 2E8GA 2B3GA 1XMOL 3LNNA 3J7ZC 2N49A 3NBHA 5EKIA 1HXYD 4C1NI 4ALPA 1PV4A 5KEEA 4OX9L 1FNVA 2E5LQ 1EQRA 4X64Q 1M1KC 3RLFA 4KJOA 1YNXA 4RKLA 2K03A 2KVMA 3FHWA 3OW2A 1A63A 3NELA 2XGTA 5DEHA 1PYBA 4POGA 4BBSB 4IOCA 4GLXA 2F0FA 1PHJA 4ZLTF 1TS5A 2EYJA 1K8GA 3GTMB 1EYAA 1A3TA 5IWAQ 4F88A 1U5KA 2KHJA 2KBNA 1I6HH 3U4ZA 1ASYA 2EDGA 4K6DA 2LXJA 2VB3X 1HR0Q 2JA7H 2F0NA 3FRPB 3M3YB 3HRZC 1PH3A 3LX0A 1KLGD 5IWAL 5C4XH 1DOMA 1E2ZA 4GOPA 3H3VI 1SBBB 3I56A 2YU9H 3JAML 2G9DA 4PMCA 4B3SQ 4DXGA 1NR2A 2K01A 4CJ0B 1EFWA 4JK1C 4BA2I 5IT9c 4X3UA 3SEBA 1IBKQ 2BA1A 1HR0L 3CU7A 3J7AF 1HH2P 4JI0Q 1Q3LA 5JOBA 4L5QA 3W3AA 4JVZA 2H1EA 3SGIA 3N6RA 4RH6A 3U9SA 1VQ9A 4C3IH 1UEBA 5I9OA 4Q0FA 1LT5D 4JC0A 1SYBA 5ELOA 2MGSA 2XIWA 3Q6SA 2B39A 3A7LA 3KBGA 1SE2A 3D31A 3T51B 4NXMQ 1VQFA 1HA5A 2MO0A 4ME5A 5FJ8H 3PF4A 2ES2A 1AH9A 3FPPA 3HOVB 1CHQD 1MHWC 4UPAA 1KDCA 1NMFA 1PTOH 1F2YA 1KAAA 1B7YB 2DNEA 1QUQB 5AFWA 1IYUA 3ULJA 2JE6I 4NXML 2EYMA 4G57A 3UDXA 4DAPA 4FVMA 4U68A 3EQLC 4B3MQ 4A76A 3KLSA 1L0XB 1MBYA 1LO5D 1K83H 1I4RA 1JB3A 3UDIA 5JJZA 2SNSA 2RBMA 1ZEQX 3I90A 4DNRB 5I6YA 3J80i 3I73A 1I3QH 1CHPD 1TVXA 4B3ML 3I4NB 1HUMA 2KHSA 5IYDH 1B53A 1TXYA 1EZ8A 3OWFA 1B8AA 4MZ9A 4KLKA 1GKHA 1BOSA 1VMPA 1B4OA 2K33A 1HTLD 3MXNA 5BN3A 4R4CA 1CSPA 5IYCH 1FGBD 2F0IA 4A3KB 1QNUA 3BDCA 1YZ6A 3ND8A 1F9PA 1Q1EA 2Y0SG 3CMAA 3LWEA 1A15A 4N9TA 5M5XH 2A6HD 4LJZC 5J3BA 4IO9A 1K8MA 1H9MA 4N8X1 4ID6A 1OO9B 2JSOA 4J15A 2K4KA 4JI5Q 1BXTA 2Z6KC 3I91A 5COYA 1XMQL 4P71A 3AQQA 1VQLA 4DGZA 5CBEE 4IPGA 5C3WA 1SYDA 2XWBB 3G48A 3SR1A 1AZQA 1DGSA 4UAIA 4ZRZA 4AYBE 5HURA 3T53B 4O42A 1STHA 1JJ2A 1E24A 4QF4A 1G6PA 4DU9A 2EJFC 4A3FB 3S1QB 2JA8H 1HUNA 1BQQT 1D8LA 1X3PA 4Y7NB 1FGUA 1AZPA 1TWCH 4JI3Q 4A3FG 1GHJA 3Q22A 3PO2B 2CWAA 4JI8Q 4G7ZC 2EYLA 2E2HH 3T56B 5C44B 2KENA 3A7AB 4PV1C 1MD2D 5EKLA 1JICA 1STYA 1U4PA 1QVFA 3PO2G 4JI3L 5K5PA 5T1IA 3I8ZA 5C44G 5AJ3Q 1PLFA 1JQYD 1G51A 3SK8A 1CZWA 1H95A 1ICWA 2Q8TA 4JI8L 3KF8B 1BF4A 4JV5L 4BBSH 1BO0A 5FLXE 5CGKA 1VCIA 3AFPA 1HFNA 1X65A 4FYDA 3OMCA 1V1PB 3GTMH 4OHJA 1VS0A 4QY7A 2N8NA 1LTBD 2NZHA 4PZ8A 5AJ3L 1Y8PB 2WB1G 2JA6B 3ERSX 2K6AA 5EPKA 3PSIA 5EJWA 5IODA 4LF6L 2L4NA 3CCMA 2IX1A 1KABA 1Z7TA 2JA6G 3M3YH 4A93B 2BH2A 2F1MA 3A74A 4QMGA 4RGOS 3D6CA 3EIVA 4L6TB 4A3EB 1EOTA 2BH8A 4C3JG 1K3BC 1E0BA 1PDQA 4A3MB 5D3DA 3F1ZA 3ULLA 3BVGA 5C4JB 1XYIA 2K32A 4AQYL 5M5YB 4A3EG 4BS9A 5NUCA 3PIO3 3NTIA 1N9WA 3MWYW 1ET9A 1OXVA 1J8IA 1F9RA 1KXLA 2QA4A 3PO3B 3VYRA 4J8QA 5IT9E 2VB2X 4HMIA 1D5ZC 2KCCA 4LF4Q 5JVH3 3RN5A 4H13C 3KUPA 1YBYA 2R6GA 3Q8DA 3SK6A 1M8AA 3OPOA 1MI2A 5E7NA 1C8CA 4UDUC 5A2QE 2R93B 1RHPA 1KTKA 3HOXB 5GADC 3DEPA 1LUZA 2UUCQ 4B08A 1SFOB 2R93G 3HOVH 1Y1VB 4LF4L 1GUWA 4A3IG 1HNWQ 2F3VA 3PUVA 3TRZA 3NTHA 1V8QA 1Y1VG 4ILWA 3KF6A 5I2XA 1DYQA 2UUCL 1KRSA 1WFQA 4G7OC 1K28A 1W6JA 2QCPX 1CZGA 1CT1D 2JA5G 3K59A 3ND9A 1E1OA 1HNWL 1NSNS 2KUMA 4A3LH 5I6WA 2WP8J 2D5DA 4A3BB 1LTLA 4GKJQ 2BCOA 3X3MA 1C4QA 2I5LX 4OELB 1D5MC 3I4NH 3CCQA 2UUAL 1TS3A 4HIDA 1DZ1A 1EZ6A 3CPWA 3D6WA 3NTKA 1HZAA 5LL6S 3I3CA 2JK8A 4TRDA 3DHQA 2NVYB 2F0UA 4KTAA 3BZKA 1IKLA 4P2CB 5M5WH 4OL7A 4K5VA 2OF1A 4DV2L 4IPHA 4HSVA 3L9AX 3BDLA 2X69A 3HKZB 4DV1Q 3I70A 1YNJC 1KIXA 4A3KH 1HZ9A 3A8KE 1PH2A 2F0HA 2ZXOA 1N34L 2XVSA 3J81E 2YYZA 3S24A 5CV7A 3HOWB 2ZJPA 1BVSA 5JPNC 5JEAH 2E2DC 1E2WA 1WCMG 3M7GA 2L0CA 5KYIA 3GV3A 1CI3M 4DV1L 2HCIA 4KKSA 4RA8A 2VQEQ 2VW9A 4BXXH 4B3TL 5KIXA 1IHZA 2F0JA 2A74C 2F0OA 1XPRA 4JPBW 1YIJA 1I6VC 1CM9A 2VQEL 4V0BA 4K2LA 3PQIA 2YTYA 1PFBA 4P73A 4KI0A 4HR7B 2PI2A 3TZDA 4K6LA 1VQ5A 1PXUA 3S1QH 1JWMD 3ITPA 3K5LA 5IP7G 2F0SA 3I55A 4QIWE 4LFAL 5LMNL 4LMQD 2F0MA 1N8RC 2ZT9C 4HAEA 2IHFA 2K75A 4XT1B 3LWUA 3PO2H 2Z9HA 1TY2A 2BA0A 4B3RQ 1TIID 4GN3B 5C44H 2PZWA 3MXNB 1KDBA 1B3AA 1GJXA 1LABA 3DWQA 3KLRA 4NPSA 2AKWB 3IL8A 1EL0A 1IKMA 3G71A 3J7YW 2TSSA 5C0XG 5EPJA 2MP1A 1CKOA 4CKBA 4X62L 4KK7A 4DV4Q 3WOEA 1IL2A 3G4SA 4UP7A 3NK9A 1ILPA 1HA6A 3DXJC 4R8IA 3C2PA 4KD3A 1D1IA 2WV6D 2FMMA 1PRTF 3EJIA 1TWHB 4OO1G 4IPCA 1AW7A 3GTKB 3WWVA 4ZKBB 2NWGA 1QCBD 3T1YL 2O5JC 4ZCKA 1UE5A 2VQFQ 1OXUA 1STNA 3CC2A 2A19A 2JA6H 2F0TA 4GN5A 3MXUA 2HHHQ 5HY6A 1HNZQ 2SOBA 1NE3A 4YIJA 4A93H 1EOVA 2H5XA 3AYHB 4DK0A 2J4XA 3O13A 4LFBL 4A3MH 1WTWA 1BNZA 3TSSA 5IT9L 5C4JH 1WI5A 1X3QA 3BYYB 3K8AA 2HHHL 3CMEA 4GKKL 1HNZL 4RWSC 5GQOA 2GVAA 5M5YH 4R4IA 3HP3A 4P72A 1XTCD 5A2QL 1VQAA 4I7ZC 4L8JA 5EAYA 1HHVA 1EY0A 3PO3H 1W6KA 1Y1WH 3VYTA 1DOLA 1N32L 4PMBA 4CDDC 3AU7A 3AMUA 4RAUC 4XXEA 5D3IB 1LT6D 5KNBA 1HPCA 3HOXH 4LUZA 1JMCA 4HIKA 4LFCL 1AEXA 1SFOH 4EX5A 1Y1VH 1NJIC 3IFTA 5CYUA 5GAGC 3I72A 2G9HD 2YTXA 3K7UC 3K0YA 1WTRA 1B1ZA 1K9MC 2OT2A 2VUMG 3HG9A 5A35A 4A3GB 1E3PA 1KNEA 1RL2A 1X55A 3KJPA 2B8FA 5IE8A 1XTDA 5E4XA 3MXPA 3FKIG 5G3LD 2EVBA 1EU3A 2KJXA 2KA7A 4A3GG 2EJGC 3ER0A 4MHEA 4DK3C 4EGVA 5KGUA 1YJ9A 2M00A 4A3BH 2A69D 3LGJA 4ZAIA 4JI1L 2FINB 3V05A 1EWIA 1XPUA 1NMGA 3WDNA 1RF2D 5EBCA 4IALA 3PUZA 2AUKA 2B2VA 3BVMA 3GD7A 3NP8A 5FK9C 3RLOA 2GN5A 4LWCA 2B2UC 4OXPA 3F8TA 2NVYH 2F0DA 4A3DB 4ZYSA 3EROA 3GQBA 1CA6A 2A1AA 1UUPA 2NYZD 5EKKA 5IP9G 1A3UA 3DUZA 1YNJD 2K52A 3U9OA 1PH7A 3HKZE 3M7NA 4A3DG 4JI7L 4DR3Q 1O80A 1YHBA 3HOWH 1JT8A 4R8NA 3BS1A 1Q81C 5IGBA 1P16A 3N52A 3BDOA 1TWFB 3CCLA 4S3SA 2G5DA 2UXDQ 4LF8Q 4R4OA 2PCFB 4JG2A 4YCUA 4ABNA 2F0LA 3KF6B 3TZUA 3PUWA 4IUPA 3W1GA 3NXWA 2K1BA 4GS3A 2WKCA 2QEJC 4DR3L 4HCSA 4PQXA 2K5NA 3BG3A 3HOYG 2XNAC 1YHAA 3PUXA 3UDGA 2E5LL 1EY5A 1NNXA 4X64L 2RDGA 1BDOA 3PUYA 5KRUA 3K5OA 4RGNA 1R4QB 5E1FA 5BN5A 1VQCA 1GUOA 3GO5A 5JPMC 2FJ2A 4GOPC 3GTPB 1HZCA 4IUVA 4BWGB 4H02A 2FFKB 4A3CH 1BCPF 3STBC 4KV6A 5CV5A 1LTSD 5K36G 1S5DD 1CSQA 1X3FA 1IW7C 2NN6G 1EUJA 5HGQA 2L55A 3A5ZB 3TQYA 2R7DA 3Q0AA 4DF7A 2NVXB 1XWEA 2KCMA 4IPDA 1SAPA 2QDBA 1V1OA 1SE4A 4HIOA 1IYJB 2C9OA 1CKMA 2K5QA 1SE8A 1NUCA 2IL8A 2R61A 4DN4M 1Y14B 3S2DB 3G7LA 4B3SL 2AQ1B 2N78A 4Z9CB 1TWHH 1RTNA 1IBKL 2QGQA 1IBLQ 4X66Q 3R2IA 3K0XA 4XYQA 5J1ZA 3EN2A 3GTKH 2KOLA 2PW7A 4FXKC 4JI0L 3J80c 2B2TC 2CWPA 4N9PA 4DV0Q 2B2TA 1T9HA 5M3FB 1Q86C 2E2JH 4LF9Q 3L2PA 1GD7A 4Q5VA 2CFMA 5DLQE 1YJNA 2D0OA 4RHSA 4WFN3 4X66L 1RIPA 5M3FG 3HFZB 2EQSA 1KC8C 5C0XJ 5FO9B 2LFNA 4DV0L 3R2TA 2ZM6Q 4RGTA 1EEFD 2EY1A 3CQZB 1VQNA 3K57A 4I65A 1VMCA 2O4XA 2NVTB 1GXDC 1SMYC 2Q2TA 4I7AA 4FXDA 2EY6A 3M85A 3S17B 3K7AB 5C5LA 2D9UA 2PQEA 1UWVA 2ZM6L 2WKDA 4IUQA 4IURA 2EJMA 1BCPC 2AHOB 3TBIB 3KDFB 1X6OA 4YCVA 1R9TB 5F2DA 4DUYQ 2Y0SB 2IW3A 2P5ZX 4A75A 1EWCA 5C4HA 2HDMA 2FMCA 2LSSA 1A3VA 1VQ4A 3MHBA 3CCRA 1JR0D 1B50A 1XNQQ 5CV8A 2F0GA 4HMJA 4P75A 4EVOA 4BY7G 4KY6A 3T1HQ 4A3GH 1EY6A 5D14A 1C0AA 4JI6Q 1K0RA 5CC4A 1R4PB 4DAVA 2HQEA 1PRTD 4J6HA 2AUJD 4DUYL 4OGQC 3MAQA 3UDFA 1EYGA 4KD4A 1JOKA 5FLMG 4A4IA 5J39A 1XPOA 3BZCA 3KYHC 5ISRA 1NTGA 1M90C 3D4DA 4YCWA 1CKNB 3M4QA 3R3OA 3E9IA 3U4VA 4CDEC 2QEXA 3CW2C 4K5XA 4OO1I 3NQIA 1GHKA 1JE4A 4XYOA 4X65Q 4JI5L 3QO2A 2N55A 4G4KA 4A3DH 2WAQE 1GOZA 3PV0A 1MSHA 2RVLA 1XX8A 2ICIA 4R1JA 3SDZA 2J7ZA 1EQQA 2PQAB 5FO8B 3M4OH 4KMUC 2L9HA 3TREA 1VF7A 1HNXQ 1BUVT 1VQBA 2RHQB 3OTOQ 3K80C 1Z6HA 1WTHA 4X65L 1J6QA 1EU4A 1V43A 5JJLA 1HZBA 1TWFH 1E22A 1SYCA 3C1FA 3K58A 4L5SA 1VQPA 1G2TA 3DLLA 2PO4A 1JCKB 1HNXL 1I94Q 1STAA 3GP7A 3OTOL 2LKVA 2MFIA 1B70B 2B29A 2WB1B 4DR4Q 1ASZA 2M9VA 2JN4A 4APVA 4P74A 3BJUA 2YTVA 1TWAB 4KN4C 1DJRD 2AQ3B 4AH6A 1SNDA 1B9MA 1I5FA 1PH1A 4KY7A 5KNDA 1FD7D 4NMZA 2OWOA 4IJLA 2CQAA 3KK7A 2WINB 4L5TA 1KRTA 4C3JB 4DR4L 1VF5C 1RKNA 2MQHA 2F0QA 3P75A 2PZUA 3GTPH 3HKSA 1VQHA 2PZTA 3TP5A 2NTSA 4IN3A 3STBD 1YVCA 2R92B 2OQ0A 1Y69U 1D5XC 1IW7D 1UAPA 1O7IA 5IY0A 2NVXH 1H9KA 2Q8IB 1Q7YC 4DAYB 1RDPD 2R92G 1LACA 5CV9A 5BR8Q 1Z9FA 4OIJA 2XRSD 1FJGQ 3G6JB 5ELNA 2ATWA 1X54A 5M3MB 3JAMi 1SN8A 4OWXB 1RTOA 3NBHB 2E75C 5E3FA 3B6YA 3S2DH 1GUTA 3NWTA 2RDFA 1UE1A 3HS0C 3HZXA 4C1NK 1C7YA 5M3MG 5IGCA 5CMDA 4A3IB 3MZ5A 5BR8L 5D65A 1FJGL 3HOZB 3MVVA 1QG7A 1F2ZA 2UU9Q 5M3FH 4A3JG 3CCEA 1UNSA 2WFWA 5M9OA 3K81C 3ICEA 2DNCA 3HOZG 4X6AH 3J80E 3NUCA 3E9HA 3H09A 4NDXA 1H9SA 2K05A 4NW2A 5FOBB 2JA5B 3H0GB 5C3EG 1IL8A 4YHHQ 1AE3A 4MNOA 1H9RA 5T1GA 1SE3A 1VQJA 3S1NB 4GOPB 1QJOA 2NVTH 3H0GG 1JC7A 1O7ZA 3SHLA 1PH6A 3QB3A 1G8ZD 5CBAE 2A69C 1SMYD 2JEBI 4MIUA 3S17H 3K7AH 3VR5A 1TU2B 2JYOA 2HD3A 3RR5A 2J0TD 1K3RA 1ZKOA 1QOHA 4C3HG 4LW1A 3H91A 4HSPA 3ZYYX 4LK1C 2F0EA 5H1SE 1BCPD 1ML0D 3CCVA 4WRDA 3S14B 1R9TH 2EYHA 1S5BD 1WTOA 4B9XA 4GKJL 1L0WA 3QR8A 1WYDA 2Y0SE 1A8VA 4UP8A 1QNKA 4WJ4A 1WCMB 4PZ7A 4RHRA 4FF4A 4ULLA 2BOSA 4JBWA 2Z6BA 4K8JA 3I7FA 2QW7A 2B2WA 5FLMH 4XDXA 1LV9A 4FXGC 1EYDA 2NBFA 3SVMA 4J1MA 3VR4A 1Q1BA 3S1MB 3MXGA 1G2SA 1JORA 5DM63 1L0YB 2EIFA 1VQDA 3TS2A 2F0KA 2CKZB 3GTOB 2MPMA 4IFDJ 4CJ2C 1VQMA 2I46A 3S15B 4ODGA 1Q46A 1LTID 5E4WC 4A3FH 1SJED 1G91A 1STEA 1EY9A 3HEJA 4H0LC 4Y7NH 1KAWA 1YITA 2AMCB 1L1OC 1EQVA 1BCPB 4DR7Q 3U50C 1L1OA 4FDBA 3V96A 1EEID 2HUGA 4FF1A 3H94A 1VQGA 2AQ2B 3T4AC 4O2DA 2SDFA 3NENA 5EQ0A 1U4RA 3KJOA 5LMNW 2EZVA 1PA6A 1SNCA 2F4VQ 4GN4B 2I5HA 2MUYA 2R7ZB 3S2HB 2B63B 2I0QA 3OMGA 1SNOA 1VQIA 1ILQA 2V4DA 4B3RL 3G6EA 4X3TA 2OCEA 2UXBQ 1BBXC 1SYGA 2YU9B 1ZXTA 3CC7A 2OTLA 3OSOA 2R7ZG 2JA7G 1TR5A 2B63G 2A8VA 1YNNC 2OEOA 2WB1E 3X3NA 5CV4A 2E2IB 5C4XG 4X3SA 1PYWD 4DV4L 2KECA 2UUBQ 1AE2A 1CQFA 5FO7B 2B2YC 2B8GA 4C3JH 2K50A 1CTMA 2B2YA 1RCVD 2FHTA 4HIMA 1PH4A 2JQOA 3NHHA 2AWNA 4O1NA 1RODA 1MIUA 3TMEA 5IOCA 2VQFL 3EA6A 2VNUD 4A3EH 2HT1A 3C3LA 4C3IG 4FF2A 1PVOA 3M9BA 1LTAD 2R92H 1X3EA 2UUBL 1B3QA 2ZJQA 3OIQA 1S40A 4DPGA 1EIFA 1T5EA 1ESRA 2MHVA 4M8AA 4ZK9B 5LL6X 1O7LA 3RNUA 1WTVA 1Q90A 1U9RA 3OYYA 5FJ8G 4RCNA 1EIHA 4K8IA 2A68C 3AEVA 4XTCS 1TY0A 2R93H 3J81j 3A0JA 3J80L 2CQOA 1QZGA 1SYEA 4A3IH 4Y52H 2MO1A 1KNAA 2F52A 3HOZH 3UE0A 4LF7Q 2AWOA 2KCNA 3CC4A 1MJCA 2VUMB 3VDYA 2C35B 1LTTD 2DGYA 3MA2B 4CDCC 1UE6A 5LMUQ 2L11A 5IGDA 4HTHA 1GUNA 1M4VA 1VQ8A 2RSOA 3FKIB 3OW7A 1YEZA 2HQLA 2JA5H 4CGYB 4NXNQ 2PNHA 1MSGA 1PRTC 1LT3D 4QL5A 3A8IE 1OXSC 1G291 4LF7L 1UEAB 4PNYA 3MFGA 5CORA 1A6XA 3HOUB 4RFBA 1RD9D 3QG1A 3S1NH 4WORA 1WVLA 2SEBD 2VXWA 3BVZA 2IY5B 1PFNA 4BY1B 3HOUG 2B2VC 2ZJRA 3VA5A 3MEFA 1Q8IA 3KLWA 3FP9A 1N36Q 3QJYA 2HCCA 4CBVA 4CKCA 5IYCG 1SR3A 3KF8A 4BY1G 2RF4A 3S9WA 4HJAA 2D62A 2ZXPA 4DV6Q 1VQOA 3S14H 4MN3A 3EVQA 2BDNA 4XQNA 1IZ6A 1S3OA 4LAAA 1JWUD 1SYFA 3ONAB 2RCFA 2VY3A 1N36L 1CA5A 3R8BA 3P20A 5DAUA 1WCMH 1U4MA 5IGEA 3URYA 2LMCB 4KN7C 5EPLA 3CHBD 2DJGC 2F0WA 3A54A 4DV6L 3RMHA 1EFID 1AFPA 4JYAQ 1HRJA 4AYBG 2IPKD 4H7BA 4HJ5A 4OX9Q 2N3SA 3HOYB 4ZUJA 2IX3A 2ICEC 3S1MH 3EBEA 1X32A 3PGZA 1F2LA 1QILA 5ELDA 2JA8G 5ELFA 4ME3A 4YWMA 4JYAL
chains in the Genus database with same CATH topology
4DUYL 1KD1C 4LF4L 4TQUS 3HOVH 2UXDL 4LF8L 2ZTDA 3H15A 4A3IG 4IFDI 5IP7H 3UDFA 1S72A 5FLXc 1HNWQ 3ULPA 1EYGA 4YY3Q 5FLMG 4A4IA 1XPOA 2FXQA 1QZHA 3S15H 3PUVA 1JB7A 3BZCA 3KYHC 3A5UA 3TRZA 1Y1VG 4HJ7A 3KF6A 1SLJA 4LFBQ 1LM0A 1NTGA 1M90C 4YCWA 1A0IA 2K14A 1CKNB 4OONA 1KRSA 1WFQA 2UUCL 3M4QA 3IRBA 4JI4Q 4GKKQ 3E9IA 3U4VA 3CP0A 4UP9A 1Q8KA 2JA5G 4UY8C 4DV3Q 2QEXA 1E1OA 3CW2C 4HJ9A 1HNWL 4OO1I 1TWGH 4A3LH 4YY3L 5M3MH 4JBMA 1PH5A 4BBSG 1NY4A 2WP8J 3I4OA 4X65Q 4JI5L 1KL9A 1LTLA 1UE7A 3PCOB 4LUVA 4GKJQ 4A3DH 4DR2Q 4TVAB 2WAQE 2IT1A 3PV0A 4O0AA 3KOJA 4R1JA 1MJEA 2I5LX 4A3JH 1SMXA 1EQQA 4JI4L 2PQAB 1N32Q 3M4OH 5JJIA 1CKNA 4MTNA 3TREA 4DV3L 3PF5A 1X9NA 2B63H 1IXRA 2R7ZH 3I4NH 3CCQA 2UUAL 4HIDA 2MNAA 4JCVE 4R4QA 2OQKA 5GAEC 2Z0SA 3CPWA 1VQBA 2RHQB 1HNXQ 1HZAA 3OTOQ 1PYSB 3K80C 2JK8A 4DR1Q 3BZKA 2Q2HA 3UE1A 1J6QA 1V43A 5M5WH 4X65L 3I4MG 5JJLA 1HR0W 4LFCQ 1HZBA 2DUDA 5C3EH 4IPHA 4DV2L 1TWFH 4DR2L 4BBRH 3RLNA 1E22A 1OTCA 2E2IH 4L5SA 1VQPA 4DV1Q 1KIXA 2IX0A 3DLLA 4A3KH 1HZ9A 4LUOA 1PH2A 4LNQA 1P8LA 3H0GH 1N34L 2PQAA 1HNXL 1XNRQ 2F3IA 1I94Q 2YYZA 3S24A 3PIOA 3OTOL 1VQ6A 2MFIA 1PH8A 4DR1L 2ZJPA 3H3VH 1BVSA 1B70B 2B29A 3L0OA 3PIPA 4DR4Q 1E1TA 5LMUL 1ASZA 1WCMG 5IYDG 1X56A 2LXKA 4APVA 1IBLL 4KHPQ 4P74A 4C3HH 3BJUA 2YTVA 1U0LA 4DV1L 1HJPA 2ZTCA 4LF5Q 4AH6A 3KFUA 4NXNL 4HJ8A 4JOIC 2JA9A 2K5HA 2K5VA 2VW9A 2VQEQ 4DR5Q 3TS0A 1BBUA 4BXXH 1I5FA 4GNXB 1PH1A 3CCUA 3JC66 4B3TL 1XNRL 4JOIA 4YWLA 2OWOA 4IJLA 4JI1Q 1CUKA 4PG3A 4L5TA 1KRTA 1K73C 1L1OB 4LF9L 4DR4L 2MQHA 1JJGA 1MKHA 1YJWA 1XPRA 1YIJA 4KHPL 4XIGS 3GTPH 1GO3E 1VQHA 3HKSA 4OWTB 4LF5L 4DR6Q 3GDEA 2VQEL 3RN2A 4DR5L 3STBD 4P73A 2YTYA 3F2CA 1YVCA 3HOVG 2OQ0A 4KI0A 2PI2A 1VQ5A 3S1QH 1PFSA 3BU2A 5IP7G 2JJQA 3CCSA 3I55A 1KHIA 1O7IA 5IY0A 2NVXH 4QIWE 3CD6A 1BBWA 1Q7YC 5LMNL 4LFAL 4DAYB 1Q82C 2R92G 1N8RC 5BR8Q 1Z9FA 4DK6C 1FJGQ 5ELNA 2ATWA 3NEMA 1X54A 2IHFA 2K75A 3L7ZC 4JI7Q 3JAMi 3PO2H 1SN8A 4OWXB 4DR6L 3NBHB 2BA0A 4B3RQ 3RZDH 2Q2UA 2VUMH 3B6YA 4GN3B 5C44H 3U58A 1QVGA 2NVQH 1XMOQ 3S2DH 1V9PA 2RHSB 3MXNB 4IFDG 4NPSA 1UE1A 1C7YA 2CCZA 4A3LG 2AKWB 5M3MG 3CCJA 1W2BA 4R4TA 3G71A 2WAQG 3FKIH 1IBMQ 5C0XG 2JEAI 1CKOA 4X62L 5BR8L 4DV4Q 1IL2A 1FJGL 3G4SA 1Z47A 3D0FA 4JBJA 4UP7A 1KQSA 1I50H 4WJ3M 1GM5A 4QGUA 2UU9Q 5M3FH 3ZJYC 4DNIA 4QQBX 1N33Q 4A3JG 3CXCA 3CCEA 2E8GA 3GTOH 2B3GA 5JJKA 3J81c 1XMOL 3J7ZC 3HOUH 2N49A 1GVPA 1X3GA 2Q2IA 2WFWA 3K81C 4ALPA 1PV4A 3I4NG 4IPCA 4OX9L 3HOZG 4OO1G 4X6AH 2E5LQ 1EQRA 4X64Q 3E9HA 1M1KC 1XNQL 3RLFA 3WWVA 1YNXA 3T1YL 1IBML 3FHWA 1UE5A 2VQFQ 5C0XI 1OXUA 4BY1H 3T1HL 4BA1I 3OW2A 1J5EQ 3CC2A 2A19A 5C3EG 4GN5A 2JA6H 3ICEA 3NELA 4YHHQ 1A63A 4JI6L 2XGTA 1AE3A 1PYBA 1YI2A 4POGA 1XMQQ 4MNOA 4IOCA 2HHHQ 1N33L 5HY6A 4GLXA 1PHJA 1HNZQ 2ASBA 1FL0A 1NE3A 1VQJA 4A3KG 4GOPB 4A93H 2NVTH 2XTIA 3H0GG 1K8GA 1EOVA 2H5XA 4PMWA 3AYHB 5IWAQ 1PH6A 3CPFA 2JEBI 5IP9H 1U5KA 5JEAG 2KHJA 3S17H 1V1QA 3K7AH 2HIVA 1J5EL 2KBNA 4LFBL 4A3MH 1I6HH 3U4ZA 2VL6A 3RR5A 5IYBG 5C4JH 1K3RA 1WI5A 3K8AA 4LW1A 2HHHL 3TEHB 3CMEA 1JJCB 2Z6KA 1ASYA 1HNZL 5GAHC 5GQOA 2GVAA 2LXJA 5H1SE 4GKKL 1HR0Q 5M5YH 4R4IA 2JA7H 2ALYB 4BXXG 4P72A 3CCVA 1VQAA 1PH3A 5IWAL 5C4XH 5EAYA 3J81i 4GOPA 1R9TH 3H3VI 3F2DA 3PO3H 3I56A 1Y1WH 2YU9H 4GKJL 4POFA 4B3SQ 4BA2I 4DAMA 2RCNA 1L0WA 1EFWA 4OWWB 5IT9c 1WOCA 1N32L 1WYDA 1IBKQ 4YWKA 5GROA 2Y0SE 1A8VA 2BA1A 4UP8A 4DKAC 3HOYH 4WJ4A 4PZ7A 1HR0L 1HH2P 4JI0Q 3HOXH 1E7ZA 4JBWA 3I7FA 4L5QA 4LUZA 3SGIA 1JMCA 5FLMH 4HIKA 4JV5Q 1VQ9A 4C3IH 3JAMc 3GTQH 4LFCL 1UEBA 4DV5Q 1SFOH 4GLVB 4EX5A 1Y1VH 4JC0A 1NJIC 5ELOA 5GAGC 2YTXA 2VS1A 3K7UC 4DV7Q 1Q1BA 1K9MC 2VUMG 4K0KQ 1I94L 2EIFA 1E3PA 3D31A 1VQDA 1RL2A 4NXMQ 1VQFA 1X55A 3TS2A 3KJPA 5IE8A 2MO0A 5FJ8H 3PF4A 2ES2A 1XTDA 2CKZB 1AH9A 1EIYB 4DV5L 3FKIG 4LF6Q 4UPAA 3CF5A 4IFDJ 4A3GG 2GVBA 1VQMA 1NMFA 3ER0A 1B7YB 4DK3C 4DV7L 1QUQB 1Q46A 1YJ9A 4A3FH 4GNXC 4A3BH 4K0KL 3LGJA 3ULJA 2JE6I 4NXML 4JI1L 4GNXA 1XPUA 1EWIA 3I2ZA 1NMGA 3UDXA 1KAWA 4Y7NH 1YITA 1YHQA 2AMCB 3PUZA 1L1OC 1Q12A 4AQYQ 3GD7A 3I4MH 4DR7Q 3U50C 1L1OA 4A76A 4B3MQ 2NZOA 4FDBA 3RLOA 2GN5A 4GLAC 4LWCA 1K83H 1VQGA 1OXTA 4OXPA 3F2BA 4O2DA 3UDIA 3F8TA 3NENA 4RMFA 2NVYH 1QVCA 3J7A5 3KJOA 3RZOH 1VQKA 3S1RH 4C2MH 5LMNW 3S2HH 1PA6A 2F4VQ 4A93G 4IJHA 2A1AA 2EXDA 3J80i 3GTLH 1I3QH 5IP9G 4GN4B 2I5HA 4B3ML 2K52A 2I0QA 1PH7A 3HKZE 4DUZQ 3M7NA 4A3MG 4A3DG 5IYDH 4JI7L 1D7QA 4DR3Q 1TXYA 1VQIA 1YHBA 4B3RL 3HOWH 4RG1A 1B8AA 3G6EA 2OCEA 4MZ9A 2UXBQ 1JT8A 4KLKA 1GKHA 1Q81C 2OTLA 3CC7A 4AIMA 1P16A 2R7ZG 2JA7G 2B63G 3CCLA 2KHIA 2UXDQ 2A8VA 1JE5A 1SRUA 4LF8Q 2WB1E 4R4OA 4JG2A 5C4XG 4YCUA 4R4CA 1CSPA 5IYCH 3M4PA 3KF6B 3PUWA 1Y1WG 3PO3G 3W1GA 4DV4L 1NBWA 1YZ6A 3W5OA 4GS3A 4DUZL 3GTJH 1Q1EA 3AFQA 2KCTA 2Y0SG 4DR3L 4BBRG 3CMAA 2PI2E 2UUBQ 1AE2A 2UU9L 1XJVA 5M5XH 2K5NA 3HOYG 4C3JH 2K50A 3CQZH 5J3BA 4IO9A 1YHAA 3PUXA 4HIMA 3UDGA 3HOXG 2ID0A 4X64L 1PH4A 4NB3A 2E5LL 2JQOA 2AWNA 1MIUA 2VQFL 2VNUD 3PUYA 4A3EH 2HT1A 1PVOA 4J15A 2K4KA 3M9BA 4JI5Q 4YHHL 2R92H 1X3EA 2UXCQ 2UUBL 2Z6KC 1OXXK 1XMQL 2ZJQA 1VQEA 4P71A 3DM3A 3AQQA 1S40A 1VQLA 4DPGA 1VQCA 1EIFA 3GO5A 2V1CC 4IPGA 4L5RC 4GOPC 1HZCA 3G48A 4H02A 2UUAQ 4A3CH 1DGSA 3STBC 3W1BA 4AYBE 5K36G 3RNUA 3OYYA 5FJ8G 1E24A 1JJ2A 1G6PA 1CSQA 1X3FA 4BY7H 1WJJA 2NN6G 1EUJA 5HGQA 2UXCL 4JI2Q 3A5ZB 3TQYA 2JA8H 2R7DA 4DV2Q 1D8LA 3AEVA 2KCMA 4IPDA 4XTCS 1LYLA 1FGUA 2R93H 4IOAA 3J81j 3GTGH 4HIOA 1IYJB 1TWCH 2CQOA 3A0JA 1CKMA 4A3IH 4A3FG 1FVIA 2MO1A 1QZGA 4A3BG 4Y52H 1SE8A 2D0PA 2F52A 1N34Q 3HOZH 3UE0A 4LF7Q 2AWOA 2CWAA 4JI8Q 3CC4A 1MJCA 1Y14B 2E2HH 3VDYA 2C35B 2NN6I 2KENA 2DGYA 2HIXA 5LMUQ 4B3SL 1UE6A 4JI2L 2N78A 1TWHH 1IBKL 1IBLQ 2QGQA 4X66Q 1VQ8A 3K0XA 4EQ5A 3PO2G 1QVFA 3EN2A 3GTKH 1YEZA 2HQLA 4JI3L 3J80c 2JA5H 5C44G 1BKBA 5AJ3Q 4JI0L 4NXNQ 2PNHA 2CWPA 1G51A 1H95A 1L2FA 4QL5A 4B3TQ 2PMZE 1OXSC 3CAMA 1G291 4DV0Q 4JI8L 4LF7L 3KF8B 1T9HA 1Q86C 4JV5L 4BBSH 4PZ6A 3HKZG 2E2JH 4LF9Q 3L2PA 1K8AC 1GD7A 1VCIA 3AFPA 3S1NH 1X65A 2CFMA 5DLQE 1YJNA 1W3SA 2D0OA 2R7FA 5IYBH 4X66L 3GTMH 1VS0A 4QY7A 2N8NA 1C9OA 1RIPA 2NZHA 2EQSA 3HFZB 5M3FG 1KC8C 3HOWG 4PZ8A 5C0XJ 2IY5B 5AJ3L 2WB1G 3HOUG 3ERSX 4JBKA 2ZJRA 3MEFA 4DV0L 1PH9A 3KLWA 3FP9A 3PSIA 4KHZA 2ZM6Q 1N36Q 4LF6L 5IYCG 1VQNA 1SR3A 3CCMA 4BY1G 4LFAQ 5LMNQ 2IX1A 2JA6G 3M3YH 2BH2A 2RF4A 4HJAA 3A74A 1VQ7A 2D62A 2Q2TA 4DV6Q 1VQOA 3S14H 3EIVA 3M85A 3S16H 1IZ6A 2BH8A 1SROA 1QUQA 1S3OA 3F1ZA 3ULLA 2I5MX 1UWVA 2VY3A 2ZM6L 1N36L 4JI3Q 4AQYL 4DR7L 2AHOB 1WCMH 4A3EG 2VZAA 2YV5A 3KDFB 1N9WA 4X62Q 1A62A 1OXVA 1X6OA 4YCVA 4DV6L 1KXLA 2QA4A 5JEAJ 2ZTEA 4JYAQ 2OTJA 3E0EA 4DUYQ 4A75A 4LF4Q 2F4VL 3RN5A 4AYBG 2LSSA 1YBYA 2R6GA 3Q8DA 1VQ4A 4HJ5A 1TWAH 2N3SA 5E7NA 3CCRA 4OX9Q 4A3CG 1XNQQ 4P75A 3S1MH 3EBEA 3PGZA 3T1YQ 4BY7G 2L15A 5GADC 2IHEA 3T1HQ 4A3GH 2JA8G 1LUZA 4QJFA 1C0AA 4JI6Q 1K0RA 2UXBL 3KDFA 2UUCQ 4ME3A 4YWMA 4JYAL 2R93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY L;  1KD1 C;  4LF4 L;  4TQU S;  3HOV H;  2UXD L;  4LF8 L;  2ZTD A;  3H15 A;  4A3I G;  4IFD I;  5IP7 H;  3UDF A;  1S72 A;  5FLX c;  1HNW Q;  3ULP A;  1EYG A;  4YY3 Q;  5FLM G;  4A4I A;  1XPO A;  2FXQ A;  1QZH A;  3S15 H;  3PUV A;  1JB7 A;  3BZC A;  3KYH C;  3A5U A;  3TRZ A;  1Y1V G;  4HJ7 A;  3KF6 A;  1SLJ A;  4LFB Q;  1LM0 A;  1NTG A;  1M90 C;  4YCW A;  1A0I A;  2K14 A;  1CKN B;  4OON A;  1KRS A;  1WFQ A;  2UUC L;  3M4Q A;  3IRB A;  4JI4 Q;  4GKK Q;  3E9I A;  3U4V A;  3CP0 A;  4UP9 A;  1Q8K A;  2JA5 G;  4UY8 C;  4DV3 Q;  2QEX A;  1E1O A;  3CW2 C;  4HJ9 A;  1HNW L;  4OO1 I;  1TWG H;  4A3L H;  4YY3 L;  5M3M H;  4JBM A;  1PH5 A;  4BBS G;  1NY4 A;  2WP8 J;  3I4O A;  4X65 Q;  4JI5 L;  1KL9 A;  1LTL A;  1UE7 A;  3PCO B;  4LUV A;  4GKJ Q;  4A3D H;  4DR2 Q;  4TVA B;  2WAQ E;  2IT1 A;  3PV0 A;  4O0A A;  3KOJ A;  4R1J A;  1MJE A;  2I5L X;  4A3J H;  1SMX A;  1EQQ A;  4JI4 L;  2PQA B;  1N32 Q;  3M4O H;  5JJI A;  1CKN A;  4MTN A;  3TRE A;  4DV3 L;  3PF5 A;  1X9N A;  2B63 H;  1IXR A;  2R7Z H;  3I4N H;  3CCQ A;  2UUA L;  4HID A;  2MNA A;  4JCV E;  4R4Q A;  2OQK A;  5GAE C;  2Z0S A;  3CPW A;  1VQB A;  2RHQ B;  1HNX Q;  1HZA A;  3OTO Q;  1PYS B;  3K80 C;  2JK8 A;  4DR1 Q;  3BZK A;  2Q2H A;  3UE1 A;  1J6Q A;  1V43 A;  5M5W H;  4X65 L;  3I4M G;  5JJL A;  1HR0 W;  4LFC Q;  1HZB A;  2DUD A;  5C3E H;  4IPH A;  4DV2 L;  1TWF H;  4DR2 L;  4BBR H;  3RLN A;  1E22 A;  1OTC A;  2E2I H;  4L5S A;  1VQP A;  4DV1 Q;  1KIX A;  2IX0 A;  3DLL A;  4A3K H;  1HZ9 A;  4LUO A;  1PH2 A;  4LNQ A;  1P8L A;  3H0G H;  1N34 L;  2PQA A;  1HNX L;  1XNR Q;  2F3I A;  1I94 Q;  2YYZ A;  3S24 A;  3PIO A;  3OTO L;  1VQ6 A;  2MFI A;  1PH8 A;  4DR1 L;  2ZJP A;  3H3V H;  1BVS A;  1B70 B;  2B29 A;  3L0O A;  3PIP A;  4DR4 Q;  1E1T A;  5LMU L;  1ASZ A;  1WCM G;  5IYD G;  1X56 A;  2LXK A;  4APV A;  1IBL L;  4KHP Q;  4P74 A;  4C3H H;  3BJU A;  2YTV A;  1U0L A;  4DV1 L;  1HJP A;  2ZTC A;  4LF5 Q;  4AH6 A;  3KFU A;  4NXN L;  4HJ8 A;  4JOI C;  2JA9 A;  2K5H A;  2K5V A;  2VW9 A;  2VQE Q;  4DR5 Q;  3TS0 A;  1BBU A;  4BXX H;  1I5F A;  4GNX B;  1PH1 A;  3CCU A;  3JC6 6;  4B3T L;  1XNR L;  4JOI A;  4YWL A;  2OWO A;  4IJL A;  4JI1 Q;  1CUK A;  4PG3 A;  4L5T A;  1KRT A;  1K73 C;  1L1O B;  4LF9 L;  4DR4 L;  2MQH A;  1JJG A;  1MKH A;  1YJW A;  1XPR A;  1YIJ A;  4KHP L;  4XIG S;  3GTP H;  1GO3 E;  1VQH A;  3HKS A;  4OWT B;  4LF5 L;  4DR6 Q;  3GDE A;  2VQE L;  3RN2 A;  4DR5 L;  3STB D;  4P73 A;  2YTY A;  3F2C A;  1YVC A;  3HOV G;  2OQ0 A;  4KI0 A;  2PI2 A;  1VQ5 A;  3S1Q H;  1PFS A;  3BU2 A;  5IP7 G;  2JJQ A;  3CCS A;  3I55 A;  1KHI A;  1O7I A;  5IY0 A;  2NVX H;  4QIW E;  3CD6 A;  1BBW A;  1Q7Y C;  5LMN L;  4LFA L;  4DAY B;  1Q82 C;  2R92 G;  1N8R C;  5BR8 Q;  1Z9F A;  4DK6 C;  1FJG Q;  5ELN A;  2ATW A;  3NEM A;  1X54 A;  2IHF A;  2K75 A;  3L7Z C;  4JI7 Q;  3JAM i;  3PO2 H;  1SN8 A;  4OWX B;  4DR6 L;  3NBH B;  2BA0 A;  4B3R Q;  3RZD H;  2Q2U A;  2VUM H;  3B6Y A;  4GN3 B;  5C44 H;  3U58 A;  1QVG A;  2NVQ H;  1XMO Q;  3S2D H;  1V9P A;  2RHS B;  3MXN B;  4IFD G;  4NPS A;  1UE1 A;  1C7Y A;  2CCZ A;  4A3L G;  2AKW B;  5M3M G;  3CCJ A;  1W2B A;  4R4T A;  3G71 A;  2WAQ G;  3FKI H;  1IBM Q;  5C0X G;  2JEA I;  1CKO A;  4X62 L;  5BR8 L;  4DV4 Q;  1IL2 A;  1FJG L;  3G4S A;  1Z47 A;  3D0F A;  4JBJ A;  4UP7 A;  1KQS A;  1I50 H;  4WJ3 M;  1GM5 A;  4QGU A;  2UU9 Q;  5M3F H;  3ZJY C;  4DNI A;  4QQB X;  1N33 Q;  4A3J G;  3CXC A;  3CCE A;  2E8G A;  3GTO H;  2B3G A;  5JJK A;  3J81 c;  1XMO L;  3J7Z C;  3HOU H;  2N49 A;  1GVP A;  1X3G A;  2Q2I A;  2WFW A;  3K81 C;  4ALP A;  1PV4 A;  3I4N G;  4IPC A;  4OX9 L;  3HOZ G;  4OO1 G;  4X6A H;  2E5L Q;  1EQR A;  4X64 Q;  3E9H A;  1M1K C;  1XNQ L;  3RLF A;  3WWV A;  1YNX A;  3T1Y L;  1IBM L;  3FHW A;  1UE5 A;  2VQF Q;  5C0X I;  1OXU A;  4BY1 H;  3T1H L;  4BA1 I;  3OW2 A;  1J5E Q;  3CC2 A;  2A19 A;  5C3E G;  4GN5 A;  2JA6 H;  3ICE A;  3NEL A;  4YHH Q;  1A63 A;  4JI6 L;  2XGT A;  1AE3 A;  1PYB A;  1YI2 A;  4POG A;  1XMQ Q;  4MNO A;  4IOC A;  2HHH Q;  1N33 L;  5HY6 A;  4GLX A;  1PHJ A;  1HNZ Q;  2ASB A;  1FL0 A;  1NE3 A;  1VQJ A;  4A3K G;  4GOP B;  4A93 H;  2NVT H;  2XTI A;  3H0G G;  1K8G A;  1EOV A;  2H5X A;  4PMW A;  3AYH B;  5IWA Q;  1PH6 A;  3CPF A;  2JEB I;  5IP9 H;  1U5K A;  5JEA G;  2KHJ A;  3S17 H;  1V1Q A;  3K7A H;  2HIV A;  1J5E L;  2KBN A;  4LFB L;  4A3M H;  1I6H H;  3U4Z A;  2VL6 A;  3RR5 A;  5IYB G;  5C4J H;  1K3R A;  1WI5 A;  3K8A A;  4LW1 A;  2HHH L;  3TEH B;  3CME A;  1JJC B;  2Z6K A;  1ASY A;  1HNZ L;  5GAH C;  5GQO A;  2GVA A;  2LXJ A;  5H1S E;  4GKK L;  1HR0 Q;  5M5Y H;  4R4I A;  2JA7 H;  2ALY B;  4BXX G;  4P72 A;  3CCV A;  1VQA A;  1PH3 A;  5IWA L;  5C4X H;  5EAY A;  3J81 i;  4GOP A;  1R9T H;  3H3V I;  3F2D A;  3PO3 H;  3I56 A;  1Y1W H;  2YU9 H;  4GKJ L;  4POF A;  4B3S Q;  4BA2 I;  4DAM A;  2RCN A;  1L0W A;  1EFW A;  4OWW B;  5IT9 c;  1WOC A;  1N32 L;  1WYD A;  1IBK Q;  4YWK A;  5GRO A;  2Y0S E;  1A8V A;  2BA1 A;  4UP8 A;  4DKA C;  3HOY H;  4WJ4 A;  4PZ7 A;  1HR0 L;  1HH2 P;  4JI0 Q;  3HOX H;  1E7Z A;  4JBW A;  3I7F A;  4L5Q A;  4LUZ A;  3SGI A;  1JMC A;  5FLM H;  4HIK A;  4JV5 Q;  1VQ9 A;  4C3I H;  3JAM c;  3GTQ H;  4LFC L;  1UEB A;  4DV5 Q;  1SFO H;  4GLV B;  4EX5 A;  1Y1V H;  4JC0 A;  1NJI C;  5ELO A;  5GAG C;  2YTX A;  2VS1 A;  3K7U C;  4DV7 Q;  1Q1B A;  1K9M C;  2VUM G;  4K0K Q;  1I94 L;  2EIF A;  1E3P A;  3D31 A;  1VQD A;  1RL2 A;  4NXM Q;  1VQF A;  1X55 A;  3TS2 A;  3KJP A;  5IE8 A;  2MO0 A;  5FJ8 H;  3PF4 A;  2ES2 A;  1XTD A;  2CKZ B;  1AH9 A;  1EIY B;  4DV5 L;  3FKI G;  4LF6 Q;  4UPA A;  3CF5 A;  4IFD J;  4A3G G;  2GVB A;  1VQM A;  1NMF A;  3ER0 A;  1B7Y B;  4DK3 C;  4DV7 L;  1QUQ B;  1Q46 A;  1YJ9 A;  4A3F H;  4GNX C;  4A3B H;  4K0K L;  3LGJ A;  3ULJ A;  2JE6 I;  4NXM L;  4JI1 L;  4GNX A;  1XPU A;  1EWI A;  3I2Z A;  1NMG A;  3UDX A;  1KAW A;  4Y7N H;  1YIT A;  1YHQ A;  2AMC B;  3PUZ A;  1L1O C;  1Q12 A;  4AQY Q;  3GD7 A;  3I4M H;  4DR7 Q;  3U50 C;  1L1O A;  4A76 A;  4B3M Q;  2NZO A;  4FDB A;  3RLO A;  2GN5 A;  4GLA C;  4LWC A;  1K83 H;  1VQG A;  1OXT A;  4OXP A;  3F2B A;  4O2D A;  3UDI A;  3F8T A;  3NEN A;  4RMF A;  2NVY H;  1QVC A;  3J7A 5;  3KJO A;  3RZO H;  1VQK A;  3S1R H;  4C2M H;  5LMN W;  3S2H H;  1PA6 A;  2F4V Q;  4A93 G;  4IJH A;  2A1A A;  2EXD A;  3J80 i;  3GTL H;  1I3Q H;  5IP9 G;  4GN4 B;  2I5H A;  4B3M L;  2K52 A;  2I0Q A;  1PH7 A;  3HKZ E;  4DUZ Q;  3M7N A;  4A3M G;  4A3D G;  5IYD H;  4JI7 L;  1D7Q A;  4DR3 Q;  1TXY A;  1VQI A;  1YHB A;  4B3R L;  3HOW H;  4RG1 A;  1B8A A;  3G6E A;  2OCE A;  4MZ9 A;  2UXB Q;  1JT8 A;  4KLK A;  1GKH A;  1Q81 C;  2OTL A;  3CC7 A;  4AIM A;  1P16 A;  2R7Z G;  2JA7 G;  2B63 G;  3CCL A;  2KHI A;  2UXD Q;  2A8V A;  1JE5 A;  1SRU A;  4LF8 Q;  2WB1 E;  4R4O A;  4JG2 A;  5C4X G;  4YCU A;  4R4C A;  1CSP A;  5IYC H;  3M4P A;  3KF6 B;  3PUW A;  1Y1W G;  3PO3 G;  3W1G A;  4DV4 L;  1NBW A;  1YZ6 A;  3W5O A;  4GS3 A;  4DUZ L;  3GTJ H;  1Q1E A;  3AFQ A;  2KCT A;  2Y0S G;  4DR3 L;  4BBR G;  3CMA A;  2PI2 E;  2UUB Q;  1AE2 A;  2UU9 L;  1XJV A;  5M5X H;  2K5N A;  3HOY G;  4C3J H;  2K50 A;  3CQZ H;  5J3B A;  4IO9 A;  1YHA A;  3PUX A;  4HIM A;  3UDG A;  3HOX G;  2ID0 A;  4X64 L;  1PH4 A;  4NB3 A;  2E5L L;  2JQO A;  2AWN A;  1MIU A;  2VQF L;  2VNU D;  3PUY A;  4A3E H;  2HT1 A;  1PVO A;  4J15 A;  2K4K A;  3M9B A;  4JI5 Q;  4YHH L;  2R92 H;  1X3E A;  2UXC Q;  2UUB L;  2Z6K C;  1OXX K;  1XMQ L;  2ZJQ A;  1VQE A;  4P71 A;  3DM3 A;  3AQQ A;  1S40 A;  1VQL A;  4DPG A;  1VQC A;  1EIF A;  3GO5 A;  2V1C C;  4IPG A;  4L5R C;  4GOP C;  1HZC A;  3G48 A;  4H02 A;  2UUA Q;  4A3C H;  1DGS A;  3STB C;  3W1B A;  4AYB E;  5K36 G;  3RNU A;  3OYY A;  5FJ8 G;  1E24 A;  1JJ2 A;  1G6P A;  1CSQ A;  1X3F A;  4BY7 H;  1WJJ A;  2NN6 G;  1EUJ A;  5HGQ A;  2UXC L;  4JI2 Q;  3A5Z B;  3TQY A;  2JA8 H;  2R7D A;  4DV2 Q;  1D8L A;  3AEV A;  2KCM A;  4IPD A;  4XTC S;  1LYL A;  1FGU A;  2R93 H;  4IOA A;  3J81 j;  3GTG H;  4HIO A;  1IYJ B;  1TWC H;  2CQO A;  3A0J A;  1CKM A;  4A3I H;  4A3F G;  1FVI A;  2MO1 A;  1QZG A;  4A3B G;  4Y52 H;  1SE8 A;  2D0P A;  2F52 A;  1N34 Q;  3HOZ H;  3UE0 A;  4LF7 Q;  2AWO A;  2CWA A;  4JI8 Q;  3CC4 A;  1MJC A;  1Y14 B;  2E2H H;  3VDY A;  2C35 B;  2NN6 I;  2KEN A;  2DGY A;  2HIX A;  5LMU Q;  4B3S L;  1UE6 A;  4JI2 L;  2N78 A;  1TWH H;  1IBK L;  1IBL Q;  2QGQ A;  4X66 Q;  1VQ8 A;  3K0X A;  4EQ5 A;  3PO2 G;  1QVF A;  3EN2 A;  3GTK H;  1YEZ A;  2HQL A;  4JI3 L;  3J80 c;  2JA5 H;  5C44 G;  1BKB A;  5AJ3 Q;  4JI0 L;  4NXN Q;  2PNH A;  2CWP A;  1G51 A;  1H95 A;  1L2F A;  4QL5 A;  4B3T Q;  2PMZ E;  1OXS C;  3CAM A;  1G29 1;  4DV0 Q;  4JI8 L;  4LF7 L;  3KF8 B;  1T9H A;  1Q86 C;  4JV5 L;  4BBS H;  4PZ6 A;  3HKZ G;  2E2J H;  4LF9 Q;  3L2P A;  1K8A C;  1GD7 A;  1VCI A;  3AFP A;  3S1N H;  1X65 A;  2CFM A;  5DLQ E;  1YJN A;  1W3S A;  2D0O A;  2R7F A;  5IYB H;  4X66 L;  3GTM H;  1VS0 A;  4QY7 A;  2N8N A;  1C9O A;  1RIP A;  2NZH A;  2EQS A;  3HFZ B;  5M3F G;  1KC8 C;  3HOW G;  4PZ8 A;  5C0X J;  2IY5 B;  5AJ3 L;  2WB1 G;  3HOU G;  3ERS X;  4JBK A;  2ZJR A;  3MEF A;  4DV0 L;  1PH9 A;  3KLW A;  3FP9 A;  3PSI A;  4KHZ A;  2ZM6 Q;  1N36 Q;  4LF6 L;  5IYC G;  1VQN A;  1SR3 A;  3CCM A;  4BY1 G;  4LFA Q;  5LMN Q;  2IX1 A;  2JA6 G;  3M3Y H;  2BH2 A;  2RF4 A;  4HJA A;  3A74 A;  1VQ7 A;  2D62 A;  2Q2T A;  4DV6 Q;  1VQO A;  3S14 H;  3EIV A;  3M85 A;  3S16 H;  1IZ6 A;  2BH8 A;  1SRO A;  1QUQ A;  1S3O A;  3F1Z A;  3ULL A;  2I5M X;  1UWV A;  2VY3 A;  2ZM6 L;  1N36 L;  4JI3 Q;  4AQY L;  4DR7 L;  2AHO B;  1WCM H;  4A3E G;  2VZA A;  2YV5 A;  3KDF B;  1N9W A;  4X62 Q;  1A62 A;  1OXV A;  1X6O A;  4YCV A;  4DV6 L;  1KXL A;  2QA4 A;  5JEA J;  2ZTE A;  4JYA Q;  2OTJ A;  3E0E A;  4DUY Q;  4A75 A;  4LF4 Q;  2F4V L;  3RN5 A;  4AYB G;  2LSS A;  1YBY A;  2R6G A;  3Q8D A;  1VQ4 A;  4HJ5 A;  1TWA H;  2N3S A;  5E7N A;  3CCR A;  4OX9 Q;  4A3C G;  1XNQ Q;  4P75 A;  3S1M H;  3EBE A;  3PGZ A;  3T1Y Q;  4BY7 G;  2L15 A;  5GAD C;  2IHE A;  3T1H Q;  4A3G H;  2JA8 G;  1LUZ A;  4QJF A;  1C0A A;  4JI6 Q;  1K0R A;  2UXB L;  3KDF A;  2UUC Q;  4ME3 A;  4YWM A;  4JYA L;  2R93 G; 
#chains in the Genus database with same CATH topology
 4M1U B;  2K04 A;  2UXD L;  1I4H A;  4LF8 L;  2CH4 A;  2ZTD A;  4DFA A;  3MEH A;  3FPU B;  5IP7 H;  5FLX c;  3ULP A;  5FKA C;  4YY3 Q;  2N88 A;  5L37 A;  2FXQ A;  1QZH A;  1ONL A;  3S15 H;  2F4I A;  1JB7 A;  2PPB C;  1SSO A;  3A5U A;  1NR4 A;  4RGM A;  3VR6 A;  1MGS A;  1S5F D;  4R9W A;  3H3V C;  1H9J A;  3QIA A;  1F77 A;  4JI4 Q;  4DV3 Q;  4HJ9 A;  4YY3 L;  1PH5 A;  4BBS G;  1NY4 A;  5C0X H;  3I4O A;  1KL9 A;  1D1K A;  2BE5 C;  4LUV A;  3KOJ A;  3RUZ A;  1SMX A;  4JI4 L;  5JJI A;  3I4M B;  5C6A A;  4MTN A;  2R7Z H;  3VYS A;  4DV3 L;  1X9N A;  2B63 H;  3S2H H;  4OO1 H;  4IUN A;  2MNA A;  4JCV E;  4R4Q A;  2OQK A;  4IQZ A;  1JOO A;  5GAE C;  3J7A V;  1DD2 A;  4B9W A;  2Q2H A;  2LS0 1;  2H4O A;  3RZO B;  1F9S A;  5TSS A;  4F8M A;  5I2Y A;  3S1R B;  4C2M B;  1HR0 W;  3I4M G;  1JOQ A;  4TSS A;  1EY8 A;  3RLN A;  1OTC A;  2E2I H;  1YNN D;  3GTL B;  3VR2 A;  2IX0 A;  2TMP A;  2GA4 B;  4LNQ A;  1P8L A;  1XNR Q;  5JAV A;  1F9Q A;  3QWN A;  3PIO A;  3L0O A;  3VYU A;  3PIP A;  3HGB A;  1E1T A;  4HN7 A;  2LXK A;  1IBL L;  4CJ1 B;  4LF5 Q;  4HJ8 A;  2JA9 A;  4DR5 Q;  2K5V A;  2Z8L A;  4ZKC B;  1BBU A;  2NUC A;  3GTJ B;  3JC6 6;  3K5N A;  1XNR L;  5C5M A;  4X3K A;  4YWL A;  1FNW A;  3TP7 A;  1CUK A;  2CHB D;  2WII B;  1K73 C;  1L1O B;  4LF9 L;  1YJW A;  4C56 C;  1GO3 E;  5IGF A;  4OWT B;  4LF5 L;  4DR6 Q;  1Y8O B;  2DY8 A;  2L1B A;  4DR5 L;  3F2C A;  3GTQ B;  1PTO F;  3HOV G;  2CH4 W;  3OHX C;  3BU2 A;  3CCS A;  1KHI A;  2A68 D;  3CD6 A;  4CHT B;  3NEM A;  4DR6 L;  3RD4 A;  4BY7 B;  2VUM H;  4F87 A;  3M4Y A;  1QVG A;  2RHS B;  4IFD G;  2XSC A;  3TP6 A;  4A3L G;  3CCJ A;  1W2B A;  4R4T A;  3GTG B;  3FKI H;  1IBM Q;  4WJW A;  2JEA I;  2A5H A;  1Z47 A;  1KQS A;  4DK1 A;  4WJ3 M;  1ZYR C;  3E3X A;  4DNI A;  4QQB X;  1STG A;  1N33 Q;  4DA2 A;  5M5W B;  5JJK A;  3J81 c;  2EY2 A;  1BR9 A;  3HOU H;  1GVP A;  1X3G A;  2Q2I A;  3K5M A;  3I4N G;  4KKT A;  1XNQ L;  3A56 A;  2RSN A;  2PMZ B;  1IBM L;  5C0X I;  1DM0 B;  3T1H L;  4BA1 I;  4BY1 H;  1J5E Q;  3PMF A;  1YI2 A;  2X6G A;  4JI6 L;  1XMQ Q;  1N33 L;  2ASB A;  3NPP A;  1FL0 A;  3K6O A;  1HQM C;  4HED A;  4A3K G;  1ENA A;  5ELC A;  2IWH A;  2XTI A;  4PMW A;  3CPF A;  5IP9 H;  5JEA G;  1PFM A;  1V1Q A;  1Y8N B;  2HIV A;  1J5E L;  1S5C D;  3AB9 A;  5IYB G;  2VL6 A;  5BN4 A;  3C1E A;  3TEH B;  1JJC B;  2Z6K A;  5GAH C;  2XN9 C;  2XRQ D;  3EFX D;  2ALY B;  1QE6 A;  4FO2 A;  3Q23 A;  4BXX G;  4U67 3;  1SNQ A;  1PTO C;  1NAP A;  4EQN A;  4RCO A;  3J81 i;  3S16 B;  3F2D A;  5J22 A;  3DM1 A;  1ET6 A;  4POF A;  4QIW B;  4DAM A;  2RCN A;  4OWW B;  1WOC A;  4XT3 B;  4YWK A;  5GRO A;  3HOY H;  1IYV A;  4DKA C;  2DN8 A;  3OWE B;  1ICF B;  3W2D A;  1E7Z A;  1PRT B;  1G6Z A;  1DON A;  4ZUI A;  4JV5 Q;  3JAM c;  3GTQ H;  4DV5 Q;  4GLV B;  3NE5 B;  1SNM A;  2VS1 A;  2EPB A;  4DV7 Q;  3IAY A;  2Z1C A;  2K28 A;  2MJ8 A;  2O5I C;  4RKB A;  3UI2 A;  1K8O A;  4K0K Q;  1I94 L;  5K36 H;  1FYC A;  2EY5 A;  4DV5 L;  2NN6 H;  1EIY B;  4LF6 Q;  3CF5 A;  4IZ8 A;  2GVB A;  4FP5 D;  4JW0 A;  1FR3 A;  2L5T A;  5G3L F;  4DV7 L;  1C48 A;  1LTR D;  4GNX C;  4K0K L;  2BE5 D;  2IJ0 A;  3CKI B;  4NP5 A;  4OEM B;  3I2Z A;  4E6I A;  4GNX A;  1YHQ A;  2PW5 A;  5EGT A;  2EXZ A;  1Q12 A;  4AQY Q;  3I4M H;  2NZO A;  1TWG B;  4GLA C;  1OXT A;  4QB4 A;  3F2B A;  1I4G A;  1A2T A;  4KJN A;  1I4X A;  4RMF A;  1KLU D;  4DNT B;  1QVC A;  1B9N A;  3J7A 5;  3RZO H;  2CW0 C;  1FNU A;  1VQK A;  3S1R H;  3FMC A;  4C2M H;  4EQP A;  2EYP A;  4A93 G;  3DMU A;  4IJH A;  2EXD A;  2F0P A;  4A3J B;  2CVR A;  3GTL H;  1TT2 A;  1B2T A;  5ELE A;  1PZK D;  4DUZ Q;  1D7Q A;  1HFG A;  4A3M G;  1WD0 A;  3I4L A;  3PIP 3;  4RG1 A;  3VA7 A;  1J9O A;  1Y1W B;  4QUC A;  4AIM A;  5C3E B;  4CKE A;  4BBR B;  2KHI A;  1JE5 A;  1SRU A;  1SDF A;  4K5W A;  1D2B A;  1EWH A;  2K7V A;  4MTK A;  3M4P A;  3SXH A;  1Y1W G;  3PO3 G;  2PNR C;  1NBW A;  3W5O A;  4DUZ L;  3GTJ H;  3AFQ A;  1EIG A;  2KCT A;  3FDT A;  4BBR G;  2PI2 E;  2UU9 L;  3BZD B;  1WTP A;  1XJV A;  5DNF A;  1PMR A;  2K5D A;  3CQZ H;  2QF7 A;  2K5W A;  1DOK A;  5I9P A;  2QIL A;  4C3H B;  2ID0 A;  3HOX G;  3D8G A;  4NB3 A;  1S4Z A;  3KLS X;  4YHH L;  2UXC Q;  2PYK A;  1OXX K;  4ZQ3 A;  1VQE A;  2A73 B;  3DM3 A;  4IUT A;  2V1C C;  2C5C A;  3BYT B;  4L5R C;  4IFD H;  2UUA Q;  2F0V A;  4FF3 A;  3W1B A;  3H6M A;  1F2M A;  5LHY 1;  4KHV A;  2Z4H A;  3ERQ A;  4BY7 H;  1WJJ A;  4UHV A;  4JI2 Q;  2UXC L;  4DV2 Q;  2NZ1 D;  3WOF A;  2KEE A;  1LYL A;  2EYF A;  2ZXR A;  4IOA A;  3GTG H;  2O2L D;  4KY5 A;  2B2W C;  4A3B G;  1FVI A;  3C46 A;  2D0P A;  3TN2 A;  1WD1 A;  1N34 Q;  2OXP A;  2HDL A;  5C4Z A;  2I07 B;  2F3W A;  3RZD B;  2NVQ B;  1ZYR D;  2NN6 I;  4JI2 L;  2HIX A;  5CR3 A;  1SEB D;  2A6E C;  2EOT A;  3IKJ A;  3NQT A;  4EQ5 A;  2EYO A;  3TP8 A;  1TQO A;  1SNP A;  1BKB A;  3IFD A;  2NTT A;  1L2F A;  4B3T Q;  2PMZ E;  1I50 B;  3CAM A;  4PZ6 A;  1TKW B;  3HKZ G;  1WTX A;  1K8A C;  2DJF C;  1W3S A;  1B44 D;  5IYB H;  2R7F A;  3Q24 A;  1C9O A;  1AN8 A;  3HOW G;  4G7H C;  2QDL A;  3KBX A;  2XWJ B;  3QOJ A;  1AP0 A;  4JBK A;  3NBI A;  1LTG D;  1PH9 A;  3L3O C;  4KHZ A;  1TS2 A;  2D2C C;  4L63 B;  1K0S A;  4LFA Q;  2LY7 A;  2RQX A;  5LMN Q;  1E2V A;  1LLR D;  4H44 C;  1VQ7 A;  2JXM B;  1PTO D;  3T13 A;  2SNM A;  5KNC A;  3DWP A;  3S16 H;  3CRL C;  1SRO A;  1QUQ A;  4GZY C;  1I6H B;  1TS4 A;  2I5M X;  3D3R A;  1DCZ A;  1ESF A;  4DR7 L;  2JA7 B;  2VZA A;  3DWA A;  2YV5 A;  4NKL A;  4X62 Q;  1A62 A;  5C4X B;  3NSW A;  3MFY A;  1GUS A;  5JEA J;  2EE1 A;  2ZTE A;  2OTJ A;  3E0E A;  5EBD A;  1WTQ A;  2F4V L;  4DXF A;  4F7X A;  3OIP A;  5FLX L;  1EY4 A;  1TWA H;  5IGG A;  4A3C G;  4V19 0;  5ELB A;  3MC0 B;  3T1Y Q;  1SXT A;  1NCV A;  2L15 A;  2IHE A;  3SK4 A;  3V2T A;  3JAM E;  4QJF A;  2UXB L;  3KDF A;  2RKS A;  1CQV A;  4C3I B;  1O78 A;  1KD1 C;  4TQU S;  3H15 A;  4IFD I;  1D6E C;  1S72 A;  1XXG A;  4XQJ A;  4K14 A;  2KQ3 A;  5HGT A;  1HQR D;  3GV6 A;  4HJ7 A;  1SLJ A;  4LFB Q;  1LM0 A;  3E5S A;  1A0I A;  2K14 A;  4OON A;  1PZI D;  1VDZ A;  3P7J A;  3IRB A;  2E2J B;  4GKK Q;  3CP0 A;  4UP9 A;  1Q8K A;  4UY8 C;  4OIK A;  1STB A;  1CFM A;  1PTO B;  1TWG H;  1CK1 A;  5M3M H;  4JBM A;  3SK5 A;  1ENC A;  5CV6 A;  4EQO A;  1UE7 A;  3PCO B;  5JVG 3;  4DR2 Q;  4TVA B;  2CW0 D;  4FNF A;  2IT1 A;  3MTS A;  4O0A A;  5IIF A;  3P1H A;  1MJE A;  1N32 Q;  4A3J H;  1A2U A;  1CKN A;  3PF5 A;  1IXR A;  1S5E D;  1PH8 A;  1K83 B;  2Z0S A;  1PYS B;  2L12 A;  4DR1 Q;  3UE1 A;  3R93 A;  3CRK C;  3F2U A;  1PZJ D;  3A8J E;  4CDF C;  1I4Q A;  2DUD A;  1QWY A;  3D4R A;  5C3E H;  2Q8R E;  4DR2 L;  4LFC Q;  3OOC A;  4BBR H;  3A55 A;  1I3Q B;  4LUO A;  1II3 A;  3H0G H;  2PQA A;  2F3I A;  1KDA A;  1LT4 D;  4HCE A;  1VQ6 A;  1I4P A;  4DR1 L;  3H3V H;  3T16 A;  1T5X D;  5LMU L;  2R3Z A;  3FEW X;  5IYD G;  1X56 A;  3E0J A;  4KHP Q;  4C3H H;  1GUG A;  1U0L A;  1HJP A;  2ZTC A;  3TDQ A;  3KFU A;  4NXN L;  4JOI C;  3TS0 A;  2K5H A;  3D4W A;  4GNX B;  3CCU A;  4XQQ A;  1SJH D;  2E76 C;  4JOI A;  1U4L A;  2A6H C;  4JI1 Q;  1RJT A;  2BDO A;  4KKU A;  1EYC A;  5M5X B;  3E6Z X;  4PG3 A;  1DXM A;  1QB5 D;  1JJG A;  3FVQ A;  1MKH A;  4N8F A;  1O7Y A;  4XIG S;  4KHP L;  2M2L A;  4QCL A;  1JWS D;  1HCZ A;  1V1P A;  3GDE A;  2RA4 A;  3NWS A;  2KED A;  3RN2 A;  2E74 C;  1PFS A;  2JP1 A;  2NB0 A;  2JJQ A;  5KYL A;  2QKI C;  3VR3 A;  2DY7 A;  1BBW A;  4AYB B;  1Q82 C;  5C3X A;  1ENF A;  4DK6 C;  4K2K A;  4JI7 Q;  3L7Z C;  2X6L A;  1EQT A;  2WAQ B;  3RZD H;  2Z4I A;  2B2U A;  2ENB A;  2Q2U A;  4TKO B;  2NVQ H;  5I4D A;  3J81 L;  3U58 A;  1XMO Q;  2JA8 B;  1EY7 A;  1V9P A;  2WAC A;  1H9S B;  2A6E D;  4IUU A;  2CCZ A;  1HTP A;  2WAQ G;  3DEO A;  1TWC B;  3M4O B;  3SE0 A;  4QUF A;  3QOL A;  3D0F A;  4DAY A;  4JBJ A;  2F03 A;  1I50 H;  2RDH A;  1GM5 A;  4QGU A;  5DM7 3;  3ZJY C;  2E2H B;  3GTO H;  3CXC A;  2E8G A;  2B3G A;  1XMO L;  3LNN A;  3J7Z C;  2N49 A;  3NBH A;  5EKI A;  1HXY D;  4C1N I;  4ALP A;  1PV4 A;  5KEE A;  4OX9 L;  1FNV A;  2E5L Q;  1EQR A;  4X64 Q;  1M1K C;  3RLF A;  4KJO A;  1YNX A;  4RKL A;  2K03 A;  2KVM A;  3FHW A;  3OW2 A;  1A63 A;  3NEL A;  2XGT A;  5DEH A;  1PYB A;  4POG A;  4BBS B;  4IOC A;  4GLX A;  2F0F A;  1PHJ A;  4ZLT F;  1TS5 A;  2EYJ A;  1K8G A;  3GTM B;  1EYA A;  1A3T A;  5IWA Q;  4F88 A;  1U5K A;  2KHJ A;  2KBN A;  1I6H H;  3U4Z A;  1ASY A;  2EDG A;  4K6D A;  2LXJ A;  2VB3 X;  1HR0 Q;  2JA7 H;  2F0N A;  3FRP B;  3M3Y B;  3HRZ C;  1PH3 A;  3LX0 A;  1KLG D;  5IWA L;  5C4X H;  1DOM A;  1E2Z A;  4GOP A;  3H3V I;  1SBB B;  3I56 A;  2YU9 H;  3JAM L;  2G9D A;  4PMC A;  4B3S Q;  4DXG A;  1NR2 A;  2K01 A;  4CJ0 B;  1EFW A;  4JK1 C;  4BA2 I;  5IT9 c;  4X3U A;  3SEB A;  1IBK Q;  2BA1 A;  1HR0 L;  3CU7 A;  3J7A F;  1HH2 P;  4JI0 Q;  1Q3L A;  5JOB A;  4L5Q A;  3W3A A;  4JVZ A;  2H1E A;  3SGI A;  3N6R A;  4RH6 A;  3U9S A;  1VQ9 A;  4C3I H;  1UEB A;  5I9O A;  4Q0F A;  1LT5 D;  4JC0 A;  1SYB A;  5ELO A;  2MGS A;  2XIW A;  3Q6S A;  2B39 A;  3A7L A;  3KBG A;  1SE2 A;  3D31 A;  3T51 B;  4NXM Q;  1VQF A;  1HA5 A;  2MO0 A;  4ME5 A;  5FJ8 H;  3PF4 A;  2ES2 A;  1AH9 A;  3FPP A;  3HOV B;  1CHQ D;  1MHW C;  4UPA A;  1KDC A;  1NMF A;  1PTO H;  1F2Y A;  1KAA A;  1B7Y B;  2DNE A;  1QUQ B;  5AFW A;  1IYU A;  3ULJ A;  2JE6 I;  4NXM L;  2EYM A;  4G57 A;  3UDX A;  4DAP A;  4FVM A;  4U68 A;  3EQL C;  4B3M Q;  4A76 A;  3KLS A;  1L0X B;  1MBY A;  1LO5 D;  1K83 H;  1I4R A;  1JB3 A;  3UDI A;  5JJZ A;  2SNS A;  2RBM A;  1ZEQ X;  3I90 A;  4DNR B;  5I6Y A;  3J80 i;  3I73 A;  1I3Q H;  1CHP D;  1TVX A;  4B3M L;  3I4N B;  1HUM A;  2KHS A;  5IYD H;  1B53 A;  1TXY A;  1EZ8 A;  3OWF A;  1B8A A;  4MZ9 A;  4KLK A;  1GKH A;  1BOS A;  1VMP A;  1B4O A;  2K33 A;  1HTL D;  3MXN A;  5BN3 A;  4R4C A;  1CSP A;  5IYC H;  1FGB D;  2F0I A;  4A3K B;  1QNU A;  3BDC A;  1YZ6 A;  3ND8 A;  1F9P A;  1Q1E A;  2Y0S G;  3CMA A;  3LWE A;  1A15 A;  4N9T A;  5M5X H;  2A6H D;  4LJZ C;  5J3B A;  4IO9 A;  1K8M A;  1H9M A;  4N8X 1;  4ID6 A;  1OO9 B;  2JSO A;  4J15 A;  2K4K A;  4JI5 Q;  1BXT A;  2Z6K C;  3I91 A;  5COY A;  1XMQ L;  4P71 A;  3AQQ A;  1VQL A;  4DGZ A;  5CBE E;  4IPG A;  5C3W A;  1SYD A;  2XWB B;  3G48 A;  3SR1 A;  1AZQ A;  1DGS A;  4UAI A;  4ZRZ A;  4AYB E;  5HUR A;  3T53 B;  4O42 A;  1STH A;  1JJ2 A;  1E24 A;  4QF4 A;  1G6P A;  4DU9 A;  2EJF C;  4A3F B;  3S1Q B;  2JA8 H;  1HUN A;  1BQQ T;  1D8L A;  1X3P A;  4Y7N B;  1FGU A;  1AZP A;  1TWC H;  4JI3 Q;  4A3F G;  1GHJ A;  3Q22 A;  3PO2 B;  2CWA A;  4JI8 Q;  4G7Z C;  2EYL A;  2E2H H;  3T56 B;  5C44 B;  2KEN A;  3A7A B;  4PV1 C;  1MD2 D;  5EKL A;  1JIC A;  1STY A;  1U4P A;  1QVF A;  3PO2 G;  4JI3 L;  5K5P A;  5T1I A;  3I8Z A;  5C44 G;  5AJ3 Q;  1PLF A;  1JQY D;  1G51 A;  3SK8 A;  1CZW A;  1H95 A;  1ICW A;  2Q8T A;  4JI8 L;  3KF8 B;  1BF4 A;  4JV5 L;  4BBS H;  1BO0 A;  5FLX E;  5CGK A;  1VCI A;  3AFP A;  1HFN A;  1X65 A;  4FYD A;  3OMC A;  1V1P B;  3GTM H;  4OHJ A;  1VS0 A;  4QY7 A;  2N8N A;  1LTB D;  2NZH A;  4PZ8 A;  5AJ3 L;  1Y8P B;  2WB1 G;  2JA6 B;  3ERS X;  2K6A A;  5EPK A;  3PSI A;  5EJW A;  5IOD A;  4LF6 L;  2L4N A;  3CCM A;  2IX1 A;  1KAB A;  1Z7T A;  2JA6 G;  3M3Y H;  4A93 B;  2BH2 A;  2F1M A;  3A74 A;  4QMG A;  4RGO S;  3D6C A;  3EIV A;  4L6T B;  4A3E B;  1EOT A;  2BH8 A;  4C3J G;  1K3B C;  1E0B A;  1PDQ A;  4A3M B;  5D3D A;  3F1Z A;  3ULL A;  3BVG A;  5C4J B;  1XYI A;  2K32 A;  4AQY L;  5M5Y B;  4A3E G;  4BS9 A;  5NUC A;  3PIO 3;  3NTI A;  1N9W A;  3MWY W;  1ET9 A;  1OXV A;  1J8I A;  1F9R A;  1KXL A;  2QA4 A;  3PO3 B;  3VYR A;  4J8Q A;  5IT9 E;  2VB2 X;  4HMI A;  1D5Z C;  2KCC A;  4LF4 Q;  5JVH 3;  3RN5 A;  4H13 C;  3KUP A;  1YBY A;  2R6G A;  3Q8D A;  3SK6 A;  1M8A A;  3OPO A;  1MI2 A;  5E7N A;  1C8C A;  4UDU C;  5A2Q E;  2R93 B;  1RHP A;  1KTK A;  3HOX B;  5GAD C;  3DEP A;  1LUZ A;  2UUC Q;  4B08 A;  1SFO B;  2R93 G;  3HOV H;  1Y1V B;  4LF4 L;  1GUW A;  4A3I G;  1HNW Q;  2F3V A;  3PUV A;  3TRZ A;  3NTH A;  1V8Q A;  1Y1V G;  4ILW A;  3KF6 A;  5I2X A;  1DYQ A;  2UUC L;  1KRS A;  1WFQ A;  4G7O C;  1K28 A;  1W6J A;  2QCP X;  1CZG A;  1CT1 D;  2JA5 G;  3K59 A;  3ND9 A;  1E1O A;  1HNW L;  1NSN S;  2KUM A;  4A3L H;  5I6W A;  2WP8 J;  2D5D A;  4A3B B;  1LTL A;  4GKJ Q;  2BCO A;  3X3M A;  1C4Q A;  2I5L X;  4OEL B;  1D5M C;  3I4N H;  3CCQ A;  2UUA L;  1TS3 A;  4HID A;  1DZ1 A;  1EZ6 A;  3CPW A;  3D6W A;  3NTK A;  1HZA A;  5LL6 S;  3I3C A;  2JK8 A;  4TRD A;  3DHQ A;  2NVY B;  2F0U A;  4KTA A;  3BZK A;  1IKL A;  4P2C B;  5M5W H;  4OL7 A;  4K5V A;  2OF1 A;  4DV2 L;  4IPH A;  4HSV A;  3L9A X;  3BDL A;  2X69 A;  3HKZ B;  4DV1 Q;  3I70 A;  1YNJ C;  1KIX A;  4A3K H;  1HZ9 A;  3A8K E;  1PH2 A;  2F0H A;  2ZXO A;  1N34 L;  2XVS A;  3J81 E;  2YYZ A;  3S24 A;  5CV7 A;  3HOW B;  2ZJP A;  1BVS A;  5JPN C;  5JEA H;  2E2D C;  1E2W A;  1WCM G;  3M7G A;  2L0C A;  5KYI A;  3GV3 A;  1CI3 M;  4DV1 L;  2HCI A;  4KKS A;  4RA8 A;  2VQE Q;  2VW9 A;  4BXX H;  4B3T L;  5KIX A;  1IHZ A;  2F0J A;  2A74 C;  2F0O A;  1XPR A;  4JPB W;  1YIJ A;  1I6V C;  1CM9 A;  2VQE L;  4V0B A;  4K2L A;  3PQI A;  2YTY A;  1PFB A;  4P73 A;  4KI0 A;  4HR7 B;  2PI2 A;  3TZD A;  4K6L A;  1VQ5 A;  1PXU A;  3S1Q H;  1JWM D;  3ITP A;  3K5L A;  5IP7 G;  2F0S A;  3I55 A;  4QIW E;  4LFA L;  5LMN L;  4LMQ D;  2F0M A;  1N8R C;  2ZT9 C;  4HAE A;  2IHF A;  2K75 A;  4XT1 B;  3LWU A;  3PO2 H;  2Z9H A;  1TY2 A;  2BA0 A;  4B3R Q;  1TII D;  4GN3 B;  5C44 H;  2PZW A;  3MXN B;  1KDB A;  1B3A A;  1GJX A;  1LAB A;  3DWQ A;  3KLR A;  4NPS A;  2AKW B;  3IL8 A;  1EL0 A;  1IKM A;  3G71 A;  3J7Y W;  2TSS A;  5C0X G;  5EPJ A;  2MP1 A;  1CKO A;  4CKB A;  4X62 L;  4KK7 A;  4DV4 Q;  3WOE A;  1IL2 A;  3G4S A;  4UP7 A;  3NK9 A;  1ILP A;  1HA6 A;  3DXJ C;  4R8I A;  3C2P A;  4KD3 A;  1D1I A;  2WV6 D;  2FMM A;  1PRT F;  3EJI A;  1TWH B;  4OO1 G;  4IPC A;  1AW7 A;  3GTK B;  3WWV A;  4ZKB B;  2NWG A;  1QCB D;  3T1Y L;  2O5J C;  4ZCK A;  1UE5 A;  2VQF Q;  1OXU A;  1STN A;  3CC2 A;  2A19 A;  2JA6 H;  2F0T A;  4GN5 A;  3MXU A;  2HHH Q;  5HY6 A;  1HNZ Q;  2SOB A;  1NE3 A;  4YIJ A;  4A93 H;  1EOV A;  2H5X A;  3AYH B;  4DK0 A;  2J4X A;  3O13 A;  4LFB L;  4A3M H;  1WTW A;  1BNZ A;  3TSS A;  5IT9 L;  5C4J H;  1WI5 A;  1X3Q A;  3BYY B;  3K8A A;  2HHH L;  3CME A;  4GKK L;  1HNZ L;  4RWS C;  5GQO A;  2GVA A;  5M5Y H;  4R4I A;  3HP3 A;  4P72 A;  1XTC D;  5A2Q L;  1VQA A;  4I7Z C;  4L8J A;  5EAY A;  1HHV A;  1EY0 A;  3PO3 H;  1W6K A;  1Y1W H;  3VYT A;  1DOL A;  1N32 L;  4PMB A;  4CDD C;  3AU7 A;  3AMU A;  4RAU C;  4XXE A;  5D3I B;  1LT6 D;  5KNB A;  1HPC A;  3HOX H;  4LUZ A;  1JMC A;  4HIK A;  4LFC L;  1AEX A;  1SFO H;  4EX5 A;  1Y1V H;  1NJI C;  3IFT A;  5CYU A;  5GAG C;  3I72 A;  2G9H D;  2YTX A;  3K7U C;  3K0Y A;  1WTR A;  1B1Z A;  1K9M C;  2OT2 A;  2VUM G;  3HG9 A;  5A35 A;  4A3G B;  1E3P A;  1KNE A;  1RL2 A;  1X55 A;  3KJP A;  2B8F A;  5IE8 A;  1XTD A;  5E4X A;  3MXP A;  3FKI G;  5G3L D;  2EVB A;  1EU3 A;  2KJX A;  2KA7 A;  4A3G G;  2EJG C;  3ER0 A;  4MHE A;  4DK3 C;  4EGV A;  5KGU A;  1YJ9 A;  2M00 A;  4A3B H;  2A69 D;  3LGJ A;  4ZAI A;  4JI1 L;  2FIN B;  3V05 A;  1EWI A;  1XPU A;  1NMG A;  3WDN A;  1RF2 D;  5EBC A;  4IAL A;  3PUZ A;  2AUK A;  2B2V A;  3BVM A;  3GD7 A;  3NP8 A;  5FK9 C;  3RLO A;  2GN5 A;  4LWC A;  2B2U C;  4OXP A;  3F8T A;  2NVY H;  2F0D A;  4A3D B;  4ZYS A;  3ERO A;  3GQB A;  1CA6 A;  2A1A A;  1UUP A;  2NYZ D;  5EKK A;  5IP9 G;  1A3U A;  3DUZ A;  1YNJ D;  2K52 A;  3U9O A;  1PH7 A;  3HKZ E;  3M7N A;  4A3D G;  4JI7 L;  4DR3 Q;  1O80 A;  1YHB A;  3HOW H;  1JT8 A;  4R8N A;  3BS1 A;  1Q81 C;  5IGB A;  1P16 A;  3N52 A;  3BDO A;  1TWF B;  3CCL A;  4S3S A;  2G5D A;  2UXD Q;  4LF8 Q;  4R4O A;  2PCF B;  4JG2 A;  4YCU A;  4ABN A;  2F0L A;  3KF6 B;  3TZU A;  3PUW A;  4IUP A;  3W1G A;  3NXW A;  2K1B A;  4GS3 A;  2WKC A;  2QEJ C;  4DR3 L;  4HCS A;  4PQX A;  2K5N A;  3BG3 A;  3HOY G;  2XNA C;  1YHA A;  3PUX A;  3UDG A;  2E5L L;  1EY5 A;  1NNX A;  4X64 L;  2RDG A;  1BDO A;  3PUY A;  5KRU A;  3K5O A;  4RGN A;  1R4Q B;  5E1F A;  5BN5 A;  1VQC A;  1GUO A;  3GO5 A;  5JPM C;  2FJ2 A;  4GOP C;  3GTP B;  1HZC A;  4IUV A;  4BWG B;  4H02 A;  2FFK B;  4A3C H;  1BCP F;  3STB C;  4KV6 A;  5CV5 A;  1LTS D;  5K36 G;  1S5D D;  1CSQ A;  1X3F A;  1IW7 C;  2NN6 G;  1EUJ A;  5HGQ A;  2L55 A;  3A5Z B;  3TQY A;  2R7D A;  3Q0A A;  4DF7 A;  2NVX B;  1XWE A;  2KCM A;  4IPD A;  1SAP A;  2QDB A;  1V1O A;  1SE4 A;  4HIO A;  1IYJ B;  2C9O A;  1CKM A;  2K5Q A;  1SE8 A;  1NUC A;  2IL8 A;  2R61 A;  4DN4 M;  1Y14 B;  3S2D B;  3G7L A;  4B3S L;  2AQ1 B;  2N78 A;  4Z9C B;  1TWH H;  1RTN A;  1IBK L;  2QGQ A;  1IBL Q;  4X66 Q;  3R2I A;  3K0X A;  4XYQ A;  5J1Z A;  3EN2 A;  3GTK H;  2KOL A;  2PW7 A;  4FXK C;  4JI0 L;  3J80 c;  2B2T C;  2CWP A;  4N9P A;  4DV0 Q;  2B2T A;  1T9H A;  5M3F B;  1Q86 C;  2E2J H;  4LF9 Q;  3L2P A;  1GD7 A;  4Q5V A;  2CFM A;  5DLQ E;  1YJN A;  2D0O A;  4RHS A;  4WFN 3;  4X66 L;  1RIP A;  5M3F G;  3HFZ B;  2EQS A;  1KC8 C;  5C0X J;  5FO9 B;  2LFN A;  4DV0 L;  3R2T A;  2ZM6 Q;  4RGT A;  1EEF D;  2EY1 A;  3CQZ B;  1VQN A;  3K57 A;  4I65 A;  1VMC A;  2O4X A;  2NVT B;  1GXD C;  1SMY C;  2Q2T A;  4I7A A;  4FXD A;  2EY6 A;  3M85 A;  3S17 B;  3K7A B;  5C5L A;  2D9U A;  2PQE A;  1UWV A;  2ZM6 L;  2WKD A;  4IUQ A;  4IUR A;  2EJM A;  1BCP C;  2AHO B;  3TBI B;  3KDF B;  1X6O A;  4YCV A;  1R9T B;  5F2D A;  4DUY Q;  2Y0S B;  2IW3 A;  2P5Z X;  4A75 A;  1EWC A;  5C4H A;  2HDM A;  2FMC A;  2LSS A;  1A3V A;  1VQ4 A;  3MHB A;  3CCR A;  1JR0 D;  1B50 A;  1XNQ Q;  5CV8 A;  2F0G A;  4HMJ A;  4P75 A;  4EVO A;  4BY7 G;  4KY6 A;  3T1H Q;  4A3G H;  1EY6 A;  5D14 A;  1C0A A;  4JI6 Q;  1K0R A;  5CC4 A;  1R4P B;  4DAV A;  2HQE A;  1PRT D;  4J6H A;  2AUJ D;  4DUY L;  4OGQ C;  3MAQ A;  3UDF A;  1EYG A;  4KD4 A;  1JOK A;  5FLM G;  4A4I A;  5J39 A;  1XPO A;  3BZC A;  3KYH C;  5ISR A;  1NTG A;  1M90 C;  3D4D A;  4YCW A;  1CKN B;  3M4Q A;  3R3O A;  3E9I A;  3U4V A;  4CDE C;  2QEX A;  3CW2 C;  4K5X A;  4OO1 I;  3NQI A;  1GHK A;  1JE4 A;  4XYO A;  4X65 Q;  4JI5 L;  3QO2 A;  2N55 A;  4G4K A;  4A3D H;  2WAQ E;  1GOZ A;  3PV0 A;  1MSH A;  2RVL A;  1XX8 A;  2ICI A;  4R1J A;  3SDZ A;  2J7Z A;  1EQQ A;  2PQA B;  5FO8 B;  3M4O H;  4KMU C;  2L9H A;  3TRE A;  1VF7 A;  1HNX Q;  1BUV T;  1VQB A;  2RHQ B;  3OTO Q;  3K80 C;  1Z6H A;  1WTH A;  4X65 L;  1J6Q A;  1EU4 A;  1V43 A;  5JJL A;  1HZB A;  1TWF H;  1E22 A;  1SYC A;  3C1F A;  3K58 A;  4L5S A;  1VQP A;  1G2T A;  3DLL A;  2PO4 A;  1JCK B;  1HNX L;  1I94 Q;  1STA A;  3GP7 A;  3OTO L;  2LKV A;  2MFI A;  1B70 B;  2B29 A;  2WB1 B;  4DR4 Q;  1ASZ A;  2M9V A;  2JN4 A;  4APV A;  4P74 A;  3BJU A;  2YTV A;  1TWA B;  4KN4 C;  1DJR D;  2AQ3 B;  4AH6 A;  1SND A;  1B9M A;  1I5F A;  1PH1 A;  4KY7 A;  5KND A;  1FD7 D;  4NMZ A;  2OWO A;  4IJL A;  2CQA A;  3KK7 A;  2WIN B;  4L5T A;  1KRT A;  4C3J B;  4DR4 L;  1VF5 C;  1RKN A;  2MQH A;  2F0Q A;  3P75 A;  2PZU A;  3GTP H;  3HKS A;  1VQH A;  2PZT A;  3TP5 A;  2NTS A;  4IN3 A;  3STB D;  1YVC A;  2R92 B;  2OQ0 A;  1Y69 U;  1D5X C;  1IW7 D;  1UAP A;  1O7I A;  5IY0 A;  2NVX H;  1H9K A;  2Q8I B;  1Q7Y C;  4DAY B;  1RDP D;  2R92 G;  1LAC A;  5CV9 A;  5BR8 Q;  1Z9F A;  4OIJ A;  2XRS D;  1FJG Q;  3G6J B;  5ELN A;  2ATW A;  1X54 A;  5M3M B;  3JAM i;  1SN8 A;  4OWX B;  1RTO A;  3NBH B;  2E75 C;  5E3F A;  3B6Y A;  3S2D H;  1GUT A;  3NWT A;  2RDF A;  1UE1 A;  3HS0 C;  3HZX A;  4C1N K;  1C7Y A;  5M3M G;  5IGC A;  5CMD A;  4A3I B;  3MZ5 A;  5BR8 L;  5D65 A;  1FJG L;  3HOZ B;  3MVV A;  1QG7 A;  1F2Z A;  2UU9 Q;  5M3F H;  4A3J G;  3CCE A;  1UNS A;  2WFW A;  5M9O A;  3K81 C;  3ICE A;  2DNC A;  3HOZ G;  4X6A H;  3J80 E;  3NUC A;  3E9H A;  3H09 A;  4NDX A;  1H9S A;  2K05 A;  4NW2 A;  5FOB B;  2JA5 B;  3H0G B;  5C3E G;  1IL8 A;  4YHH Q;  1AE3 A;  4MNO A;  1H9R A;  5T1G A;  1SE3 A;  1VQJ A;  3S1N B;  4GOP B;  1QJO A;  2NVT H;  3H0G G;  1JC7 A;  1O7Z A;  3SHL A;  1PH6 A;  3QB3 A;  1G8Z D;  5CBA E;  2A69 C;  1SMY D;  2JEB I;  4MIU A;  3S17 H;  3K7A H;  3VR5 A;  1TU2 B;  2JYO A;  2HD3 A;  3RR5 A;  2J0T D;  1K3R A;  1ZKO A;  1QOH A;  4C3H G;  4LW1 A;  3H91 A;  4HSP A;  3ZYY X;  4LK1 C;  2F0E A;  5H1S E;  1BCP D;  1ML0 D;  3CCV A;  4WRD A;  3S14 B;  1R9T H;  2EYH A;  1S5B D;  1WTO A;  4B9X A;  4GKJ L;  1L0W A;  3QR8 A;  1WYD A;  2Y0S E;  1A8V A;  4UP8 A;  1QNK A;  4WJ4 A;  1WCM B;  4PZ7 A;  4RHR A;  4FF4 A;  4ULL A;  2BOS A;  4JBW A;  2Z6B A;  4K8J A;  3I7F A;  2QW7 A;  2B2W A;  5FLM H;  4XDX A;  1LV9 A;  4FXG C;  1EYD A;  2NBF A;  3SVM A;  4J1M A;  3VR4 A;  1Q1B A;  3S1M B;  3MXG A;  1G2S A;  1JOR A;  5DM6 3;  1L0Y B;  2EIF A;  1VQD A;  3TS2 A;  2F0K A;  2CKZ B;  3GTO B;  2MPM A;  4IFD J;  4CJ2 C;  1VQM A;  2I46 A;  3S15 B;  4ODG A;  1Q46 A;  1LTI D;  5E4W C;  4A3F H;  1SJE D;  1G91 A;  1STE A;  1EY9 A;  3HEJ A;  4H0L C;  4Y7N H;  1KAW A;  1YIT A;  2AMC B;  1L1O C;  1EQV A;  1BCP B;  4DR7 Q;  3U50 C;  1L1O A;  4FDB A;  3V96 A;  1EEI D;  2HUG A;  4FF1 A;  3H94 A;  1VQG A;  2AQ2 B;  3T4A C;  4O2D A;  2SDF A;  3NEN A;  5EQ0 A;  1U4R A;  3KJO A;  5LMN W;  2EZV A;  1PA6 A;  1SNC A;  2F4V Q;  4GN4 B;  2I5H A;  2MUY A;  2R7Z B;  3S2H B;  2B63 B;  2I0Q A;  3OMG A;  1SNO A;  1VQI A;  1ILQ A;  2V4D A;  4B3R L;  3G6E A;  4X3T A;  2OCE A;  2UXB Q;  1BBX C;  1SYG A;  2YU9 B;  1ZXT A;  3CC7 A;  2OTL A;  3OSO A;  2R7Z G;  2JA7 G;  1TR5 A;  2B63 G;  2A8V A;  1YNN C;  2OEO A;  2WB1 E;  3X3N A;  5CV4 A;  2E2I B;  5C4X G;  4X3S A;  1PYW D;  4DV4 L;  2KEC A;  2UUB Q;  1AE2 A;  1CQF A;  5FO7 B;  2B2Y C;  2B8G A;  4C3J H;  2K50 A;  1CTM A;  2B2Y A;  1RCV D;  2FHT A;  4HIM A;  1PH4 A;  2JQO A;  3NHH A;  2AWN A;  4O1N A;  1ROD A;  1MIU A;  3TME A;  5IOC A;  2VQF L;  3EA6 A;  2VNU D;  4A3E H;  2HT1 A;  3C3L A;  4C3I G;  4FF2 A;  1PVO A;  3M9B A;  1LTA D;  2R92 H;  1X3E A;  2UUB L;  1B3Q A;  2ZJQ A;  3OIQ A;  1S40 A;  4DPG A;  1EIF A;  1T5E A;  1ESR A;  2MHV A;  4M8A A;  4ZK9 B;  5LL6 X;  1O7L A;  3RNU A;  1WTV A;  1Q90 A;  1U9R A;  3OYY A;  5FJ8 G;  4RCN A;  1EIH A;  4K8I A;  2A68 C;  3AEV A;  4XTC S;  1TY0 A;  2R93 H;  3J81 j;  3A0J A;  3J80 L;  2CQO A;  1QZG A;  1SYE A;  4A3I H;  4Y52 H;  2MO1 A;  1KNA A;  2F52 A;  3HOZ H;  3UE0 A;  4LF7 Q;  2AWO A;  2KCN A;  3CC4 A;  1MJC A;  2VUM B;  3VDY A;  2C35 B;  1LTT D;  2DGY A;  3MA2 B;  4CDC C;  1UE6 A;  5LMU Q;  2L11 A;  5IGD A;  4HTH A;  1GUN A;  1M4V A;  1VQ8 A;  2RSO A;  3FKI B;  3OW7 A;  1YEZ A;  2HQL A;  2JA5 H;  4CGY B;  4NXN Q;  2PNH A;  1MSG A;  1PRT C;  1LT3 D;  4QL5 A;  3A8I E;  1OXS C;  1G29 1;  4LF7 L;  1UEA B;  4PNY A;  3MFG A;  5COR A;  1A6X A;  3HOU B;  4RFB A;  1RD9 D;  3QG1 A;  3S1N H;  4WOR A;  1WVL A;  2SEB D;  2VXW A;  3BVZ A;  2IY5 B;  1PFN A;  4BY1 B;  3HOU G;  2B2V C;  2ZJR A;  3VA5 A;  3MEF A;  1Q8I A;  3KLW A;  3FP9 A;  1N36 Q;  3QJY A;  2HCC A;  4CBV A;  4CKC A;  5IYC G;  1SR3 A;  3KF8 A;  4BY1 G;  2RF4 A;  3S9W A;  4HJA A;  2D62 A;  2ZXP A;  4DV6 Q;  1VQO A;  3S14 H;  4MN3 A;  3EVQ A;  2BDN A;  4XQN A;  1IZ6 A;  1S3O A;  4LAA A;  1JWU D;  1SYF A;  3ONA B;  2RCF A;  2VY3 A;  1N36 L;  1CA5 A;  3R8B A;  3P20 A;  5DAU A;  1WCM H;  1U4M A;  5IGE A;  3URY A;  2LMC B;  4KN7 C;  5EPL A;  3CHB D;  2DJG C;  2F0W A;  3A54 A;  4DV6 L;  3RMH A;  1EFI D;  1AFP A;  4JYA Q;  1HRJ A;  4AYB G;  2IPK D;  4H7B A;  4HJ5 A;  4OX9 Q;  2N3S A;  3HOY B;  4ZUJ A;  2IX3 A;  2ICE C;  3S1M H;  3EBE A;  1X32 A;  3PGZ A;  1F2L A;  1QIL A;  5ELD A;  2JA8 G;  5ELF A;  4ME3 A;  4YWM A;  4JYA L; 
#chains in the Genus database with same CATH homology
 4DUY L;  1KD1 C;  4LF4 L;  4TQU S;  3HOV H;  2UXD L;  4LF8 L;  2ZTD A;  3H15 A;  4A3I G;  4IFD I;  5IP7 H;  3UDF A;  1S72 A;  5FLX c;  1HNW Q;  3ULP A;  1EYG A;  4YY3 Q;  5FLM G;  4A4I A;  1XPO A;  2FXQ A;  1QZH A;  3S15 H;  3PUV A;  1JB7 A;  3BZC A;  3KYH C;  3A5U A;  3TRZ A;  1Y1V G;  4HJ7 A;  3KF6 A;  1SLJ A;  4LFB Q;  1LM0 A;  1NTG A;  1M90 C;  4YCW A;  1A0I A;  2K14 A;  1CKN B;  4OON A;  1KRS A;  1WFQ A;  2UUC L;  3M4Q A;  3IRB A;  4JI4 Q;  4GKK Q;  3E9I A;  3U4V A;  3CP0 A;  4UP9 A;  1Q8K A;  2JA5 G;  4UY8 C;  4DV3 Q;  2QEX A;  1E1O A;  3CW2 C;  4HJ9 A;  1HNW L;  4OO1 I;  1TWG H;  4A3L H;  4YY3 L;  5M3M H;  4JBM A;  1PH5 A;  4BBS G;  1NY4 A;  2WP8 J;  3I4O A;  4X65 Q;  4JI5 L;  1KL9 A;  1LTL A;  1UE7 A;  3PCO B;  4LUV A;  4GKJ Q;  4A3D H;  4DR2 Q;  4TVA B;  2WAQ E;  2IT1 A;  3PV0 A;  4O0A A;  3KOJ A;  4R1J A;  1MJE A;  2I5L X;  4A3J H;  1SMX A;  1EQQ A;  4JI4 L;  2PQA B;  1N32 Q;  3M4O H;  5JJI A;  1CKN A;  4MTN A;  3TRE A;  4DV3 L;  3PF5 A;  1X9N A;  2B63 H;  1IXR A;  2R7Z H;  3I4N H;  3CCQ A;  2UUA L;  4HID A;  2MNA A;  4JCV E;  4R4Q A;  2OQK A;  5GAE C;  2Z0S A;  3CPW A;  1VQB A;  2RHQ B;  1HNX Q;  1HZA A;  3OTO Q;  1PYS B;  3K80 C;  2JK8 A;  4DR1 Q;  3BZK A;  2Q2H A;  3UE1 A;  1J6Q A;  1V43 A;  5M5W H;  4X65 L;  3I4M G;  5JJL A;  1HR0 W;  4LFC Q;  1HZB A;  2DUD A;  5C3E H;  4IPH A;  4DV2 L;  1TWF H;  4DR2 L;  4BBR H;  3RLN A;  1E22 A;  1OTC A;  2E2I H;  4L5S A;  1VQP A;  4DV1 Q;  1KIX A;  2IX0 A;  3DLL A;  4A3K H;  1HZ9 A;  4LUO A;  1PH2 A;  4LNQ A;  1P8L A;  3H0G H;  1N34 L;  2PQA A;  1HNX L;  1XNR Q;  2F3I A;  1I94 Q;  2YYZ A;  3S24 A;  3PIO A;  3OTO L;  1VQ6 A;  2MFI A;  1PH8 A;  4DR1 L;  2ZJP A;  3H3V H;  1BVS A;  1B70 B;  2B29 A;  3L0O A;  3PIP A;  4DR4 Q;  1E1T A;  5LMU L;  1ASZ A;  1WCM G;  5IYD G;  1X56 A;  2LXK A;  4APV A;  1IBL L;  4KHP Q;  4P74 A;  4C3H H;  3BJU A;  2YTV A;  1U0L A;  4DV1 L;  1HJP A;  2ZTC A;  4LF5 Q;  4AH6 A;  3KFU A;  4NXN L;  4HJ8 A;  4JOI C;  2JA9 A;  2K5H A;  2K5V A;  2VW9 A;  2VQE Q;  4DR5 Q;  3TS0 A;  1BBU A;  4BXX H;  1I5F A;  4GNX B;  1PH1 A;  3CCU A;  3JC6 6;  4B3T L;  1XNR L;  4JOI A;  4YWL A;  2OWO A;  4IJL A;  4JI1 Q;  1CUK A;  4PG3 A;  4L5T A;  1KRT A;  1K73 C;  1L1O B;  4LF9 L;  4DR4 L;  2MQH A;  1JJG A;  1MKH A;  1YJW A;  1XPR A;  1YIJ A;  4KHP L;  4XIG S;  3GTP H;  1GO3 E;  1VQH A;  3HKS A;  4OWT B;  4LF5 L;  4DR6 Q;  3GDE A;  2VQE L;  3RN2 A;  4DR5 L;  3STB D;  4P73 A;  2YTY A;  3F2C A;  1YVC A;  3HOV G;  2OQ0 A;  4KI0 A;  2PI2 A;  1VQ5 A;  3S1Q H;  1PFS A;  3BU2 A;  5IP7 G;  2JJQ A;  3CCS A;  3I55 A;  1KHI A;  1O7I A;  5IY0 A;  2NVX H;  4QIW E;  3CD6 A;  1BBW A;  1Q7Y C;  5LMN L;  4LFA L;  4DAY B;  1Q82 C;  2R92 G;  1N8R C;  5BR8 Q;  1Z9F A;  4DK6 C;  1FJG Q;  5ELN A;  2ATW A;  3NEM A;  1X54 A;  2IHF A;  2K75 A;  3L7Z C;  4JI7 Q;  3JAM i;  3PO2 H;  1SN8 A;  4OWX B;  4DR6 L;  3NBH B;  2BA0 A;  4B3R Q;  3RZD H;  2Q2U A;  2VUM H;  3B6Y A;  4GN3 B;  5C44 H;  3U58 A;  1QVG A;  2NVQ H;  1XMO Q;  3S2D H;  1V9P A;  2RHS B;  3MXN B;  4IFD G;  4NPS A;  1UE1 A;  1C7Y A;  2CCZ A;  4A3L G;  2AKW B;  5M3M G;  3CCJ A;  1W2B A;  4R4T A;  3G71 A;  2WAQ G;  3FKI H;  1IBM Q;  5C0X G;  2JEA I;  1CKO A;  4X62 L;  5BR8 L;  4DV4 Q;  1IL2 A;  1FJG L;  3G4S A;  1Z47 A;  3D0F A;  4JBJ A;  4UP7 A;  1KQS A;  1I50 H;  4WJ3 M;  1GM5 A;  4QGU A;  2UU9 Q;  5M3F H;  3ZJY C;  4DNI A;  4QQB X;  1N33 Q;  4A3J G;  3CXC A;  3CCE A;  2E8G A;  3GTO H;  2B3G A;  5JJK A;  3J81 c;  1XMO L;  3J7Z C;  3HOU H;  2N49 A;  1GVP A;  1X3G A;  2Q2I A;  2WFW A;  3K81 C;  4ALP A;  1PV4 A;  3I4N G;  4IPC A;  4OX9 L;  3HOZ G;  4OO1 G;  4X6A H;  2E5L Q;  1EQR A;  4X64 Q;  3E9H A;  1M1K C;  1XNQ L;  3RLF A;  3WWV A;  1YNX A;  3T1Y L;  1IBM L;  3FHW A;  1UE5 A;  2VQF Q;  5C0X I;  1OXU A;  4BY1 H;  3T1H L;  4BA1 I;  3OW2 A;  1J5E Q;  3CC2 A;  2A19 A;  5C3E G;  4GN5 A;  2JA6 H;  3ICE A;  3NEL A;  4YHH Q;  1A63 A;  4JI6 L;  2XGT A;  1AE3 A;  1PYB A;  1YI2 A;  4POG A;  1XMQ Q;  4MNO A;  4IOC A;  2HHH Q;  1N33 L;  5HY6 A;  4GLX A;  1PHJ A;  1HNZ Q;  2ASB A;  1FL0 A;  1NE3 A;  1VQJ A;  4A3K G;  4GOP B;  4A93 H;  2NVT H;  2XTI A;  3H0G G;  1K8G A;  1EOV A;  2H5X A;  4PMW A;  3AYH B;  5IWA Q;  1PH6 A;  3CPF A;  2JEB I;  5IP9 H;  1U5K A;  5JEA G;  2KHJ A;  3S17 H;  1V1Q A;  3K7A H;  2HIV A;  1J5E L;  2KBN A;  4LFB L;  4A3M H;  1I6H H;  3U4Z A;  2VL6 A;  3RR5 A;  5IYB G;  5C4J H;  1K3R A;  1WI5 A;  3K8A A;  4LW1 A;  2HHH L;  3TEH B;  3CME A;  1JJC B;  2Z6K A;  1ASY A;  1HNZ L;  5GAH C;  5GQO A;  2GVA A;  2LXJ A;  5H1S E;  4GKK L;  1HR0 Q;  5M5Y H;  4R4I A;  2JA7 H;  2ALY B;  4BXX G;  4P72 A;  3CCV A;  1VQA A;  1PH3 A;  5IWA L;  5C4X H;  5EAY A;  3J81 i;  4GOP A;  1R9T H;  3H3V I;  3F2D A;  3PO3 H;  3I56 A;  1Y1W H;  2YU9 H;  4GKJ L;  4POF A;  4B3S Q;  4BA2 I;  4DAM A;  2RCN A;  1L0W A;  1EFW A;  4OWW B;  5IT9 c;  1WOC A;  1N32 L;  1WYD A;  1IBK Q;  4YWK A;  5GRO A;  2Y0S E;  1A8V A;  2BA1 A;  4UP8 A;  4DKA C;  3HOY H;  4WJ4 A;  4PZ7 A;  1HR0 L;  1HH2 P;  4JI0 Q;  3HOX H;  1E7Z A;  4JBW A;  3I7F A;  4L5Q A;  4LUZ A;  3SGI A;  1JMC A;  5FLM H;  4HIK A;  4JV5 Q;  1VQ9 A;  4C3I H;  3JAM c;  3GTQ H;  4LFC L;  1UEB A;  4DV5 Q;  1SFO H;  4GLV B;  4EX5 A;  1Y1V H;  4JC0 A;  1NJI C;  5ELO A;  5GAG C;  2YTX A;  2VS1 A;  3K7U C;  4DV7 Q;  1Q1B A;  1K9M C;  2VUM G;  4K0K Q;  1I94 L;  2EIF A;  1E3P A;  3D31 A;  1VQD A;  1RL2 A;  4NXM Q;  1VQF A;  1X55 A;  3TS2 A;  3KJP A;  5IE8 A;  2MO0 A;  5FJ8 H;  3PF4 A;  2ES2 A;  1XTD A;  2CKZ B;  1AH9 A;  1EIY B;  4DV5 L;  3FKI G;  4LF6 Q;  4UPA A;  3CF5 A;  4IFD J;  4A3G G;  2GVB A;  1VQM A;  1NMF A;  3ER0 A;  1B7Y B;  4DK3 C;  4DV7 L;  1QUQ B;  1Q46 A;  1YJ9 A;  4A3F H;  4GNX C;  4A3B H;  4K0K L;  3LGJ A;  3ULJ A;  2JE6 I;  4NXM L;  4JI1 L;  4GNX A;  1XPU A;  1EWI A;  3I2Z A;  1NMG A;  3UDX A;  1KAW A;  4Y7N H;  1YIT A;  1YHQ A;  2AMC B;  3PUZ A;  1L1O C;  1Q12 A;  4AQY Q;  3GD7 A;  3I4M H;  4DR7 Q;  3U50 C;  1L1O A;  4A76 A;  4B3M Q;  2NZO A;  4FDB A;  3RLO A;  2GN5 A;  4GLA C;  4LWC A;  1K83 H;  1VQG A;  1OXT A;  4OXP A;  3F2B A;  4O2D A;  3UDI A;  3F8T A;  3NEN A;  4RMF A;  2NVY H;  1QVC A;  3J7A 5;  3KJO A;  3RZO H;  1VQK A;  3S1R H;  4C2M H;  5LMN W;  3S2H H;  1PA6 A;  2F4V Q;  4A93 G;  4IJH A;  2A1A A;  2EXD A;  3J80 i;  3GTL H;  1I3Q H;  5IP9 G;  4GN4 B;  2I5H A;  4B3M L;  2K52 A;  2I0Q A;  1PH7 A;  3HKZ E;  4DUZ Q;  3M7N A;  4A3M G;  4A3D G;  5IYD H;  4JI7 L;  1D7Q A;  4DR3 Q;  1TXY A;  1VQI A;  1YHB A;  4B3R L;  3HOW H;  4RG1 A;  1B8A A;  3G6E A;  2OCE A;  4MZ9 A;  2UXB Q;  1JT8 A;  4KLK A;  1GKH A;  1Q81 C;  2OTL A;  3CC7 A;  4AIM A;  1P16 A;  2R7Z G;  2JA7 G;  2B63 G;  3CCL A;  2KHI A;  2UXD Q;  2A8V A;  1JE5 A;  1SRU A;  4LF8 Q;  2WB1 E;  4R4O A;  4JG2 A;  5C4X G;  4YCU A;  4R4C A;  1CSP A;  5IYC H;  3M4P A;  3KF6 B;  3PUW A;  1Y1W G;  3PO3 G;  3W1G A;  4DV4 L;  1NBW A;  1YZ6 A;  3W5O A;  4GS3 A;  4DUZ L;  3GTJ H;  1Q1E A;  3AFQ A;  2KCT A;  2Y0S G;  4DR3 L;  4BBR G;  3CMA A;  2PI2 E;  2UUB Q;  1AE2 A;  2UU9 L;  1XJV A;  5M5X H;  2K5N A;  3HOY G;  4C3J H;  2K50 A;  3CQZ H;  5J3B A;  4IO9 A;  1YHA A;  3PUX A;  4HIM A;  3UDG A;  3HOX G;  2ID0 A;  4X64 L;  1PH4 A;  4NB3 A;  2E5L L;  2JQO A;  2AWN A;  1MIU A;  2VQF L;  2VNU D;  3PUY A;  4A3E H;  2HT1 A;  1PVO A;  4J15 A;  2K4K A;  3M9B A;  4JI5 Q;  4YHH L;  2R92 H;  1X3E A;  2UXC Q;  2UUB L;  2Z6K C;  1OXX K;  1XMQ L;  2ZJQ A;  1VQE A;  4P71 A;  3DM3 A;  3AQQ A;  1S40 A;  1VQL A;  4DPG A;  1VQC A;  1EIF A;  3GO5 A;  2V1C C;  4IPG A;  4L5R C;  4GOP C;  1HZC A;  3G48 A;  4H02 A;  2UUA Q;  4A3C H;  1DGS A;  3STB C;  3W1B A;  4AYB E;  5K36 G;  3RNU A;  3OYY A;  5FJ8 G;  1E24 A;  1JJ2 A;  1G6P A;  1CSQ A;  1X3F A;  4BY7 H;  1WJJ A;  2NN6 G;  1EUJ A;  5HGQ A;  2UXC L;  4JI2 Q;  3A5Z B;  3TQY A;  2JA8 H;  2R7D A;  4DV2 Q;  1D8L A;  3AEV A;  2KCM A;  4IPD A;  4XTC S;  1LYL A;  1FGU A;  2R93 H;  4IOA A;  3J81 j;  3GTG H;  4HIO A;  1IYJ B;  1TWC H;  2CQO A;  3A0J A;  1CKM A;  4A3I H;  4A3F G;  1FVI A;  2MO1 A;  1QZG A;  4A3B G;  4Y52 H;  1SE8 A;  2D0P A;  2F52 A;  1N34 Q;  3HOZ H;  3UE0 A;  4LF7 Q;  2AWO A;  2CWA A;  4JI8 Q;  3CC4 A;  1MJC A;  1Y14 B;  2E2H H;  3VDY A;  2C35 B;  2NN6 I;  2KEN A;  2DGY A;  2HIX A;  5LMU Q;  4B3S L;  1UE6 A;  4JI2 L;  2N78 A;  1TWH H;  1IBK L;  1IBL Q;  2QGQ A;  4X66 Q;  1VQ8 A;  3K0X A;  4EQ5 A;  3PO2 G;  1QVF A;  3EN2 A;  3GTK H;  1YEZ A;  2HQL A;  4JI3 L;  3J80 c;  2JA5 H;  5C44 G;  1BKB A;  5AJ3 Q;  4JI0 L;  4NXN Q;  2PNH A;  2CWP A;  1G51 A;  1H95 A;  1L2F A;  4QL5 A;  4B3T Q;  2PMZ E;  1OXS C;  3CAM A;  1G29 1;  4DV0 Q;  4JI8 L;  4LF7 L;  3KF8 B;  1T9H A;  1Q86 C;  4JV5 L;  4BBS H;  4PZ6 A;  3HKZ G;  2E2J H;  4LF9 Q;  3L2P A;  1K8A C;  1GD7 A;  1VCI A;  3AFP A;  3S1N H;  1X65 A;  2CFM A;  5DLQ E;  1YJN A;  1W3S A;  2D0O A;  2R7F A;  5IYB H;  4X66 L;  3GTM H;  1VS0 A;  4QY7 A;  2N8N A;  1C9O A;  1RIP A;  2NZH A;  2EQS A;  3HFZ B;  5M3F G;  1KC8 C;  3HOW G;  4PZ8 A;  5C0X J;  2IY5 B;  5AJ3 L;  2WB1 G;  3HOU G;  3ERS X;  4JBK A;  2ZJR A;  3MEF A;  4DV0 L;  1PH9 A;  3KLW A;  3FP9 A;  3PSI A;  4KHZ A;  2ZM6 Q;  1N36 Q;  4LF6 L;  5IYC G;  1VQN A;  1SR3 A;  3CCM A;  4BY1 G;  4LFA Q;  5LMN Q;  2IX1 A;  2JA6 G;  3M3Y H;  2BH2 A;  2RF4 A;  4HJA A;  3A74 A;  1VQ7 A;  2D62 A;  2Q2T A;  4DV6 Q;  1VQO A;  3S14 H;  3EIV A;  3M85 A;  3S16 H;  1IZ6 A;  2BH8 A;  1SRO A;  1QUQ A;  1S3O A;  3F1Z A;  3ULL A;  2I5M X;  1UWV A;  2VY3 A;  2ZM6 L;  1N36 L;  4JI3 Q;  4AQY L;  4DR7 L;  2AHO B;  1WCM H;  4A3E G;  2VZA A;  2YV5 A;  3KDF B;  1N9W A;  4X62 Q;  1A62 A;  1OXV A;  1X6O A;  4YCV A;  4DV6 L;  1KXL A;  2QA4 A;  5JEA J;  2ZTE A;  4JYA Q;  2OTJ A;  3E0E A;  4DUY Q;  4A75 A;  4LF4 Q;  2F4V L;  3RN5 A;  4AYB G;  2LSS A;  1YBY A;  2R6G A;  3Q8D A;  1VQ4 A;  4HJ5 A;  1TWA H;  2N3S A;  5E7N A;  3CCR A;  4OX9 Q;  4A3C G;  1XNQ Q;  4P75 A;  3S1M H;  3EBE A;  3PGZ A;  3T1Y Q;  4BY7 G;  2L15 A;  5GAD C;  2IHE A;  3T1H Q;  4A3G H;  2JA8 G;  1LUZ A;  4QJF A;  1C0A A;  4JI6 Q;  1K0R A;  2UXB L;  3KDF A;  2UUC Q;  4ME3 A;  4YWM A;  4JYA L;  2R93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...