3GTLJ

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtlJ00
4C3HJ 2CUFA 3OOUA 3K2AA 5F0CA 3HDDA 4G12A 3S14J 1JTXA 2EH3A 2XGEA 1JT0A 4JYKA 4JX4A 5EG0A 5EG0B 2JA8J 4XRSA 5EZGA 4DZJA 2K9NA 4JX5A 5FKKA 2WV1A 3JRGA 1JKRC 3GTPJ 1GDTA 1VI0A 2YU9J 3LNQA 3BTLA 4CYCB 4CYCA 4DYCA 2HDDA 3Q3SA 3ZQHA 2OF7A 3B6AA 1WGXA 4MLOA 1IDZA 2LKXA 3OSGA 2DA2A 1JJ6C 3JRAA 4GFBA 1VNDA 4LOCA 1O4XA 1CQTA 5M5YJ 2HYJA 2JA6J 1T33A 5DS9A 5IP7J 2L7ZA 5J3LA 3C2BA 2MGQA 5F0HA 4A3FJ 2RAEA 1WCMJ 4D5CA 2DN0A 2M34A 4XRSG 2YUSA 3BTCA 4A3DJ 3BR2A 2R92J 4M6VA 1ETQA 5FKNA 2W48A 4A3BJ 1ENHA 1GT0C 3BR1A 4IHVA 3L1PA 2ME0A 4UUSB 4UUSA 2KDZA 4DYQA 3SJMA 1RR7A 2L7FP 1EF4A 2XSDC 1FJLA 2E19A 2I10A 2NVXJ 4MO7A 5F1JA 4M3FA 1JKQC 4RDUA 4Y52J 1BW5A 2DA7A 1HCRA 3OIOA 1WH5A 3I4NJ 1P7IA 5BNGA 3OSFA 1F43A 1LFUP 3QPLA 1ZK8A 5E3LA 3S2DJ 2TRTA 3K7AJ 4V2FA 3DCFA 2P81A 5K7FA 5M5XJ 1FEXA 3G1MA 5K7HA 2ID3A 1IUFA 4A3IJ 4M3DA 2LLKA 3RKQA 3QQAA 1DU6A 1WPKA 2DA3A 2VPRA 3M4OJ 3JRDA 1FTTA 2LVSA 1NTCA 2N8GA 1VFCA 3BR5A 1ZGWA 4A3KJ 1Q1VA 1TWHJ 3GBGA 2WB1N 2HI3A 2XPUA 5E3MA 3GTMJ 3JRFA 2VKVA 2NS7A 1P7JA 2DJNA 4A3GJ 2R93J 2XB5A 3FK7A 4QTRA 2NVTJ 2X9DA 4L5EA 1R9TJ 3BQZA 2DMUA 1B8IB 1B8IA 4I6ZA 2EZIA 2G0EA 3LSJA 1GV2A 2XB0X 3BQYA 1LFBA 4JX6A 3ZOBA 3GTLJ 3S1MJ 2M8GX 1ETKA 5E3OA 9ANTA 1UG2A 4XIDA 2MSYA 4V2GA 3S1QJ 1YRNB 1YRNA 4B3AA 2K40A 5IOZA 5C3EJ 1WI3A 1D5YA 2E2HJ 1IRZA 2NVYJ 1AKHA 1AKHB 2XGDA 4DW6A 2EZHA 3O8GA 5HODA 3W6VA 1IC8A 1POGA 3G1LA 1MBFA 4A3CJ 1ZTRA 3Q0UA 2O7OA 1TC3C 1TWAJ 4A93J 3QPSA 3B6CA 1ZR4A 1JJ8C 4MIMA 3SDGA 1Y1VJ 1MSFC 2MG4A 1QVUA 3TP0A 3JRHA 2M0CA 3Q0WA 3FK6A 1ETOA 3TP3A 4XRMA 1JT6A 2LTPA 1FIAA 4AUXA 3A01A 3A01B 2H8RA 1Z77A 1IV6A 1IGNA 2TCTA 2XPVA 1G2HA 1TWGJ 1ZQ3P 4BY7J 2R0QC 3GTOJ 5JLXA 1BA5A 1MBJA 5EZHA 3MKLA 1A6IA 1Y1WJ 4HNVA 2K9SA 2AHQA 1T56A 2FJ1A 2O9LA 3BG5A 4D7NA 2DMPA 2IBDA 2ELKA 4FISA 2EQRA 2E1OA 5GPAA 2JJ7A 1GUUA 4BY1J 1GVDA 1U9OA 2NVQJ 2YS9A 5F27A 3GTJJ 2WAQN 1OFCX 3LSGA 3WHBA 4QSHA 3CCYA 4B4CA 3JREA 3GTKJ 5J1RA 2JA7J 4BKXA 1U9NA 1MBKA 4C3IJ 3LSPA 3CDLA 3M3YJ 4DYRA 3HOWJ 3NAUA 3S2HJ 1APLC 2DTZA 2L7MP 3O8HA 1H88C 4JP0A 3HBLA 5M3MJ 5F0FA 5GP9A 1MBEA 3S17J 3IH4A 1QVTA 2DA4A 2VKEA 2FX0A 2IAIA 4QIWN 4UUTA 1SFOJ 2JA5J 1UHSA 2L0KA 5FKLA 1A5JA 2NOGA 2HOAA 1OCPA 5EEAA 2D5VA 3NARA 2E2IJ 2JMWA 4MFDA 2JN6A 1ETYA 1H89C 2VUMJ 3S15J 5JLWA 3HM5A 1ZR2A 1Z0XA 5IP9J 5IYDJ 4X1EA 3GTQJ 1MSEC 2FQ4A 1W0UA 1ZKGA 4DZPA 3S1NJ 2EZLA 1MNMC 2XGCA 2LY9A 4A3EJ 1OCTC 5FLVA 4M3EA 1UMQA 2DA1A 2CJJA 2ECBA 3HGYA 4J19A 1WH7A 1ETWA 4M3GA 3BR3A 3ZQCA 4MFEA 5C4JJ 1W0TA 5F08A 3WHCA 1OJLA 5IYCJ 3RZDJ 2DMNA 5IP6A 1JUPA 1IDYA 3FISA 1XG1A 4W97A 1BL0A 4C3JJ 1JGGA 4A3JJ 4IEJA 4D7MA 1I50J 2GBYA 1RKWA 1H8AC 3IH2A 3JRIA 2Y9YA 3BTIA 1ETXA 4BXXJ 3HOUJ 3BT9A 2X6OA 4FE7A 2DMQA 3G1OA 2CUEA 4B1RA 2LR8A 4BBRJ 2Y31A 2CQQA 1JKPC 2R7ZJ 5EYRA 1SANA 2HOTA 1XS9A 2GM4A 2AO9A 2NS8A 2LFBA 3HOXJ 1E3OC 1RETA 2MW8A 3PO2J 1JTYA 2HQ5A 5DTDA 5EDNA 1QRYA 2ME6A 3ZQGA 3JRCA 5M5WJ 3H0GJ 3PO3J 1JUMA 3SFIA 3BR6A 1ORKA 3HB9A 5IOYA 2Y30A 3ZQFA 4FE4A 4D5FA 5C4XJ 2COBA 3VPRA 1I3QJ 2QCOA 1LE8B 1LE8A 3CMYA 2XPWA 3IH3A 3RQIA 3HOZJ 3D1NI 4IHWA 4RBOA 3TW7A 5FKMA 2FD5A 2EBIA 1MBGA 3IV5A 1U8BA 3GTGJ 1MBHA 3HEFA 3HOYJ 2M9HA 2M2EA 1AU7A 4FTHA 1ETVA 1F36A 5J1YA 2Y0SN 1BW6A 4FCYA 3BTJA 2E2JJ 2B63J 3BR0A 1VF9A 4S0HB 3RZOJ 1XC5A 3TW6A 3F0CA 2JWTA 1HLVA 1K61A 4IHXA 3PM1A 5IPAA 2CQXA 5EF6A 3S1RJ 2ID6A 1JUSA 2DA6A 2QF7A 4EEFG 4A3LJ 3LOCA 5FKOA 2JK3A 3FIWA 5F04A 2CRGA 1RKTA 1X2MA 2LK2A 1NK3P 5GPCA 5IYBJ 5EGOB 5EGOA 2R5YA 2R5YB 3HGGA 3MVPA 2CU7A 4A69C 2DA5A 2LD5A 1B72B 1B72A 3H3VK 2ECCA 1IG7A 1IJWC 1HOMA 2Y2ZA 2EZKA 3E7LA 2PMZN 3CQZJ 4XICA 3TEDA 1DU0A 2KT0A 3HKZN 5FJ8J 5M3FJ 3UKGA 1HDDC 5C44J 2OPTA 2GLOA 3LSRA 1QPIA 2HOSA 1RPWA 3ZQIA 2H1KA 3S16J 1RESA 1FIPA 4NDLA 3JRBA 2L9RA 1HDPA 4AYBN 2DMTA 3FKIJ 1ITYA 3BG9A 4BBSJ 2K9QA 4AC0A 4IHYA 3ZQLA 4I76A 2IEKA 2XRLA 2X48A 1U78A 5FLMJ 3DEWA 5J1UA 4ABZA 2LP0A 1X2NA 1AHDP 2ZB9A 1K83J 1HF0A 1FTZA 5E3NA 1PUFA 2HXOA 1PUFB 2Y9ZA 1JKOC 4W1UA 3A03A 1MH3A 3HOVJ 4Y7NJ 3BG3A 4M3BA 2VI6A 3Q0VA 4X6AJ 2R5ZA 2R5ZB 1X58A 1BJZA 3A02A 4XK4A 2HXIA 1TWCJ 5K7ZA 1TWFJ 4C2MJ 1MH4A 2O8KA 1NK2P 4A3MJ 3MN2A 3I4MJ 1S7EA 1I6HJ 1GV5A 3JR9A
chains in the Genus database with same CATH superfamily
1X4PA 2CUFA 4BXFA 4PZJA 2P5VA 4A2UA 5F0CA 4G12A 1FYKA 3SEZA 2EH3A 1Y8QB 2YR2A 3QAHA 5EG0A 1A04A 1UZCA 3VODA 3JSPA 3JW4A 3MZHA 1YJWI 4DZJA 3K1MA 3FHNA 4JX5A 3LSHA 2PJRA 4G94A 1TBXA 2WV1A 4NQWA 3MD2A 2MC3A 5A2QZ 1BR4A 4BGDA 3RKYA 1TT0A 4U7BA 3EDPA 3BTLA 1TP4A 4CYCB 2CV2A 1Y39A 1FPQA 3WU0A 2W25A 1GHCA 4EATA 3ZQHA 4DBRA 3H36A 3SZGA 5CJ9A 1D0ZA 4P55A 1FBQA 3FXLA 1IDZA 2LKXA 1ZYRF 2QENA 3CUQB 2KP6A 4FASD 1VQ4I 4U0YA 1JJ6C 3DV8A 5D6EA 5LLQA 2BHYA 3OYLA 1YG2A 1XN7A 1P6RA 1VNDA 3FM5A 3ERED 1O4XA 1Q1HA 4EV0A 1AWCA 1X4OA 4ZYEA 5IP7J 2ZXWH 2L7ZA 2ZSIB 4ZZLA 5ERIA 2EIKH 5D8LB 4M73A 3C1DA 5B66C 4L9TA 2JVHA 2Q2EA 2YUSA 4KICA 1D8JA 1TQPA 3BWGA 1RRJA 1FZPB 1FYMA 4G6QA 5FKNA 2W48A 3I64A 1R00A 4CGZA 3L1PA 2IW5A 4XLFA 4UUSB 2KDZA 4DYQA 1EH6A 3E5QA 4G7OF 3K4CA 1EF4A 1TLHB 2PN6A 4LJZF 1TNSA 2E19A 4KJZA 3DLAA 4IX7A 5CVIA 4PJJA 2IT0A 2BV6A 2CYYA 2OD5A 2KJBA 1E3PA 2CV0A 2MA3A 3J80K 2HU9A 3QODA 1HCRA 3JTHA 4WWCA 2KISA 4G6DA 1XSDA 1FMWA 3KLOA 2IS4A 3H9QA 1P7IA 3AFHA 3SHFA 1XCBA 3QPLA 3TMOA 5LHHA 5E3LA 4BQQA 3CCVI 1LFUP 4ZYAA 4UV8A 3K7AJ 2ZNYA 2P81A 3MWMA 4JQFA 4U0WA 1TNTA 4ENMA 4FT8A 3RYRA 5K7HA 1IUFA 5LHGA 5L3BA 1R22A 2GXGA 5IT3A 3RKQA 5CKTA 2EK5A 1O3TA 3CUOA 3EYIA 5BOXA 3M4OJ 3JRDA 2VJ4A 2VT2A 4KT5C 2BY0A 3HHGA 4CH7A 4XKWA 4A3KJ 5HLTA 3ONQA 4C2UA 3L7WA 5LRRA 2ADUA 2OZUA 4QPOA 1U5TA 3GLLA 1BC7C 2OTLI 5E3MA 1RUNA 4B3XA 2DO7A 2GOXB 2R93J 5TISC 4LLNA 3FK7A 4NC8A 1IN6A 3T5XA 5JVGF 2RREA 3CF5F 2K5CA 1Z9CA 5CVRA 2FUG2 2GXBA 2EZIA 4BEHA 1GV2A 4Y4RA 5L3FA 1XGOA 5DCMA 3TOBA 1V5EA 2M8GX 4PDKA 1EH8A 4EM2A 2VBXA 4RS8A 3DEEA 4EJUA 3OR1C 1R71A 4OIPF 2MSYA 5LFAA 3DBLB 2VIXA 1YRNA 4A0YA 1YIOA 2DDAA 2IA0A 1ODDA 5C3EJ 5HS8A 1RIOH 3RYPA 2W4SA 3I5UA 1EKEA 2NVYJ 1AKHA 2HKOA 3IAM2 2EZHA 2ISZA 3V7CA 2V6EA 3KZIC 2LYCA 3G1LA 1ZTRA 2ZO4A 3Q0UA 2O7OA 1SVOA 3MZ8A 1HKSA 2VQGA 1MMSA 1USSA 2ESHA 2ESNA 3O6BB 4MIMA 1MSFC 2MG4A 1QVUA 3OYHA 4OWRB 2ZMEA 1BM9A 1BN5A 3Q0WA 3P9CA 2M0MA 4HLXA 3WTXC 4D1QA 2F5CA 4OAYA 3TP3A 1JT6A 3VYUB 2YX4A 1FIAA 3GX4X 3A01A 2H8RA 2RDPA 2UXNA 2BBYA 4HF0A 3FF5A 2XPVA 3L2CA 3LAJA 1G2HA 4DOZA 1ZQ3P 1JHHA 3JAMZ 1ZGJA 2A3SA 5JLXA 2R0QC 3GTOJ 2E1MC 1A6IA 3VYRB 4B44A 1Y1WJ 2JA2A 5F6FA 2OAZA 2K9SA 1PVEA 1V3FA 3KEOA 2O9LA 3L2VA 3QPHA 5B1AH 1NH3A 2DMPA 4L0YB 1W5TA 4L18B 2ZJQF 4FISA 1VQLI 2EQRA 3K4MA 4CDGA 2ZBKA 1I6XA 4R79A 5GPAA 1TT5B 1GUUA 4G7ZF 3GWZA 2X4HA 4S05A 1K79A 1VQ7I 1LEBA 3I59B 2L4MA 2X6XA 1T2KA 2WAQN 3LSGA 3K4BA 3HTUA 1D1CA 5BQTA 1OCZH 4HV6A 2X85A 1E17A 4CCNA 4NHJA 2HGCA 4BKXA 3LQRA 3M3YJ 3DF8A 3HOWJ 1BR2A 2DBBA 1OQYA 3GFJA 2QUFA 3ABMH 2DTZA 2L7MP 2VXDA 2QLZA 3FWEA 3WTUC 2OTJI 4JP0A 3HBLA 3MZYA 4KISA 1DPUA 3S17J 4Z2YA 1HSJA 3ULQB 5LEJA 1MJBA 2L9SA 4DIQA 2QZ8A 4PJMA 1ZG5A 4XLPF 4V19K 2QSHX 1W5CC 1XB4A 2F5VA 3N4MA 1I5ZA 1X3ZB 3KLNA 5JFRA 2NOGA 3GVAA 1R7JA 1VQOI 5CVUA 5D5UB 2H8WA 3OIQA 3S15J 1T39A 3FZVA 4M9SA 1R5ID 5IP9J 1ONVA 4F92B 5IYDJ 2P7CB 6PAXA 2KIMA 5ED4A 2F48A 2P5KA 1W0UA 1MNMC 3K6GA 3OS0A 2QM3A 1OCTC 2JUCA 1V5GA 2F2EA 1IV8A 1MW7A 3BR3A 3EPZA 3J7ZI 4A12A 4CA0A 2EINH 4U0VA 3DKYA 1TQIA 1KZHA 2BY3A 5IYCJ 3RZDJ 1MZBA 1JUPA 1DGWY 1IDYA 1SD6A 5CPRB 4F7ZA 1XG1A 5ICFA 1BL0A 2WADA 1H9TA 1JGGA 4A3JJ 2OQRA 4KIBA 2GBYA 2WV0A 3DFGA 3DXJF 3IH2A 3LAPA 5TRDA 2Y0SA 2Y9YA 4MHGA 4HDUA 3S3OA 4N9HA 2X6OA 3I54A 2ICWG 1W7PB 1PP8F 2XRNA 2LR8A 4XKBA 4LMYA 2Y31A 3TL4X 2HWVA 4BJ5C 3NQOA 1MJ9A 1UHMA 2V1XA 2HOTA 2WA0A 4M71A 3TQNA 1TW2A 2GM4A 2AO9A 3PNTA 1R1VA 2CSOA 2EWNA 4RA2A 2LFBA 4A6DA 4RB0A 3HOXJ 1K6OA 1X1PA 2MW8A 1U8RA 5J6XA 1KQ9A 5LD2C 3ZMUA 3FX3A 1Y0UA 1W1WE 1QRYA 5J47A 3ZQGA 4KITB 3JRCA 2F5DA 3BR6A 1GXQA 1WJ5A 3CCUI 1LDJA 4AWXB 3CJRB 4DGWB 5C4XJ 2QGUA 2Z1DA 3A4CA 1I3QJ 4ITVA 4IZZA 5B1BH 3IH3A 3RQIA 3HOZJ 3HSFA 2BVLA 3CF2A 3K69A 4IHWA 5FRMA 3K0LA 3B02A 4A0XA 3ASOH 2VQCA 3BZCA 1SD5A 1SEUA 2FD5A 4HX7A 1MBGA 3IV5A 2EFWA 3GTGJ 4Y3OA 2EFOA 3KZYA 4WXHA 1S6LA 2KZGA 3HEFA 3HOYJ 3OL4A 1XMKA 3RIRA 4BAYA 4IHTA 4CZZA 2JSCA 4FTHA 2ISYA 4AVZA 5H2FC 4RGRA 1QBJA 2XF5A 4AYBA 4RGUA 4CHUA 4E7IA 2P5LC 2LY1A 1P4XA 1LKXA 1VF9A 3DQVC 3RZOJ 1XC5A 3HJEA 2VLAA 4IHXA 5IPAA 1ZLJA 4BJTA 1Y0NA 3HSRA 3CMMA 4EGZA 4HQMA 3LWFA 2DA6A 2HQAA 4N0BA 3OYNA 2BW3A 2A61A 2KIQA 1EV7A 2NAZA 5CQEA 1DUXC 2JK3A 1Z21A 2DT5A 2LDUA 5F04A 2F4MB 1DDNA 5L3CA 2IRFG 1YIJI 4TV7A 1IXSB 2X1CA 4HNUA 3IKTA 2WTEA 3C18A 3R61A 2R5YB 3HGGA 2CU7A 1Y8RB 5D5XB 1PJRA 1B72B 3ERMA 4PK4A 4RM2A 2Y2ZA 5BPIA 4IL6C 2EZKA 1K78B 2HYGD 4KYWA 1TW3A 3CQZJ 3ZGKA 2AXTC 3CESA 3O2PE 3E5UA 2KT0A 3HKZN 5FJ8J 1L0OC 2XAQA 1MD0A 3VOEA 2OPTA 2GLOA 2VPLA 1QPIA 4A5MA 3F21A 1GXPA 2H1KA 3HUGA 5FLXZ 2MFZA 2QBYB 2L9RA 3H5NA 3MEXA 1HDPA 4AYBN 2QYOA 4BBSJ 2DPUA 3H3UA 2W7NA 2X48A 1U78A 5KVRA 1SFEA 3M1CA 3OYFA 1P4AA 4ABZA 2LP0A 3EQLF 4L0ZB 4IRIA 5LEKA 1HF0A 3LFKA 4GXOA 1FTZA 5E3NA 1PUFB 2ZXJA 1VQ8I 3A03A 4W1UA 4HF1A 1XPXA 3HOVJ 3BG3A 4M3BA 3SZTA 2VI6A 1QNTA 2STTA 4M9ZA 5K5OA 2R5ZB 3FMRA 5LHIA 2DPDA 4XK4A 2M5WA 3I9V2 2FOWA 5K7ZA 1D0XA 2CW8A 4ESFA 2R7WA 2W57A 4BE1A 1OPCA 2KIFA 4H0EA 3JR9A 3H3ZA 2P6TA 2OJED 2JSPA 4IPAA 4C3HJ 1OISA 3CDHA 1XMXA 3OOUA 2O5RA 1QQIA 1HW2A 2IGKA 2ZMEC 4E7SA 2HEOA 3OYIA 4MQVA 3TDUC 4JYKA 2IS6A 4FETA 3A2KA 2OU2A 5CVVA 3A0BC 3GW2A 1R6RA 4M9XA 3ZQQA 3JRGA 3FXUA 1ZLKA 4II3A 3DEUA 1JHFA 2J5OA 3KP5A 1VI0A 3T1BA 1S72I 4RMNA 2YU9J 3G71I 3AKZA 1Z7LA 2GWRA 4FX0A 2LSOA 1A31A 2HDCA 2ZJPF 2V1DA 3Q3SA 2HDDA 4C30A 4LG0A 1BIBA 2UUZA 3B6AA 2JRTA 3K4NA 4KIFA 1WGXA 4BYYA 4Y13A 1C0WA 1VQNI 3OSGA 2X6YA 2DA2A 2XVCA 4BDYA 1V4RA 1X19A 4ASNA 3JSOA 3SXYA 3QWLA 5LGTA 1MNEA 2LOOA 1IXCA 5M5YJ 4U7DA 2JA6J 1T33A 1R58A 5DS9A 3G4SI 2MH2A 3C2BA 3W2VA 2F6CA 5F0HA 3W2WA 5D4RA 3MKYB 1WCMJ 4HAMA 4A3FJ 2DN0A 1GVJA 3T8TA 3BLYA 3BR2A 2R92J 5HS7A 4HOBA 1LPQA 3OYGA 4M6VA 2VASA 3EETA 2Y0MA 1ENHA 1GT0C 2MD0A 3F8CA 2VONA 3R4KA 4MTEA 3LSMA 3SFZA 2D1HA 3OYBA 4L5IA 1B9MA 3SDBA 2QQAA 1FT9A 2HQNA 4YEJA 1FJLA 3M8EA 3ZPLA 3M7GA 2I10A 5GADJ 4YIFA 1Z3YA 4M3FA 4RDUA 3M8FA 3IL2A 1BW5A 4O3MA 3E5XA 2P6SA 1G3WA 3K9TA 2XIGA 4KN7X 2ELHA 2CG4A 4L9VA 3F72A 5HDKA 3OSFA 4XN0A 3I4NJ 1ZK8A 3WGIA 3HC7A 3KYCB 4P9FA 1YQAA 2QQBA 4BUPA 4KNYA 2TRTA 4V2FA 4DQ2A 5K7FA 3PIOF 2VKHA 1FEXA 1SMTA 1BI0A 3DWLE 5LGUA 3I55I 2QEXI 2KKOA 1DU6A 3DBRB 1WPKA 1I1GA 2VPRA 3N97A 1VTNC 1T6SA 3PL8A 1K4SA 1NTCA 2N8GA 1VFCA 2OCCH 2JVGA 2FA5A 2CMPA 1T38A 3FMQA 4HPQA 1Q1VA 2L02A 1TWHJ 4K2EA 3D0SA 4JOMA 3WG9A 3WU2C 3GTMJ 2WB1N 2HI3A 2JTVA 5HLHA 3F8FA 2F5FA 2NS7A 3H9JA 4A3GJ 1D3YA 4DJAA 1BC8C 2KRCA 1K4TA 2LH9A 1YFHA 4IJAA 2HR3A 4L5EA 5H20A 2DMUA 1B8IB 1S5LC 4OMZA 2A05A 3W2AA 2XB0X 4JX6A 1ZG1A 3WGHA 3R0AA 2CW7A 1FMVA 2W85A 2DK8A 3OYDA 3CO6C 2KMUA 3H92A 3PNYA 4HX4A 4PSWA 4V2GA 4Z6YA 1HKQA 5FFZA 4B3AA 2K40A 5CVJA 2Q1ZB 4OIRF 4N4NB 2A6EF 5KCMA 2ZKZA 3O3KA 2CS3A 3BJAA 3IUOA 3VYTB 2E2HJ 4I98B 5HODA 3W6VA 4B43A 2E34A 4BQNA 3Q9VA 3RCOA 1XGMA 1PUEE 2FBHA 1MMDA 2O0YA 5D5WB 4A6EA 1TC3C 4CCLA 1V54H 4CCJA 1XGSA 2X51A 1RUOA 1ZH5A 4KIGA 3SDGA 1Y1VJ 1J09A 4BHCA 1O3QA 1YJNI 1NG7A 1S9HA 1BJAA 2M0CA 2QWWA 2Z5UA 2PJPA 3GZ6A 1T0FA 1D1AA 2DFEA 2LTPA 1R4NB 3KZZA 1Z77A 2OCEA 2K3FA 1IV6A 3BJ6A 3BPVA 5HVQC 1N75A 1R4MB 1SVLA 1QU3A 3RQ4A 3CLOA 3J7AO 5EZHA 2D45A 4HNVA 5HLIA 1HKTA 2AHQA 1T56A 5ICGA 3DLLF 4D7NA 1OCRH 1WQ2A 1RZ4A 1S29A 2EA2A 2ELKA 1UG0A 4J00A 1IF1A 5J8CA 2HVRA 1KQ8A 4BY1J 1GVDA 4F91B 1J0RA 2OA4A 3KP6A 5HNFA 2YS9A 3I0TA 3LA3A 5F27A 4R8HA 1OFCX 1HA8A 4DBQA 2RQPA 3W6KB 3WHBA 3CCYA 4B4CA 3JREA 4UV9A 2GA2A 1UB9A 3V8JA 2K4BA 3BZ6A 1MBKA 4C3IJ 3IC7A 2UXXA 4Q48A 1G4DA 3NAUA 1H88C 4PUSA 2VOPA 1B59A 5FGMA 1T0FC 2DA4A 2A6TA 1ZRFA 2R4GA 3NWSA 2K7LA 2CO5A 2LKPA 2IAIA 3HYIA 3HXLA 2K9LA 3OMYA 3U2RA 4RLQA 4HW0A 3I56I 4I2OA 2L0KA 3CDIA 3HKZA 2KIUA 2LKSA 1OCPA 4UVCA 3CJQB 3ZMSA 5EEAA 3CCLI 2EA4A 1O7LA 3NARA 3U9GA 2JMWA 4UB6C 2JN6A 1ETYA 3E6BA 2MD5A 4RGXA 4F93B 5JLWA 1G59A 1ZR2A 3VSKA 2LBFA 2CQKA 2ZNZA 4RB1A 2RQQA 1J7KA 3HRMA 2KHMA 4EJWA 3OIPA 3ZXSA 3V42A 1OLTA 5HDNA 2DA1A 2CJJA 2ECBA 3HGYA 4PCQA 3FXJA 2CH0A 1WH7A 2E1MB 3DTKA 3RJPA 1W5SA 3ZQCA 3AG4H 1W0TA 4II2A 5F08A 4AIHA 1G8XA 3GYHX 3T0YA 2DMNA 5IP6A 2XAHA 3M1EA 5J4YA 3K70D 3TO6A 5HLGA 3T8RA 4OIQF 4W97A 1YHQI 3ELKA 4BHPA 2XF6A 3H5RA 3P7NA 2VC1A 3R6SA 3BTIA 4AVPA 1CF7A 3N05A 1WHUA 2LG4A 2Y69H 2DMQA 3ZN0A 2CUEA 4E7KA 1X1AA 3OL3A 4UY8I 2R7ZJ 3BC8A 2WY7Q 1MDMB 4MGRA 1IW7F 2FE3A 3JAMK 4XL9A 3PJRA 4PGGA 1BI2A 3OR2C 4ENKA 2FEZA 5D6FA 4HNTA 1KU3A 1ON1A 2L5QA 3BOQA 1VQ6I 3QYBA 5DD4A 2RNGA 3PQKA 2BE5F 1RETA 3PO2J 5FB2A 3S8PA 2HQ5A 1QO0D 4RM3A 5DUKA 2BGCA 2ME6A 2H1LA 5M5WJ 3PO3J 4OMYA 3CLQA 1JUMA 1YO5C 3RKXA 3TKYA 1FBUA 5FO5A 3HB9A 5CYVA 3ZQFA 4CO8A 1DGRM 3DU6A 2COBA 2JPBA 1FNNA 4YRVA 1HSTA 1MMNA 1OR7A 2QCOA 3J7YJ 4XMYA 1LE8A 3OYJA 2XPWA 4FX4A 2KZVA 5ICCA 3D1NI 4RB3C 4PFOA 2L4AA 5FKMA 3V7RA 2A07F 2L2OA 2EV5A 1U8BA 3MFKA 2GA1A 4BHBA 1FC3A 2IVMA 2O6GE 2K9MA 2M9HA 2M2EA 3F23A 1QZZA 3FHZA 3A0HC 1V5FA 2WB1A 3WTVC 1KU2A 4YELA 1ETVA 4BNCA 3H5AA 1R1UA 5J1YA 3FDYA 1G6NA 3FMSA 1EA3A 5H6RA 4FCYA 2E2JJ 5BS6A 4ZYDA 2Z33A 4KUMA 2NRAC 3Q9SA 3TW6A 3F0CA 2JWTA 4EM0B 3ZP5A 5GAGJ 2WC2A 2BEOA 2NOJB 3E6MA 2IA1A 3CCMI 2ID6A 2WAEA 2LNBA 4ETSA 3HL2A 1IUYA 4YFKF 4A3LJ 4LLGF 5E8IA 3HRTA 5BPDA 1RKTA 1X2MA 3CJNA 1W4MA 4E7LA 3GZNB 5IYBJ 4ANJA 4IKFA 5L3GA 2E1NA 5EGOA 2DOAA 4A69C 2L9NA 2P7VB 2XF7A 2E1CA 3CUQC 4WXDA 3CP2A 2X0LA 1X3WB 1J5YA 2MLKA 2PMZN 1LEAA 2E7WA 4GCVA 4XICA 2MYSA 1TL8A 4BXUA 5DM7F 1DU0A 2DT7B 4YFXF 3UKGA 5C44J 3MKZA 1U3EM 2IS2A 2BZTA 4CUGA 4RAZA 4HX8A 3LSKA 2HOSA 2IGMA 3S16J 1U2WA 4NDLA 3DTIA 5KK1A 2BHZA 1DQUA 2RV8A 1ITYA 3ZMVA 2BY2A 3IWFA 1FOXA 3GEZA 3LSIA 4AC0A 2NNYA 4IHYA 3ZQLA 1U6GA 4I76A 5LGNA 2XRLA 1FYLA 2DYRH 2LF7A 3E6CC 4B8XA 4G8XA 2HTSA 2GIZA 3M07A 1SMYF 3ZR8X 3DBHB 5LRSA 2HXOA 2XAJA 2XV4S 5ILUA 1JKOC 2CUJA 2L01A 3ML6A 2Z99A 3FXOA 1Z7UA 3AAFA 1JGSA 4CCOA 4Y7NJ 3KEYA 3FM3A 3Q5FA 4BS9A 1E2XA 1X58A 2HXIA 2YSRA 5TJJA 1TWFJ 1MMGA 4C2MJ 1MH4A 4A0ZA 1G3SA 1KYWA 2TDXA 3HRUA 3P9IA 3M9AA 2GOMA 4A3MJ 2A5WA 3MN2A 1S7EA 3I4MJ 1JI8A 2P0WA 3ZN1A 2XSJC 5HNHA 2Y48A 2R7RA 5HDGA 5GAEJ 1RR8C 3VSLA 5AONA 4LGWA 2HS5A 4XKCA 2M4GA 3K2AA 1IO2A 1FWZA 3HDDA 2PBIA 1JTXA 1J2XA 2Z2SB 1DP3A 4JX4A 5EG0B 2Z16A 5IT9Z 1N25A 1EH7A 1YW8A 2ZJ2A 3FBNB 5FKKA 2PJRB 2D2WA 2W1OA 4NQWB 3CO7C 1JKRC 4Q47A 4UB8C 3NRVA 3GTPJ 4LB6B 3QPTA 4XLHA 3W6JB 4LD5A 3HPGA 1MNDA 1MKMA 1STZA 4H4KC 4NB5A 4DYCA 4CYCA 1FP1D 1Y6IA 3E1SA 3F8BA 3U1KA 1ZN2A 2UV1A 3CCRI 2K86A 2RNJA 1WRJA 3CUQA 4LFUA 1BR1A 2X1DA 5K1YA 3MMYB 2ZFWA 4ZDLA 3RPUD 4BJ6C 1VQMI 3JRAA 3LQQA 4GFBA 2IGNA 3OYEA 2FMLA 3CC7I 1XDSA 2DQRA 4LOCA 4IRHA 2XROA 1P2FA 1IN5A 4CSWA 1WKMA 1ZAOA 4KDPA 2DU9A 2MGQA 3F3XA 3GFMA 1WWXA 2RAEA 4D5CA 5EEGA 2QQ8A 4WXCA 2Q2EB 1O3SA 3GZ5A 4OIOF 1ETQA 2KDOA 1PDNC 4IHSA 5CLSA 4EJOA 4A3BJ 1W36C 2QSGX 4IHVA 3VWBA 4LB5A 2ME0A 2DFFA 4F52A 4CCKA 4UUSA 2R3SA 1BOBA 3ABUA 2HZDA 4IQ4A 1RR7A 2XSDC 1MGTA 4XN3A 1WJDA 1OMIA 3QU3A 2WY8Q 3LA7A 5FFXA 3RI4A 2WAFA 5F1JA 2M30A 2A5YB 5GTHC 3OYCA 3E6DA 1JKQC 2GAUA 1WJFA 4Y52J 1SFUA 2FXAA 5HS9A 2DA7A 3OIOA 5AIPA 1WH5A 2C6YA 1X1DA 3DU5A 4NC7A 2E35A 4C9YA 1U5TC 3SZPA 3JTGA 4BQAA 3C2GA 3S2DJ 1DPRA 3FKJA 1E3HA 5K5QA 3DCFA 4LLLA 3G1MA 2ID3A 4A3IJ 2LLKA 5ICEA 3TOAA 4GYGA 2M4KA 3KP2A 2H09A 2Z3YA 1ZELA 1KQ0A 3BR5A 3K2ZA 1T98A 4RB2C 2VE9A 4KT6A 1KU9A 1U5TB 3GBGA 2XPUA 1X3UA 3HPHA 4EQQA 2L7KA 3BY6A 2E5NA 2XB5A 4QTRA 5KNLA 2CQNA 2NVTJ 1YX5A 1TQMA 2X9DA 3PSIA 4MEYF 1R9TJ 3BQZA 2AQEA 2R7QA 5KAIC 5D4SA 3REOA 1I3AA 4I6ZA 2VOOA 3C2HA 2G0EA 3LSJA 4BEHB 1IN7A 1A6QA 3BQYA 4HG2A 3KP4A 5JVTA 2W24A 3ZOBA 2CFOA 3OV8A 3GTLJ 5DCMB 2R7UA 1ETKA 4LITA 5E3OA 4G7HF 2RGVA 1YOVB 2IXSA 3KCCA 4CICA 4XIDA 3S1QJ 4JBAA 2CUZA 1YRNB 2PMUA 5IOZA 1WJAA 4LK1F 1WI3A 3V8LA 4ESJA 1IN8A 1AKHB 4DW6A 2XKOA 2OBPA 1LFPA 2JT1A 2DLLA 1POGA 1OYIA 4A3CJ 3F22A 4E7ZA 3ASNH 3BG6A 1TWAJ 3F9KA 3QPSA 1X1CA 1YW7A 3B6CA 1ZR4A 1FOKA 4PJLA 2MBFA 2ZMEB 1B4AA 4ZDOA 2VKDA 3FK6A 2LMDA 4XM3A 3COAC 1UELB 2DFIA 4GRIA 3D5LA 2XC7A 4AUXA 1W7PD 3A01B 2VJ5A 3EUKL 2TCTA 1IAWA 2EPFA 1FLIA 1G3TA 4BY7J 2K02A 3ESWB 1HQCA 4E70A 5LBQA 1MBJA 3CCEI 3MKLA 5F64A 2FRHA 2K27A 3KE2A 5B3SH 1P92A 4C2TA 3NWTA 1LDKB 4QPQA 1MJAA 1QPMA 3IAS2 3BG5A 1RNLA 2IBDA 2HPIA 3SYTA 3D5RC 5D8KB 2HTJA 3I59A 2ZJRF 2NVQJ 3RKWA 4HQEA 3GTJJ 2IA2A 1U0JA 2STWA 3RTRA 1T8IA 1R49A 3K70C 1QHHD 1ULYA 2OQGA 2WAQA 5J1RA 2Q0OA 2JA7J 4XQFA 1YW9A 2H6BA 3LSPA 1B9NA 1UAAA 3LSTA 4ZDPA 4DYRA 3ABTA 3S2HJ 4I09A 3QOEA 5DDGA 1P9QC 2QA4I 1APLC 1ZRCA 1NG6A 1HC8A 1R5GA 2IGOA 2HKXA 3VFZA 5E1XA 1MBEA 5GP9A 2M7AA 3U1DA 1FOYA 3OYMA 1AA7A 1QVTA 3IH4A 2VKEA 2FX0A 4CYDA 3KEQA 3I71A 4GO1A 2LRDA 2VODA 3GMEA 1LVAA 4BU2A 4E7HA 1SFOJ 2M3AA 2JA5J 1UHSA 4RGSA 1LB2A 3F8MA 1YYVA 2DT6A 2OV7A 3VEPA 5KAFC 1A5JA 2HOAA 2OUMA 4HSRA 3ZMZA 2VUMJ 4FQGA 3HM5A 4IVNA 5E17F 3H35A 2FSWA 4KN4X 4XSXF 3GTQJ 3SEQA 4Y15A 2FQ4A 2XUBA 1ZKGA 4DZPA 4QLCU 1KU7A 2GXAA 3S1NJ 1RI7A 3CMEI 3WE2A 4A3EJ 1ZRDA 2BYVE 2ZCWA 4UVAA 3HTSB 5FLVA 4O6JA 4P96A 1W36D 4KA4A 1UMQA 2DODA 3EYYA 1SFKA 4M3GA 2E60A 4MFEA 2DFHA 2PX9A 5ILVA 1SD7A 1OJLA 1D0YA 1TTYA 1TZLA 2GZWA 3ABLH 2I8DA 1XSXA 1JE8A 2KLOA 2XHKA 5J4VA 2NS0A 4C3JJ 5L3EA 3V7SA 1N77A 4P5OA 4UVBA 3KP3A 3JRIA 3MKWB 1JXSA 4IQJA 1ETXA 4BXXJ 3HOUJ 2CW0F 1W7PA 4FE7A 5FLXK 3G1OA 2VQHA 4B1RA 4BBRJ 3BG7A 4XSZF 2CQQA 3R0JA 1QZYA 3DPLC 3WE3A 4ENNA 2RC4A 3QOPA 2O03A 1SANA 1XS9A 2EV6A 4EGYA 4MTDA 3F6OA 2IJLA 3KYDB 5DCFA 1SAUA 1JTYA 1A35A 4LG3A 1BI3A 2BXYA 4LIVA 2IPQX 3SFIA 5IOYA 2K3PA 2Y30A 4FE4A 4D5FA 1L3LA 5FD6A 2CGPA 2EJRA 2CV1A 3ZQ7A 4G9YA 2PMZA 3PIPF 2E36A 4RBOA 3OS2A 1F9NA 4UHTA 2F4IA 3W3CA 4L9NA 4GDFA 2QKLB 1SC7A 5E18F 5CQGA 3ISPA 1BBYA 2HZTA 3ROUA 1XTAA 4LIUA 3RDIA 5IY5H 2V1NA 3AL0B 3IRRA 2DW4A 4IOAF 1AU7A 4BL0B 3E0JB 1N78A 2L9VA 2PG4A 2PQ8A 4U87A 2HDWA 3BTJA 2B63J 2EILH 1OYYA 2IP2A 3BR0A 1UHWA 3WG7H 4E6KG 4EMSA 5KHDA 4S0HB 2NNNA 3PM1A 4LK0F 3CCSI 5EF6A 3S1RJ 3BCBA 1XGNA 1M1EB 1JUSA 4KFCA 4BQOA 1HW1A 2BW3B 3FBIB 1FBSA 3CP8A 5FKOA 4J01A 2FOKA 1A36A 2CRGA 2LK2A 3IHUA 4XRFA 5GPCA 2W82A 3P5JA 1MIJA 2L3DA 3KP7A 5DEQA 3ECOA 2JQ7A 1J75A 2O61A 1FX7A 2R5YA 3MVPA 4B48A 1YS7A 3J81K 2QKMB 2LD5A 1B72A 2ZSHB 3H3VK 2ECCA 1IG7A 2PEXA 3F8NA 3S93A 2UZKA 3R60A 1YLFA 2BXZA 4E4HA 2V9PA 1K78A 4B47A 3HRSA 2R7VA 3HOTA 2H6CA 4IXAA 3KETA 5JI6A 3BPXA 1UFMA 4YFNF 2ZXIA 3QRFF 5M3FJ 2E5ZA 5DUIA 2PFBA 2H27A 4GYIA 3RPUA 2XAFA 2O3FA 3LSRA 1Z67A 3HOSA 3GFIA 1RPWA 3HUGB 3ECHA 2QBYA 1FIPA 3PSFA 3JRBA 3NEUA 4KMUX 5E20A 4Q5SF 2K9QA 1PP7U 4ZZDA 2IEKA 4ZYHA 1S8NA 3DPUA 5FLMJ 3DEWA 5J1UA 1NHAA 1LJ9A 4XONA 1YI2I 2ZB9A 4EM1A 4ENJA 1K83J 2HYFA 2DOFA 3WTWC 4YIRX 1PUFA 4RLFA 1YX3A 3LFUA 4I7HA 3QP5A 4HYEA 1BIAA 1MH3A 2R7XA 1EJ9A 4X6AJ 5DYMA 1WJEA 1Y56A 2R5ZA 4PGHA 1BJZA 3A02A 2JZYA 2V7FA 3OS1A 2LF8A 3DPTA 4XLCA 4ON0A 3WTYC 1NK2P 3AG3H 4HA8A 5H6QA 1D1BA 1I6HJ 1UJ8A 1GV5A 4ESBA 2IS1A 1ON2A 4NBQA 4XOPA 3C7JA 4PSXA 4WCGA 1VQ5I 1WFXA 3ZMTA 2HQRA 2KL4A 3C3WA 3CJTB 3BZKA 3L2WA 2XGEA 2ACJA 1JT0A 3S14J 4AM3A 3BP8A 2G7HA 2JA8J 4XRSA 1FY7A 4RAGA 1IXRC 5EZGA 4AIJA 3V4GA 1UCRA 4MEXF 2K9NA 3S3NA 3KX2A 2KJCA 3J80Z 3PFIA 1GDTA 1D5VA 4EJTA 1LNWA 3LNQA 1YITI 2WBMA 4OU0A 3PNVA 2OC6A 4I0AA 3V8KA 3K4JA 2EIJH 4LG0B 2OF7A 4HDVA 2K4JA 3WTSC 2V26A 4MLOA 2KQRA 1KYZA 2E7XA 4XLEA 4Y33A 3S32A 5E1ZB 3GF2A 1PYVA 3I58A 1CQTA 2VJIA 4CCMA 3L9FA 2HYJA 3H0DA 1WJCA 2CQ7A 5J3LA 1P4WA 3I4PA 5L3DA 3ZMDA 2M34A 2VE8A 3BTCA 4XRSG 4A3DJ 4AU7A 3E3VA 2FBKA 4ZYGA 2Z9OA 4WF2A 1Z91A 5DD8A 2XKPA 3BR1A 3OYAA 2O8XA 4AIDA 4UNOA 4EVIA 3L09A 4NUBA 3SJMA 4D0PA 2L7FP 4P1WA 5IT9K 3WTZA 4HBLA 2NVXJ 1SD4A 2D1VA 3HSEA 4MO7A 2A6HF 1OR7C 1KONA 2PLYA 2I5UA 2P4WA 1Z3XA 4ZH4F 2AQFA 2MLGA 2DI3A 2DK5A 4NNJA 1K7AA 1WJBA 4BH9A 4M6XA 3BDDA 2V79A 5BNGA 3GLXA 2VJJA 1F43A 5EJCA 2ETHA 3SQNA 5HOOA 2FU4A 5M5XJ 2VN2A 2UWMA 3P9KA 1LVKA 2CWEA 2NXNB 4M3DA 1OYWA 4XNFA 3QQAA 3B73A 2XASA 1HBXG 2DA3A 3BROA 1O7FA 3A1YA 4U88A 1FTTA 2A69F 2LVSA 3HIFA 4HEA2 4OOIA 3PUFA 3QYEA 1ZGWA 3L2QA 4M74A 1VQ9I 4KMFA 1QHGA 3HG9A 1F1ZA 5FRNA 1Z05A 2KFDA 4HZFA 3K4KA 3JRFA 3K1PA 2DDBA 1YJ9I 1QA6A 1FP2A 1ERDA 2VKVA 1P7JA 2DJNA 4XKVA 3JCUC 2R7SA 1ZARA 2JUGA 2VT3A 2R7TA 4GGGA 5EEHA 3CD6I 1I1SA 1HXDA 4BACA 1B8IA 2R7DA 4XLAA 2LY2A 5FROA 2V4JC 1LFBA 1QZEA 5JR3A 4F3QA 2FNAA 4UUVA 3S1MJ 9ANTA 1UG2A 1IRXA 2HOEA 1OCCH 1H9GA 1FOWA 2COMA 1S7AA 2LC2A 1Z6TA 2XDVA 4BE2A 2Y75A 1IRGA 1D5YA 4XOTA 1IRZA 2XGDA 3O8GA 1IC8A 3FXRA 4D9JA 1RC9A 1BOAA 3EUHA 1AOYA 4UXNA 5DM6F 1MBFA 4HLYA 1MMAA 2AS5F 3S3MA 4E7JA 5D5VB 4A93J 2J5PA 1JJ8C 2HPMA 3EUAA 3TP0A 3J81Z 3JRHA 1ETOA 1R23A 2VBWA 4XRMA 1SFXA 1ZHFA 3DKXA 3MQ0A 3H1CA 3K10A 1IGNA 2VXZA 1Z6RA 3J7AY 1TWGJ 4N9IA 4IF4A 3OYKA 2RKHA 3X2QH 1REPC 1VZ0A 2GQQA 2HVQA 1XSVA 2FJ1A 2VBZA 3BJOA 2K85A 3WU1B 2E1OA 4AIKA 2JJ7A 3KFWX 3PFYA 3ZRGA 3DKWA 1U9OA 2B9SA 1X1BA 3ZCOA 3LL7A 2M7BA 3E97A 3UR3C 3S2WA 3G2BA 4EJVA 4QSHA 4I99C 5J40A 3GTKJ 4WX9A 2VBYA 2ELJA 1U9NA 1O57A 3CDLA 4L5JA 4ZJZA 1BI1A 4PJ0C 3O8HA 3IRQA 3AL0C 3PQJA 5M3MJ 3H9GA 4S04A 5F0FA 2MH9A 2EIMH 3CZ6A 1WZ2A 1XD7A 3I53A 2X6WA 2HVSA 4I01A 2JRMA 2DAOA 4QIWN 3L2RA 4FHTA 4UUTA 5A2QK 3FXQA 2EV0A 2KPMA 1FSHA 4NC6A 5FKLA 1LUJB 2NYXA 2D5VA 3IWZA 4X0GA 2E2IJ 4MFDA 1IN4A 1H89C 2DYSH 2V1UA 2FNPA 1Z0XA 2LBFB 2EB7A 4X1EA 3U21A 4BDZA 4ZTJA 1MSEC 1SAXA 1WVRA 2M45A 4QWQA 4WK8F 4OINF 1D8KA 4HV5A 1XMAA 1VQPI 2EZLA 1YE9A 1B1BA 1GLNA 2LY9A 2XGCA 2ZXHA 2MC4A 3G6EI 4M3EA 4P9UA 2W00A 4MQ9F 4IOCF 4J19A 2RVCA 1XDUA 5TGTA 3FXMA 1ETWA 1ZGAA 2FQ3A 1R36A 1S3JA 5K5RA 1WI9A 2F4OB 1YS6A 3QP6A 5B5EC 5C4JJ 3WHCA 3IP4B 1WSUA 4HSTA 3GUDA 5E8GA 1IZ1A 3FISA 3KYLA 2HNHA 4IEJA 4D7MA 4ZTFA 1I50J 4IO9F 1RKWA 1H8AC 2P8TA 3TBIA 3HZJA 4IRGA 1CF7B 3CCJI 3BT9A 3VDXA 1LDDA 1S7OA 4A5NA 1FSEA 2RN7A 2F5EA 2FF4A 2HFHA 2W84A 3VYSB 4ZC3A 2Q8KA 4I02A 4F55A 1JKPC 2DXIA 3IKVA 2G7UA 1MDMA 5EYRA 4XR6A 2EFQA 2B0LA 4HF2A 3WODF 4YIIA 2NS8A 3G3ZA 4G6TB 1E3OC 1KA8A 3UNGC 4CZCA 1QGPA 5FD5A 5DTDA 3OY9A 5EDNA 5GAHJ 3H0GJ 2VL8A 5BMZA 3VB2A 1ORKA 3BCAA 3LA2A 1H0MA 5ILSA 2V6CA 2FBIA 4I0BA 2DJIA 5DV5A 3VPRA 1XCVA 1LE8B 3CMYA 3HHHA 3PUBA 1Z1DA 4PFPA 2ZFUA 4L9JA 2ZC2A 2L54A 3TW7A 1SVMA 4RAYA 2FMYA 2GIVA 4N4OB 2EBIA 3CTAA 2R7FA 3TO7A 1MBHA 2A68F 2XAUA 5AIQA 4AD9A 1F4KA 2CFXA 3GXOA 1VQKI 2KRFA 3F6VA 5GTIC 3OOPA 2V9KA 3CMAI 2YPRA 1F36A 2V9VA 2Y0SN 3MCZA 1USTA 1BW6A 5F1RA 4HRIA 4Y17A 2EFPA 2X1EA 3LMMA 3WGGA 4JK1X 4BE0A 1K61A 1HLVA 2VQLA 2CQXA 3L00A 4XLNF 3RSNA 1OCOH 1E0EA 2R7OA 3MAJA 2QF7A 4B09A 3TGNA 2DQLA 4EEFG 3L2UA 2BOLA 2QSFX 3AG1H 5J8FA 4Q4ZF 2M8EA 3LOCA 3M8JA 3FIWA 4M6YA 2PI0A 1NK3P 3EUHC 5JHFA 3DTEA 1DP7P 1T08B 5EGOB 4XORA 1F5TA 1BA5A 1ACIA 2DA5A 2NVUB 1YTYA 2PMHA 2VC0A 3WTTC 3GO5A 1IJWC 1HOMA 3GCMA 3QU6A 3E7LA 2LREA 1KGSA 2BVMA 2AXLA 3TEDA 5JHUA 4XBFA 2WWYA 2QQ9A 3CC4I 4OAZA 1I39A 2B7EA 2M1BA 3K4LA 2H94A 3QYFA 1HDDC 3GFLA 1K6YA 1I27A 2KRHA 5E79C 1XX5A 2E71A 4MNUA 3ZQIA 1RESA 4M72A 3TO9A 3AG2H 3CCQI 4O5VA 2DMTA 3FKIJ 3BG9A 2EFNA 1J9IA 1ZG3A 1ZREA 3OWTA 3K1NA 1O3RA 5E1WA 1X2NA 1AHDP 4R1HA 4RAFA 4CXFA 2VB6A 4PJNA 1J59A 3FXKA 1HW5A 2JPCA 2DOEA 1OKRA 2XGXA 2Y9ZA 3KIOA 2M87A 1R1TA 3ABKH 4YG2F 2BY1A 1V55H 3CC2I 2DCEA 3DP7A 3D5SC 3Q0VA 3KPHA 2YU3A 2G9WA 1TWCJ 2XAGA 2OZ6A 1LQ1A 1R5HA 1G3YA 3I3LA 2O8KA 1IRFA 1CGPA 3RPQA 1T95A 2DTRA 4DNCA 3TDZC 2MABA 2QVOA 3G73A 1B6AA 2YX7A
chains in the Genus database with same CATH topology
4C3HJ 2CUFA 3OOUA 3K2AA 5F0CA 3HDDA 4G12A 3S14J 1JTXA 2EH3A 2XGEA 1JT0A 4JYKA 4JX4A 5EG0A 5EG0B 2JA8J 4XRSA 5EZGA 4DZJA 2K9NA 4JX5A 5FKKA 2WV1A 3JRGA 1JKRC 3GTPJ 1GDTA 1VI0A 2YU9J 3LNQA 3BTLA 4CYCB 4CYCA 4DYCA 2HDDA 3Q3SA 3ZQHA 2OF7A 3B6AA 1WGXA 4MLOA 1IDZA 2LKXA 3OSGA 2DA2A 1JJ6C 3JRAA 4GFBA 1VNDA 4LOCA 1O4XA 1CQTA 5M5YJ 2HYJA 2JA6J 1T33A 5DS9A 5IP7J 2L7ZA 5J3LA 3C2BA 2MGQA 5F0HA 4A3FJ 2RAEA 1WCMJ 4D5CA 2DN0A 2M34A 4XRSG 2YUSA 3BTCA 4A3DJ 3BR2A 2R92J 4M6VA 1ETQA 5FKNA 2W48A 4A3BJ 1ENHA 1GT0C 3BR1A 4IHVA 3L1PA 2ME0A 4UUSB 4UUSA 2KDZA 4DYQA 3SJMA 1RR7A 2L7FP 1EF4A 2XSDC 1FJLA 2E19A 2I10A 2NVXJ 4MO7A 5F1JA 4M3FA 1JKQC 4RDUA 4Y52J 1BW5A 2DA7A 1HCRA 3OIOA 1WH5A 3I4NJ 1P7IA 5BNGA 3OSFA 1F43A 1LFUP 3QPLA 1ZK8A 5E3LA 3S2DJ 2TRTA 3K7AJ 4V2FA 3DCFA 2P81A 5K7FA 5M5XJ 1FEXA 3G1MA 5K7HA 2ID3A 1IUFA 4A3IJ 4M3DA 2LLKA 3RKQA 3QQAA 1DU6A 1WPKA 2DA3A 2VPRA 3M4OJ 3JRDA 1FTTA 2LVSA 1NTCA 2N8GA 1VFCA 3BR5A 1ZGWA 4A3KJ 1Q1VA 1TWHJ 3GBGA 2WB1N 2HI3A 2XPUA 5E3MA 3GTMJ 3JRFA 2VKVA 2NS7A 1P7JA 2DJNA 4A3GJ 2R93J 2XB5A 3FK7A 4QTRA 2NVTJ 2X9DA 4L5EA 1R9TJ 3BQZA 2DMUA 1B8IB 1B8IA 4I6ZA 2EZIA 2G0EA 3LSJA 1GV2A 2XB0X 3BQYA 1LFBA 4JX6A 3ZOBA 3GTLJ 3S1MJ 2M8GX 1ETKA 5E3OA 9ANTA 1UG2A 4XIDA 2MSYA 4V2GA 3S1QJ 1YRNB 1YRNA 4B3AA 2K40A 5IOZA 5C3EJ 1WI3A 1D5YA 2E2HJ 1IRZA 2NVYJ 1AKHA 1AKHB 2XGDA 4DW6A 2EZHA 3O8GA 5HODA 3W6VA 1IC8A 1POGA 3G1LA 1MBFA 4A3CJ 1ZTRA 3Q0UA 2O7OA 1TC3C 1TWAJ 4A93J 3QPSA 3B6CA 1ZR4A 1JJ8C 4MIMA 3SDGA 1Y1VJ 1MSFC 2MG4A 1QVUA 3TP0A 3JRHA 2M0CA 3Q0WA 3FK6A 1ETOA 3TP3A 4XRMA 1JT6A 2LTPA 1FIAA 4AUXA 3A01A 3A01B 2H8RA 1Z77A 1IV6A 1IGNA 2TCTA 2XPVA 1G2HA 1TWGJ 1ZQ3P 4BY7J 2R0QC 3GTOJ 5JLXA 1BA5A 1MBJA 5EZHA 3MKLA 1A6IA 1Y1WJ 4HNVA 2K9SA 2AHQA 1T56A 2FJ1A 2O9LA 3BG5A 4D7NA 2DMPA 2IBDA 2ELKA 4FISA 2EQRA 2E1OA 5GPAA 2JJ7A 1GUUA 4BY1J 1GVDA 1U9OA 2NVQJ 2YS9A 5F27A 3GTJJ 2WAQN 1OFCX 3LSGA 3WHBA 4QSHA 3CCYA 4B4CA 3JREA 3GTKJ 5J1RA 2JA7J 4BKXA 1U9NA 1MBKA 4C3IJ 3LSPA 3CDLA 3M3YJ 4DYRA 3HOWJ 3NAUA 3S2HJ 1APLC 2DTZA 2L7MP 3O8HA 1H88C 4JP0A 3HBLA 5M3MJ 5F0FA 5GP9A 1MBEA 3S17J 3IH4A 1QVTA 2DA4A 2VKEA 2FX0A 2IAIA 4QIWN 4UUTA 1SFOJ 2JA5J 1UHSA 2L0KA 5FKLA 1A5JA 2NOGA 2HOAA 1OCPA 5EEAA 2D5VA 3NARA 2E2IJ 2JMWA 4MFDA 2JN6A 1ETYA 1H89C 2VUMJ 3S15J 5JLWA 3HM5A 1ZR2A 1Z0XA 5IP9J 5IYDJ 4X1EA 3GTQJ 1MSEC 2FQ4A 1W0UA 1ZKGA 4DZPA 3S1NJ 2EZLA 1MNMC 2XGCA 2LY9A 4A3EJ 1OCTC 5FLVA 4M3EA 1UMQA 2DA1A 2CJJA 2ECBA 3HGYA 4J19A 1WH7A 1ETWA 4M3GA 3BR3A 3ZQCA 4MFEA 5C4JJ 1W0TA 5F08A 3WHCA 1OJLA 5IYCJ 3RZDJ 2DMNA 5IP6A 1JUPA 1IDYA 3FISA 1XG1A 4W97A 1BL0A 4C3JJ 1JGGA 4A3JJ 4IEJA 4D7MA 1I50J 2GBYA 1RKWA 1H8AC 3IH2A 3JRIA 2Y9YA 3BTIA 1ETXA 4BXXJ 3HOUJ 3BT9A 2X6OA 4FE7A 2DMQA 3G1OA 2CUEA 4B1RA 2LR8A 4BBRJ 2Y31A 2CQQA 1JKPC 2R7ZJ 5EYRA 1SANA 2HOTA 1XS9A 2GM4A 2AO9A 2NS8A 2LFBA 3HOXJ 1E3OC 1RETA 2MW8A 3PO2J 1JTYA 2HQ5A 5DTDA 5EDNA 1QRYA 2ME6A 3ZQGA 3JRCA 5M5WJ 3H0GJ 3PO3J 1JUMA 3SFIA 3BR6A 1ORKA 3HB9A 5IOYA 2Y30A 3ZQFA 4FE4A 4D5FA 5C4XJ 2COBA 3VPRA 1I3QJ 2QCOA 1LE8B 1LE8A 3CMYA 2XPWA 3IH3A 3RQIA 3HOZJ 3D1NI 4IHWA 4RBOA 3TW7A 5FKMA 2FD5A 2EBIA 1MBGA 3IV5A 1U8BA 3GTGJ 1MBHA 3HEFA 3HOYJ 2M9HA 2M2EA 1AU7A 4FTHA 1ETVA 1F36A 5J1YA 2Y0SN 1BW6A 4FCYA 3BTJA 2E2JJ 2B63J 3BR0A 1VF9A 4S0HB 3RZOJ 1XC5A 3TW6A 3F0CA 2JWTA 1HLVA 1K61A 4IHXA 3PM1A 5IPAA 2CQXA 5EF6A 3S1RJ 2ID6A 1JUSA 2DA6A 2QF7A 4EEFG 4A3LJ 3LOCA 5FKOA 2JK3A 3FIWA 5F04A 2CRGA 1RKTA 1X2MA 2LK2A 1NK3P 5GPCA 5IYBJ 5EGOB 5EGOA 2R5YA 2R5YB 3HGGA 3MVPA 2CU7A 4A69C 2DA5A 2LD5A 1B72B 1B72A 3H3VK 2ECCA 1IG7A 1IJWC 1HOMA 2Y2ZA 2EZKA 3E7LA 2PMZN 3CQZJ 4XICA 3TEDA 1DU0A 2KT0A 3HKZN 5FJ8J 5M3FJ 3UKGA 1HDDC 5C44J 2OPTA 2GLOA 3LSRA 1QPIA 2HOSA 1RPWA 3ZQIA 2H1KA 3S16J 1RESA 1FIPA 4NDLA 3JRBA 2L9RA 1HDPA 4AYBN 2DMTA 3FKIJ 1ITYA 3BG9A 4BBSJ 2K9QA 4AC0A 4IHYA 3ZQLA 4I76A 2IEKA 2XRLA 2X48A 1U78A 5FLMJ 3DEWA 5J1UA 4ABZA 2LP0A 1X2NA 1AHDP 2ZB9A 1K83J 1HF0A 1FTZA 5E3NA 1PUFA 2HXOA 1PUFB 2Y9ZA 1JKOC 4W1UA 3A03A 1MH3A 3HOVJ 4Y7NJ 3BG3A 4M3BA 2VI6A 3Q0VA 4X6AJ 2R5ZA 2R5ZB 1X58A 1BJZA 3A02A 4XK4A 2HXIA 1TWCJ 5K7ZA 1TWFJ 4C2MJ 1MH4A 2O8KA 1NK2P 4A3MJ 3MN2A 3I4MJ 1S7EA 1I6HJ 1GV5A 3JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H J;  2CUF A;  3OOU A;  3K2A A;  5F0C A;  3HDD A;  4G12 A;  3S14 J;  1JTX A;  2EH3 A;  2XGE A;  1JT0 A;  4JYK A;  4JX4 A;  5EG0 A;  5EG0 B;  2JA8 J;  4XRS A;  5EZG A;  4DZJ A;  2K9N A;  4JX5 A;  5FKK A;  2WV1 A;  3JRG A;  1JKR C;  3GTP J;  1GDT A;  1VI0 A;  2YU9 J;  3LNQ A;  3BTL A;  4CYC B;  4CYC A;  4DYC A;  2HDD A;  3Q3S A;  3ZQH A;  2OF7 A;  3B6A A;  1WGX A;  4MLO A;  1IDZ A;  2LKX A;  3OSG A;  2DA2 A;  1JJ6 C;  3JRA A;  4GFB A;  1VND A;  4LOC A;  1O4X A;  1CQT A;  5M5Y J;  2HYJ A;  2JA6 J;  1T33 A;  5DS9 A;  5IP7 J;  2L7Z A;  5J3L A;  3C2B A;  2MGQ A;  5F0H A;  4A3F J;  2RAE A;  1WCM J;  4D5C A;  2DN0 A;  2M34 A;  4XRS G;  2YUS A;  3BTC A;  4A3D J;  3BR2 A;  2R92 J;  4M6V A;  1ETQ A;  5FKN A;  2W48 A;  4A3B J;  1ENH A;  1GT0 C;  3BR1 A;  4IHV A;  3L1P A;  2ME0 A;  4UUS B;  4UUS A;  2KDZ A;  4DYQ A;  3SJM A;  1RR7 A;  2L7F P;  1EF4 A;  2XSD C;  1FJL A;  2E19 A;  2I10 A;  2NVX J;  4MO7 A;  5F1J A;  4M3F A;  1JKQ C;  4RDU A;  4Y52 J;  1BW5 A;  2DA7 A;  1HCR A;  3OIO A;  1WH5 A;  3I4N J;  1P7I A;  5BNG A;  3OSF A;  1F43 A;  1LFU P;  3QPL A;  1ZK8 A;  5E3L A;  3S2D J;  2TRT A;  3K7A J;  4V2F A;  3DCF A;  2P81 A;  5K7F A;  5M5X J;  1FEX A;  3G1M A;  5K7H A;  2ID3 A;  1IUF A;  4A3I J;  4M3D A;  2LLK A;  3RKQ A;  3QQA A;  1DU6 A;  1WPK A;  2DA3 A;  2VPR A;  3M4O J;  3JRD A;  1FTT A;  2LVS A;  1NTC A;  2N8G A;  1VFC A;  3BR5 A;  1ZGW A;  4A3K J;  1Q1V A;  1TWH J;  3GBG A;  2WB1 N;  2HI3 A;  2XPU A;  5E3M A;  3GTM J;  3JRF A;  2VKV A;  2NS7 A;  1P7J A;  2DJN A;  4A3G J;  2R93 J;  2XB5 A;  3FK7 A;  4QTR A;  2NVT J;  2X9D A;  4L5E A;  1R9T J;  3BQZ A;  2DMU A;  1B8I B;  1B8I A;  4I6Z A;  2EZI A;  2G0E A;  3LSJ A;  1GV2 A;  2XB0 X;  3BQY A;  1LFB A;  4JX6 A;  3ZOB A;  3GTL J;  3S1M J;  2M8G X;  1ETK A;  5E3O A;  9ANT A;  1UG2 A;  4XID A;  2MSY A;  4V2G A;  3S1Q J;  1YRN B;  1YRN A;  4B3A A;  2K40 A;  5IOZ A;  5C3E J;  1WI3 A;  1D5Y A;  2E2H J;  1IRZ A;  2NVY J;  1AKH A;  1AKH B;  2XGD A;  4DW6 A;  2EZH A;  3O8G A;  5HOD A;  3W6V A;  1IC8 A;  1POG A;  3G1L A;  1MBF A;  4A3C J;  1ZTR A;  3Q0U A;  2O7O A;  1TC3 C;  1TWA J;  4A93 J;  3QPS A;  3B6C A;  1ZR4 A;  1JJ8 C;  4MIM A;  3SDG A;  1Y1V J;  1MSF C;  2MG4 A;  1QVU A;  3TP0 A;  3JRH A;  2M0C A;  3Q0W A;  3FK6 A;  1ETO A;  3TP3 A;  4XRM A;  1JT6 A;  2LTP A;  1FIA A;  4AUX A;  3A01 A;  3A01 B;  2H8R A;  1Z77 A;  1IV6 A;  1IGN A;  2TCT A;  2XPV A;  1G2H A;  1TWG J;  1ZQ3 P;  4BY7 J;  2R0Q C;  3GTO J;  5JLX A;  1BA5 A;  1MBJ A;  5EZH A;  3MKL A;  1A6I A;  1Y1W J;  4HNV A;  2K9S A;  2AHQ A;  1T56 A;  2FJ1 A;  2O9L A;  3BG5 A;  4D7N A;  2DMP A;  2IBD A;  2ELK A;  4FIS A;  2EQR A;  2E1O A;  5GPA A;  2JJ7 A;  1GUU A;  4BY1 J;  1GVD A;  1U9O A;  2NVQ J;  2YS9 A;  5F27 A;  3GTJ J;  2WAQ N;  1OFC X;  3LSG A;  3WHB A;  4QSH A;  3CCY A;  4B4C A;  3JRE A;  3GTK J;  5J1R A;  2JA7 J;  4BKX A;  1U9N A;  1MBK A;  4C3I J;  3LSP A;  3CDL A;  3M3Y J;  4DYR A;  3HOW J;  3NAU A;  3S2H J;  1APL C;  2DTZ A;  2L7M P;  3O8H A;  1H88 C;  4JP0 A;  3HBL A;  5M3M J;  5F0F A;  5GP9 A;  1MBE A;  3S17 J;  3IH4 A;  1QVT A;  2DA4 A;  2VKE A;  2FX0 A;  2IAI A;  4QIW N;  4UUT A;  1SFO J;  2JA5 J;  1UHS A;  2L0K A;  5FKL A;  1A5J A;  2NOG A;  2HOA A;  1OCP A;  5EEA A;  2D5V A;  3NAR A;  2E2I J;  2JMW A;  4MFD A;  2JN6 A;  1ETY A;  1H89 C;  2VUM J;  3S15 J;  5JLW A;  3HM5 A;  1ZR2 A;  1Z0X A;  5IP9 J;  5IYD J;  4X1E A;  3GTQ J;  1MSE C;  2FQ4 A;  1W0U A;  1ZKG A;  4DZP A;  3S1N J;  2EZL A;  1MNM C;  2XGC A;  2LY9 A;  4A3E J;  1OCT C;  5FLV A;  4M3E A;  1UMQ A;  2DA1 A;  2CJJ A;  2ECB A;  3HGY A;  4J19 A;  1WH7 A;  1ETW A;  4M3G A;  3BR3 A;  3ZQC A;  4MFE A;  5C4J J;  1W0T A;  5F08 A;  3WHC A;  1OJL A;  5IYC J;  3RZD J;  2DMN A;  5IP6 A;  1JUP A;  1IDY A;  3FIS A;  1XG1 A;  4W97 A;  1BL0 A;  4C3J J;  1JGG A;  4A3J J;  4IEJ A;  4D7M A;  1I50 J;  2GBY A;  1RKW A;  1H8A C;  3IH2 A;  3JRI A;  2Y9Y A;  3BTI A;  1ETX A;  4BXX J;  3HOU J;  3BT9 A;  2X6O A;  4FE7 A;  2DMQ A;  3G1O A;  2CUE A;  4B1R A;  2LR8 A;  4BBR J;  2Y31 A;  2CQQ A;  1JKP C;  2R7Z J;  5EYR A;  1SAN A;  2HOT A;  1XS9 A;  2GM4 A;  2AO9 A;  2NS8 A;  2LFB A;  3HOX J;  1E3O C;  1RET A;  2MW8 A;  3PO2 J;  1JTY A;  2HQ5 A;  5DTD A;  5EDN A;  1QRY A;  2ME6 A;  3ZQG A;  3JRC A;  5M5W J;  3H0G J;  3PO3 J;  1JUM A;  3SFI A;  3BR6 A;  1ORK A;  3HB9 A;  5IOY A;  2Y30 A;  3ZQF A;  4FE4 A;  4D5F A;  5C4X J;  2COB A;  3VPR A;  1I3Q J;  2QCO A;  1LE8 B;  1LE8 A;  3CMY A;  2XPW A;  3IH3 A;  3RQI A;  3HOZ J;  3D1N I;  4IHW A;  4RBO A;  3TW7 A;  5FKM A;  2FD5 A;  2EBI A;  1MBG A;  3IV5 A;  1U8B A;  3GTG J;  1MBH A;  3HEF A;  3HOY J;  2M9H A;  2M2E A;  1AU7 A;  4FTH A;  1ETV A;  1F36 A;  5J1Y A;  2Y0S N;  1BW6 A;  4FCY A;  3BTJ A;  2E2J J;  2B63 J;  3BR0 A;  1VF9 A;  4S0H B;  3RZO J;  1XC5 A;  3TW6 A;  3F0C A;  2JWT A;  1HLV A;  1K61 A;  4IHX A;  3PM1 A;  5IPA A;  2CQX A;  5EF6 A;  3S1R J;  2ID6 A;  1JUS A;  2DA6 A;  2QF7 A;  4EEF G;  4A3L J;  3LOC A;  5FKO A;  2JK3 A;  3FIW A;  5F04 A;  2CRG A;  1RKT A;  1X2M A;  2LK2 A;  1NK3 P;  5GPC A;  5IYB J;  5EGO B;  5EGO A;  2R5Y A;  2R5Y B;  3HGG A;  3MVP A;  2CU7 A;  4A69 C;  2DA5 A;  2LD5 A;  1B72 B;  1B72 A;  3H3V K;  2ECC A;  1IG7 A;  1IJW C;  1HOM A;  2Y2Z A;  2EZK A;  3E7L A;  2PMZ N;  3CQZ J;  4XIC A;  3TED A;  1DU0 A;  2KT0 A;  3HKZ N;  5FJ8 J;  5M3F J;  3UKG A;  1HDD C;  5C44 J;  2OPT A;  2GLO A;  3LSR A;  1QPI A;  2HOS A;  1RPW A;  3ZQI A;  2H1K A;  3S16 J;  1RES A;  1FIP A;  4NDL A;  3JRB A;  2L9R A;  1HDP A;  4AYB N;  2DMT A;  3FKI J;  1ITY A;  3BG9 A;  4BBS J;  2K9Q A;  4AC0 A;  4IHY A;  3ZQL A;  4I76 A;  2IEK A;  2XRL A;  2X48 A;  1U78 A;  5FLM J;  3DEW A;  5J1U A;  4ABZ A;  2LP0 A;  1X2N A;  1AHD P;  2ZB9 A;  1K83 J;  1HF0 A;  1FTZ A;  5E3N A;  1PUF A;  2HXO A;  1PUF B;  2Y9Z A;  1JKO C;  4W1U A;  3A03 A;  1MH3 A;  3HOV J;  4Y7N J;  3BG3 A;  4M3B A;  2VI6 A;  3Q0V A;  4X6A J;  2R5Z A;  2R5Z B;  1X58 A;  1BJZ A;  3A02 A;  4XK4 A;  2HXI A;  1TWC J;  5K7Z A;  1TWF J;  4C2M J;  1MH4 A;  2O8K A;  1NK2 P;  4A3M J;  3MN2 A;  3I4M J;  1S7E A;  1I6H J;  1GV5 A;  3JR9 A; 
#chains in the Genus database with same CATH topology
 1X4P A;  2CUF A;  4BXF A;  4PZJ A;  2P5V A;  4A2U A;  5F0C A;  4G12 A;  1FYK A;  3SEZ A;  2EH3 A;  1Y8Q B;  2YR2 A;  3QAH A;  5EG0 A;  1A04 A;  1UZC A;  3VOD A;  3JSP A;  3JW4 A;  3MZH A;  1YJW I;  4DZJ A;  3K1M A;  3FHN A;  4JX5 A;  3LSH A;  2PJR A;  4G94 A;  1TBX A;  2WV1 A;  4NQW A;  3MD2 A;  2MC3 A;  5A2Q Z;  1BR4 A;  4BGD A;  3RKY A;  1TT0 A;  4U7B A;  3EDP A;  3BTL A;  1TP4 A;  4CYC B;  2CV2 A;  1Y39 A;  1FPQ A;  3WU0 A;  2W25 A;  1GHC A;  4EAT A;  3ZQH A;  4DBR A;  3H36 A;  3SZG A;  5CJ9 A;  1D0Z A;  4P55 A;  1FBQ A;  3FXL A;  1IDZ A;  2LKX A;  1ZYR F;  2QEN A;  3CUQ B;  2KP6 A;  4FAS D;  1VQ4 I;  4U0Y A;  1JJ6 C;  3DV8 A;  5D6E A;  5LLQ A;  2BHY A;  3OYL A;  1YG2 A;  1XN7 A;  1P6R A;  1VND A;  3FM5 A;  3ERE D;  1O4X A;  1Q1H A;  4EV0 A;  1AWC A;  1X4O A;  4ZYE A;  5IP7 J;  2ZXW H;  2L7Z A;  2ZSI B;  4ZZL A;  5ERI A;  2EIK H;  5D8L B;  4M73 A;  3C1D A;  5B66 C;  4L9T A;  2JVH A;  2Q2E A;  2YUS A;  4KIC A;  1D8J A;  1TQP A;  3BWG A;  1RRJ A;  1FZP B;  1FYM A;  4G6Q A;  5FKN A;  2W48 A;  3I64 A;  1R00 A;  4CGZ A;  3L1P A;  2IW5 A;  4XLF A;  4UUS B;  2KDZ A;  4DYQ A;  1EH6 A;  3E5Q A;  4G7O F;  3K4C A;  1EF4 A;  1TLH B;  2PN6 A;  4LJZ F;  1TNS A;  2E19 A;  4KJZ A;  3DLA A;  4IX7 A;  5CVI A;  4PJJ A;  2IT0 A;  2BV6 A;  2CYY A;  2OD5 A;  2KJB A;  1E3P A;  2CV0 A;  2MA3 A;  3J80 K;  2HU9 A;  3QOD A;  1HCR A;  3JTH A;  4WWC A;  2KIS A;  4G6D A;  1XSD A;  1FMW A;  3KLO A;  2IS4 A;  3H9Q A;  1P7I A;  3AFH A;  3SHF A;  1XCB A;  3QPL A;  3TMO A;  5LHH A;  5E3L A;  4BQQ A;  3CCV I;  1LFU P;  4ZYA A;  4UV8 A;  3K7A J;  2ZNY A;  2P81 A;  3MWM A;  4JQF A;  4U0W A;  1TNT A;  4ENM A;  4FT8 A;  3RYR A;  5K7H A;  1IUF A;  5LHG A;  5L3B A;  1R22 A;  2GXG A;  5IT3 A;  3RKQ A;  5CKT A;  2EK5 A;  1O3T A;  3CUO A;  3EYI A;  5BOX A;  3M4O J;  3JRD A;  2VJ4 A;  2VT2 A;  4KT5 C;  2BY0 A;  3HHG A;  4CH7 A;  4XKW A;  4A3K J;  5HLT A;  3ONQ A;  4C2U A;  3L7W A;  5LRR A;  2ADU A;  2OZU A;  4QPO A;  1U5T A;  3GLL A;  1BC7 C;  2OTL I;  5E3M A;  1RUN A;  4B3X A;  2DO7 A;  2GOX B;  2R93 J;  5TIS C;  4LLN A;  3FK7 A;  4NC8 A;  1IN6 A;  3T5X A;  5JVG F;  2RRE A;  3CF5 F;  2K5C A;  1Z9C A;  5CVR A;  2FUG 2;  2GXB A;  2EZI A;  4BEH A;  1GV2 A;  4Y4R A;  5L3F A;  1XGO A;  5DCM A;  3TOB A;  1V5E A;  2M8G X;  4PDK A;  1EH8 A;  4EM2 A;  2VBX A;  4RS8 A;  3DEE A;  4EJU A;  3OR1 C;  1R71 A;  4OIP F;  2MSY A;  5LFA A;  3DBL B;  2VIX A;  1YRN A;  4A0Y A;  1YIO A;  2DDA A;  2IA0 A;  1ODD A;  5C3E J;  5HS8 A;  1RIO H;  3RYP A;  2W4S A;  3I5U A;  1EKE A;  2NVY J;  1AKH A;  2HKO A;  3IAM 2;  2EZH A;  2ISZ A;  3V7C A;  2V6E A;  3KZI C;  2LYC A;  3G1L A;  1ZTR A;  2ZO4 A;  3Q0U A;  2O7O A;  1SVO A;  3MZ8 A;  1HKS A;  2VQG A;  1MMS A;  1USS A;  2ESH A;  2ESN A;  3O6B B;  4MIM A;  1MSF C;  2MG4 A;  1QVU A;  3OYH A;  4OWR B;  2ZME A;  1BM9 A;  1BN5 A;  3Q0W A;  3P9C A;  2M0M A;  4HLX A;  3WTX C;  4D1Q A;  2F5C A;  4OAY A;  3TP3 A;  1JT6 A;  3VYU B;  2YX4 A;  1FIA A;  3GX4 X;  3A01 A;  2H8R A;  2RDP A;  2UXN A;  2BBY A;  4HF0 A;  3FF5 A;  2XPV A;  3L2C A;  3LAJ A;  1G2H A;  4DOZ A;  1ZQ3 P;  1JHH A;  3JAM Z;  1ZGJ A;  2A3S A;  5JLX A;  2R0Q C;  3GTO J;  2E1M C;  1A6I A;  3VYR B;  4B44 A;  1Y1W J;  2JA2 A;  5F6F A;  2OAZ A;  2K9S A;  1PVE A;  1V3F A;  3KEO A;  2O9L A;  3L2V A;  3QPH A;  5B1A H;  1NH3 A;  2DMP A;  4L0Y B;  1W5T A;  4L18 B;  2ZJQ F;  4FIS A;  1VQL I;  2EQR A;  3K4M A;  4CDG A;  2ZBK A;  1I6X A;  4R79 A;  5GPA A;  1TT5 B;  1GUU A;  4G7Z F;  3GWZ A;  2X4H A;  4S05 A;  1K79 A;  1VQ7 I;  1LEB A;  3I59 B;  2L4M A;  2X6X A;  1T2K A;  2WAQ N;  3LSG A;  3K4B A;  3HTU A;  1D1C A;  5BQT A;  1OCZ H;  4HV6 A;  2X85 A;  1E17 A;  4CCN A;  4NHJ A;  2HGC A;  4BKX A;  3LQR A;  3M3Y J;  3DF8 A;  3HOW J;  1BR2 A;  2DBB A;  1OQY A;  3GFJ A;  2QUF A;  3ABM H;  2DTZ A;  2L7M P;  2VXD A;  2QLZ A;  3FWE A;  3WTU C;  2OTJ I;  4JP0 A;  3HBL A;  3MZY A;  4KIS A;  1DPU A;  3S17 J;  4Z2Y A;  1HSJ A;  3ULQ B;  5LEJ A;  1MJB A;  2L9S A;  4DIQ A;  2QZ8 A;  4PJM A;  1ZG5 A;  4XLP F;  4V19 K;  2QSH X;  1W5C C;  1XB4 A;  2F5V A;  3N4M A;  1I5Z A;  1X3Z B;  3KLN A;  5JFR A;  2NOG A;  3GVA A;  1R7J A;  1VQO I;  5CVU A;  5D5U B;  2H8W A;  3OIQ A;  3S15 J;  1T39 A;  3FZV A;  4M9S A;  1R5I D;  5IP9 J;  1ONV A;  4F92 B;  5IYD J;  2P7C B;  6PAX A;  2KIM A;  5ED4 A;  2F48 A;  2P5K A;  1W0U A;  1MNM C;  3K6G A;  3OS0 A;  2QM3 A;  1OCT C;  2JUC A;  1V5G A;  2F2E A;  1IV8 A;  1MW7 A;  3BR3 A;  3EPZ A;  3J7Z I;  4A12 A;  4CA0 A;  2EIN H;  4U0V A;  3DKY A;  1TQI A;  1KZH A;  2BY3 A;  5IYC J;  3RZD J;  1MZB A;  1JUP A;  1DGW Y;  1IDY A;  1SD6 A;  5CPR B;  4F7Z A;  1XG1 A;  5ICF A;  1BL0 A;  2WAD A;  1H9T A;  1JGG A;  4A3J J;  2OQR A;  4KIB A;  2GBY A;  2WV0 A;  3DFG A;  3DXJ F;  3IH2 A;  3LAP A;  5TRD A;  2Y0S A;  2Y9Y A;  4MHG A;  4HDU A;  3S3O A;  4N9H A;  2X6O A;  3I54 A;  2ICW G;  1W7P B;  1PP8 F;  2XRN A;  2LR8 A;  4XKB A;  4LMY A;  2Y31 A;  3TL4 X;  2HWV A;  4BJ5 C;  3NQO A;  1MJ9 A;  1UHM A;  2V1X A;  2HOT A;  2WA0 A;  4M71 A;  3TQN A;  1TW2 A;  2GM4 A;  2AO9 A;  3PNT A;  1R1V A;  2CSO A;  2EWN A;  4RA2 A;  2LFB A;  4A6D A;  4RB0 A;  3HOX J;  1K6O A;  1X1P A;  2MW8 A;  1U8R A;  5J6X A;  1KQ9 A;  5LD2 C;  3ZMU A;  3FX3 A;  1Y0U A;  1W1W E;  1QRY A;  5J47 A;  3ZQG A;  4KIT B;  3JRC A;  2F5D A;  3BR6 A;  1GXQ A;  1WJ5 A;  3CCU I;  1LDJ A;  4AWX B;  3CJR B;  4DGW B;  5C4X J;  2QGU A;  2Z1D A;  3A4C A;  1I3Q J;  4ITV A;  4IZZ A;  5B1B H;  3IH3 A;  3RQI A;  3HOZ J;  3HSF A;  2BVL A;  3CF2 A;  3K69 A;  4IHW A;  5FRM A;  3K0L A;  3B02 A;  4A0X A;  3ASO H;  2VQC A;  3BZC A;  1SD5 A;  1SEU A;  2FD5 A;  4HX7 A;  1MBG A;  3IV5 A;  2EFW A;  3GTG J;  4Y3O A;  2EFO A;  3KZY A;  4WXH A;  1S6L A;  2KZG A;  3HEF A;  3HOY J;  3OL4 A;  1XMK A;  3RIR A;  4BAY A;  4IHT A;  4CZZ A;  2JSC A;  4FTH A;  2ISY A;  4AVZ A;  5H2F C;  4RGR A;  1QBJ A;  2XF5 A;  4AYB A;  4RGU A;  4CHU A;  4E7I A;  2P5L C;  2LY1 A;  1P4X A;  1LKX A;  1VF9 A;  3DQV C;  3RZO J;  1XC5 A;  3HJE A;  2VLA A;  4IHX A;  5IPA A;  1ZLJ A;  4BJT A;  1Y0N A;  3HSR A;  3CMM A;  4EGZ A;  4HQM A;  3LWF A;  2DA6 A;  2HQA A;  4N0B A;  3OYN A;  2BW3 A;  2A61 A;  2KIQ A;  1EV7 A;  2NAZ A;  5CQE A;  1DUX C;  2JK3 A;  1Z21 A;  2DT5 A;  2LDU A;  5F04 A;  2F4M B;  1DDN A;  5L3C A;  2IRF G;  1YIJ I;  4TV7 A;  1IXS B;  2X1C A;  4HNU A;  3IKT A;  2WTE A;  3C18 A;  3R61 A;  2R5Y B;  3HGG A;  2CU7 A;  1Y8R B;  5D5X B;  1PJR A;  1B72 B;  3ERM A;  4PK4 A;  4RM2 A;  2Y2Z A;  5BPI A;  4IL6 C;  2EZK A;  1K78 B;  2HYG D;  4KYW A;  1TW3 A;  3CQZ J;  3ZGK A;  2AXT C;  3CES A;  3O2P E;  3E5U A;  2KT0 A;  3HKZ N;  5FJ8 J;  1L0O C;  2XAQ A;  1MD0 A;  3VOE A;  2OPT A;  2GLO A;  2VPL A;  1QPI A;  4A5M A;  3F21 A;  1GXP A;  2H1K A;  3HUG A;  5FLX Z;  2MFZ A;  2QBY B;  2L9R A;  3H5N A;  3MEX A;  1HDP A;  4AYB N;  2QYO A;  4BBS J;  2DPU A;  3H3U A;  2W7N A;  2X48 A;  1U78 A;  5KVR A;  1SFE A;  3M1C A;  3OYF A;  1P4A A;  4ABZ A;  2LP0 A;  3EQL F;  4L0Z B;  4IRI A;  5LEK A;  1HF0 A;  3LFK A;  4GXO A;  1FTZ A;  5E3N A;  1PUF B;  2ZXJ A;  1VQ8 I;  3A03 A;  4W1U A;  4HF1 A;  1XPX A;  3HOV J;  3BG3 A;  4M3B A;  3SZT A;  2VI6 A;  1QNT A;  2STT A;  4M9Z A;  5K5O A;  2R5Z B;  3FMR A;  5LHI A;  2DPD A;  4XK4 A;  2M5W A;  3I9V 2;  2FOW A;  5K7Z A;  1D0X A;  2CW8 A;  4ESF A;  2R7W A;  2W57 A;  4BE1 A;  1OPC A;  2KIF A;  4H0E A;  3JR9 A;  3H3Z A;  2P6T A;  2OJE D;  2JSP A;  4IPA A;  4C3H J;  1OIS A;  3CDH A;  1XMX A;  3OOU A;  2O5R A;  1QQI A;  1HW2 A;  2IGK A;  2ZME C;  4E7S A;  2HEO A;  3OYI A;  4MQV A;  3TDU C;  4JYK A;  2IS6 A;  4FET A;  3A2K A;  2OU2 A;  5CVV A;  3A0B C;  3GW2 A;  1R6R A;  4M9X A;  3ZQQ A;  3JRG A;  3FXU A;  1ZLK A;  4II3 A;  3DEU A;  1JHF A;  2J5O A;  3KP5 A;  1VI0 A;  3T1B A;  1S72 I;  4RMN A;  2YU9 J;  3G71 I;  3AKZ A;  1Z7L A;  2GWR A;  4FX0 A;  2LSO A;  1A31 A;  2HDC A;  2ZJP F;  2V1D A;  3Q3S A;  2HDD A;  4C30 A;  4LG0 A;  1BIB A;  2UUZ A;  3B6A A;  2JRT A;  3K4N A;  4KIF A;  1WGX A;  4BYY A;  4Y13 A;  1C0W A;  1VQN I;  3OSG A;  2X6Y A;  2DA2 A;  2XVC A;  4BDY A;  1V4R A;  1X19 A;  4ASN A;  3JSO A;  3SXY A;  3QWL A;  5LGT A;  1MNE A;  2LOO A;  1IXC A;  5M5Y J;  4U7D A;  2JA6 J;  1T33 A;  1R58 A;  5DS9 A;  3G4S I;  2MH2 A;  3C2B A;  3W2V A;  2F6C A;  5F0H A;  3W2W A;  5D4R A;  3MKY B;  1WCM J;  4HAM A;  4A3F J;  2DN0 A;  1GVJ A;  3T8T A;  3BLY A;  3BR2 A;  2R92 J;  5HS7 A;  4HOB A;  1LPQ A;  3OYG A;  4M6V A;  2VAS A;  3EET A;  2Y0M A;  1ENH A;  1GT0 C;  2MD0 A;  3F8C A;  2VON A;  3R4K A;  4MTE A;  3LSM A;  3SFZ A;  2D1H A;  3OYB A;  4L5I A;  1B9M A;  3SDB A;  2QQA A;  1FT9 A;  2HQN A;  4YEJ A;  1FJL A;  3M8E A;  3ZPL A;  3M7G A;  2I10 A;  5GAD J;  4YIF A;  1Z3Y A;  4M3F A;  4RDU A;  3M8F A;  3IL2 A;  1BW5 A;  4O3M A;  3E5X A;  2P6S A;  1G3W A;  3K9T A;  2XIG A;  4KN7 X;  2ELH A;  2CG4 A;  4L9V A;  3F72 A;  5HDK A;  3OSF A;  4XN0 A;  3I4N J;  1ZK8 A;  3WGI A;  3HC7 A;  3KYC B;  4P9F A;  1YQA A;  2QQB A;  4BUP A;  4KNY A;  2TRT A;  4V2F A;  4DQ2 A;  5K7F A;  3PIO F;  2VKH A;  1FEX A;  1SMT A;  1BI0 A;  3DWL E;  5LGU A;  3I55 I;  2QEX I;  2KKO A;  1DU6 A;  3DBR B;  1WPK A;  1I1G A;  2VPR A;  3N97 A;  1VTN C;  1T6S A;  3PL8 A;  1K4S A;  1NTC A;  2N8G A;  1VFC A;  2OCC H;  2JVG A;  2FA5 A;  2CMP A;  1T38 A;  3FMQ A;  4HPQ A;  1Q1V A;  2L02 A;  1TWH J;  4K2E A;  3D0S A;  4JOM A;  3WG9 A;  3WU2 C;  3GTM J;  2WB1 N;  2HI3 A;  2JTV A;  5HLH A;  3F8F A;  2F5F A;  2NS7 A;  3H9J A;  4A3G J;  1D3Y A;  4DJA A;  1BC8 C;  2KRC A;  1K4T A;  2LH9 A;  1YFH A;  4IJA A;  2HR3 A;  4L5E A;  5H20 A;  2DMU A;  1B8I B;  1S5L C;  4OMZ A;  2A05 A;  3W2A A;  2XB0 X;  4JX6 A;  1ZG1 A;  3WGH A;  3R0A A;  2CW7 A;  1FMV A;  2W85 A;  2DK8 A;  3OYD A;  3CO6 C;  2KMU A;  3H92 A;  3PNY A;  4HX4 A;  4PSW A;  4V2G A;  4Z6Y A;  1HKQ A;  5FFZ A;  4B3A A;  2K40 A;  5CVJ A;  2Q1Z B;  4OIR F;  4N4N B;  2A6E F;  5KCM A;  2ZKZ A;  3O3K A;  2CS3 A;  3BJA A;  3IUO A;  3VYT B;  2E2H J;  4I98 B;  5HOD A;  3W6V A;  4B43 A;  2E34 A;  4BQN A;  3Q9V A;  3RCO A;  1XGM A;  1PUE E;  2FBH A;  1MMD A;  2O0Y A;  5D5W B;  4A6E A;  1TC3 C;  4CCL A;  1V54 H;  4CCJ A;  1XGS A;  2X51 A;  1RUO A;  1ZH5 A;  4KIG A;  3SDG A;  1Y1V J;  1J09 A;  4BHC A;  1O3Q A;  1YJN I;  1NG7 A;  1S9H A;  1BJA A;  2M0C A;  2QWW A;  2Z5U A;  2PJP A;  3GZ6 A;  1T0F A;  1D1A A;  2DFE A;  2LTP A;  1R4N B;  3KZZ A;  1Z77 A;  2OCE A;  2K3F A;  1IV6 A;  3BJ6 A;  3BPV A;  5HVQ C;  1N75 A;  1R4M B;  1SVL A;  1QU3 A;  3RQ4 A;  3CLO A;  3J7A O;  5EZH A;  2D45 A;  4HNV A;  5HLI A;  1HKT A;  2AHQ A;  1T56 A;  5ICG A;  3DLL F;  4D7N A;  1OCR H;  1WQ2 A;  1RZ4 A;  1S29 A;  2EA2 A;  2ELK A;  1UG0 A;  4J00 A;  1IF1 A;  5J8C A;  2HVR A;  1KQ8 A;  4BY1 J;  1GVD A;  4F91 B;  1J0R A;  2OA4 A;  3KP6 A;  5HNF A;  2YS9 A;  3I0T A;  3LA3 A;  5F27 A;  4R8H A;  1OFC X;  1HA8 A;  4DBQ A;  2RQP A;  3W6K B;  3WHB A;  3CCY A;  4B4C A;  3JRE A;  4UV9 A;  2GA2 A;  1UB9 A;  3V8J A;  2K4B A;  3BZ6 A;  1MBK A;  4C3I J;  3IC7 A;  2UXX A;  4Q48 A;  1G4D A;  3NAU A;  1H88 C;  4PUS A;  2VOP A;  1B59 A;  5FGM A;  1T0F C;  2DA4 A;  2A6T A;  1ZRF A;  2R4G A;  3NWS A;  2K7L A;  2CO5 A;  2LKP A;  2IAI A;  3HYI A;  3HXL A;  2K9L A;  3OMY A;  3U2R A;  4RLQ A;  4HW0 A;  3I56 I;  4I2O A;  2L0K A;  3CDI A;  3HKZ A;  2KIU A;  2LKS A;  1OCP A;  4UVC A;  3CJQ B;  3ZMS A;  5EEA A;  3CCL I;  2EA4 A;  1O7L A;  3NAR A;  3U9G A;  2JMW A;  4UB6 C;  2JN6 A;  1ETY A;  3E6B A;  2MD5 A;  4RGX A;  4F93 B;  5JLW A;  1G59 A;  1ZR2 A;  3VSK A;  2LBF A;  2CQK A;  2ZNZ A;  4RB1 A;  2RQQ A;  1J7K A;  3HRM A;  2KHM A;  4EJW A;  3OIP A;  3ZXS A;  3V42 A;  1OLT A;  5HDN A;  2DA1 A;  2CJJ A;  2ECB A;  3HGY A;  4PCQ A;  3FXJ A;  2CH0 A;  1WH7 A;  2E1M B;  3DTK A;  3RJP A;  1W5S A;  3ZQC A;  3AG4 H;  1W0T A;  4II2 A;  5F08 A;  4AIH A;  1G8X A;  3GYH X;  3T0Y A;  2DMN A;  5IP6 A;  2XAH A;  3M1E A;  5J4Y A;  3K70 D;  3TO6 A;  5HLG A;  3T8R A;  4OIQ F;  4W97 A;  1YHQ I;  3ELK A;  4BHP A;  2XF6 A;  3H5R A;  3P7N A;  2VC1 A;  3R6S A;  3BTI A;  4AVP A;  1CF7 A;  3N05 A;  1WHU A;  2LG4 A;  2Y69 H;  2DMQ A;  3ZN0 A;  2CUE A;  4E7K A;  1X1A A;  3OL3 A;  4UY8 I;  2R7Z J;  3BC8 A;  2WY7 Q;  1MDM B;  4MGR A;  1IW7 F;  2FE3 A;  3JAM K;  4XL9 A;  3PJR A;  4PGG A;  1BI2 A;  3OR2 C;  4ENK A;  2FEZ A;  5D6F A;  4HNT A;  1KU3 A;  1ON1 A;  2L5Q A;  3BOQ A;  1VQ6 I;  3QYB A;  5DD4 A;  2RNG A;  3PQK A;  2BE5 F;  1RET A;  3PO2 J;  5FB2 A;  3S8P A;  2HQ5 A;  1QO0 D;  4RM3 A;  5DUK A;  2BGC A;  2ME6 A;  2H1L A;  5M5W J;  3PO3 J;  4OMY A;  3CLQ A;  1JUM A;  1YO5 C;  3RKX A;  3TKY A;  1FBU A;  5FO5 A;  3HB9 A;  5CYV A;  3ZQF A;  4CO8 A;  1DGR M;  3DU6 A;  2COB A;  2JPB A;  1FNN A;  4YRV A;  1HST A;  1MMN A;  1OR7 A;  2QCO A;  3J7Y J;  4XMY A;  1LE8 A;  3OYJ A;  2XPW A;  4FX4 A;  2KZV A;  5ICC A;  3D1N I;  4RB3 C;  4PFO A;  2L4A A;  5FKM A;  3V7R A;  2A07 F;  2L2O A;  2EV5 A;  1U8B A;  3MFK A;  2GA1 A;  4BHB A;  1FC3 A;  2IVM A;  2O6G E;  2K9M A;  2M9H A;  2M2E A;  3F23 A;  1QZZ A;  3FHZ A;  3A0H C;  1V5F A;  2WB1 A;  3WTV C;  1KU2 A;  4YEL A;  1ETV A;  4BNC A;  3H5A A;  1R1U A;  5J1Y A;  3FDY A;  1G6N A;  3FMS A;  1EA3 A;  5H6R A;  4FCY A;  2E2J J;  5BS6 A;  4ZYD A;  2Z33 A;  4KUM A;  2NRA C;  3Q9S A;  3TW6 A;  3F0C A;  2JWT A;  4EM0 B;  3ZP5 A;  5GAG J;  2WC2 A;  2BEO A;  2NOJ B;  3E6M A;  2IA1 A;  3CCM I;  2ID6 A;  2WAE A;  2LNB A;  4ETS A;  3HL2 A;  1IUY A;  4YFK F;  4A3L J;  4LLG F;  5E8I A;  3HRT A;  5BPD A;  1RKT A;  1X2M A;  3CJN A;  1W4M A;  4E7L A;  3GZN B;  5IYB J;  4ANJ A;  4IKF A;  5L3G A;  2E1N A;  5EGO A;  2DOA A;  4A69 C;  2L9N A;  2P7V B;  2XF7 A;  2E1C A;  3CUQ C;  4WXD A;  3CP2 A;  2X0L A;  1X3W B;  1J5Y A;  2MLK A;  2PMZ N;  1LEA A;  2E7W A;  4GCV A;  4XIC A;  2MYS A;  1TL8 A;  4BXU A;  5DM7 F;  1DU0 A;  2DT7 B;  4YFX F;  3UKG A;  5C44 J;  3MKZ A;  1U3E M;  2IS2 A;  2BZT A;  4CUG A;  4RAZ A;  4HX8 A;  3LSK A;  2HOS A;  2IGM A;  3S16 J;  1U2W A;  4NDL A;  3DTI A;  5KK1 A;  2BHZ A;  1DQU A;  2RV8 A;  1ITY A;  3ZMV A;  2BY2 A;  3IWF A;  1FOX A;  3GEZ A;  3LSI A;  4AC0 A;  2NNY A;  4IHY A;  3ZQL A;  1U6G A;  4I76 A;  5LGN A;  2XRL A;  1FYL A;  2DYR H;  2LF7 A;  3E6C C;  4B8X A;  4G8X A;  2HTS A;  2GIZ A;  3M07 A;  1SMY F;  3ZR8 X;  3DBH B;  5LRS A;  2HXO A;  2XAJ A;  2XV4 S;  5ILU A;  1JKO C;  2CUJ A;  2L01 A;  3ML6 A;  2Z99 A;  3FXO A;  1Z7U A;  3AAF A;  1JGS A;  4CCO A;  4Y7N J;  3KEY A;  3FM3 A;  3Q5F A;  4BS9 A;  1E2X A;  1X58 A;  2HXI A;  2YSR A;  5TJJ A;  1TWF J;  1MMG A;  4C2M J;  1MH4 A;  4A0Z A;  1G3S A;  1KYW A;  2TDX A;  3HRU A;  3P9I A;  3M9A A;  2GOM A;  4A3M J;  2A5W A;  3MN2 A;  1S7E A;  3I4M J;  1JI8 A;  2P0W A;  3ZN1 A;  2XSJ C;  5HNH A;  2Y48 A;  2R7R A;  5HDG A;  5GAE J;  1RR8 C;  3VSL A;  5AON A;  4LGW A;  2HS5 A;  4XKC A;  2M4G A;  3K2A A;  1IO2 A;  1FWZ A;  3HDD A;  2PBI A;  1JTX A;  1J2X A;  2Z2S B;  1DP3 A;  4JX4 A;  5EG0 B;  2Z16 A;  5IT9 Z;  1N25 A;  1EH7 A;  1YW8 A;  2ZJ2 A;  3FBN B;  5FKK A;  2PJR B;  2D2W A;  2W1O A;  4NQW B;  3CO7 C;  1JKR C;  4Q47 A;  4UB8 C;  3NRV A;  3GTP J;  4LB6 B;  3QPT A;  4XLH A;  3W6J B;  4LD5 A;  3HPG A;  1MND A;  1MKM A;  1STZ A;  4H4K C;  4NB5 A;  4DYC A;  4CYC A;  1FP1 D;  1Y6I A;  3E1S A;  3F8B A;  3U1K A;  1ZN2 A;  2UV1 A;  3CCR I;  2K86 A;  2RNJ A;  1WRJ A;  3CUQ A;  4LFU A;  1BR1 A;  2X1D A;  5K1Y A;  3MMY B;  2ZFW A;  4ZDL A;  3RPU D;  4BJ6 C;  1VQM I;  3JRA A;  3LQQ A;  4GFB A;  2IGN A;  3OYE A;  2FML A;  3CC7 I;  1XDS A;  2DQR A;  4LOC A;  4IRH A;  2XRO A;  1P2F A;  1IN5 A;  4CSW A;  1WKM A;  1ZAO A;  4KDP A;  2DU9 A;  2MGQ A;  3F3X A;  3GFM A;  1WWX A;  2RAE A;  4D5C A;  5EEG A;  2QQ8 A;  4WXC A;  2Q2E B;  1O3S A;  3GZ5 A;  4OIO F;  1ETQ A;  2KDO A;  1PDN C;  4IHS A;  5CLS A;  4EJO A;  4A3B J;  1W36 C;  2QSG X;  4IHV A;  3VWB A;  4LB5 A;  2ME0 A;  2DFF A;  4F52 A;  4CCK A;  4UUS A;  2R3S A;  1BOB A;  3ABU A;  2HZD A;  4IQ4 A;  1RR7 A;  2XSD C;  1MGT A;  4XN3 A;  1WJD A;  1OMI A;  3QU3 A;  2WY8 Q;  3LA7 A;  5FFX A;  3RI4 A;  2WAF A;  5F1J A;  2M30 A;  2A5Y B;  5GTH C;  3OYC A;  3E6D A;  1JKQ C;  2GAU A;  1WJF A;  4Y52 J;  1SFU A;  2FXA A;  5HS9 A;  2DA7 A;  3OIO A;  5AIP A;  1WH5 A;  2C6Y A;  1X1D A;  3DU5 A;  4NC7 A;  2E35 A;  4C9Y A;  1U5T C;  3SZP A;  3JTG A;  4BQA A;  3C2G A;  3S2D J;  1DPR A;  3FKJ A;  1E3H A;  5K5Q A;  3DCF A;  4LLL A;  3G1M A;  2ID3 A;  4A3I J;  2LLK A;  5ICE A;  3TOA A;  4GYG A;  2M4K A;  3KP2 A;  2H09 A;  2Z3Y A;  1ZEL A;  1KQ0 A;  3BR5 A;  3K2Z A;  1T98 A;  4RB2 C;  2VE9 A;  4KT6 A;  1KU9 A;  1U5T B;  3GBG A;  2XPU A;  1X3U A;  3HPH A;  4EQQ A;  2L7K A;  3BY6 A;  2E5N A;  2XB5 A;  4QTR A;  5KNL A;  2CQN A;  2NVT J;  1YX5 A;  1TQM A;  2X9D A;  3PSI A;  4MEY F;  1R9T J;  3BQZ A;  2AQE A;  2R7Q A;  5KAI C;  5D4S A;  3REO A;  1I3A A;  4I6Z A;  2VOO A;  3C2H A;  2G0E A;  3LSJ A;  4BEH B;  1IN7 A;  1A6Q A;  3BQY A;  4HG2 A;  3KP4 A;  5JVT A;  2W24 A;  3ZOB A;  2CFO A;  3OV8 A;  3GTL J;  5DCM B;  2R7U A;  1ETK A;  4LIT A;  5E3O A;  4G7H F;  2RGV A;  1YOV B;  2IXS A;  3KCC A;  4CIC A;  4XID A;  3S1Q J;  4JBA A;  2CUZ A;  1YRN B;  2PMU A;  5IOZ A;  1WJA A;  4LK1 F;  1WI3 A;  3V8L A;  4ESJ A;  1IN8 A;  1AKH B;  4DW6 A;  2XKO A;  2OBP A;  1LFP A;  2JT1 A;  2DLL A;  1POG A;  1OYI A;  4A3C J;  3F22 A;  4E7Z A;  3ASN H;  3BG6 A;  1TWA J;  3F9K A;  3QPS A;  1X1C A;  1YW7 A;  3B6C A;  1ZR4 A;  1FOK A;  4PJL A;  2MBF A;  2ZME B;  1B4A A;  4ZDO A;  2VKD A;  3FK6 A;  2LMD A;  4XM3 A;  3COA C;  1UEL B;  2DFI A;  4GRI A;  3D5L A;  2XC7 A;  4AUX A;  1W7P D;  3A01 B;  2VJ5 A;  3EUK L;  2TCT A;  1IAW A;  2EPF A;  1FLI A;  1G3T A;  4BY7 J;  2K02 A;  3ESW B;  1HQC A;  4E70 A;  5LBQ A;  1MBJ A;  3CCE I;  3MKL A;  5F64 A;  2FRH A;  2K27 A;  3KE2 A;  5B3S H;  1P92 A;  4C2T A;  3NWT A;  1LDK B;  4QPQ A;  1MJA A;  1QPM A;  3IAS 2;  3BG5 A;  1RNL A;  2IBD A;  2HPI A;  3SYT A;  3D5R C;  5D8K B;  2HTJ A;  3I59 A;  2ZJR F;  2NVQ J;  3RKW A;  4HQE A;  3GTJ J;  2IA2 A;  1U0J A;  2STW A;  3RTR A;  1T8I A;  1R49 A;  3K70 C;  1QHH D;  1ULY A;  2OQG A;  2WAQ A;  5J1R A;  2Q0O A;  2JA7 J;  4XQF A;  1YW9 A;  2H6B A;  3LSP A;  1B9N A;  1UAA A;  3LST A;  4ZDP A;  4DYR A;  3ABT A;  3S2H J;  4I09 A;  3QOE A;  5DDG A;  1P9Q C;  2QA4 I;  1APL C;  1ZRC A;  1NG6 A;  1HC8 A;  1R5G A;  2IGO A;  2HKX A;  3VFZ A;  5E1X A;  1MBE A;  5GP9 A;  2M7A A;  3U1D A;  1FOY A;  3OYM A;  1AA7 A;  1QVT A;  3IH4 A;  2VKE A;  2FX0 A;  4CYD A;  3KEQ A;  3I71 A;  4GO1 A;  2LRD A;  2VOD A;  3GME A;  1LVA A;  4BU2 A;  4E7H A;  1SFO J;  2M3A A;  2JA5 J;  1UHS A;  4RGS A;  1LB2 A;  3F8M A;  1YYV A;  2DT6 A;  2OV7 A;  3VEP A;  5KAF C;  1A5J A;  2HOA A;  2OUM A;  4HSR A;  3ZMZ A;  2VUM J;  4FQG A;  3HM5 A;  4IVN A;  5E17 F;  3H35 A;  2FSW A;  4KN4 X;  4XSX F;  3GTQ J;  3SEQ A;  4Y15 A;  2FQ4 A;  2XUB A;  1ZKG A;  4DZP A;  4QLC U;  1KU7 A;  2GXA A;  3S1N J;  1RI7 A;  3CME I;  3WE2 A;  4A3E J;  1ZRD A;  2BYV E;  2ZCW A;  4UVA A;  3HTS B;  5FLV A;  4O6J A;  4P96 A;  1W36 D;  4KA4 A;  1UMQ A;  2DOD A;  3EYY A;  1SFK A;  4M3G A;  2E60 A;  4MFE A;  2DFH A;  2PX9 A;  5ILV A;  1SD7 A;  1OJL A;  1D0Y A;  1TTY A;  1TZL A;  2GZW A;  3ABL H;  2I8D A;  1XSX A;  1JE8 A;  2KLO A;  2XHK A;  5J4V A;  2NS0 A;  4C3J J;  5L3E A;  3V7S A;  1N77 A;  4P5O A;  4UVB A;  3KP3 A;  3JRI A;  3MKW B;  1JXS A;  4IQJ A;  1ETX A;  4BXX J;  3HOU J;  2CW0 F;  1W7P A;  4FE7 A;  5FLX K;  3G1O A;  2VQH A;  4B1R A;  4BBR J;  3BG7 A;  4XSZ F;  2CQQ A;  3R0J A;  1QZY A;  3DPL C;  3WE3 A;  4ENN A;  2RC4 A;  3QOP A;  2O03 A;  1SAN A;  1XS9 A;  2EV6 A;  4EGY A;  4MTD A;  3F6O A;  2IJL A;  3KYD B;  5DCF A;  1SAU A;  1JTY A;  1A35 A;  4LG3 A;  1BI3 A;  2BXY A;  4LIV A;  2IPQ X;  3SFI A;  5IOY A;  2K3P A;  2Y30 A;  4FE4 A;  4D5F A;  1L3L A;  5FD6 A;  2CGP A;  2EJR A;  2CV1 A;  3ZQ7 A;  4G9Y A;  2PMZ A;  3PIP F;  2E36 A;  4RBO A;  3OS2 A;  1F9N A;  4UHT A;  2F4I A;  3W3C A;  4L9N A;  4GDF A;  2QKL B;  1SC7 A;  5E18 F;  5CQG A;  3ISP A;  1BBY A;  2HZT A;  3ROU A;  1XTA A;  4LIU A;  3RDI A;  5IY5 H;  2V1N A;  3AL0 B;  3IRR A;  2DW4 A;  4IOA F;  1AU7 A;  4BL0 B;  3E0J B;  1N78 A;  2L9V A;  2PG4 A;  2PQ8 A;  4U87 A;  2HDW A;  3BTJ A;  2B63 J;  2EIL H;  1OYY A;  2IP2 A;  3BR0 A;  1UHW A;  3WG7 H;  4E6K G;  4EMS A;  5KHD A;  4S0H B;  2NNN A;  3PM1 A;  4LK0 F;  3CCS I;  5EF6 A;  3S1R J;  3BCB A;  1XGN A;  1M1E B;  1JUS A;  4KFC A;  4BQO A;  1HW1 A;  2BW3 B;  3FBI B;  1FBS A;  3CP8 A;  5FKO A;  4J01 A;  2FOK A;  1A36 A;  2CRG A;  2LK2 A;  3IHU A;  4XRF A;  5GPC A;  2W82 A;  3P5J A;  1MIJ A;  2L3D A;  3KP7 A;  5DEQ A;  3ECO A;  2JQ7 A;  1J75 A;  2O61 A;  1FX7 A;  2R5Y A;  3MVP A;  4B48 A;  1YS7 A;  3J81 K;  2QKM B;  2LD5 A;  1B72 A;  2ZSH B;  3H3V K;  2ECC A;  1IG7 A;  2PEX A;  3F8N A;  3S93 A;  2UZK A;  3R60 A;  1YLF A;  2BXZ A;  4E4H A;  2V9P A;  1K78 A;  4B47 A;  3HRS A;  2R7V A;  3HOT A;  2H6C A;  4IXA A;  3KET A;  5JI6 A;  3BPX A;  1UFM A;  4YFN F;  2ZXI A;  3QRF F;  5M3F J;  2E5Z A;  5DUI A;  2PFB A;  2H27 A;  4GYI A;  3RPU A;  2XAF A;  2O3F A;  3LSR A;  1Z67 A;  3HOS A;  3GFI A;  1RPW A;  3HUG B;  3ECH A;  2QBY A;  1FIP A;  3PSF A;  3JRB A;  3NEU A;  4KMU X;  5E20 A;  4Q5S F;  2K9Q A;  1PP7 U;  4ZZD A;  2IEK A;  4ZYH A;  1S8N A;  3DPU A;  5FLM J;  3DEW A;  5J1U A;  1NHA A;  1LJ9 A;  4XON A;  1YI2 I;  2ZB9 A;  4EM1 A;  4ENJ A;  1K83 J;  2HYF A;  2DOF A;  3WTW C;  4YIR X;  1PUF A;  4RLF A;  1YX3 A;  3LFU A;  4I7H A;  3QP5 A;  4HYE A;  1BIA A;  1MH3 A;  2R7X A;  1EJ9 A;  4X6A J;  5DYM A;  1WJE A;  1Y56 A;  2R5Z A;  4PGH A;  1BJZ A;  3A02 A;  2JZY A;  2V7F A;  3OS1 A;  2LF8 A;  3DPT A;  4XLC A;  4ON0 A;  3WTY C;  1NK2 P;  3AG3 H;  4HA8 A;  5H6Q A;  1D1B A;  1I6H J;  1UJ8 A;  1GV5 A;  4ESB A;  2IS1 A;  1ON2 A;  4NBQ A;  4XOP A;  3C7J A;  4PSX A;  4WCG A;  1VQ5 I;  1WFX A;  3ZMT A;  2HQR A;  2KL4 A;  3C3W A;  3CJT B;  3BZK A;  3L2W A;  2XGE A;  2ACJ A;  1JT0 A;  3S14 J;  4AM3 A;  3BP8 A;  2G7H A;  2JA8 J;  4XRS A;  1FY7 A;  4RAG A;  1IXR C;  5EZG A;  4AIJ A;  3V4G A;  1UCR A;  4MEX F;  2K9N A;  3S3N A;  3KX2 A;  2KJC A;  3J80 Z;  3PFI A;  1GDT A;  1D5V A;  4EJT A;  1LNW A;  3LNQ A;  1YIT I;  2WBM A;  4OU0 A;  3PNV A;  2OC6 A;  4I0A A;  3V8K A;  3K4J A;  2EIJ H;  4LG0 B;  2OF7 A;  4HDV A;  2K4J A;  3WTS C;  2V26 A;  4MLO A;  2KQR A;  1KYZ A;  2E7X A;  4XLE A;  4Y33 A;  3S32 A;  5E1Z B;  3GF2 A;  1PYV A;  3I58 A;  1CQT A;  2VJI A;  4CCM A;  3L9F A;  2HYJ A;  3H0D A;  1WJC A;  2CQ7 A;  5J3L A;  1P4W A;  3I4P A;  5L3D A;  3ZMD A;  2M34 A;  2VE8 A;  3BTC A;  4XRS G;  4A3D J;  4AU7 A;  3E3V A;  2FBK A;  4ZYG A;  2Z9O A;  4WF2 A;  1Z91 A;  5DD8 A;  2XKP A;  3BR1 A;  3OYA A;  2O8X A;  4AID A;  4UNO A;  4EVI A;  3L09 A;  4NUB A;  3SJM A;  4D0P A;  2L7F P;  4P1W A;  5IT9 K;  3WTZ A;  4HBL A;  2NVX J;  1SD4 A;  2D1V A;  3HSE A;  4MO7 A;  2A6H F;  1OR7 C;  1KON A;  2PLY A;  2I5U A;  2P4W A;  1Z3X A;  4ZH4 F;  2AQF A;  2MLG A;  2DI3 A;  2DK5 A;  4NNJ A;  1K7A A;  1WJB A;  4BH9 A;  4M6X A;  3BDD A;  2V79 A;  5BNG A;  3GLX A;  2VJJ A;  1F43 A;  5EJC A;  2ETH A;  3SQN A;  5HOO A;  2FU4 A;  5M5X J;  2VN2 A;  2UWM A;  3P9K A;  1LVK A;  2CWE A;  2NXN B;  4M3D A;  1OYW A;  4XNF A;  3QQA A;  3B73 A;  2XAS A;  1HBX G;  2DA3 A;  3BRO A;  1O7F A;  3A1Y A;  4U88 A;  1FTT A;  2A69 F;  2LVS A;  3HIF A;  4HEA 2;  4OOI A;  3PUF A;  3QYE A;  1ZGW A;  3L2Q A;  4M74 A;  1VQ9 I;  4KMF A;  1QHG A;  3HG9 A;  1F1Z A;  5FRN A;  1Z05 A;  2KFD A;  4HZF A;  3K4K A;  3JRF A;  3K1P A;  2DDB A;  1YJ9 I;  1QA6 A;  1FP2 A;  1ERD A;  2VKV A;  1P7J A;  2DJN A;  4XKV A;  3JCU C;  2R7S A;  1ZAR A;  2JUG A;  2VT3 A;  2R7T A;  4GGG A;  5EEH A;  3CD6 I;  1I1S A;  1HXD A;  4BAC A;  1B8I A;  2R7D A;  4XLA A;  2LY2 A;  5FRO A;  2V4J C;  1LFB A;  1QZE A;  5JR3 A;  4F3Q A;  2FNA A;  4UUV A;  3S1M J;  9ANT A;  1UG2 A;  1IRX A;  2HOE A;  1OCC H;  1H9G A;  1FOW A;  2COM A;  1S7A A;  2LC2 A;  1Z6T A;  2XDV A;  4BE2 A;  2Y75 A;  1IRG A;  1D5Y A;  4XOT A;  1IRZ A;  2XGD A;  3O8G A;  1IC8 A;  3FXR A;  4D9J A;  1RC9 A;  1BOA A;  3EUH A;  1AOY A;  4UXN A;  5DM6 F;  1MBF A;  4HLY A;  1MMA A;  2AS5 F;  3S3M A;  4E7J A;  5D5V B;  4A93 J;  2J5P A;  1JJ8 C;  2HPM A;  3EUA A;  3TP0 A;  3J81 Z;  3JRH A;  1ETO A;  1R23 A;  2VBW A;  4XRM A;  1SFX A;  1ZHF A;  3DKX A;  3MQ0 A;  3H1C A;  3K10 A;  1IGN A;  2VXZ A;  1Z6R A;  3J7A Y;  1TWG J;  4N9I A;  4IF4 A;  3OYK A;  2RKH A;  3X2Q H;  1REP C;  1VZ0 A;  2GQQ A;  2HVQ A;  1XSV A;  2FJ1 A;  2VBZ A;  3BJO A;  2K85 A;  3WU1 B;  2E1O A;  4AIK A;  2JJ7 A;  3KFW X;  3PFY A;  3ZRG A;  3DKW A;  1U9O A;  2B9S A;  1X1B A;  3ZCO A;  3LL7 A;  2M7B A;  3E97 A;  3UR3 C;  3S2W A;  3G2B A;  4EJV A;  4QSH A;  4I99 C;  5J40 A;  3GTK J;  4WX9 A;  2VBY A;  2ELJ A;  1U9N A;  1O57 A;  3CDL A;  4L5J A;  4ZJZ A;  1BI1 A;  4PJ0 C;  3O8H A;  3IRQ A;  3AL0 C;  3PQJ A;  5M3M J;  3H9G A;  4S04 A;  5F0F A;  2MH9 A;  2EIM H;  3CZ6 A;  1WZ2 A;  1XD7 A;  3I53 A;  2X6W A;  2HVS A;  4I01 A;  2JRM A;  2DAO A;  4QIW N;  3L2R A;  4FHT A;  4UUT A;  5A2Q K;  3FXQ A;  2EV0 A;  2KPM A;  1FSH A;  4NC6 A;  5FKL A;  1LUJ B;  2NYX A;  2D5V A;  3IWZ A;  4X0G A;  2E2I J;  4MFD A;  1IN4 A;  1H89 C;  2DYS H;  2V1U A;  2FNP A;  1Z0X A;  2LBF B;  2EB7 A;  4X1E A;  3U21 A;  4BDZ A;  4ZTJ A;  1MSE C;  1SAX A;  1WVR A;  2M45 A;  4QWQ A;  4WK8 F;  4OIN F;  1D8K A;  4HV5 A;  1XMA A;  1VQP I;  2EZL A;  1YE9 A;  1B1B A;  1GLN A;  2LY9 A;  2XGC A;  2ZXH A;  2MC4 A;  3G6E I;  4M3E A;  4P9U A;  2W00 A;  4MQ9 F;  4IOC F;  4J19 A;  2RVC A;  1XDU A;  5TGT A;  3FXM A;  1ETW A;  1ZGA A;  2FQ3 A;  1R36 A;  1S3J A;  5K5R A;  1WI9 A;  2F4O B;  1YS6 A;  3QP6 A;  5B5E C;  5C4J J;  3WHC A;  3IP4 B;  1WSU A;  4HST A;  3GUD A;  5E8G A;  1IZ1 A;  3FIS A;  3KYL A;  2HNH A;  4IEJ A;  4D7M A;  4ZTF A;  1I50 J;  4IO9 F;  1RKW A;  1H8A C;  2P8T A;  3TBI A;  3HZJ A;  4IRG A;  1CF7 B;  3CCJ I;  3BT9 A;  3VDX A;  1LDD A;  1S7O A;  4A5N A;  1FSE A;  2RN7 A;  2F5E A;  2FF4 A;  2HFH A;  2W84 A;  3VYS B;  4ZC3 A;  2Q8K A;  4I02 A;  4F55 A;  1JKP C;  2DXI A;  3IKV A;  2G7U A;  1MDM A;  5EYR A;  4XR6 A;  2EFQ A;  2B0L A;  4HF2 A;  3WOD F;  4YII A;  2NS8 A;  3G3Z A;  4G6T B;  1E3O C;  1KA8 A;  3UNG C;  4CZC A;  1QGP A;  5FD5 A;  5DTD A;  3OY9 A;  5EDN A;  5GAH J;  3H0G J;  2VL8 A;  5BMZ A;  3VB2 A;  1ORK A;  3BCA A;  3LA2 A;  1H0M A;  5ILS A;  2V6C A;  2FBI A;  4I0B A;  2DJI A;  5DV5 A;  3VPR A;  1XCV A;  1LE8 B;  3CMY A;  3HHH A;  3PUB A;  1Z1D A;  4PFP A;  2ZFU A;  4L9J A;  2ZC2 A;  2L54 A;  3TW7 A;  1SVM A;  4RAY A;  2FMY A;  2GIV A;  4N4O B;  2EBI A;  3CTA A;  2R7F A;  3TO7 A;  1MBH A;  2A68 F;  2XAU A;  5AIQ A;  4AD9 A;  1F4K A;  2CFX A;  3GXO A;  1VQK I;  2KRF A;  3F6V A;  5GTI C;  3OOP A;  2V9K A;  3CMA I;  2YPR A;  1F36 A;  2V9V A;  2Y0S N;  3MCZ A;  1UST A;  1BW6 A;  5F1R A;  4HRI A;  4Y17 A;  2EFP A;  2X1E A;  3LMM A;  3WGG A;  4JK1 X;  4BE0 A;  1K61 A;  1HLV A;  2VQL A;  2CQX A;  3L00 A;  4XLN F;  3RSN A;  1OCO H;  1E0E A;  2R7O A;  3MAJ A;  2QF7 A;  4B09 A;  3TGN A;  2DQL A;  4EEF G;  3L2U A;  2BOL A;  2QSF X;  3AG1 H;  5J8F A;  4Q4Z F;  2M8E A;  3LOC A;  3M8J A;  3FIW A;  4M6Y A;  2PI0 A;  1NK3 P;  3EUH C;  5JHF A;  3DTE A;  1DP7 P;  1T08 B;  5EGO B;  4XOR A;  1F5T A;  1BA5 A;  1ACI A;  2DA5 A;  2NVU B;  1YTY A;  2PMH A;  2VC0 A;  3WTT C;  3GO5 A;  1IJW C;  1HOM A;  3GCM A;  3QU6 A;  3E7L A;  2LRE A;  1KGS A;  2BVM A;  2AXL A;  3TED A;  5JHU A;  4XBF A;  2WWY A;  2QQ9 A;  3CC4 I;  4OAZ A;  1I39 A;  2B7E A;  2M1B A;  3K4L A;  2H94 A;  3QYF A;  1HDD C;  3GFL A;  1K6Y A;  1I27 A;  2KRH A;  5E79 C;  1XX5 A;  2E71 A;  4MNU A;  3ZQI A;  1RES A;  4M72 A;  3TO9 A;  3AG2 H;  3CCQ I;  4O5V A;  2DMT A;  3FKI J;  3BG9 A;  2EFN A;  1J9I A;  1ZG3 A;  1ZRE A;  3OWT A;  3K1N A;  1O3R A;  5E1W A;  1X2N A;  1AHD P;  4R1H A;  4RAF A;  4CXF A;  2VB6 A;  4PJN A;  1J59 A;  3FXK A;  1HW5 A;  2JPC A;  2DOE A;  1OKR A;  2XGX A;  2Y9Z A;  3KIO A;  2M87 A;  1R1T A;  3ABK H;  4YG2 F;  2BY1 A;  1V55 H;  3CC2 I;  2DCE A;  3DP7 A;  3D5S C;  3Q0V A;  3KPH A;  2YU3 A;  2G9W A;  1TWC J;  2XAG A;  2OZ6 A;  1LQ1 A;  1R5H A;  1G3Y A;  3I3L A;  2O8K A;  1IRF A;  1CGP A;  3RPQ A;  1T95 A;  2DTR A;  4DNC A;  3TDZ C;  2MAB A;  2QVO A;  3G73 A;  1B6A A;  2YX7 A; 
#chains in the Genus database with same CATH homology
 4C3H J;  2CUF A;  3OOU A;  3K2A A;  5F0C A;  3HDD A;  4G12 A;  3S14 J;  1JTX A;  2EH3 A;  2XGE A;  1JT0 A;  4JYK A;  4JX4 A;  5EG0 A;  5EG0 B;  2JA8 J;  4XRS A;  5EZG A;  4DZJ A;  2K9N A;  4JX5 A;  5FKK A;  2WV1 A;  3JRG A;  1JKR C;  3GTP J;  1GDT A;  1VI0 A;  2YU9 J;  3LNQ A;  3BTL A;  4CYC B;  4CYC A;  4DYC A;  2HDD A;  3Q3S A;  3ZQH A;  2OF7 A;  3B6A A;  1WGX A;  4MLO A;  1IDZ A;  2LKX A;  3OSG A;  2DA2 A;  1JJ6 C;  3JRA A;  4GFB A;  1VND A;  4LOC A;  1O4X A;  1CQT A;  5M5Y J;  2HYJ A;  2JA6 J;  1T33 A;  5DS9 A;  5IP7 J;  2L7Z A;  5J3L A;  3C2B A;  2MGQ A;  5F0H A;  4A3F J;  2RAE A;  1WCM J;  4D5C A;  2DN0 A;  2M34 A;  4XRS G;  2YUS A;  3BTC A;  4A3D J;  3BR2 A;  2R92 J;  4M6V A;  1ETQ A;  5FKN A;  2W48 A;  4A3B J;  1ENH A;  1GT0 C;  3BR1 A;  4IHV A;  3L1P A;  2ME0 A;  4UUS B;  4UUS A;  2KDZ A;  4DYQ A;  3SJM A;  1RR7 A;  2L7F P;  1EF4 A;  2XSD C;  1FJL A;  2E19 A;  2I10 A;  2NVX J;  4MO7 A;  5F1J A;  4M3F A;  1JKQ C;  4RDU A;  4Y52 J;  1BW5 A;  2DA7 A;  1HCR A;  3OIO A;  1WH5 A;  3I4N J;  1P7I A;  5BNG A;  3OSF A;  1F43 A;  1LFU P;  3QPL A;  1ZK8 A;  5E3L A;  3S2D J;  2TRT A;  3K7A J;  4V2F A;  3DCF A;  2P81 A;  5K7F A;  5M5X J;  1FEX A;  3G1M A;  5K7H A;  2ID3 A;  1IUF A;  4A3I J;  4M3D A;  2LLK A;  3RKQ A;  3QQA A;  1DU6 A;  1WPK A;  2DA3 A;  2VPR A;  3M4O J;  3JRD A;  1FTT A;  2LVS A;  1NTC A;  2N8G A;  1VFC A;  3BR5 A;  1ZGW A;  4A3K J;  1Q1V A;  1TWH J;  3GBG A;  2WB1 N;  2HI3 A;  2XPU A;  5E3M A;  3GTM J;  3JRF A;  2VKV A;  2NS7 A;  1P7J A;  2DJN A;  4A3G J;  2R93 J;  2XB5 A;  3FK7 A;  4QTR A;  2NVT J;  2X9D A;  4L5E A;  1R9T J;  3BQZ A;  2DMU A;  1B8I B;  1B8I A;  4I6Z A;  2EZI A;  2G0E A;  3LSJ A;  1GV2 A;  2XB0 X;  3BQY A;  1LFB A;  4JX6 A;  3ZOB A;  3GTL J;  3S1M J;  2M8G X;  1ETK A;  5E3O A;  9ANT A;  1UG2 A;  4XID A;  2MSY A;  4V2G A;  3S1Q J;  1YRN B;  1YRN A;  4B3A A;  2K40 A;  5IOZ A;  5C3E J;  1WI3 A;  1D5Y A;  2E2H J;  1IRZ A;  2NVY J;  1AKH A;  1AKH B;  2XGD A;  4DW6 A;  2EZH A;  3O8G A;  5HOD A;  3W6V A;  1IC8 A;  1POG A;  3G1L A;  1MBF A;  4A3C J;  1ZTR A;  3Q0U A;  2O7O A;  1TC3 C;  1TWA J;  4A93 J;  3QPS A;  3B6C A;  1ZR4 A;  1JJ8 C;  4MIM A;  3SDG A;  1Y1V J;  1MSF C;  2MG4 A;  1QVU A;  3TP0 A;  3JRH A;  2M0C A;  3Q0W A;  3FK6 A;  1ETO A;  3TP3 A;  4XRM A;  1JT6 A;  2LTP A;  1FIA A;  4AUX A;  3A01 A;  3A01 B;  2H8R A;  1Z77 A;  1IV6 A;  1IGN A;  2TCT A;  2XPV A;  1G2H A;  1TWG J;  1ZQ3 P;  4BY7 J;  2R0Q C;  3GTO J;  5JLX A;  1BA5 A;  1MBJ A;  5EZH A;  3MKL A;  1A6I A;  1Y1W J;  4HNV A;  2K9S A;  2AHQ A;  1T56 A;  2FJ1 A;  2O9L A;  3BG5 A;  4D7N A;  2DMP A;  2IBD A;  2ELK A;  4FIS A;  2EQR A;  2E1O A;  5GPA A;  2JJ7 A;  1GUU A;  4BY1 J;  1GVD A;  1U9O A;  2NVQ J;  2YS9 A;  5F27 A;  3GTJ J;  2WAQ N;  1OFC X;  3LSG A;  3WHB A;  4QSH A;  3CCY A;  4B4C A;  3JRE A;  3GTK J;  5J1R A;  2JA7 J;  4BKX A;  1U9N A;  1MBK A;  4C3I J;  3LSP A;  3CDL A;  3M3Y J;  4DYR A;  3HOW J;  3NAU A;  3S2H J;  1APL C;  2DTZ A;  2L7M P;  3O8H A;  1H88 C;  4JP0 A;  3HBL A;  5M3M J;  5F0F A;  5GP9 A;  1MBE A;  3S17 J;  3IH4 A;  1QVT A;  2DA4 A;  2VKE A;  2FX0 A;  2IAI A;  4QIW N;  4UUT A;  1SFO J;  2JA5 J;  1UHS A;  2L0K A;  5FKL A;  1A5J A;  2NOG A;  2HOA A;  1OCP A;  5EEA A;  2D5V A;  3NAR A;  2E2I J;  2JMW A;  4MFD A;  2JN6 A;  1ETY A;  1H89 C;  2VUM J;  3S15 J;  5JLW A;  3HM5 A;  1ZR2 A;  1Z0X A;  5IP9 J;  5IYD J;  4X1E A;  3GTQ J;  1MSE C;  2FQ4 A;  1W0U A;  1ZKG A;  4DZP A;  3S1N J;  2EZL A;  1MNM C;  2XGC A;  2LY9 A;  4A3E J;  1OCT C;  5FLV A;  4M3E A;  1UMQ A;  2DA1 A;  2CJJ A;  2ECB A;  3HGY A;  4J19 A;  1WH7 A;  1ETW A;  4M3G A;  3BR3 A;  3ZQC A;  4MFE A;  5C4J J;  1W0T A;  5F08 A;  3WHC A;  1OJL A;  5IYC J;  3RZD J;  2DMN A;  5IP6 A;  1JUP A;  1IDY A;  3FIS A;  1XG1 A;  4W97 A;  1BL0 A;  4C3J J;  1JGG A;  4A3J J;  4IEJ A;  4D7M A;  1I50 J;  2GBY A;  1RKW A;  1H8A C;  3IH2 A;  3JRI A;  2Y9Y A;  3BTI A;  1ETX A;  4BXX J;  3HOU J;  3BT9 A;  2X6O A;  4FE7 A;  2DMQ A;  3G1O A;  2CUE A;  4B1R A;  2LR8 A;  4BBR J;  2Y31 A;  2CQQ A;  1JKP C;  2R7Z J;  5EYR A;  1SAN A;  2HOT A;  1XS9 A;  2GM4 A;  2AO9 A;  2NS8 A;  2LFB A;  3HOX J;  1E3O C;  1RET A;  2MW8 A;  3PO2 J;  1JTY A;  2HQ5 A;  5DTD A;  5EDN A;  1QRY A;  2ME6 A;  3ZQG A;  3JRC A;  5M5W J;  3H0G J;  3PO3 J;  1JUM A;  3SFI A;  3BR6 A;  1ORK A;  3HB9 A;  5IOY A;  2Y30 A;  3ZQF A;  4FE4 A;  4D5F A;  5C4X J;  2COB A;  3VPR A;  1I3Q J;  2QCO A;  1LE8 B;  1LE8 A;  3CMY A;  2XPW A;  3IH3 A;  3RQI A;  3HOZ J;  3D1N I;  4IHW A;  4RBO A;  3TW7 A;  5FKM A;  2FD5 A;  2EBI A;  1MBG A;  3IV5 A;  1U8B A;  3GTG J;  1MBH A;  3HEF A;  3HOY J;  2M9H A;  2M2E A;  1AU7 A;  4FTH A;  1ETV A;  1F36 A;  5J1Y A;  2Y0S N;  1BW6 A;  4FCY A;  3BTJ A;  2E2J J;  2B63 J;  3BR0 A;  1VF9 A;  4S0H B;  3RZO J;  1XC5 A;  3TW6 A;  3F0C A;  2JWT A;  1HLV A;  1K61 A;  4IHX A;  3PM1 A;  5IPA A;  2CQX A;  5EF6 A;  3S1R J;  2ID6 A;  1JUS A;  2DA6 A;  2QF7 A;  4EEF G;  4A3L J;  3LOC A;  5FKO A;  2JK3 A;  3FIW A;  5F04 A;  2CRG A;  1RKT A;  1X2M A;  2LK2 A;  1NK3 P;  5GPC A;  5IYB J;  5EGO B;  5EGO A;  2R5Y A;  2R5Y B;  3HGG A;  3MVP A;  2CU7 A;  4A69 C;  2DA5 A;  2LD5 A;  1B72 B;  1B72 A;  3H3V K;  2ECC A;  1IG7 A;  1IJW C;  1HOM A;  2Y2Z A;  2EZK A;  3E7L A;  2PMZ N;  3CQZ J;  4XIC A;  3TED A;  1DU0 A;  2KT0 A;  3HKZ N;  5FJ8 J;  5M3F J;  3UKG A;  1HDD C;  5C44 J;  2OPT A;  2GLO A;  3LSR A;  1QPI A;  2HOS A;  1RPW A;  3ZQI A;  2H1K A;  3S16 J;  1RES A;  1FIP A;  4NDL A;  3JRB A;  2L9R A;  1HDP A;  4AYB N;  2DMT A;  3FKI J;  1ITY A;  3BG9 A;  4BBS J;  2K9Q A;  4AC0 A;  4IHY A;  3ZQL A;  4I76 A;  2IEK A;  2XRL A;  2X48 A;  1U78 A;  5FLM J;  3DEW A;  5J1U A;  4ABZ A;  2LP0 A;  1X2N A;  1AHD P;  2ZB9 A;  1K83 J;  1HF0 A;  1FTZ A;  5E3N A;  1PUF A;  2HXO A;  1PUF B;  2Y9Z A;  1JKO C;  4W1U A;  3A03 A;  1MH3 A;  3HOV J;  4Y7N J;  3BG3 A;  4M3B A;  2VI6 A;  3Q0V A;  4X6A J;  2R5Z A;  2R5Z B;  1X58 A;  1BJZ A;  3A02 A;  4XK4 A;  2HXI A;  1TWC J;  5K7Z A;  1TWF J;  4C2M J;  1MH4 A;  2O8K A;  1NK2 P;  4A3M J;  3MN2 A;  3I4M J;  1S7E A;  1I6H J;  1GV5 A;  3JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...