3GTLJ

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtlJ00
2P81A 4FE4A 2N8GA 3JRAA 3D1NI 1IC8A 1BW5A 1NK2P 5EZHA 3PO2J 2EZIA 4M3BA 1IUFA 2FX0A 2R5YB 3BR6A 5M5XJ 1GT0C 2Y9ZA 4LOCA 4JX5A 3TP3A 1U78A 1AKHA 3FK7A 1HCRA 5J1YA 2XPVA 3Q0WA 1A6IA 2QF7A 5EGOB 4M3EA 1B72A 1JJ6C 1QPIA 3QQAA 5GPCA 3CDLA 4CYCB 1U9OA 3BR1A 2LFBA 1ETXA 2WAQN 2ID6A 3LSGA 1RR7A 2DA7A 3HOWJ 2MSYA 4A3EJ 2XB0X 2HXIA 1Q1VA 1MBJA 2EZKA 1YRNA 3LNQA 3F0CA 4A3FJ 2WB1N 2IAIA 1OJLA 5IP9J 1IDZA 3S2HJ 4MFDA 2H8RA 2COBA 1MBFA 1CQTA 2VKVA 5E3OA 2R5YA 2ECCA 1XC5A 2EZLA 2LVSA 3GBGA 3BTIA 2R92J 2R93J 2GLOA 1JTYA 1APLC 5E3NA 2JK3A 1RPWA 1UMQA 3ZQCA 3TP0A 5JLWA 5FKOA 3TW6A 3WHCA 4UUTA 1DU6A 2WV1A 1AU7A 1HOMA 1JUSA 1X58A 3GTQJ 1MH4A 4M3FA 3GTPJ 1MBHA 1TC3C 3A02A 4EEFG 1QRYA 3RQIA 1TWHJ 4M6VA 4UUSA 2MW8A 5M3FJ 2O9LA 5FKNA 1W0TA 3QPSA 1WGXA 1MBKA 2M8GX 5DTDA 5J1RA 3S16J 4ABZA 1K83J 4JP0A 4UUSB 1VI0A 2NVYJ 2E19A 5E3MA 5F04A 3B6CA 5E3LA 2K9SA 4AC0A 3VPRA 1OCTC 3I4MJ 4M3DA 5EDNA 3O8HA 2XB5A 2L7MP 1S7EA 5FLVA 1QVUA 1NTCA 3ZOBA 2B63J 3S1MJ 5IYDJ 2L7ZA 2D5VA 1JUMA 1I3QJ 2W48A 4G12A 4QSHA 4I76A 3OIOA 3MKLA 1JKQC 3OOUA 4XIDA 1FIAA 3RZDJ 4Y52J 3S1NJ 1TWFJ 3SJMA 3HOUJ 3BR0A 4V2GA 9ANTA 1BJZA 1JT6A 3A03A 4A3DJ 3NAUA 3HOXJ 1BL0A 2LKXA 2E2JJ 2CUFA 5EF6A 4XRSA 3K7AJ 2YUSA 3HOVJ 2NS8A 4L5EA 2LK2A 3ZQIA 1ZK8A 3JRBA 2K9QA 1XS9A 2KT0A 2PMZN 2CQQA 2HOTA 1P7JA 3JRCA 3NARA 2DN0A 1ETQA 2JA5J 5FJ8J 5IP6A 1F43A 3BTLA 4D5CA 5F1JA 2DA6A 3ZQGA 3CQZJ 1IV6A 4A3BJ 3ZQLA 1D5YA 2NVQJ 1MNMC 2CJJA 1Y1VJ 1WPKA 3BTCA 4D7NA 1T33A 1FIPA 1X2MA 2HXOA 2VI6A 3LOCA 5M3MJ 1VFCA 1PUFA 4BBSJ 3TEDA 2DMPA 2L7FP 1IDYA 4FCYA 3HB9A 1K61A 4C3JJ 4C3IJ 1Z0XA 5HODA 1X2NA 4FISA 1GUUA 3CCYA 1GV2A 1ETWA 4D5FA 3BT9A 4B4CA 2JWTA 4I6ZA 2DMQA 1NK3P 1ETVA 2XRLA 3UKGA 1O4XA 4AYBN 1ZQ3P 5EGOA 2Y30A 4MLOA 5FLMJ 1MBGA 5C44J 2Y2ZA 4A3IJ 3ZQHA 1LE8A 3JRHA 2G0EA 3DCFA 5IOYA 2M9HA 2HQ5A 3IH2A 3JREA 4W97A 4XK4A 3LSPA 1ZR2A 2JJ7A 5F0FA 1WH5A 2K40A 1F36A 3O8GA 3G1MA 2XPUA 2CRGA 1RKWA 3OSGA 2HYJA 1TWGJ 5EG0B 1U8BA 5IPAA 4BY7J 2L9RA 1ETKA 3HGGA 2TRTA 1ITYA 3A01B 3S14J 3LSJA 1MBEA 2I10A 4XRSG 4NDLA 1G2HA 2JA6J 4AUXA 4A93J 3BG9A 2DA1A 3K2AA 1I6HJ 1LFUP 3JR9A 4RDUA 1FTZA 1ZGWA 3JRGA 2VKEA 3PO3J 1IJWC 2LR8A 3WHBA 3M3YJ 2AO9A 2XGCA 4IEJA 1ZR4A 1ENHA 3BQZA 3BR5A 2EZHA 4D7MA 1HF0A 1MSEC 1BA5A 2DA5A 3TW7A 5K7HA 2XGEA 2O8KA 4V2FA 1I50J 4DZJA 2ME0A 4S0HB 2DMUA 1POGA 2CUEA 4MO7A 2ID3A 1A5JA 1ETOA 2JN6A 2EH3A 2CU7A 3CMYA 4DYRA 1R9TJ 2E1OA 5DS9A 1ETYA 3S15J 4JYKA 3W6VA 2FD5A 4MFEA 3GTGJ 3HM5A 2R7ZJ 4DZPA 2MGQA 3OSFA 2ECBA 2MG4A 2ME6A 2OPTA 2XSDC 1AHDP 2XGDA 1GV5A 2L0KA 3IH3A 4DW6A 1JJ8C 1H8AC 2YU9J 2HOAA 2IBDA 1FJLA 2KDZA 3L1PA 2TCTA 2X9DA 1UHSA 1Z77A 5IOZA 2M0CA 2FJ1A 5EZGA 2EBIA 1MSFC 2LY9A 4A3JJ 1WI3A 1HDPA 2DJNA 2LLKA 4XRMA 1EF4A 3GTJJ 2OF7A 5GP9A 2NVXJ 3BR2A 3Q0VA 1JUPA 2E2HJ 5GPAA 1B8IA 2R0QC 4A3KJ 4C2MJ 4MIMA 4J19A 5JLXA 4A3CJ 1TWCJ 4BBRJ 4W1UA 3GTMJ 2AHQA 1IGNA 4IHYA 3HOYJ 1HLVA 1LFBA 4B1RA 4JX6A 2E2IJ 1IRZA 1TWAJ 3HBLA 1B8IB 4X6AJ 2R5ZA 3S2DJ 2Y31A 3BG5A 4X1EA 5F08A 1LE8B 2HI3A 4FTHA 1OCPA 1GDTA 1ZKGA 3FISA 3MVPA 1FTTA 1RETA 5FKLA 5M5YJ 5J1UA 2NOGA 4A69C 1ORKA 1UG2A 1H88C 2LTPA 2R5ZB 2EQRA 1P7IA 5C4JJ 3A01A 1RKTA 1FEXA 2RAEA 3HKZN 3Q0UA 2JMWA 2NS7A 5J3LA 1U9NA 1JKPC 4BY1J 4FE7A 3H3VK 3BTJA 1WH7A 5EG0A 2X48A 2Y9YA 4A3GJ 1IG7A 1SFOJ 2DTZA 1T56A 2ELKA 3M4OJ 3FK6A 5BNGA 1PUFB 2XPWA 1VNDA 3HDDA 4DYQA 5FKKA 3DEWA 3LSRA 1ZTRA 2DA3A 3B6AA 3FKIJ 3HOZJ 5IYBJ 4BKXA 3SDGA 3HGYA 4JX4A 1RESA 3Q3SA 1MH3A 3ZQFA 2QCOA 2DA2A 1GVDA 1YRNB 5M5WJ 1XG1A 5FKMA 2LP0A 4BXXJ 3BR3A 2GBYA 4CYCA 3JRFA 2JA7J 4GFBA 4A3MJ 4HNVA 3S17J 3IV5A 1OFCX 3MN2A 3S1QJ 2DA4A 2CQXA 2IEKA 2Y0SN 2NVTJ 3I4NJ 5K7FA 4A3LJ 2FQ4A 5C3EJ 4IHWA 3GTLJ 2H1KA 4RBOA 5K7ZA 5IP7J 2DMNA 3PM1A 2GM4A 2K9NA 1JTXA 3H0GJ 3JRDA 2HOSA 2VPRA 5F0CA 3C2BA 3SFIA 5EEAA 1B72B 3JRIA 1JKOC 5EYRA 1SANA 3HEFA 4XICA 4QTRA 3BQYA 2JA8J 3GTOJ 2ZB9A 3G1LA 2M2EA 1W0UA 4Y7NJ 3GTKJ 1E3OC 3BG3A 2X6OA 1AKHB 5IYCJ 3G1OA 1VF9A 3FIWA 2DMTA 5F27A 2M34A 2O7OA 1DU0A 3QPLA 4C3HJ 1QVTA 3RKQA 5F0HA 1JGGA 2VUMJ 4IHXA 3RZOJ 3IH4A 4M3GA 3S1RJ 2LD5A 1Y1WJ 1HDDC 4B3AA 4DYCA 4IHVA 3E7LA 1JT0A 1BW6A 1H89C 2YS9A 1JKRC 2HDDA 1WCMJ 5C4XJ 4QIWN
chains in the Genus database with same CATH superfamily
2DTRA 2MFZA 1U5TC 5HLTA 3D1NI 4RGSA 1J75A 4AM3A 1BW5A 3WTXC 1ODDA 1R1TA 1RRJA 4KN7X 3PO2J 2EZIA 2DQRA 5HS7A 2CSOA 1V54H 2VC1A 3QP6A 4JQFA 5HLIA 4BDZA 1IZ1A 2E1MB 2X6XA 4LOCA 4L9TA 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3NWTA 3CCEI 3PQKA 1FBSA 3Q0WA 1YIOA 2X4HA 4WF2A 3MZYA 4CA0A 2JZYA 2V4JC 1B72A 4ENKA 2A07F 3QQAA 3W6KB 1V5EA 5GPCA 4CYCB 4ZZDA 3LSGA 1RR7A 1K79A 3L9FA 1MJBA 2PJRB 5DD8A 1JI8A 3D5LA 2WB1N 1R71A 3L09A 5DM7F 2IAIA 3AG2H 1USTA 5IP9J 1IDZA 1EH8A 2XHKA 1CGPA 3S2HJ 2QWWA 2STTA 3SXYA 2EPFA 4B47A 4JK1X 1CQTA 2R5YA 2NNYA 3EUKL 1XGNA 2CW7A 3LWFA 3HRMA 3TOBA 1E0EA 3J81Z 3TKYA 2EZLA 2FMLA 1K6YA 2R93J 5J8FA 1MMGA 5E3NA 3CC7I 2LG4A 1ZLKA 2VT2A 1RZ4A 1GXQA 1SVOA 2D45A 3MCZA 1QQIA 1SD7A 3OIPA 4BDYA 4D1QA 3DLAA 4XN3A 3LMMA 1W5TA 1IN4A 1TNTA 2DJIA 3ZMTA 3DQVC 1HOMA 3WU2C 1PP8F 1X58A 3FXJA 1MH4A 4YFXF 4M3FA 2BBYA 3HOTA 5E1WA 4PGHA 3GMEA 4G6QA 1O7FA 3DFGA 3ZMUA 1LFPA 3QPSA 1WGXA 2LOOA 5DTDA 5D6FA 2BEOA 3S16J 2FE3A 2M4KA 5LLQA 3S2WA 3FBIB 4E4HA 1I1GA 1PVEA 2GQQA 4CCNA 5KVRA 2E19A 3CMMA 1Z7LA 5TJJA 3F22A 2HQNA 4E6KG 1TT0A 5F04A 3B6CA 3LSKA 1WJBA 1T2KA 1MJ9A 3H9GA 4AC0A 2Q2EA 3V4GA 3VPRA 4BS9A 4WXHA 1N77A 2RQQA 5DCFA 3FX3A 2L7MP 1S7EA 3ZQ7A 1LKXA 4GYIA 1P6RA 4IRIA 1R5ID 3Q9VA 2XUBA 2M8EA 4B44A 2DW4A 2ZJRF 4HSRA 4F7ZA 3OIOA 3MKLA 4M73A 2BGCA 2QYOA 3RZDJ 1QO0D 1TWFJ 2ACJA 3KZIC 4A0ZA 1UCRA 9ANTA 4PSWA 3QPHA 4A3DJ 2Z1DA 5IY5H 2LKXA 3EQLF 1LJ9A 2F5DA 4MNUA 5EF6A 3KZYA 1FMWA 4JBAA 1F9NA 3M8EA 5EEGA 2R4GA 2NS8A 3ECHA 2LK2A 1YITI 1FOYA 4ITVA 1G3TA 4LD5A 4ZYDA 2BHYA 4RGRA 2K9QA 1YO5C 2KT0A 2PMZN 2HOTA 1YJ9I 3BJAA 2G7UA 5BS6A 3MMYB 3U2RA 2JA5J 5FJ8J 2JVHA 3BTLA 3SYTA 5CVJA 3LA7A 1TNSA 3H5NA 5F1JA 3A4CA 2DA6A 4ZYAA 1VTNC 2QENA 3JTHA 1Z3XA 3ZQGA 1IV6A 1Y0UA 4IRHA 3T0YA 1Y1VJ 4PJMA 1VQMI 4IRGA 4D7NA 1T33A 4EGYA 1FIPA 2VI6A 4BBSJ 1UJ8A 1VQOI 3SEQA 4LK1F 3FBNB 2OAZA 4YIIA 1I5ZA 3V7SA 3HB9A 1HKTA 2DFFA 5IT3A 3GZNB 3M7GA 3WE3A 4PK4A 1A6QA 2EB7A 1GUUA 3PJRA 2OD5A 4WX9A 2UXXA 1GV2A 1ETWA 1O57A 3DKYA 4BGDA 3BT9A 5JFRA 5L3FA 1IUYA 1DPRA 2DMQA 3DU5A 1IXRC 2XRLA 2LBFB 3WE2A 1NK3P 4CGZA 4BHPA 2H94A 2M7BA 2Y30A 1O3TA 2UXNA 3J80Z 3KEOA 2KJCA 4XORA 2RVCA 3ZQHA 2LRDA 1R7JA 2M9HA 3COAC 1BR1A 2Y75A 2HQ5A 4X0GA 2K02A 3MKYB 1FMVA 3PL8A 3KP3A 2GWRA 3MD2A 1GHCA 4OMYA 3D0SA 5FRMA 4CICA 2LSOA 4EM0B 3I59B 3PFYA 4G9YA 2DT5A 2E7XA 3P9CA 1P92A 1V55H 1FSEA 4PGGA 4E7LA 2VN2A 3OYLA 3C3WA 2R7RA 2EFWA 4BNCA 3E5UA 1IF1A 2B9SA 3BG9A 1ZG5A 2VOPA 5HS9A 3K2AA 2XF6A 3RSNA 4BEHA 1I6HJ 3E6MA 3CUQA 3DTEA 1WJCA 5LBQA 1LPQA 2QQ8A 2KZVA 3PO3J 4RAGA 2OC6A 3LAJA 3TBIA 3K4JA 1G59A 3K69A 1QGPA 1A35A 2R7SA 4PDKA 4RB0A 1BA5A 2D1HA 3TDUC 1FOWA 1W7PB 4HQMA 1ZYRF 4WXCA 4XLEA 1ZREA 2VXDA 3I64A 1E2XA 5ERIA 4AVPA 4EGZA 3LFUA 2M3AA 3NWSA 3HRSA 4CDGA 2KRFA 3I59A 4PJLA 4A6DA 5FB2A 4ZDOA 1IN7A 2ME0A 4IJAA 3CLOA 4S0HB 2JUGA 4NC8A 3W2VA 3F8NA 4EM2A 2XF5A 5LGUA 2ID3A 4CYDA 4E7SA 1A5JA 3H3ZA 5JHFA 4XNFA 4C2TA 2VKHA 4NQWB 2HS5A 3E5QA 3ML6A 4N9IA 1R9TJ 3TO7A 4I2OA 2E1OA 2Q1ZB 2EV0A 4FT8A 1ZGAA 3FXLA 5DUKA 1T6SA 3KYLA 3KX2A 3DBRB 3TDZC 2A5YB 3GTGJ 3K4KA 2R7ZJ 4DZPA 1B1BA 3HKZA 2XSDC 1AHDP 1Y6IA 1H8AC 1HA8A 2A3SA 2K5CA 3F8BA 2IBDA 2PQ8A 3OYGA 1FJLA 5HDKA 3L1PA 2X9DA 2QQAA 1UHSA 1W7PA 1OCRH 2ZFWA 1STZA 2UWMA 4ZTJA 1XSDA 4MHGA 1EH6A 2P5VA 1WI3A 5E1XA 4RS8A 3OOPA 2DFIA 2VLAA 2FNPA 2HTSA 1UFMA 1O3RA 1JUPA 5F64A 2E2HJ 2EFQA 3H36A 2JPCA 2R0QC 4J19A 1R23A 3JW4A 3VEPA 2K86A 3WTZA 3J80K 4IO9F 1DPUA 3HOYJ 1EKEA 3BDDA 4B1RA 4XBFA 4AD9A 5KK1A 1MIJA 1F1ZA 2K4JA 3L00A 1YFHA 4X6AJ 3QOPA 2DOFA 2DYSH 4IXAA 4OINF 1OCPA 2HGCA 3FISA 1RETA 5FKLA 5M5YJ 4BACA 1Z21A 1SAUA 4EVIA 1H88C 3GZ5A 1G3SA 2F5FA 4F92B 2RAEA 4MQVA 3Q0UA 1YLFA 3VSKA 1FNNA 1IRFA 5J3LA 2GXAA 3ELKA 2GAUA 1JKPC 4FE7A 3BTJA 3PUFA 4XLNF 5EG0A 4HZFA 4J01A 2VOOA 5BOXA 2HPMA 1IG7A 4ZC3A 3DPLC 1UZCA 1WQ2A 2QM3A 2ZXHA 5E1ZB 2XPWA 2CW0F 1O3QA 5GADJ 1IRGA 2BYVE 2MABA 1U5TB 2VL8A 3DEWA 4XLHA 4YG2F 1ZTRA 1IO2A 3HOZJ 5IYBJ 4BKXA 3PSIA 3QODA 4L9VA 4ESBA 2DXIA 4AVZA 5D5WB 4M74A 2DQLA 1OCZH 3KEYA 2VASA 3ASNH 3ZQFA 2QCOA 3RKXA 1I1SA 2KQRA 3K70C 3RCOA 2WADA 4UVAA 4N4NB 2H6CA 2LYCA 3W2AA 1H0MA 4U7DA 5J8CA 1X3WB 4CYCA 3JRFA 3JTGA 3WTWC 1TQMA 2V6CA 2OA4A 4KITB 3MN2A 2BV6A 1XMXA 2WTEA 2QSFX 5LRSA 4ON0A 4KA4A 2F4MB 1WVRA 4UV9A 3G71I 2Z33A 3OYCA 3CF5F 1E3HA 2L5QA 4RBOA 4IL6C 2JPBA 3K6GA 5K7ZA 1KA8A 2R7VA 2XAGA 2LNBA 2VBYA 4OMZA 2F5CA 3EUAA 4Y13A 1W4MA 2LREA 4G6TB 1Z9CA 5ED4A 5DEQA 1JKOC 2M45A 3CCJI 3BQYA 2ZB9A 3KP5A 1OR7A 1NH3A 2WB1A 1BR2A 4Y7NJ 4XM3A 1ZG1A 1K7AA 3GTKJ 1BIAA 3HG9A 2ETHA 2MLGA 3KP7A 4XMYA 2ESNA 3ABMH 4PCQA 2X51A 2QGUA 5F27A 5DUIA 1WI9A 3BY6A 1VQNI 2GA1A 5DYMA 3CCSI 4HF1A 2J5PA 2ZNZA 1C0WA 3CMEI 1MZBA 1Y1WJ 3CC2I 3IC7A 2RQPA 4DYCA 1IN5A 4IHVA 2DYRH 5IT9K 4ANJA 4A6EA 4G7ZF 2IGKA 4FE4A 2N8GA 3LL7A 4KNYA 3L7WA 4PFOA 1Y56A 1FZPB 4XR6A 3EUHA 2EIMH 3ESWB 3IWZA 3MKZA 1QU3A 2E71A 5DCMA 2LH9A 3ZGKA 2CFXA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 4AIDA 4HYEA 4CXFA 5J1YA 1HCRA 4XLPF 3LQQA 3GW2A 2L02A 3VYUB 4GO1A 5LD2C 3TO6A 2K9MA 1OYIA 2L54A 1JJ6C 2LKSA 2OCCH 2ESHA 2ZXIA 4B09A 1FLIA 1ACIA 2Z9OA 2ISZA 2YR2A 1T08B 4UNOA 2LFBA 2WAQN 3OWTA 2ID6A 4CCJA 4A3EJ 4IOAF 2HXIA 2EZKA 1MBJA 4NB5A 3HTSB 1YRNA 1WJDA 3LNQA 3F0CA 1LQ1A 3E5XA 2COBA 4Z6YA 5KAIC 3WTUC 5E3OA 1M1EB 2ECCA 2IGMA 1QBJA 1XGSA 3V8LA 2ZJQF 1XC5A 1YW7A 5J47A 2LVSA 3GBGA 4HX7A 4C9YA 4ZDLA 1G4DA 1APLC 1RI7A 2CUJA 3M07A 4LLLA 3T5XA 2F6CA 5JLWA 4KIGA 5FD5A 5FKOA 2GXGA 3VOEA 3KP6A 5GAGJ 3WHCA 2IRFG 2BVMA 2V1DA 4UUTA 1DU6A 2WV1A 2DODA 3HSEA 2FU4A 2MC3A 5FLXZ 3MZHA 4U0YA 2HZTA 2JSCA 1MBHA 5ICFA 3CCQI 4CHUA 1W36C 1FYLA 1YQAA 4IQ4A 4YELA 2DLLA 1T0FC 4YFNF 2IGNA 2TDXA 5E8GA 2M8GX 3ZP5A 3CUOA 4XKVA 5D6EA 5DM6F 3OMYA 4RAZA 4R1HA 2RC4A 1S5LC 4HX4A 3W3CA 5A2QZ 1K83J 4UUSB 1VI0A 3GFIA 2DOAA 1LEBA 2K9SA 1XPXA 1P4XA 1FP1D 2CV2A 1OKRA 2VBXA 3I4MJ 3H5AA 3WTSC 3ZPLA 3O8HA 2F4IA 5FFXA 3G2BA 3IL2A 3CO7C 4KYWA 2E34A 3ZOBA 2B63J 3OL3A 3HSRA 3NQOA 4Y17A 2D5VA 4M72A 3FKJA 2W48A 2JVGA 4ZTFA 2E1CA 1LEAA 4MTDA 4Q48A 1JKQC 2KIQA 3U1DA 1KYZA 4Y52J 1BI3A 1KGSA 3SJMA 2A6HF 3BR0A 1JT6A 2HQRA 3E6DA 3P7NA 3I4PA 3HOXJ 2E2JJ 2JUCA 2KIMA 2WY7Q 5FO5A 4HW0A 2K85A 2A6TA 3DKWA 1UB9A 2M4GA 3HPGA 3K7AJ 5L3BA 1HSJA 3OYDA 3BZ6A 3GLXA 5ICEA 1FSHA 1JHFA 1ZK8A 3JRBA 2EFOA 3QRFF 4H0EA 1X1DA 1G6NA 3EDPA 2DN0A 5CJ9A 5K5QA 4GYGA 2JRMA 1W5SA 2RV8A 4II3A 2MC4A 2L9SA 4A3BJ 2XVCA 3HRTA 2NVQJ 1MNMC 2CJJA 5ILUA 2EK5A 2CQ7A 5B5EC 1D1AA 4NC6A 2BY3A 2VBZA 2HYFA 2HXOA 1OCCH 3LOCA 4G94A 2MH2A 2J5OA 2VE9A 4CSWA 2DMPA 6PAXA 1VQPI 3SDBA 5D8KB 1EJ9A 2CV0A 2EA4A 3LSIA 3FXUA 3IRRA 4L5JA 1MNDA 4D5FA 4IHSA 2CFOA 1S7AA 3R4KA 2XKOA 1N78A 3UKGA 1O4XA 4AYBN 4CUGA 1ZQ3P 1MBGA 5HDGA 2VONA 2P5KA 2Y2ZA 2RNJA 2KRHA 3BOQA 3DBLB 2VJJA 2WWYA 3KYCB 1LE8A 3F9KA 1WRJA 3K4MA 2K4BA 3I71A 3HHGA 2BVLA 4W97A 4GCVA 1B6AA 1IRXA 1YS6A 2A05A 3LSPA 2JJ7A 4RB1A 1WH5A 3O8GA 3E6BA 2E5ZA 2NNNA 3GWZA 4E7KA 1RKWA 1SD6A 2CMPA 4LIVA 3OSGA 5E20A 5CPRB 2AXLA 5HNFA 5D5UB 5H2FC 1U8BA 5L3DA 1V5GA 1YX3A 2HPIA 3RYRA 2L9RA 4Z2YA 1Y8RB 2W1OA 3SZPA 2TRTA 1Y0NA 3S14J 4D0PA 2X85A 2W25A 2OJED 3N05A 3F8MA 1R22A 4NDLA 4ENMA 2LC2A 4A93J 4ASNA 1VQ7I 4KIBA 1G8XA 1EV7A 1PDNC 3AG1H 1X3ZB 3L2QA 2HTJA 4UVBA 3KPHA 3OYMA 3VB2A 2VBWA 1ZGWA 3CJQB 1IW7F 2E36A 2OTLI 4BUPA 3WGGA 3I56I 3M3YJ 1XCVA 4PJ0C 2XSJC 3GO5A 1QPMA 3EPZA 3GZ6A 3BQZA 1E17A 5GTHC 3EUHC 2PLYA 2LDUA 4DIQA 5ICGA 4EM1A 5CVUA 2ZMEA 5K7HA 4XONA 1TL8A 3RQ4A 2Z99A 3GUDA 1I50J 2HVQA 1SVLA 2BZTA 3T8RA 1POGA 2HU9A 3FDYA 3REOA 1BI1A 2YU3A 5A2QK 2ZO4A 3E3VA 2CU7A 3H92A 3CMYA 1WHUA 4OAYA 1TQPA 3FXKA 1QZZA 5K1YA 3ISPA 4JYKA 2O6GE 2X6WA 2VODA 2XAFA 2IJLA 1FWZA 1OYWA 4DGWB 3GLLA 2MGQA 2W7NA 3OSFA 2MG4A 2P8TA 2ME6A 3VYSB 2OPTA 1MDMB 3FXOA 4PZJA 3T8TA 1JJ8C 2LY1A 3HIFA 2Q0OA 2HOAA 1I27A 5CQGA 1Z67A 1ZRDA 2TCTA 1KZHA 2HEOA 3IP4B 3HHHA 2EBIA 1DGRM 3LQRA 3AG4H 4HNUA 2LLKA 1D1CA 3GTJJ 2OF7A 2NVXJ 2P0WA 3WG7H 3S93A 2XASA 2PN6A 2XIGA 3GTMJ 2AHQA 2DT7B 3RYPA 1WJFA 4XOTA 4JX6A 3FMQA 3FMRA 1IRZA 3HBLA 1J2XA 2R5ZA 2KJBA 1YIJI 2F48A 4A5NA 4UXNA 4X1EA 4KUMA 2DDBA 4CCLA 2HI3A 2O61A 1D8KA 4BYYA 5LEJA 2BE5F 1UG2A 2LTPA 2IPQX 2EQRA 4G6DA 3A01A 2EINH 5CYVA 4MEXF 2DPDA 2OBPA 2NYXA 2CS3A 4IKFA 3KCCA 5B1BH 3BJ6A 3ERED 1WH7A 4R79A 1FC3A 4ZZLA 4A3GJ 3GEZA 4I98B 2D1VA 3WTYC 1WSUA 3DTKA 5BPIA 4Y15A 1VNDA 1YW9A 3K4CA 4DYQA 5FKKA 2PG4A 3DF8A 2WAFA 2EV6A 4EJWA 3CCUI 4F93B 3B6AA 2QQ9A 3FKIJ 3SDGA 2PBIA 2A5WA 4WXDA 1F4KA 1D3YA 3AFHA 4JX4A 3DXJF 1MH3A 3QYFA 5CVRA 5HLHA 1S3JA 1GVDA 1YRNB 1PJRA 2DCEA 4BU2A 4AIKA 3K1PA 2LP0A 3Q9SA 3BR3A 2GBYA 2KPMA 2WAQA 3EETA 3GVAA 4GFBA 1R58A 3UR3C 3TO9A 1J09A 4ZYGA 2NAZA 2OQGA 2DA4A 2CQXA 1A36A 1A04A 1UG0A 4DOZA 3OYNA 4KT6A 4DQ2A 2E5NA 3ULQB 5HVQC 5K7FA 2QQBA 2L9VA 2QKLB 3CZ6A 3D5RC 4LFUA 3G3ZA 3RKWA 4IHWA 2EIKH 3QYBA 2O03A 5LEKA 3N97A 4KDPA 2HDWA 4K2EA 4I7HA 2DFEA 2V26A 3GF2A 4N0BA 2GM4A 3BCAA 2K9NA 3JRDA 3J81K 3F3XA 2VPRA 3C2BA 5EEAA 1H9GA 1R00A 3S8PA 3JRIA 2BY2A 3CP2A 2XGXA 2HQAA 2JA8J 3GTOJ 1YX5A 1W1WE 1DGWY 3QU3A 1KU2A 4BHBA 4HDUA 4HX8A 3BG3A 1HXDA 4TV7A 2DMTA 4F55A 2OCEA 1X4OA 1DU0A 1VQLI 1B4AA 3WTVC 3HRUA 1Z6RA 1JGGA 3RZOJ 1B9NA 4V19K 3IH4A 4M3GA 3S1RJ 1HDDC 4DJAA 3DEUA 2K3PA 4HV5A 3M9AA 3WGIA 3E7LA 4A5MA 1SFKA 1H89C 2LF8A 3OYAA 2CQNA 2HDDA 1KU3A 5C4XJ 2F5EA 2P81A 4Y33A 1SFXA 1B9MA 3PSFA 4E7IA 1TTYA 1IC8A 2FRHA 3DKXA 4LB5A 1MDMA 1VQKI 5EZHA 5E17F 4L9JA 1IUFA 2FX0A 3BR6A 1GT0C 1V3FA 2Y9ZA 4FX0A 4E7ZA 1IXCA 4JX5A 3TP3A 3F72A 3O3KA 1XTAA 4NBQA 2A69F 1UHWA 4BQNA 1BI0A 2QF7A 2YX4A 3OS2A 2R3SA 4RM2A 1QA6A 5EGOB 1MNEA 1QPIA 3HXLA 4L9NA 1TLHB 1R4MB 3RDIA 4RLQA 3CDLA 2FF4A 1ZELA 3AAFA 3BR1A 4XQFA 4MEYF 4Q47A 3MWMA 5FROA 3JAMZ 4F91B 4IOCF 3ERMA 2R7QA 3HZJA 4ZYHA 3CMAI 3U21A 2R7DA 4B43A 1JXSA 2H8RA 2FMYA 3AL0B 2IS2A 4BL0B 4XSXF 4CH7A 1TW2A 2GA2A 4CCOA 3V42A 3SFZA 4HAMA 4RM3A 1R1VA 1ULYA 3BTIA 4XKBA 2VQHA 2VQLA 3RJPA 3CCVI 4RB2C 5FLXK 4M9SA 3A0HC 2JK3A 1R4NB 4O6JA 1CF7B 1RPWA 1UMQA 3ZQCA 5JI6A 1BI2A 3TP0A 2VB6A 5B3SH 1U3EM 1EH7A 1K78A 2CO5A 3D5SC 3TW6A 2JSPA 4OWRB 1YYVA 5F1RA 1PYVA 2Y48A 3N4MA 4GXOA 3FHZA 3JAMK 3ZMZA 1RIOH 1K4SA 4NUBA 1SFUA 2ELHA 1JUSA 1R5HA 3SEZA 1JGSA 1Z3YA 2WV0A 4OIOF 2ELJA 4HRIA 1XSXA 1ON1A 3A02A 1XDSA 3HYIA 4HV6A 4XLAA 4EEFG 3HUGB 3BCBA 4M6VA 3F8FA 1R5GA 1RR8C 2MW8A 5L3GA 2A61A 4HOBA 1MBKA 4OIPF 2VJ4A 2ZBKA 3TGNA 5J1RA 2AQEA 2KLOA 4LMYA 3X2QH 4JP0A 2FOKA 2NVYJ 2XC7A 3OR1C 2HFHA 3SHFA 5E3MA 2HVSA 2QBYB 2QEXI 1KONA 2KIUA 2ZSIB 2ZKZA 1MMAA 4M3DA 5J40A 5EDNA 2P6SA 2XB5A 1SD4A 3OYKA 5FLVA 3ZQQA 1QVUA 1NTCA 3S1MJ 5IYDJ 3L2CA 4IX7A 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4P9FA 1JUMA 4L18B 3P5JA 3MKWB 1I3QJ 2L01A 4XRFA 2VPLA 3R0AA 5EJCA 4I76A 4LLGF 3OOUA 4XIDA 3HOUJ 4HA8A 3MZ8A 4HLYA 3C2HA 2D2WA 3K1MA 1BJZA 3CCLI 5ILVA 2FBKA 2GXBA 2UZKA 3NAUA 1BL0A 4EV0A 4HF0A 4CZCA 2Y0SA 5J4YA 3IKTA 4XRSA 4M6XA 3WTTC 2KHMA 5FD6A 3RKYA 3HUGA 3C18A 3JCUC 4Y4RA 1R1UA 1XS9A 1D0ZA 2CQQA 4RAFA 3JRCA 3NARA 3ZXSA 1BN5A 4UB6C 2X1CA 2DO7A 2KIFA 3GX4X 4D5CA 2RN7A 2H8WA 3PFIA 3UNGC 2W00A 2KKOA 4G8XA 3ZQLA 2VQGA 2AQFA 1ZN2A 3BTCA 2M5WA 2P5LC 1DQUA 1X2MA 2OTJI 1VFCA 5J4VA 4BE2A 1T38A 1PUFA 3S3NA 3K2ZA 1IDYA 4FCYA 1K61A 3I5UA 4A2UA 2KP6A 3R60A 4C3IJ 5HODA 5TISC 3HPHA 1AWCA 4QPQA 3H9QA 2IA1A 3LSTA 3ABTA 2DBBA 1Y8QB 1MW7A 1WWXA 1YOVB 2QVOA 3ZMVA 2R7XA 3OL4A 3KEQA 1FYMA 4I6ZA 1O3SA 3OS0A 4MLOA 5FLMJ 1TQIA 3AL0C 4P1WA 2VXZA 3CTAA 1MD0A 4A3IJ 2CYYA 4PJNA 3W6JB 3RPUA 4DBRA 1I39A 2G0EA 3DCFA 3I53A 1L3LA 4S05A 1IV8A 3DPTA 5TGTA 3F21A 5E79C 2PEXA 3JREA 2OU2A 4H4KC 1WZ2A 5HLGA 5CKTA 1F36A 3CJRB 1VZ0A 2FUG2 2PI0A 4EJTA 2XPUA 2H27A 2FBHA 2NRAC 2CRGA 3HL2A 5E18F 3BG6A 1HQCA 2HYJA 1LVAA 3M8FA 5EG0B 2E7WA 5IPAA 2ZJ2A 5TRDA 2L7KA 2ZFUA 4XLCA 2E1NA 2UV1A 3HGGA 1ITYA 2PMUA 3A01B 3LSJA 2CGPA 3BC8A 1MBEA 3GFMA 5L3CA 1G2HA 3OYHA 4AUXA 2MYSA 1UAAA 1VQ9I 1SAXA 2DA1A 3VFZA 3K4LA 3CUQC 5AIQA 3JR9A 4KFCA 1OMIA 2W84A 3TOAA 1VQ6I 3DTIA 3CDHA 4ZDPA 2FBIA 2DAOA 1J9IA 2H6BA 1IJWC 2LR8A 2AO9A 2XGCA 1ENHA 3BR5A 4D7MA 1MSEC 5KHDA 2F2EA 2DA5A 5E8IA 2DFHA 2STWA 4XKCA 1LDKB 4HNTA 1B59A 1XDUA 2XGEA 4KJZA 5JVGF 2O8KA 2NS0A 4EJVA 1J5YA 1OCOH 5LHGA 2GOMA 4CO8A 4DZJA 2DMUA 1W5CC 3J7YJ 3OYEA 4MO7A 3KLNA 4XN0A 1ETOA 4Y3OA 3I55I 3LSMA 3G4SI 3PUBA 2O0YA 4GRIA 1HC8A 2VT3A 4MTEA 1VQ8I 4U88A 1SMTA 1BBYA 1ETYA 4FQGA 2BHZA 1GLNA 4XLFA 2BXYA 2CQKA 1S72I 2AS5F 4KIFA 2CV1A 4OAZA 4KT5C 4NQWA 4DW6A 1GV5A 2L0KA 3IH3A 4WCGA 4XOPA 3V7CA 3V8JA 2BW3B 2KDZA 3H1CA 3I54A 4P55A 3S3OA 2XAJA 2XRNA 1MSFC 1BR4A 2LY9A 4A12A 1BM9A 1HDPA 2DJNA 1I3AA 2K7LA 4BE1A 1YJNI 2MA3A 1EF4A 5GP9A 1YJWI 1BOBA 2GIZA 2MD5A 2WAEA 2DK5A 4MQ9F 2L3DA 5CLSA 5GPAA 1B8IA 4A3KJ 2XAUA 1XGOA 1H9TA 4A3CJ 1X4PA 1TWCJ 2O5RA 3CD6I 2IA2A 2H1LA 1IGNA 1J0RA 1LVKA 3FF5A 1HLVA 3CCMI 2VE8A 4EMSA 1NG6A 4I0AA 1TBXA 2E2IJ 2W85A 2WA0A 1OR7C 2VIXA 4KISA 1DDNA 1XB4A 4B3XA 3ASOH 4UHTA 4BJ5C 1RUOA 1GDTA 1ZKGA 5D4RA 3KETA 1FTTA 1USSA 3P9KA 2FNAA 5IT9Z 5J1UA 3OV8A 4A69C 2P4WA 1N75A 4BXFA 5C4JJ 1RKTA 1KQ9A 3KZZA 4NNJA 1N25A 2DDAA 2NS7A 3MFKA 4DBQA 5HDNA 2QUFA 3H3VK 3BPVA 2Y9YA 1V5FA 2DTZA 3DBHB 1T56A 2A68F 2WBMA 3K10A 1FOXA 1ZRFA 3ABUA 1PUFB 3IRQA 1MMSA 4PFPA 3EYYA 3HDDA 4HSTA 1DUXC 3O6BB 3QAHA 2V1UA 2RDPA 2GOXB 2R7OA 3HGYA 4P5OA 2K27A 1S8NA 5GTIC 1K4TA 4AU7A 1Z91A 3CUQB 4AIJA 2L2OA 1XD7A 4O3MA 2E60A 4XKWA 3DPUA 3HSFA 5M5WJ 1XG1A 4U87A 3H9JA 4BXXJ 3H35A 3KP2A 4ETSA 4BJTA 4A3MJ 4OOIA 2I8DA 2F5VA 2OV7A 3KP4A 2HZDA 4AWXB 3IV5A 1OFCX 4RA2A 4UB8C 1LNWA 2OZUA 3F23A 1UELB 2IA0A 2ZXJA 4U7BA 3SZTA 4DNCA 2IS4A 4BEHB 1AA7A 3BWGA 4M9ZA 4A3LJ 5LRRA 1T0FA 4AYBA 2MBFA 5C3EJ 3GTLJ 1G3WA 2R7FA 3QWLA 2NVUB 3C7JA 3R61A 5DD4A 3G73A 1XGMA 2EA2A 2Z2SB 1AOYA 3ONQA 1XX5A 3A1YA 3H0GJ 2IW5A 2HOSA 1XSVA 2IP2A 2W4SA 3E1SA 5K5RA 3DWLE 5EYRA 1SANA 3QOEA 4QTRA 1ZG3A 4A0XA 2E1MC 4HDVA 3FM5A 1LB2A 1TW3A 2X6OA 1AKHB 4S04A 4KMUX 5IYCJ 1ONVA 3G1OA 1VF9A 1MGTA 3FIWA 4M71A 4HQEA 2O7OA 3QPLA 4C3HJ 1QVTA 3RKQA 4KN4X 5F0HA 2VUMJ 1HKQA 1MMNA 4R8HA 4IHXA 5HS8A 2L4AA 4C2UA 5D5XB 1A31A 3U9GA 2LD5A 2X1DA 4B3AA 1WJAA 2XF7A 1BW6A 1Z05A 2LMDA 4LG0B 2YS9A 1JKRC 1IAWA 4QIWN 2LBFA 3ZMSA 1I6XA 2R7UA 3JRAA 1LDJA 2IS6A 3A0BC 1X19A 1NK2P 3DEEA 4KMFA 1W7PD 1QNTA 2EILH 3RPQA 3DV8A 2CWEA 3PNYA 2FEZA 4M3BA 4FASD 3KFWX 2R5YB 2JQ7A 5M5XJ 5DDGA 4YIRX 1AKHA 3FK7A 1X1CA 1LDDA 3SZGA 2XPVA 3L2UA 3G6EI 4RMNA 4D9JA 1U2WA 4ZH4F 1A6IA 3E6CC 2KISA 4G7OF 1ZHFA 4M3EA 2R7WA 4RGXA 2QKMB 2JA2A 4M9XA 4NC7A 5DV5A 2UUZA 2NXNB 5BPDA 5KAFC 1QHHD 1U9OA 3HOWJ 1ETXA 3BZCA 3FM3A 2DA7A 2MSYA 2V1NA 1XMAA 2XB0X 1Q1VA 3F8CA 5FFZA 3CC4I 1G3YA 4LG0A 2PFBA 2BXZA 4A3FJ 1OJLA 2BY1A 2JT1A 3L2WA 4U0WA 4MFDA 3PQJA 1JHHA 5K5OA 3DLLF 3RPUD 1WKMA 2PMHA 2QSHX 4ZJZA 1MBFA 4OIQF 5LHIA 2VKVA 3FXRA 3ZN1A 2MLKA 5LHHA 5ICCA 2V9PA 3IKVA 2XAQA 2R92J 4E7JA 5FGMA 2GLOA 3FHNA 3MAJA 4J00A 1JTYA 3ABKH 1X1AA 2Z16A 1DP7P 3I3LA 2KMUA 2XROA 2OUMA 4LK0F 2KZGA 2M30A 3E97A 4BAYA 3CP8A 2P7VB 2V9VA 3HOSA 2EFPA 1AU7A 1X3UA 3GTQJ 5F6FA 3BZKA 1FYKA 4L0YB 3GTPJ 4QPOA 2W82A 4RB3C 1TC3C 5L3EA 2P7CB 1IXSB 1SD5A 4BXUA 1QZEA 2VC0A 1QRYA 2EIJH 1TWHJ 4PSXA 3RQIA 5D8LB 4UUSA 3E0JB 5M3FJ 4IPAA 2O9LA 5FKNA 1W0TA 4M6YA 1U0JA 5LGTA 4FETA 1DP3A 5LGNA 2B0LA 3T1BA 2KFDA 4ABZA 4ESJA 1D1BA 1PP7U 3OIQA 2PJPA 1HW5A 2ZNYA 2L4MA 2VJIA 3FWEA 5CVIA 3KE2A 3EYIA 2PMZA 2G9WA 5E3LA 1YI2I 3ABLH 3OS1A 3OR2C 2XKPA 4HPQA 4OIRF 4F3QA 1OCTC 2WY8Q 1YW8A 2VJ5A 4ESFA 2DPUA 3ZCOA 3SQNA 2KL4A 1QZYA 1S9HA 1Z6TA 3DU6A 3O2PE 4O5VA 2CW8A 4LJZF 1O7LA 3FZVA 2L7ZA 5D4SA 2V6EA 3ZR8X 1MJAA 1Z1DA 2VQCA 5EEHA 4G12A 4QSHA 4II2A 2Z3YA 2C6YA 3OYFA 3TL4X 1SFEA 4GGGA 2ZSHB 1FBUA 1R36A 2E35A 2V1XA 2YSRA 1FIAA 4C30A 3S1NJ 2ISYA 4V2GA 1ZARA 3A03A 5CQEA 4I0BA 1Q1HA 2CUFA 3L2RA 2EV5A 2HYGD 3BG7A 4I01A 5J6XA 5KCMA 1BJAA 2JRTA 3TQNA 2DI3A 2YUSA 2OQRA 3HOVJ 3BJOA 3CESA 1SMYF 4L5EA 4ENJA 1RUNA 3ZQIA 2O3FA 1FP2A 3S3MA 3WU1B 3HC7A 1YE9A 1P7JA 4UVCA 1K6OA 2ICWG 2LKPA 1ETQA 3BPXA 3WODF 1FT9A 2V9KA 5IP6A 3HJEA 1F43A 2RKHA 1FOKA 3J7ZI 4CCKA 3CQZJ 4LB6B 2PX9A 5AIPA 1D5YA 1OQYA 1KU9A 5JVTA 1U8RA 1WPKA 2Y0MA 2F4OB 3B02A 2ZMEB 1ON2A 5M3MJ 3OY9A 4MGRA 3TEDA 2IVMA 4HG2A 5H20A 2L7FP 1WFXA 2OZ6A 3ECOA 1FBQA 5H6RA 4C3JJ 1Z0XA 4E7HA 4UUVA 1KQ8A 1X2NA 2XAHA 1Z7UA 1OYYA 4FISA 2A6EF 1VQ5I 1YG2A 5AONA 4IQJA 3CCYA 4B4CA 2JWTA 4LG3A 2K3FA 2RREA 1ETVA 2KRCA 4EJOA 2DK8A 2KDOA 1QHGA 5EGOA 3OYIA 1J59A 4PUSA 3V7RA 3CDIA 5C44J 3MQ0A 2BOLA 3QPTA 5H6QA 3VSLA 5GAHJ 3GXOA 3JRHA 2V7FA 5IOYA 3M1CA 3Q5FA 3IHUA 1YS7A 2NOJB 3IH2A 4EQQA 3CJNA 3PNTA 2W24A 4HEA2 3RI4A 4FHTA 4XK4A 1ZGJA 3WU0A 1ZR2A 3C2GA 3KYDB 4PJJA 5F0FA 1SEUA 2DU9A 2K40A 2ZC2A 2Z5UA 3G1MA 1SVMA 4Q4ZF 2EWNA 3LFKA 3GFLA 1BIBA 3I9V2 3K4BA 3K70D 1TWGJ 3L2VA 1T98A 3VODA 3TMOA 4YIFA 4BY7J 1BOAA 2CUZA 5BMZA 1ETKA 3VWBA 2WC2A 1J7KA 1NG7A 3PIOF 4NHJA 1ZH5A 2HNHA 1D0YA 2I10A 4XRSG 1UHMA 2BW3A 3LSHA 3R0JA 3RIRA 3HTUA 4RGUA 1E3PA 3V8KA 1K78B 2JA6J 4ENNA 1XN7A 2FA5A 1EA3A 3RTRA 1LFUP 4RDUA 1FTZA 1HSTA 3BP8A 3JRGA 2B7EA 4EJUA 2VKEA 4B48A 2X0LA 1XCBA 5B1AH 2RNGA 3WHBA 1KU7A 3M1EA 5B66C 4IEJA 1ZR4A 4CZZA 2EZHA 1HF0A 3OYBA 2HWVA 3DP7A 5FRNA 1R6RA 3TW7A 3S32A 3CO6C 3KLOA 2RGVA 2I5UA 2Y69H 3JSPA 3AKZA 3J7AO 3H5RA 4V2FA 4FX4A 3NRVA 3LA2A 4G7HF 2P6TA 4IZZA 3J7AY 2CUEA 4QLCU 4YFKF 4B8XA 2M7AA 2EJRA 2JN6A 4N4OB 2EH3A 1HKSA 4UY8I 2LF7A 4P96A 1D8JA 4YEJA 3WGHA 1TT5B 3GCMA 1L0OC 2HOEA 4DYRA 2IS1A 5DS9A 2QZ8A 3CLQA 3S15J 1P2FA 3VDXA 4I09A 3W6VA 2FD5A 4MFEA 3HM5A 3FXMA 2ADUA 2ECBA 1GXPA 3ZN0A 5HOOA 3PIPF 2XGDA 1T95A 1U6GA 1BC7C 2YU9J 2O8XA 2DT6A 4BQOA 2IXSA 2V79A 1Z77A 5IOZA 2M0CA 2FJ1A 1IN6A 3C1DA 5EZGA 5KNLA 1OPCA 1TZLA 2MH9A 4A3JJ 1YTYA 1SC7A 4E70A 4XRMA 1VQ4I 4Q5SF 1V4RA 3IAS2 4IVNA 3BR2A 3Q0VA 2H09A 4C2MJ 4MIMA 5JLXA 4BBRJ 3H3UA 3KIOA 4W1UA 3A2KA 4XL9A 2ZJPF 4IHYA 2XDVA 4BJ6C 1U5TA 3K1NA 1LFBA 3B73A 1KYWA 4BE0A 2HR3A 4BQAA 2XV4S 1TWAJ 1B8IB 2L9NA 1RC9A 3VYTB 3S2DJ 2Y31A 3BG5A 1LE8B 2ZMEC 5F08A 2GIVA 2W57A 4LLNA 3BLYA 4FTHA 4RLFA 5LFAA 1ERDA 3MVPA 3QU6A 2NOGA 1ORKA 3PNVA 2R5ZB 2K9LA 2LY2A 1P7IA 4HF2A 1FEXA 3HKZN 3LAPA 4CCMA 1W36D 2ZCWA 4L0ZB 1FPQA 1MMDA 2JMWA 1HBXG 1F5TA 1U9NA 4BY1J 4OU0A 2X48A 1NHAA 2JTVA 5BQTA 3W2WA 1SFOJ 1CF7A 3GFJA 2COMA 3BROA 1P9QC 3FXQA 4BHCA 2ELKA 4A0YA 3FK6A 4U0VA 3M4OJ 4LIUA 5BNGA 3P9IA 2BY0A 4I99C 4XSZF 4LGWA 4UV8A 1HW2A 3ZRGA 3K0LA 3LSRA 2QSGX 1HW1A 1OLTA 2DA3A 1D0XA 2G7HA 2IGOA 2FOWA 4L5IA 1S7OA 4LITA 1YHQI 1ZRCA 1RESA 3Q3SA 4P9UA 2AXTC 2DA2A 5JHUA 2PJRA 4AIHA 3CJTB 3WG9A 3ZMDA 3CCRI 1XMKA 1ZAOA 3GYHX 5FKMA 3M8JA 4N9HA 3MEXA 3U1KA 2JA7J 3I0TA 5GAEJ 3H0DA 4HNVA 2QLZA 3S17J 4BQQA 2EFNA 1GVJA 1S29A 2Q2EB 2VKDA 3S1QJ 1R49A 2Y0SN 4HBLA 2IEKA 5CVVA 2CH0A 2NVTJ 1WJ5A 3I4NJ 2R7TA 2HKOA 1D5VA 1P4AA 3NEUA 2M1BA 2FQ4A 4WWCA 2HVRA 1T8IA 4HLXA 1FY7A 3OYJA 2M0MA 2H1KA 4KICA 2QA4I 3ROUA 2X6YA 4ZYEA 5IP7J 4IHTA 2DMNA 3PM1A 4GDFA 1TP4A 1MKMA 1JTXA 3K9TA 5F0CA 3SFIA 3K4NA 1REPC 2IT0A 1B72B 4BH9A 3CF2A 4XICA 3HEFA 1WJEA 5DCMB 3G1LA 1ZLJA 2M2EA 2X1EA 2YX7A 1PUEE 4F52A 1W0UA 4QWQA 1E3OC 2FXAA 5D5VB 3QYEA 1X1BA 2M34A 3R6SA 2GZWA 1JE8A 5HNHA 1S6LA 3IUOA 4RAYA 2DOEA 1RNLA 2MD0A 3AG3H 2HKXA 4IF4A 4YRVA 2QBYA 2ZXWH 1KQ0A 4JOMA 5ILSA 1IN8A 3IAM2 1OISA 1X1PA 1JT0A 3F6VA 3FMSA 3F6OA 3LA3A 1Y39A 1LUJB 4EATA 4I02A 5JR3A 2M87A 1WCMJ 3VYRB 3QP5A
chains in the Genus database with same CATH topology
2P81A 4FE4A 2N8GA 3JRAA 3D1NI 1IC8A 1BW5A 1NK2P 5EZHA 3PO2J 2EZIA 4M3BA 1IUFA 2FX0A 2R5YB 3BR6A 5M5XJ 1GT0C 2Y9ZA 4LOCA 4JX5A 3TP3A 1U78A 1AKHA 3FK7A 1HCRA 5J1YA 2XPVA 3Q0WA 1A6IA 2QF7A 5EGOB 4M3EA 1B72A 1JJ6C 1QPIA 3QQAA 5GPCA 3CDLA 4CYCB 1U9OA 3BR1A 2LFBA 1ETXA 2WAQN 2ID6A 3LSGA 1RR7A 2DA7A 3HOWJ 2MSYA 4A3EJ 2XB0X 2HXIA 1Q1VA 1MBJA 2EZKA 1YRNA 3LNQA 3F0CA 4A3FJ 2WB1N 2IAIA 1OJLA 5IP9J 1IDZA 3S2HJ 4MFDA 2H8RA 2COBA 1MBFA 1CQTA 2VKVA 5E3OA 2R5YA 2ECCA 1XC5A 2EZLA 2LVSA 3GBGA 3BTIA 2R92J 2R93J 2GLOA 1JTYA 1APLC 5E3NA 2JK3A 1RPWA 1UMQA 3ZQCA 3TP0A 5JLWA 5FKOA 3TW6A 3WHCA 4UUTA 1DU6A 2WV1A 1AU7A 1HOMA 1JUSA 1X58A 3GTQJ 1MH4A 4M3FA 3GTPJ 1MBHA 1TC3C 3A02A 4EEFG 1QRYA 3RQIA 1TWHJ 4M6VA 4UUSA 2MW8A 5M3FJ 2O9LA 5FKNA 1W0TA 3QPSA 1WGXA 1MBKA 2M8GX 5DTDA 5J1RA 3S16J 4ABZA 1K83J 4JP0A 4UUSB 1VI0A 2NVYJ 2E19A 5E3MA 5F04A 3B6CA 5E3LA 2K9SA 4AC0A 3VPRA 1OCTC 3I4MJ 4M3DA 5EDNA 3O8HA 2XB5A 2L7MP 1S7EA 5FLVA 1QVUA 1NTCA 3ZOBA 2B63J 3S1MJ 5IYDJ 2L7ZA 2D5VA 1JUMA 1I3QJ 2W48A 4G12A 4QSHA 4I76A 3OIOA 3MKLA 1JKQC 3OOUA 4XIDA 1FIAA 3RZDJ 4Y52J 3S1NJ 1TWFJ 3SJMA 3HOUJ 3BR0A 4V2GA 9ANTA 1BJZA 1JT6A 3A03A 4A3DJ 3NAUA 3HOXJ 1BL0A 2LKXA 2E2JJ 2CUFA 5EF6A 4XRSA 3K7AJ 2YUSA 3HOVJ 2NS8A 4L5EA 2LK2A 3ZQIA 1ZK8A 3JRBA 2K9QA 1XS9A 2KT0A 2PMZN 2CQQA 2HOTA 1P7JA 3JRCA 3NARA 2DN0A 1ETQA 2JA5J 5FJ8J 5IP6A 1F43A 3BTLA 4D5CA 5F1JA 2DA6A 3ZQGA 3CQZJ 1IV6A 4A3BJ 3ZQLA 1D5YA 2NVQJ 1MNMC 2CJJA 1Y1VJ 1WPKA 3BTCA 4D7NA 1T33A 1FIPA 1X2MA 2HXOA 2VI6A 3LOCA 5M3MJ 1VFCA 1PUFA 4BBSJ 3TEDA 2DMPA 2L7FP 1IDYA 4FCYA 3HB9A 1K61A 4C3JJ 4C3IJ 1Z0XA 5HODA 1X2NA 4FISA 1GUUA 3CCYA 1GV2A 1ETWA 4D5FA 3BT9A 4B4CA 2JWTA 4I6ZA 2DMQA 1NK3P 1ETVA 2XRLA 3UKGA 1O4XA 4AYBN 1ZQ3P 5EGOA 2Y30A 4MLOA 5FLMJ 1MBGA 5C44J 2Y2ZA 4A3IJ 3ZQHA 1LE8A 3JRHA 2G0EA 3DCFA 5IOYA 2M9HA 2HQ5A 3IH2A 3JREA 4W97A 4XK4A 3LSPA 1ZR2A 2JJ7A 5F0FA 1WH5A 2K40A 1F36A 3O8GA 3G1MA 2XPUA 2CRGA 1RKWA 3OSGA 2HYJA 1TWGJ 5EG0B 1U8BA 5IPAA 4BY7J 2L9RA 1ETKA 3HGGA 2TRTA 1ITYA 3A01B 3S14J 3LSJA 1MBEA 2I10A 4XRSG 4NDLA 1G2HA 2JA6J 4AUXA 4A93J 3BG9A 2DA1A 3K2AA 1I6HJ 1LFUP 3JR9A 4RDUA 1FTZA 1ZGWA 3JRGA 2VKEA 3PO3J 1IJWC 2LR8A 3WHBA 3M3YJ 2AO9A 2XGCA 4IEJA 1ZR4A 1ENHA 3BQZA 3BR5A 2EZHA 4D7MA 1HF0A 1MSEC 1BA5A 2DA5A 3TW7A 5K7HA 2XGEA 2O8KA 4V2FA 1I50J 4DZJA 2ME0A 4S0HB 2DMUA 1POGA 2CUEA 4MO7A 2ID3A 1A5JA 1ETOA 2JN6A 2EH3A 2CU7A 3CMYA 4DYRA 1R9TJ 2E1OA 5DS9A 1ETYA 3S15J 4JYKA 3W6VA 2FD5A 4MFEA 3GTGJ 3HM5A 2R7ZJ 4DZPA 2MGQA 3OSFA 2ECBA 2MG4A 2ME6A 2OPTA 2XSDC 1AHDP 2XGDA 1GV5A 2L0KA 3IH3A 4DW6A 1JJ8C 1H8AC 2YU9J 2HOAA 2IBDA 1FJLA 2KDZA 3L1PA 2TCTA 2X9DA 1UHSA 1Z77A 5IOZA 2M0CA 2FJ1A 5EZGA 2EBIA 1MSFC 2LY9A 4A3JJ 1WI3A 1HDPA 2DJNA 2LLKA 4XRMA 1EF4A 3GTJJ 2OF7A 5GP9A 2NVXJ 3BR2A 3Q0VA 1JUPA 2E2HJ 5GPAA 1B8IA 2R0QC 4A3KJ 4C2MJ 4MIMA 4J19A 5JLXA 4A3CJ 1TWCJ 4BBRJ 4W1UA 3GTMJ 2AHQA 1IGNA 4IHYA 3HOYJ 1HLVA 1LFBA 4B1RA 4JX6A 2E2IJ 1IRZA 1TWAJ 3HBLA 1B8IB 4X6AJ 2R5ZA 3S2DJ 2Y31A 3BG5A 4X1EA 5F08A 1LE8B 2HI3A 4FTHA 1OCPA 1GDTA 1ZKGA 3FISA 3MVPA 1FTTA 1RETA 5FKLA 5M5YJ 5J1UA 2NOGA 4A69C 1ORKA 1UG2A 1H88C 2LTPA 2R5ZB 2EQRA 1P7IA 5C4JJ 3A01A 1RKTA 1FEXA 2RAEA 3HKZN 3Q0UA 2JMWA 2NS7A 5J3LA 1U9NA 1JKPC 4BY1J 4FE7A 3H3VK 3BTJA 1WH7A 5EG0A 2X48A 2Y9YA 4A3GJ 1IG7A 1SFOJ 2DTZA 1T56A 2ELKA 3M4OJ 3FK6A 5BNGA 1PUFB 2XPWA 1VNDA 3HDDA 4DYQA 5FKKA 3DEWA 3LSRA 1ZTRA 2DA3A 3B6AA 3FKIJ 3HOZJ 5IYBJ 4BKXA 3SDGA 3HGYA 4JX4A 1RESA 3Q3SA 1MH3A 3ZQFA 2QCOA 2DA2A 1GVDA 1YRNB 5M5WJ 1XG1A 5FKMA 2LP0A 4BXXJ 3BR3A 2GBYA 4CYCA 3JRFA 2JA7J 4GFBA 4A3MJ 4HNVA 3S17J 3IV5A 1OFCX 3MN2A 3S1QJ 2DA4A 2CQXA 2IEKA 2Y0SN 2NVTJ 3I4NJ 5K7FA 4A3LJ 2FQ4A 5C3EJ 4IHWA 3GTLJ 2H1KA 4RBOA 5K7ZA 5IP7J 2DMNA 3PM1A 2GM4A 2K9NA 1JTXA 3H0GJ 3JRDA 2HOSA 2VPRA 5F0CA 3C2BA 3SFIA 5EEAA 1B72B 3JRIA 1JKOC 5EYRA 1SANA 3HEFA 4XICA 4QTRA 3BQYA 2JA8J 3GTOJ 2ZB9A 3G1LA 2M2EA 1W0UA 4Y7NJ 3GTKJ 1E3OC 3BG3A 2X6OA 1AKHB 5IYCJ 3G1OA 1VF9A 3FIWA 2DMTA 5F27A 2M34A 2O7OA 1DU0A 3QPLA 4C3HJ 1QVTA 3RKQA 5F0HA 1JGGA 2VUMJ 4IHXA 3RZOJ 3IH4A 4M3GA 3S1RJ 2LD5A 1Y1WJ 1HDDC 4B3AA 4DYCA 4IHVA 3E7LA 1JT0A 1BW6A 1H89C 2YS9A 1JKRC 2HDDA 1WCMJ 5C4XJ 4QIWN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P81 A;  4FE4 A;  2N8G A;  3JRA A;  3D1N I;  1IC8 A;  1BW5 A;  1NK2 P;  5EZH A;  3PO2 J;  2EZI A;  4M3B A;  1IUF A;  2FX0 A;  2R5Y B;  3BR6 A;  5M5X J;  1GT0 C;  2Y9Z A;  4LOC A;  4JX5 A;  3TP3 A;  1U78 A;  1AKH A;  3FK7 A;  1HCR A;  5J1Y A;  2XPV A;  3Q0W A;  1A6I A;  2QF7 A;  5EGO B;  4M3E A;  1B72 A;  1JJ6 C;  1QPI A;  3QQA A;  5GPC A;  3CDL A;  4CYC B;  1U9O A;  3BR1 A;  2LFB A;  1ETX A;  2WAQ N;  2ID6 A;  3LSG A;  1RR7 A;  2DA7 A;  3HOW J;  2MSY A;  4A3E J;  2XB0 X;  2HXI A;  1Q1V A;  1MBJ A;  2EZK A;  1YRN A;  3LNQ A;  3F0C A;  4A3F J;  2WB1 N;  2IAI A;  1OJL A;  5IP9 J;  1IDZ A;  3S2H J;  4MFD A;  2H8R A;  2COB A;  1MBF A;  1CQT A;  2VKV A;  5E3O A;  2R5Y A;  2ECC A;  1XC5 A;  2EZL A;  2LVS A;  3GBG A;  3BTI A;  2R92 J;  2R93 J;  2GLO A;  1JTY A;  1APL C;  5E3N A;  2JK3 A;  1RPW A;  1UMQ A;  3ZQC A;  3TP0 A;  5JLW A;  5FKO A;  3TW6 A;  3WHC A;  4UUT A;  1DU6 A;  2WV1 A;  1AU7 A;  1HOM A;  1JUS A;  1X58 A;  3GTQ J;  1MH4 A;  4M3F A;  3GTP J;  1MBH A;  1TC3 C;  3A02 A;  4EEF G;  1QRY A;  3RQI A;  1TWH J;  4M6V A;  4UUS A;  2MW8 A;  5M3F J;  2O9L A;  5FKN A;  1W0T A;  3QPS A;  1WGX A;  1MBK A;  2M8G X;  5DTD A;  5J1R A;  3S16 J;  4ABZ A;  1K83 J;  4JP0 A;  4UUS B;  1VI0 A;  2NVY J;  2E19 A;  5E3M A;  5F04 A;  3B6C A;  5E3L A;  2K9S A;  4AC0 A;  3VPR A;  1OCT C;  3I4M J;  4M3D A;  5EDN A;  3O8H A;  2XB5 A;  2L7M P;  1S7E A;  5FLV A;  1QVU A;  1NTC A;  3ZOB A;  2B63 J;  3S1M J;  5IYD J;  2L7Z A;  2D5V A;  1JUM A;  1I3Q J;  2W48 A;  4G12 A;  4QSH A;  4I76 A;  3OIO A;  3MKL A;  1JKQ C;  3OOU A;  4XID A;  1FIA A;  3RZD J;  4Y52 J;  3S1N J;  1TWF J;  3SJM A;  3HOU J;  3BR0 A;  4V2G A;  9ANT A;  1BJZ A;  1JT6 A;  3A03 A;  4A3D J;  3NAU A;  3HOX J;  1BL0 A;  2LKX A;  2E2J J;  2CUF A;  5EF6 A;  4XRS A;  3K7A J;  2YUS A;  3HOV J;  2NS8 A;  4L5E A;  2LK2 A;  3ZQI A;  1ZK8 A;  3JRB A;  2K9Q A;  1XS9 A;  2KT0 A;  2PMZ N;  2CQQ A;  2HOT A;  1P7J A;  3JRC A;  3NAR A;  2DN0 A;  1ETQ A;  2JA5 J;  5FJ8 J;  5IP6 A;  1F43 A;  3BTL A;  4D5C A;  5F1J A;  2DA6 A;  3ZQG A;  3CQZ J;  1IV6 A;  4A3B J;  3ZQL A;  1D5Y A;  2NVQ J;  1MNM C;  2CJJ A;  1Y1V J;  1WPK A;  3BTC A;  4D7N A;  1T33 A;  1FIP A;  1X2M A;  2HXO A;  2VI6 A;  3LOC A;  5M3M J;  1VFC A;  1PUF A;  4BBS J;  3TED A;  2DMP A;  2L7F P;  1IDY A;  4FCY A;  3HB9 A;  1K61 A;  4C3J J;  4C3I J;  1Z0X A;  5HOD A;  1X2N A;  4FIS A;  1GUU A;  3CCY A;  1GV2 A;  1ETW A;  4D5F A;  3BT9 A;  4B4C A;  2JWT A;  4I6Z A;  2DMQ A;  1NK3 P;  1ETV A;  2XRL A;  3UKG A;  1O4X A;  4AYB N;  1ZQ3 P;  5EGO A;  2Y30 A;  4MLO A;  5FLM J;  1MBG A;  5C44 J;  2Y2Z A;  4A3I J;  3ZQH A;  1LE8 A;  3JRH A;  2G0E A;  3DCF A;  5IOY A;  2M9H A;  2HQ5 A;  3IH2 A;  3JRE A;  4W97 A;  4XK4 A;  3LSP A;  1ZR2 A;  2JJ7 A;  5F0F A;  1WH5 A;  2K40 A;  1F36 A;  3O8G A;  3G1M A;  2XPU A;  2CRG A;  1RKW A;  3OSG A;  2HYJ A;  1TWG J;  5EG0 B;  1U8B A;  5IPA A;  4BY7 J;  2L9R A;  1ETK A;  3HGG A;  2TRT A;  1ITY A;  3A01 B;  3S14 J;  3LSJ A;  1MBE A;  2I10 A;  4XRS G;  4NDL A;  1G2H A;  2JA6 J;  4AUX A;  4A93 J;  3BG9 A;  2DA1 A;  3K2A A;  1I6H J;  1LFU P;  3JR9 A;  4RDU A;  1FTZ A;  1ZGW A;  3JRG A;  2VKE A;  3PO3 J;  1IJW C;  2LR8 A;  3WHB A;  3M3Y J;  2AO9 A;  2XGC A;  4IEJ A;  1ZR4 A;  1ENH A;  3BQZ A;  3BR5 A;  2EZH A;  4D7M A;  1HF0 A;  1MSE C;  1BA5 A;  2DA5 A;  3TW7 A;  5K7H A;  2XGE A;  2O8K A;  4V2F A;  1I50 J;  4DZJ A;  2ME0 A;  4S0H B;  2DMU A;  1POG A;  2CUE A;  4MO7 A;  2ID3 A;  1A5J A;  1ETO A;  2JN6 A;  2EH3 A;  2CU7 A;  3CMY A;  4DYR A;  1R9T J;  2E1O A;  5DS9 A;  1ETY A;  3S15 J;  4JYK A;  3W6V A;  2FD5 A;  4MFE A;  3GTG J;  3HM5 A;  2R7Z J;  4DZP A;  2MGQ A;  3OSF A;  2ECB A;  2MG4 A;  2ME6 A;  2OPT A;  2XSD C;  1AHD P;  2XGD A;  1GV5 A;  2L0K A;  3IH3 A;  4DW6 A;  1JJ8 C;  1H8A C;  2YU9 J;  2HOA A;  2IBD A;  1FJL A;  2KDZ A;  3L1P A;  2TCT A;  2X9D A;  1UHS A;  1Z77 A;  5IOZ A;  2M0C A;  2FJ1 A;  5EZG A;  2EBI A;  1MSF C;  2LY9 A;  4A3J J;  1WI3 A;  1HDP A;  2DJN A;  2LLK A;  4XRM A;  1EF4 A;  3GTJ J;  2OF7 A;  5GP9 A;  2NVX J;  3BR2 A;  3Q0V A;  1JUP A;  2E2H J;  5GPA A;  1B8I A;  2R0Q C;  4A3K J;  4C2M J;  4MIM A;  4J19 A;  5JLX A;  4A3C J;  1TWC J;  4BBR J;  4W1U A;  3GTM J;  2AHQ A;  1IGN A;  4IHY A;  3HOY J;  1HLV A;  1LFB A;  4B1R A;  4JX6 A;  2E2I J;  1IRZ A;  1TWA J;  3HBL A;  1B8I B;  4X6A J;  2R5Z A;  3S2D J;  2Y31 A;  3BG5 A;  4X1E A;  5F08 A;  1LE8 B;  2HI3 A;  4FTH A;  1OCP A;  1GDT A;  1ZKG A;  3FIS A;  3MVP A;  1FTT A;  1RET A;  5FKL A;  5M5Y J;  5J1U A;  2NOG A;  4A69 C;  1ORK A;  1UG2 A;  1H88 C;  2LTP A;  2R5Z B;  2EQR A;  1P7I A;  5C4J J;  3A01 A;  1RKT A;  1FEX A;  2RAE A;  3HKZ N;  3Q0U A;  2JMW A;  2NS7 A;  5J3L A;  1U9N A;  1JKP C;  4BY1 J;  4FE7 A;  3H3V K;  3BTJ A;  1WH7 A;  5EG0 A;  2X48 A;  2Y9Y A;  4A3G J;  1IG7 A;  1SFO J;  2DTZ A;  1T56 A;  2ELK A;  3M4O J;  3FK6 A;  5BNG A;  1PUF B;  2XPW A;  1VND A;  3HDD A;  4DYQ A;  5FKK A;  3DEW A;  3LSR A;  1ZTR A;  2DA3 A;  3B6A A;  3FKI J;  3HOZ J;  5IYB J;  4BKX A;  3SDG A;  3HGY A;  4JX4 A;  1RES A;  3Q3S A;  1MH3 A;  3ZQF A;  2QCO A;  2DA2 A;  1GVD A;  1YRN B;  5M5W J;  1XG1 A;  5FKM A;  2LP0 A;  4BXX J;  3BR3 A;  2GBY A;  4CYC A;  3JRF A;  2JA7 J;  4GFB A;  4A3M J;  4HNV A;  3S17 J;  3IV5 A;  1OFC X;  3MN2 A;  3S1Q J;  2DA4 A;  2CQX A;  2IEK A;  2Y0S N;  2NVT J;  3I4N J;  5K7F A;  4A3L J;  2FQ4 A;  5C3E J;  4IHW A;  3GTL J;  2H1K A;  4RBO A;  5K7Z A;  5IP7 J;  2DMN A;  3PM1 A;  2GM4 A;  2K9N A;  1JTX A;  3H0G J;  3JRD A;  2HOS A;  2VPR A;  5F0C A;  3C2B A;  3SFI A;  5EEA A;  1B72 B;  3JRI A;  1JKO C;  5EYR A;  1SAN A;  3HEF A;  4XIC A;  4QTR A;  3BQY A;  2JA8 J;  3GTO J;  2ZB9 A;  3G1L A;  2M2E A;  1W0U A;  4Y7N J;  3GTK J;  1E3O C;  3BG3 A;  2X6O A;  1AKH B;  5IYC J;  3G1O A;  1VF9 A;  3FIW A;  2DMT A;  5F27 A;  2M34 A;  2O7O A;  1DU0 A;  3QPL A;  4C3H J;  1QVT A;  3RKQ A;  5F0H A;  1JGG A;  2VUM J;  4IHX A;  3RZO J;  3IH4 A;  4M3G A;  3S1R J;  2LD5 A;  1Y1W J;  1HDD C;  4B3A A;  4DYC A;  4IHV A;  3E7L A;  1JT0 A;  1BW6 A;  1H89 C;  2YS9 A;  1JKR C;  2HDD A;  1WCM J;  5C4X J;  4QIW N; 
#chains in the Genus database with same CATH topology
 2DTR A;  2MFZ A;  1U5T C;  5HLT A;  3D1N I;  4RGS A;  1J75 A;  4AM3 A;  1BW5 A;  3WTX C;  1ODD A;  1R1T A;  1RRJ A;  4KN7 X;  3PO2 J;  2EZI A;  2DQR A;  5HS7 A;  2CSO A;  1V54 H;  2VC1 A;  3QP6 A;  4JQF A;  5HLI A;  4BDZ A;  1IZ1 A;  2E1M B;  2X6X A;  4LOC A;  4L9T A;  1FX7 A;  2Q8K A;  1P4W A;  1U78 A;  2CG4 A;  3NWT A;  3CCE I;  3PQK A;  1FBS A;  3Q0W A;  1YIO A;  2X4H A;  4WF2 A;  3MZY A;  4CA0 A;  2JZY A;  2V4J C;  1B72 A;  4ENK A;  2A07 F;  3QQA A;  3W6K B;  1V5E A;  5GPC A;  4CYC B;  4ZZD A;  3LSG A;  1RR7 A;  1K79 A;  3L9F A;  1MJB A;  2PJR B;  5DD8 A;  1JI8 A;  3D5L A;  2WB1 N;  1R71 A;  3L09 A;  5DM7 F;  2IAI A;  3AG2 H;  1UST A;  5IP9 J;  1IDZ A;  1EH8 A;  2XHK A;  1CGP A;  3S2H J;  2QWW A;  2STT A;  3SXY A;  2EPF A;  4B47 A;  4JK1 X;  1CQT A;  2R5Y A;  2NNY A;  3EUK L;  1XGN A;  2CW7 A;  3LWF A;  3HRM A;  3TOB A;  1E0E A;  3J81 Z;  3TKY A;  2EZL A;  2FML A;  1K6Y A;  2R93 J;  5J8F A;  1MMG A;  5E3N A;  3CC7 I;  2LG4 A;  1ZLK A;  2VT2 A;  1RZ4 A;  1GXQ A;  1SVO A;  2D45 A;  3MCZ A;  1QQI A;  1SD7 A;  3OIP A;  4BDY A;  4D1Q A;  3DLA A;  4XN3 A;  3LMM A;  1W5T A;  1IN4 A;  1TNT A;  2DJI A;  3ZMT A;  3DQV C;  1HOM A;  3WU2 C;  1PP8 F;  1X58 A;  3FXJ A;  1MH4 A;  4YFX F;  4M3F A;  2BBY A;  3HOT A;  5E1W A;  4PGH A;  3GME A;  4G6Q A;  1O7F A;  3DFG A;  3ZMU A;  1LFP A;  3QPS A;  1WGX A;  2LOO A;  5DTD A;  5D6F A;  2BEO A;  3S16 J;  2FE3 A;  2M4K A;  5LLQ A;  3S2W A;  3FBI B;  4E4H A;  1I1G A;  1PVE A;  2GQQ A;  4CCN A;  5KVR A;  2E19 A;  3CMM A;  1Z7L A;  5TJJ A;  3F22 A;  2HQN A;  4E6K G;  1TT0 A;  5F04 A;  3B6C A;  3LSK A;  1WJB A;  1T2K A;  1MJ9 A;  3H9G A;  4AC0 A;  2Q2E A;  3V4G A;  3VPR A;  4BS9 A;  4WXH A;  1N77 A;  2RQQ A;  5DCF A;  3FX3 A;  2L7M P;  1S7E A;  3ZQ7 A;  1LKX A;  4GYI A;  1P6R A;  4IRI A;  1R5I D;  3Q9V A;  2XUB A;  2M8E A;  4B44 A;  2DW4 A;  2ZJR F;  4HSR A;  4F7Z A;  3OIO A;  3MKL A;  4M73 A;  2BGC A;  2QYO A;  3RZD J;  1QO0 D;  1TWF J;  2ACJ A;  3KZI C;  4A0Z A;  1UCR A;  9ANT A;  4PSW A;  3QPH A;  4A3D J;  2Z1D A;  5IY5 H;  2LKX A;  3EQL F;  1LJ9 A;  2F5D A;  4MNU A;  5EF6 A;  3KZY A;  1FMW A;  4JBA A;  1F9N A;  3M8E A;  5EEG A;  2R4G A;  2NS8 A;  3ECH A;  2LK2 A;  1YIT I;  1FOY A;  4ITV A;  1G3T A;  4LD5 A;  4ZYD A;  2BHY A;  4RGR A;  2K9Q A;  1YO5 C;  2KT0 A;  2PMZ N;  2HOT A;  1YJ9 I;  3BJA A;  2G7U A;  5BS6 A;  3MMY B;  3U2R A;  2JA5 J;  5FJ8 J;  2JVH A;  3BTL A;  3SYT A;  5CVJ A;  3LA7 A;  1TNS A;  3H5N A;  5F1J A;  3A4C A;  2DA6 A;  4ZYA A;  1VTN C;  2QEN A;  3JTH A;  1Z3X A;  3ZQG A;  1IV6 A;  1Y0U A;  4IRH A;  3T0Y A;  1Y1V J;  4PJM A;  1VQM I;  4IRG A;  4D7N A;  1T33 A;  4EGY A;  1FIP A;  2VI6 A;  4BBS J;  1UJ8 A;  1VQO I;  3SEQ A;  4LK1 F;  3FBN B;  2OAZ A;  4YII A;  1I5Z A;  3V7S A;  3HB9 A;  1HKT A;  2DFF A;  5IT3 A;  3GZN B;  3M7G A;  3WE3 A;  4PK4 A;  1A6Q A;  2EB7 A;  1GUU A;  3PJR A;  2OD5 A;  4WX9 A;  2UXX A;  1GV2 A;  1ETW A;  1O57 A;  3DKY A;  4BGD A;  3BT9 A;  5JFR A;  5L3F A;  1IUY A;  1DPR A;  2DMQ A;  3DU5 A;  1IXR C;  2XRL A;  2LBF B;  3WE2 A;  1NK3 P;  4CGZ A;  4BHP A;  2H94 A;  2M7B A;  2Y30 A;  1O3T A;  2UXN A;  3J80 Z;  3KEO A;  2KJC A;  4XOR A;  2RVC A;  3ZQH A;  2LRD A;  1R7J A;  2M9H A;  3COA C;  1BR1 A;  2Y75 A;  2HQ5 A;  4X0G A;  2K02 A;  3MKY B;  1FMV A;  3PL8 A;  3KP3 A;  2GWR A;  3MD2 A;  1GHC A;  4OMY A;  3D0S A;  5FRM A;  4CIC A;  2LSO A;  4EM0 B;  3I59 B;  3PFY A;  4G9Y A;  2DT5 A;  2E7X A;  3P9C A;  1P92 A;  1V55 H;  1FSE A;  4PGG A;  4E7L A;  2VN2 A;  3OYL A;  3C3W A;  2R7R A;  2EFW A;  4BNC A;  3E5U A;  1IF1 A;  2B9S A;  3BG9 A;  1ZG5 A;  2VOP A;  5HS9 A;  3K2A A;  2XF6 A;  3RSN A;  4BEH A;  1I6H J;  3E6M A;  3CUQ A;  3DTE A;  1WJC A;  5LBQ A;  1LPQ A;  2QQ8 A;  2KZV A;  3PO3 J;  4RAG A;  2OC6 A;  3LAJ A;  3TBI A;  3K4J A;  1G59 A;  3K69 A;  1QGP A;  1A35 A;  2R7S A;  4PDK A;  4RB0 A;  1BA5 A;  2D1H A;  3TDU C;  1FOW A;  1W7P B;  4HQM A;  1ZYR F;  4WXC A;  4XLE A;  1ZRE A;  2VXD A;  3I64 A;  1E2X A;  5ERI A;  4AVP A;  4EGZ A;  3LFU A;  2M3A A;  3NWS A;  3HRS A;  4CDG A;  2KRF A;  3I59 A;  4PJL A;  4A6D A;  5FB2 A;  4ZDO A;  1IN7 A;  2ME0 A;  4IJA A;  3CLO A;  4S0H B;  2JUG A;  4NC8 A;  3W2V A;  3F8N A;  4EM2 A;  2XF5 A;  5LGU A;  2ID3 A;  4CYD A;  4E7S A;  1A5J A;  3H3Z A;  5JHF A;  4XNF A;  4C2T A;  2VKH A;  4NQW B;  2HS5 A;  3E5Q A;  3ML6 A;  4N9I A;  1R9T J;  3TO7 A;  4I2O A;  2E1O A;  2Q1Z B;  2EV0 A;  4FT8 A;  1ZGA A;  3FXL A;  5DUK A;  1T6S A;  3KYL A;  3KX2 A;  3DBR B;  3TDZ C;  2A5Y B;  3GTG J;  3K4K A;  2R7Z J;  4DZP A;  1B1B A;  3HKZ A;  2XSD C;  1AHD P;  1Y6I A;  1H8A C;  1HA8 A;  2A3S A;  2K5C A;  3F8B A;  2IBD A;  2PQ8 A;  3OYG A;  1FJL A;  5HDK A;  3L1P A;  2X9D A;  2QQA A;  1UHS A;  1W7P A;  1OCR H;  2ZFW A;  1STZ A;  2UWM A;  4ZTJ A;  1XSD A;  4MHG A;  1EH6 A;  2P5V A;  1WI3 A;  5E1X A;  4RS8 A;  3OOP A;  2DFI A;  2VLA A;  2FNP A;  2HTS A;  1UFM A;  1O3R A;  1JUP A;  5F64 A;  2E2H J;  2EFQ A;  3H36 A;  2JPC A;  2R0Q C;  4J19 A;  1R23 A;  3JW4 A;  3VEP A;  2K86 A;  3WTZ A;  3J80 K;  4IO9 F;  1DPU A;  3HOY J;  1EKE A;  3BDD A;  4B1R A;  4XBF A;  4AD9 A;  5KK1 A;  1MIJ A;  1F1Z A;  2K4J A;  3L00 A;  1YFH A;  4X6A J;  3QOP A;  2DOF A;  2DYS H;  4IXA A;  4OIN F;  1OCP A;  2HGC A;  3FIS A;  1RET A;  5FKL A;  5M5Y J;  4BAC A;  1Z21 A;  1SAU A;  4EVI A;  1H88 C;  3GZ5 A;  1G3S A;  2F5F A;  4F92 B;  2RAE A;  4MQV A;  3Q0U A;  1YLF A;  3VSK A;  1FNN A;  1IRF A;  5J3L A;  2GXA A;  3ELK A;  2GAU A;  1JKP C;  4FE7 A;  3BTJ A;  3PUF A;  4XLN F;  5EG0 A;  4HZF A;  4J01 A;  2VOO A;  5BOX A;  2HPM A;  1IG7 A;  4ZC3 A;  3DPL C;  1UZC A;  1WQ2 A;  2QM3 A;  2ZXH A;  5E1Z B;  2XPW A;  2CW0 F;  1O3Q A;  5GAD J;  1IRG A;  2BYV E;  2MAB A;  1U5T B;  2VL8 A;  3DEW A;  4XLH A;  4YG2 F;  1ZTR A;  1IO2 A;  3HOZ J;  5IYB J;  4BKX A;  3PSI A;  3QOD A;  4L9V A;  4ESB A;  2DXI A;  4AVZ A;  5D5W B;  4M74 A;  2DQL A;  1OCZ H;  3KEY A;  2VAS A;  3ASN H;  3ZQF A;  2QCO A;  3RKX A;  1I1S A;  2KQR A;  3K70 C;  3RCO A;  2WAD A;  4UVA A;  4N4N B;  2H6C A;  2LYC A;  3W2A A;  1H0M A;  4U7D A;  5J8C A;  1X3W B;  4CYC A;  3JRF A;  3JTG A;  3WTW C;  1TQM A;  2V6C A;  2OA4 A;  4KIT B;  3MN2 A;  2BV6 A;  1XMX A;  2WTE A;  2QSF X;  5LRS A;  4ON0 A;  4KA4 A;  2F4M B;  1WVR A;  4UV9 A;  3G71 I;  2Z33 A;  3OYC A;  3CF5 F;  1E3H A;  2L5Q A;  4RBO A;  4IL6 C;  2JPB A;  3K6G A;  5K7Z A;  1KA8 A;  2R7V A;  2XAG A;  2LNB A;  2VBY A;  4OMZ A;  2F5C A;  3EUA A;  4Y13 A;  1W4M A;  2LRE A;  4G6T B;  1Z9C A;  5ED4 A;  5DEQ A;  1JKO C;  2M45 A;  3CCJ I;  3BQY A;  2ZB9 A;  3KP5 A;  1OR7 A;  1NH3 A;  2WB1 A;  1BR2 A;  4Y7N J;  4XM3 A;  1ZG1 A;  1K7A A;  3GTK J;  1BIA A;  3HG9 A;  2ETH A;  2MLG A;  3KP7 A;  4XMY A;  2ESN A;  3ABM H;  4PCQ A;  2X51 A;  2QGU A;  5F27 A;  5DUI A;  1WI9 A;  3BY6 A;  1VQN I;  2GA1 A;  5DYM A;  3CCS I;  4HF1 A;  2J5P A;  2ZNZ A;  1C0W A;  3CME I;  1MZB A;  1Y1W J;  3CC2 I;  3IC7 A;  2RQP A;  4DYC A;  1IN5 A;  4IHV A;  2DYR H;  5IT9 K;  4ANJ A;  4A6E A;  4G7Z F;  2IGK A;  4FE4 A;  2N8G A;  3LL7 A;  4KNY A;  3L7W A;  4PFO A;  1Y56 A;  1FZP B;  4XR6 A;  3EUH A;  2EIM H;  3ESW B;  3IWZ A;  3MKZ A;  1QU3 A;  2E71 A;  5DCM A;  2LH9 A;  3ZGK A;  2CFX A;  3I58 A;  2FQ3 A;  2YPR A;  3IWF A;  1T39 A;  4AID A;  4HYE A;  4CXF A;  5J1Y A;  1HCR A;  4XLP F;  3LQQ A;  3GW2 A;  2L02 A;  3VYU B;  4GO1 A;  5LD2 C;  3TO6 A;  2K9M A;  1OYI A;  2L54 A;  1JJ6 C;  2LKS A;  2OCC H;  2ESH A;  2ZXI A;  4B09 A;  1FLI A;  1ACI A;  2Z9O A;  2ISZ A;  2YR2 A;  1T08 B;  4UNO A;  2LFB A;  2WAQ N;  3OWT A;  2ID6 A;  4CCJ A;  4A3E J;  4IOA F;  2HXI A;  2EZK A;  1MBJ A;  4NB5 A;  3HTS B;  1YRN A;  1WJD A;  3LNQ A;  3F0C A;  1LQ1 A;  3E5X A;  2COB A;  4Z6Y A;  5KAI C;  3WTU C;  5E3O A;  1M1E B;  2ECC A;  2IGM A;  1QBJ A;  1XGS A;  3V8L A;  2ZJQ F;  1XC5 A;  1YW7 A;  5J47 A;  2LVS A;  3GBG A;  4HX7 A;  4C9Y A;  4ZDL A;  1G4D A;  1APL C;  1RI7 A;  2CUJ A;  3M07 A;  4LLL A;  3T5X A;  2F6C A;  5JLW A;  4KIG A;  5FD5 A;  5FKO A;  2GXG A;  3VOE A;  3KP6 A;  5GAG J;  3WHC A;  2IRF G;  2BVM A;  2V1D A;  4UUT A;  1DU6 A;  2WV1 A;  2DOD A;  3HSE A;  2FU4 A;  2MC3 A;  5FLX Z;  3MZH A;  4U0Y A;  2HZT A;  2JSC A;  1MBH A;  5ICF A;  3CCQ I;  4CHU A;  1W36 C;  1FYL A;  1YQA A;  4IQ4 A;  4YEL A;  2DLL A;  1T0F C;  4YFN F;  2IGN A;  2TDX A;  5E8G A;  2M8G X;  3ZP5 A;  3CUO A;  4XKV A;  5D6E A;  5DM6 F;  3OMY A;  4RAZ A;  4R1H A;  2RC4 A;  1S5L C;  4HX4 A;  3W3C A;  5A2Q Z;  1K83 J;  4UUS B;  1VI0 A;  3GFI A;  2DOA A;  1LEB A;  2K9S A;  1XPX A;  1P4X A;  1FP1 D;  2CV2 A;  1OKR A;  2VBX A;  3I4M J;  3H5A A;  3WTS C;  3ZPL A;  3O8H A;  2F4I A;  5FFX A;  3G2B A;  3IL2 A;  3CO7 C;  4KYW A;  2E34 A;  3ZOB A;  2B63 J;  3OL3 A;  3HSR A;  3NQO A;  4Y17 A;  2D5V A;  4M72 A;  3FKJ A;  2W48 A;  2JVG A;  4ZTF A;  2E1C A;  1LEA A;  4MTD A;  4Q48 A;  1JKQ C;  2KIQ A;  3U1D A;  1KYZ A;  4Y52 J;  1BI3 A;  1KGS A;  3SJM A;  2A6H F;  3BR0 A;  1JT6 A;  2HQR A;  3E6D A;  3P7N A;  3I4P A;  3HOX J;  2E2J J;  2JUC A;  2KIM A;  2WY7 Q;  5FO5 A;  4HW0 A;  2K85 A;  2A6T A;  3DKW A;  1UB9 A;  2M4G A;  3HPG A;  3K7A J;  5L3B A;  1HSJ A;  3OYD A;  3BZ6 A;  3GLX A;  5ICE A;  1FSH A;  1JHF A;  1ZK8 A;  3JRB A;  2EFO A;  3QRF F;  4H0E A;  1X1D A;  1G6N A;  3EDP A;  2DN0 A;  5CJ9 A;  5K5Q A;  4GYG A;  2JRM A;  1W5S A;  2RV8 A;  4II3 A;  2MC4 A;  2L9S A;  4A3B J;  2XVC A;  3HRT A;  2NVQ J;  1MNM C;  2CJJ A;  5ILU A;  2EK5 A;  2CQ7 A;  5B5E C;  1D1A A;  4NC6 A;  2BY3 A;  2VBZ A;  2HYF A;  2HXO A;  1OCC H;  3LOC A;  4G94 A;  2MH2 A;  2J5O A;  2VE9 A;  4CSW A;  2DMP A;  6PAX A;  1VQP I;  3SDB A;  5D8K B;  1EJ9 A;  2CV0 A;  2EA4 A;  3LSI A;  3FXU A;  3IRR A;  4L5J A;  1MND A;  4D5F A;  4IHS A;  2CFO A;  1S7A A;  3R4K A;  2XKO A;  1N78 A;  3UKG A;  1O4X A;  4AYB N;  4CUG A;  1ZQ3 P;  1MBG A;  5HDG A;  2VON A;  2P5K A;  2Y2Z A;  2RNJ A;  2KRH A;  3BOQ A;  3DBL B;  2VJJ A;  2WWY A;  3KYC B;  1LE8 A;  3F9K A;  1WRJ A;  3K4M A;  2K4B A;  3I71 A;  3HHG A;  2BVL A;  4W97 A;  4GCV A;  1B6A A;  1IRX A;  1YS6 A;  2A05 A;  3LSP A;  2JJ7 A;  4RB1 A;  1WH5 A;  3O8G A;  3E6B A;  2E5Z A;  2NNN A;  3GWZ A;  4E7K A;  1RKW A;  1SD6 A;  2CMP A;  4LIV A;  3OSG A;  5E20 A;  5CPR B;  2AXL A;  5HNF A;  5D5U B;  5H2F C;  1U8B A;  5L3D A;  1V5G A;  1YX3 A;  2HPI A;  3RYR A;  2L9R A;  4Z2Y A;  1Y8R B;  2W1O A;  3SZP A;  2TRT A;  1Y0N A;  3S14 J;  4D0P A;  2X85 A;  2W25 A;  2OJE D;  3N05 A;  3F8M A;  1R22 A;  4NDL A;  4ENM A;  2LC2 A;  4A93 J;  4ASN A;  1VQ7 I;  4KIB A;  1G8X A;  1EV7 A;  1PDN C;  3AG1 H;  1X3Z B;  3L2Q A;  2HTJ A;  4UVB A;  3KPH A;  3OYM A;  3VB2 A;  2VBW A;  1ZGW A;  3CJQ B;  1IW7 F;  2E36 A;  2OTL I;  4BUP A;  3WGG A;  3I56 I;  3M3Y J;  1XCV A;  4PJ0 C;  2XSJ C;  3GO5 A;  1QPM A;  3EPZ A;  3GZ6 A;  3BQZ A;  1E17 A;  5GTH C;  3EUH C;  2PLY A;  2LDU A;  4DIQ A;  5ICG A;  4EM1 A;  5CVU A;  2ZME A;  5K7H A;  4XON A;  1TL8 A;  3RQ4 A;  2Z99 A;  3GUD A;  1I50 J;  2HVQ A;  1SVL A;  2BZT A;  3T8R A;  1POG A;  2HU9 A;  3FDY A;  3REO A;  1BI1 A;  2YU3 A;  5A2Q K;  2ZO4 A;  3E3V A;  2CU7 A;  3H92 A;  3CMY A;  1WHU A;  4OAY A;  1TQP A;  3FXK A;  1QZZ A;  5K1Y A;  3ISP A;  4JYK A;  2O6G E;  2X6W A;  2VOD A;  2XAF A;  2IJL A;  1FWZ A;  1OYW A;  4DGW B;  3GLL A;  2MGQ A;  2W7N A;  3OSF A;  2MG4 A;  2P8T A;  2ME6 A;  3VYS B;  2OPT A;  1MDM B;  3FXO A;  4PZJ A;  3T8T A;  1JJ8 C;  2LY1 A;  3HIF A;  2Q0O A;  2HOA A;  1I27 A;  5CQG A;  1Z67 A;  1ZRD A;  2TCT A;  1KZH A;  2HEO A;  3IP4 B;  3HHH A;  2EBI A;  1DGR M;  3LQR A;  3AG4 H;  4HNU A;  2LLK A;  1D1C A;  3GTJ J;  2OF7 A;  2NVX J;  2P0W A;  3WG7 H;  3S93 A;  2XAS A;  2PN6 A;  2XIG A;  3GTM J;  2AHQ A;  2DT7 B;  3RYP A;  1WJF A;  4XOT A;  4JX6 A;  3FMQ A;  3FMR A;  1IRZ A;  3HBL A;  1J2X A;  2R5Z A;  2KJB A;  1YIJ I;  2F48 A;  4A5N A;  4UXN A;  4X1E A;  4KUM A;  2DDB A;  4CCL A;  2HI3 A;  2O61 A;  1D8K A;  4BYY A;  5LEJ A;  2BE5 F;  1UG2 A;  2LTP A;  2IPQ X;  2EQR A;  4G6D A;  3A01 A;  2EIN H;  5CYV A;  4MEX F;  2DPD A;  2OBP A;  2NYX A;  2CS3 A;  4IKF A;  3KCC A;  5B1B H;  3BJ6 A;  3ERE D;  1WH7 A;  4R79 A;  1FC3 A;  4ZZL A;  4A3G J;  3GEZ A;  4I98 B;  2D1V A;  3WTY C;  1WSU A;  3DTK A;  5BPI A;  4Y15 A;  1VND A;  1YW9 A;  3K4C A;  4DYQ A;  5FKK A;  2PG4 A;  3DF8 A;  2WAF A;  2EV6 A;  4EJW A;  3CCU I;  4F93 B;  3B6A A;  2QQ9 A;  3FKI J;  3SDG A;  2PBI A;  2A5W A;  4WXD A;  1F4K A;  1D3Y A;  3AFH A;  4JX4 A;  3DXJ F;  1MH3 A;  3QYF A;  5CVR A;  5HLH A;  1S3J A;  1GVD A;  1YRN B;  1PJR A;  2DCE A;  4BU2 A;  4AIK A;  3K1P A;  2LP0 A;  3Q9S A;  3BR3 A;  2GBY A;  2KPM A;  2WAQ A;  3EET A;  3GVA A;  4GFB A;  1R58 A;  3UR3 C;  3TO9 A;  1J09 A;  4ZYG A;  2NAZ A;  2OQG A;  2DA4 A;  2CQX A;  1A36 A;  1A04 A;  1UG0 A;  4DOZ A;  3OYN A;  4KT6 A;  4DQ2 A;  2E5N A;  3ULQ B;  5HVQ C;  5K7F A;  2QQB A;  2L9V A;  2QKL B;  3CZ6 A;  3D5R C;  4LFU A;  3G3Z A;  3RKW A;  4IHW A;  2EIK H;  3QYB A;  2O03 A;  5LEK A;  3N97 A;  4KDP A;  2HDW A;  4K2E A;  4I7H A;  2DFE A;  2V26 A;  3GF2 A;  4N0B A;  2GM4 A;  3BCA A;  2K9N A;  3JRD A;  3J81 K;  3F3X A;  2VPR A;  3C2B A;  5EEA A;  1H9G A;  1R00 A;  3S8P A;  3JRI A;  2BY2 A;  3CP2 A;  2XGX A;  2HQA A;  2JA8 J;  3GTO J;  1YX5 A;  1W1W E;  1DGW Y;  3QU3 A;  1KU2 A;  4BHB A;  4HDU A;  4HX8 A;  3BG3 A;  1HXD A;  4TV7 A;  2DMT A;  4F55 A;  2OCE A;  1X4O A;  1DU0 A;  1VQL I;  1B4A A;  3WTV C;  3HRU A;  1Z6R A;  1JGG A;  3RZO J;  1B9N A;  4V19 K;  3IH4 A;  4M3G A;  3S1R J;  1HDD C;  4DJA A;  3DEU A;  2K3P A;  4HV5 A;  3M9A A;  3WGI A;  3E7L A;  4A5M A;  1SFK A;  1H89 C;  2LF8 A;  3OYA A;  2CQN A;  2HDD A;  1KU3 A;  5C4X J;  2F5E A;  2P81 A;  4Y33 A;  1SFX A;  1B9M A;  3PSF A;  4E7I A;  1TTY A;  1IC8 A;  2FRH A;  3DKX A;  4LB5 A;  1MDM A;  1VQK I;  5EZH A;  5E17 F;  4L9J A;  1IUF A;  2FX0 A;  3BR6 A;  1GT0 C;  1V3F A;  2Y9Z A;  4FX0 A;  4E7Z A;  1IXC A;  4JX5 A;  3TP3 A;  3F72 A;  3O3K A;  1XTA A;  4NBQ A;  2A69 F;  1UHW A;  4BQN A;  1BI0 A;  2QF7 A;  2YX4 A;  3OS2 A;  2R3S A;  4RM2 A;  1QA6 A;  5EGO B;  1MNE A;  1QPI A;  3HXL A;  4L9N A;  1TLH B;  1R4M B;  3RDI A;  4RLQ A;  3CDL A;  2FF4 A;  1ZEL A;  3AAF A;  3BR1 A;  4XQF A;  4MEY F;  4Q47 A;  3MWM A;  5FRO A;  3JAM Z;  4F91 B;  4IOC F;  3ERM A;  2R7Q A;  3HZJ A;  4ZYH A;  3CMA I;  3U21 A;  2R7D A;  4B43 A;  1JXS A;  2H8R A;  2FMY A;  3AL0 B;  2IS2 A;  4BL0 B;  4XSX F;  4CH7 A;  1TW2 A;  2GA2 A;  4CCO A;  3V42 A;  3SFZ A;  4HAM A;  4RM3 A;  1R1V A;  1ULY A;  3BTI A;  4XKB A;  2VQH A;  2VQL A;  3RJP A;  3CCV I;  4RB2 C;  5FLX K;  4M9S A;  3A0H C;  2JK3 A;  1R4N B;  4O6J A;  1CF7 B;  1RPW A;  1UMQ A;  3ZQC A;  5JI6 A;  1BI2 A;  3TP0 A;  2VB6 A;  5B3S H;  1U3E M;  1EH7 A;  1K78 A;  2CO5 A;  3D5S C;  3TW6 A;  2JSP A;  4OWR B;  1YYV A;  5F1R A;  1PYV A;  2Y48 A;  3N4M A;  4GXO A;  3FHZ A;  3JAM K;  3ZMZ A;  1RIO H;  1K4S A;  4NUB A;  1SFU A;  2ELH A;  1JUS A;  1R5H A;  3SEZ A;  1JGS A;  1Z3Y A;  2WV0 A;  4OIO F;  2ELJ A;  4HRI A;  1XSX A;  1ON1 A;  3A02 A;  1XDS A;  3HYI A;  4HV6 A;  4XLA A;  4EEF G;  3HUG B;  3BCB A;  4M6V A;  3F8F A;  1R5G A;  1RR8 C;  2MW8 A;  5L3G A;  2A61 A;  4HOB A;  1MBK A;  4OIP F;  2VJ4 A;  2ZBK A;  3TGN A;  5J1R A;  2AQE A;  2KLO A;  4LMY A;  3X2Q H;  4JP0 A;  2FOK A;  2NVY J;  2XC7 A;  3OR1 C;  2HFH A;  3SHF A;  5E3M A;  2HVS A;  2QBY B;  2QEX I;  1KON A;  2KIU A;  2ZSI B;  2ZKZ A;  1MMA A;  4M3D A;  5J40 A;  5EDN A;  2P6S A;  2XB5 A;  1SD4 A;  3OYK A;  5FLV A;  3ZQQ A;  1QVU A;  1NTC A;  3S1M J;  5IYD J;  3L2C A;  4IX7 A;  4WK8 F;  1BC8 C;  3JSO A;  2FSW A;  2HDC A;  4P9F A;  1JUM A;  4L18 B;  3P5J A;  3MKW B;  1I3Q J;  2L01 A;  4XRF A;  2VPL A;  3R0A A;  5EJC A;  4I76 A;  4LLG F;  3OOU A;  4XID A;  3HOU J;  4HA8 A;  3MZ8 A;  4HLY A;  3C2H A;  2D2W A;  3K1M A;  1BJZ A;  3CCL I;  5ILV A;  2FBK A;  2GXB A;  2UZK A;  3NAU A;  1BL0 A;  4EV0 A;  4HF0 A;  4CZC A;  2Y0S A;  5J4Y A;  3IKT A;  4XRS A;  4M6X A;  3WTT C;  2KHM A;  5FD6 A;  3RKY A;  3HUG A;  3C18 A;  3JCU C;  4Y4R A;  1R1U A;  1XS9 A;  1D0Z A;  2CQQ A;  4RAF A;  3JRC A;  3NAR A;  3ZXS A;  1BN5 A;  4UB6 C;  2X1C A;  2DO7 A;  2KIF A;  3GX4 X;  4D5C A;  2RN7 A;  2H8W A;  3PFI A;  3UNG C;  2W00 A;  2KKO A;  4G8X A;  3ZQL A;  2VQG A;  2AQF A;  1ZN2 A;  3BTC A;  2M5W A;  2P5L C;  1DQU A;  1X2M A;  2OTJ I;  1VFC A;  5J4V A;  4BE2 A;  1T38 A;  1PUF A;  3S3N A;  3K2Z A;  1IDY A;  4FCY A;  1K61 A;  3I5U A;  4A2U A;  2KP6 A;  3R60 A;  4C3I J;  5HOD A;  5TIS C;  3HPH A;  1AWC A;  4QPQ A;  3H9Q A;  2IA1 A;  3LST A;  3ABT A;  2DBB A;  1Y8Q B;  1MW7 A;  1WWX A;  1YOV B;  2QVO A;  3ZMV A;  2R7X A;  3OL4 A;  3KEQ A;  1FYM A;  4I6Z A;  1O3S A;  3OS0 A;  4MLO A;  5FLM J;  1TQI A;  3AL0 C;  4P1W A;  2VXZ A;  3CTA A;  1MD0 A;  4A3I J;  2CYY A;  4PJN A;  3W6J B;  3RPU A;  4DBR A;  1I39 A;  2G0E A;  3DCF A;  3I53 A;  1L3L A;  4S05 A;  1IV8 A;  3DPT A;  5TGT A;  3F21 A;  5E79 C;  2PEX A;  3JRE A;  2OU2 A;  4H4K C;  1WZ2 A;  5HLG A;  5CKT A;  1F36 A;  3CJR B;  1VZ0 A;  2FUG 2;  2PI0 A;  4EJT A;  2XPU A;  2H27 A;  2FBH A;  2NRA C;  2CRG A;  3HL2 A;  5E18 F;  3BG6 A;  1HQC A;  2HYJ A;  1LVA A;  3M8F A;  5EG0 B;  2E7W A;  5IPA A;  2ZJ2 A;  5TRD A;  2L7K A;  2ZFU A;  4XLC A;  2E1N A;  2UV1 A;  3HGG A;  1ITY A;  2PMU A;  3A01 B;  3LSJ A;  2CGP A;  3BC8 A;  1MBE A;  3GFM A;  5L3C A;  1G2H A;  3OYH A;  4AUX A;  2MYS A;  1UAA A;  1VQ9 I;  1SAX A;  2DA1 A;  3VFZ A;  3K4L A;  3CUQ C;  5AIQ A;  3JR9 A;  4KFC A;  1OMI A;  2W84 A;  3TOA A;  1VQ6 I;  3DTI A;  3CDH A;  4ZDP A;  2FBI A;  2DAO A;  1J9I A;  2H6B A;  1IJW C;  2LR8 A;  2AO9 A;  2XGC A;  1ENH A;  3BR5 A;  4D7M A;  1MSE C;  5KHD A;  2F2E A;  2DA5 A;  5E8I A;  2DFH A;  2STW A;  4XKC A;  1LDK B;  4HNT A;  1B59 A;  1XDU A;  2XGE A;  4KJZ A;  5JVG F;  2O8K A;  2NS0 A;  4EJV A;  1J5Y A;  1OCO H;  5LHG A;  2GOM A;  4CO8 A;  4DZJ A;  2DMU A;  1W5C C;  3J7Y J;  3OYE A;  4MO7 A;  3KLN A;  4XN0 A;  1ETO A;  4Y3O A;  3I55 I;  3LSM A;  3G4S I;  3PUB A;  2O0Y A;  4GRI A;  1HC8 A;  2VT3 A;  4MTE A;  1VQ8 I;  4U88 A;  1SMT A;  1BBY A;  1ETY A;  4FQG A;  2BHZ A;  1GLN A;  4XLF A;  2BXY A;  2CQK A;  1S72 I;  2AS5 F;  4KIF A;  2CV1 A;  4OAZ A;  4KT5 C;  4NQW A;  4DW6 A;  1GV5 A;  2L0K A;  3IH3 A;  4WCG A;  4XOP A;  3V7C A;  3V8J A;  2BW3 B;  2KDZ A;  3H1C A;  3I54 A;  4P55 A;  3S3O A;  2XAJ A;  2XRN A;  1MSF C;  1BR4 A;  2LY9 A;  4A12 A;  1BM9 A;  1HDP A;  2DJN A;  1I3A A;  2K7L A;  4BE1 A;  1YJN I;  2MA3 A;  1EF4 A;  5GP9 A;  1YJW I;  1BOB A;  2GIZ A;  2MD5 A;  2WAE A;  2DK5 A;  4MQ9 F;  2L3D A;  5CLS A;  5GPA A;  1B8I A;  4A3K J;  2XAU A;  1XGO A;  1H9T A;  4A3C J;  1X4P A;  1TWC J;  2O5R A;  3CD6 I;  2IA2 A;  2H1L A;  1IGN A;  1J0R A;  1LVK A;  3FF5 A;  1HLV A;  3CCM I;  2VE8 A;  4EMS A;  1NG6 A;  4I0A A;  1TBX A;  2E2I J;  2W85 A;  2WA0 A;  1OR7 C;  2VIX A;  4KIS A;  1DDN A;  1XB4 A;  4B3X A;  3ASO H;  4UHT A;  4BJ5 C;  1RUO A;  1GDT A;  1ZKG A;  5D4R A;  3KET A;  1FTT A;  1USS A;  3P9K A;  2FNA A;  5IT9 Z;  5J1U A;  3OV8 A;  4A69 C;  2P4W A;  1N75 A;  4BXF A;  5C4J J;  1RKT A;  1KQ9 A;  3KZZ A;  4NNJ A;  1N25 A;  2DDA A;  2NS7 A;  3MFK A;  4DBQ A;  5HDN A;  2QUF A;  3H3V K;  3BPV A;  2Y9Y A;  1V5F A;  2DTZ A;  3DBH B;  1T56 A;  2A68 F;  2WBM A;  3K10 A;  1FOX A;  1ZRF A;  3ABU A;  1PUF B;  3IRQ A;  1MMS A;  4PFP A;  3EYY A;  3HDD A;  4HST A;  1DUX C;  3O6B B;  3QAH A;  2V1U A;  2RDP A;  2GOX B;  2R7O A;  3HGY A;  4P5O A;  2K27 A;  1S8N A;  5GTI C;  1K4T A;  4AU7 A;  1Z91 A;  3CUQ B;  4AIJ A;  2L2O A;  1XD7 A;  4O3M A;  2E60 A;  4XKW A;  3DPU A;  3HSF A;  5M5W J;  1XG1 A;  4U87 A;  3H9J A;  4BXX J;  3H35 A;  3KP2 A;  4ETS A;  4BJT A;  4A3M J;  4OOI A;  2I8D A;  2F5V A;  2OV7 A;  3KP4 A;  2HZD A;  4AWX B;  3IV5 A;  1OFC X;  4RA2 A;  4UB8 C;  1LNW A;  2OZU A;  3F23 A;  1UEL B;  2IA0 A;  2ZXJ A;  4U7B A;  3SZT A;  4DNC A;  2IS4 A;  4BEH B;  1AA7 A;  3BWG A;  4M9Z A;  4A3L J;  5LRR A;  1T0F A;  4AYB A;  2MBF A;  5C3E J;  3GTL J;  1G3W A;  2R7F A;  3QWL A;  2NVU B;  3C7J A;  3R61 A;  5DD4 A;  3G73 A;  1XGM A;  2EA2 A;  2Z2S B;  1AOY A;  3ONQ A;  1XX5 A;  3A1Y A;  3H0G J;  2IW5 A;  2HOS A;  1XSV A;  2IP2 A;  2W4S A;  3E1S A;  5K5R A;  3DWL E;  5EYR A;  1SAN A;  3QOE A;  4QTR A;  1ZG3 A;  4A0X A;  2E1M C;  4HDV A;  3FM5 A;  1LB2 A;  1TW3 A;  2X6O A;  1AKH B;  4S04 A;  4KMU X;  5IYC J;  1ONV A;  3G1O A;  1VF9 A;  1MGT A;  3FIW A;  4M71 A;  4HQE A;  2O7O A;  3QPL A;  4C3H J;  1QVT A;  3RKQ A;  4KN4 X;  5F0H A;  2VUM J;  1HKQ A;  1MMN A;  4R8H A;  4IHX A;  5HS8 A;  2L4A A;  4C2U A;  5D5X B;  1A31 A;  3U9G A;  2LD5 A;  2X1D A;  4B3A A;  1WJA A;  2XF7 A;  1BW6 A;  1Z05 A;  2LMD A;  4LG0 B;  2YS9 A;  1JKR C;  1IAW A;  4QIW N;  2LBF A;  3ZMS A;  1I6X A;  2R7U A;  3JRA A;  1LDJ A;  2IS6 A;  3A0B C;  1X19 A;  1NK2 P;  3DEE A;  4KMF A;  1W7P D;  1QNT A;  2EIL H;  3RPQ A;  3DV8 A;  2CWE A;  3PNY A;  2FEZ A;  4M3B A;  4FAS D;  3KFW X;  2R5Y B;  2JQ7 A;  5M5X J;  5DDG A;  4YIR X;  1AKH A;  3FK7 A;  1X1C A;  1LDD A;  3SZG A;  2XPV A;  3L2U A;  3G6E I;  4RMN A;  4D9J A;  1U2W A;  4ZH4 F;  1A6I A;  3E6C C;  2KIS A;  4G7O F;  1ZHF A;  4M3E A;  2R7W A;  4RGX A;  2QKM B;  2JA2 A;  4M9X A;  4NC7 A;  5DV5 A;  2UUZ A;  2NXN B;  5BPD A;  5KAF C;  1QHH D;  1U9O A;  3HOW J;  1ETX A;  3BZC A;  3FM3 A;  2DA7 A;  2MSY A;  2V1N A;  1XMA A;  2XB0 X;  1Q1V A;  3F8C A;  5FFZ A;  3CC4 I;  1G3Y A;  4LG0 A;  2PFB A;  2BXZ A;  4A3F J;  1OJL A;  2BY1 A;  2JT1 A;  3L2W A;  4U0W A;  4MFD A;  3PQJ A;  1JHH A;  5K5O A;  3DLL F;  3RPU D;  1WKM A;  2PMH A;  2QSH X;  4ZJZ A;  1MBF A;  4OIQ F;  5LHI A;  2VKV A;  3FXR A;  3ZN1 A;  2MLK A;  5LHH A;  5ICC A;  2V9P A;  3IKV A;  2XAQ A;  2R92 J;  4E7J A;  5FGM A;  2GLO A;  3FHN A;  3MAJ A;  4J00 A;  1JTY A;  3ABK H;  1X1A A;  2Z16 A;  1DP7 P;  3I3L A;  2KMU A;  2XRO A;  2OUM A;  4LK0 F;  2KZG A;  2M30 A;  3E97 A;  4BAY A;  3CP8 A;  2P7V B;  2V9V A;  3HOS A;  2EFP A;  1AU7 A;  1X3U A;  3GTQ J;  5F6F A;  3BZK A;  1FYK A;  4L0Y B;  3GTP J;  4QPO A;  2W82 A;  4RB3 C;  1TC3 C;  5L3E A;  2P7C B;  1IXS B;  1SD5 A;  4BXU A;  1QZE A;  2VC0 A;  1QRY A;  2EIJ H;  1TWH J;  4PSX A;  3RQI A;  5D8L B;  4UUS A;  3E0J B;  5M3F J;  4IPA A;  2O9L A;  5FKN A;  1W0T A;  4M6Y A;  1U0J A;  5LGT A;  4FET A;  1DP3 A;  5LGN A;  2B0L A;  3T1B A;  2KFD A;  4ABZ A;  4ESJ A;  1D1B A;  1PP7 U;  3OIQ A;  2PJP A;  1HW5 A;  2ZNY A;  2L4M A;  2VJI A;  3FWE A;  5CVI A;  3KE2 A;  3EYI A;  2PMZ A;  2G9W A;  5E3L A;  1YI2 I;  3ABL H;  3OS1 A;  3OR2 C;  2XKP A;  4HPQ A;  4OIR F;  4F3Q A;  1OCT C;  2WY8 Q;  1YW8 A;  2VJ5 A;  4ESF A;  2DPU A;  3ZCO A;  3SQN A;  2KL4 A;  1QZY A;  1S9H A;  1Z6T A;  3DU6 A;  3O2P E;  4O5V A;  2CW8 A;  4LJZ F;  1O7L A;  3FZV A;  2L7Z A;  5D4S A;  2V6E A;  3ZR8 X;  1MJA A;  1Z1D A;  2VQC A;  5EEH A;  4G12 A;  4QSH A;  4II2 A;  2Z3Y A;  2C6Y A;  3OYF A;  3TL4 X;  1SFE A;  4GGG A;  2ZSH B;  1FBU A;  1R36 A;  2E35 A;  2V1X A;  2YSR A;  1FIA A;  4C30 A;  3S1N J;  2ISY A;  4V2G A;  1ZAR A;  3A03 A;  5CQE A;  4I0B A;  1Q1H A;  2CUF A;  3L2R A;  2EV5 A;  2HYG D;  3BG7 A;  4I01 A;  5J6X A;  5KCM A;  1BJA A;  2JRT A;  3TQN A;  2DI3 A;  2YUS A;  2OQR A;  3HOV J;  3BJO A;  3CES A;  1SMY F;  4L5E A;  4ENJ A;  1RUN A;  3ZQI A;  2O3F A;  1FP2 A;  3S3M A;  3WU1 B;  3HC7 A;  1YE9 A;  1P7J A;  4UVC A;  1K6O A;  2ICW G;  2LKP A;  1ETQ A;  3BPX A;  3WOD F;  1FT9 A;  2V9K A;  5IP6 A;  3HJE A;  1F43 A;  2RKH A;  1FOK A;  3J7Z I;  4CCK A;  3CQZ J;  4LB6 B;  2PX9 A;  5AIP A;  1D5Y A;  1OQY A;  1KU9 A;  5JVT A;  1U8R A;  1WPK A;  2Y0M A;  2F4O B;  3B02 A;  2ZME B;  1ON2 A;  5M3M J;  3OY9 A;  4MGR A;  3TED A;  2IVM A;  4HG2 A;  5H20 A;  2L7F P;  1WFX A;  2OZ6 A;  3ECO A;  1FBQ A;  5H6R A;  4C3J J;  1Z0X A;  4E7H A;  4UUV A;  1KQ8 A;  1X2N A;  2XAH A;  1Z7U A;  1OYY A;  4FIS A;  2A6E F;  1VQ5 I;  1YG2 A;  5AON A;  4IQJ A;  3CCY A;  4B4C A;  2JWT A;  4LG3 A;  2K3F A;  2RRE A;  1ETV A;  2KRC A;  4EJO A;  2DK8 A;  2KDO A;  1QHG A;  5EGO A;  3OYI A;  1J59 A;  4PUS A;  3V7R A;  3CDI A;  5C44 J;  3MQ0 A;  2BOL A;  3QPT A;  5H6Q A;  3VSL A;  5GAH J;  3GXO A;  3JRH A;  2V7F A;  5IOY A;  3M1C A;  3Q5F A;  3IHU A;  1YS7 A;  2NOJ B;  3IH2 A;  4EQQ A;  3CJN A;  3PNT A;  2W24 A;  4HEA 2;  3RI4 A;  4FHT A;  4XK4 A;  1ZGJ A;  3WU0 A;  1ZR2 A;  3C2G A;  3KYD B;  4PJJ A;  5F0F A;  1SEU A;  2DU9 A;  2K40 A;  2ZC2 A;  2Z5U A;  3G1M A;  1SVM A;  4Q4Z F;  2EWN A;  3LFK A;  3GFL A;  1BIB A;  3I9V 2;  3K4B A;  3K70 D;  1TWG J;  3L2V A;  1T98 A;  3VOD A;  3TMO A;  4YIF A;  4BY7 J;  1BOA A;  2CUZ A;  5BMZ A;  1ETK A;  3VWB A;  2WC2 A;  1J7K A;  1NG7 A;  3PIO F;  4NHJ A;  1ZH5 A;  2HNH A;  1D0Y A;  2I10 A;  4XRS G;  1UHM A;  2BW3 A;  3LSH A;  3R0J A;  3RIR A;  3HTU A;  4RGU A;  1E3P A;  3V8K A;  1K78 B;  2JA6 J;  4ENN A;  1XN7 A;  2FA5 A;  1EA3 A;  3RTR A;  1LFU P;  4RDU A;  1FTZ A;  1HST A;  3BP8 A;  3JRG A;  2B7E A;  4EJU A;  2VKE A;  4B48 A;  2X0L A;  1XCB A;  5B1A H;  2RNG A;  3WHB A;  1KU7 A;  3M1E A;  5B66 C;  4IEJ A;  1ZR4 A;  4CZZ A;  2EZH A;  1HF0 A;  3OYB A;  2HWV A;  3DP7 A;  5FRN A;  1R6R A;  3TW7 A;  3S32 A;  3CO6 C;  3KLO A;  2RGV A;  2I5U A;  2Y69 H;  3JSP A;  3AKZ A;  3J7A O;  3H5R A;  4V2F A;  4FX4 A;  3NRV A;  3LA2 A;  4G7H F;  2P6T A;  4IZZ A;  3J7A Y;  2CUE A;  4QLC U;  4YFK F;  4B8X A;  2M7A A;  2EJR A;  2JN6 A;  4N4O B;  2EH3 A;  1HKS A;  4UY8 I;  2LF7 A;  4P96 A;  1D8J A;  4YEJ A;  3WGH A;  1TT5 B;  3GCM A;  1L0O C;  2HOE A;  4DYR A;  2IS1 A;  5DS9 A;  2QZ8 A;  3CLQ A;  3S15 J;  1P2F A;  3VDX A;  4I09 A;  3W6V A;  2FD5 A;  4MFE A;  3HM5 A;  3FXM A;  2ADU A;  2ECB A;  1GXP A;  3ZN0 A;  5HOO A;  3PIP F;  2XGD A;  1T95 A;  1U6G A;  1BC7 C;  2YU9 J;  2O8X A;  2DT6 A;  4BQO A;  2IXS A;  2V79 A;  1Z77 A;  5IOZ A;  2M0C A;  2FJ1 A;  1IN6 A;  3C1D A;  5EZG A;  5KNL A;  1OPC A;  1TZL A;  2MH9 A;  4A3J J;  1YTY A;  1SC7 A;  4E70 A;  4XRM A;  1VQ4 I;  4Q5S F;  1V4R A;  3IAS 2;  4IVN A;  3BR2 A;  3Q0V A;  2H09 A;  4C2M J;  4MIM A;  5JLX A;  4BBR J;  3H3U A;  3KIO A;  4W1U A;  3A2K A;  4XL9 A;  2ZJP F;  4IHY A;  2XDV A;  4BJ6 C;  1U5T A;  3K1N A;  1LFB A;  3B73 A;  1KYW A;  4BE0 A;  2HR3 A;  4BQA A;  2XV4 S;  1TWA J;  1B8I B;  2L9N A;  1RC9 A;  3VYT B;  3S2D J;  2Y31 A;  3BG5 A;  1LE8 B;  2ZME C;  5F08 A;  2GIV A;  2W57 A;  4LLN A;  3BLY A;  4FTH A;  4RLF A;  5LFA A;  1ERD A;  3MVP A;  3QU6 A;  2NOG A;  1ORK A;  3PNV A;  2R5Z B;  2K9L A;  2LY2 A;  1P7I A;  4HF2 A;  1FEX A;  3HKZ N;  3LAP A;  4CCM A;  1W36 D;  2ZCW A;  4L0Z B;  1FPQ A;  1MMD A;  2JMW A;  1HBX G;  1F5T A;  1U9N A;  4BY1 J;  4OU0 A;  2X48 A;  1NHA A;  2JTV A;  5BQT A;  3W2W A;  1SFO J;  1CF7 A;  3GFJ A;  2COM A;  3BRO A;  1P9Q C;  3FXQ A;  4BHC A;  2ELK A;  4A0Y A;  3FK6 A;  4U0V A;  3M4O J;  4LIU A;  5BNG A;  3P9I A;  2BY0 A;  4I99 C;  4XSZ F;  4LGW A;  4UV8 A;  1HW2 A;  3ZRG A;  3K0L A;  3LSR A;  2QSG X;  1HW1 A;  1OLT A;  2DA3 A;  1D0X A;  2G7H A;  2IGO A;  2FOW A;  4L5I A;  1S7O A;  4LIT A;  1YHQ I;  1ZRC A;  1RES A;  3Q3S A;  4P9U A;  2AXT C;  2DA2 A;  5JHU A;  2PJR A;  4AIH A;  3CJT B;  3WG9 A;  3ZMD A;  3CCR I;  1XMK A;  1ZAO A;  3GYH X;  5FKM A;  3M8J A;  4N9H A;  3MEX A;  3U1K A;  2JA7 J;  3I0T A;  5GAE J;  3H0D A;  4HNV A;  2QLZ A;  3S17 J;  4BQQ A;  2EFN A;  1GVJ A;  1S29 A;  2Q2E B;  2VKD A;  3S1Q J;  1R49 A;  2Y0S N;  4HBL A;  2IEK A;  5CVV A;  2CH0 A;  2NVT J;  1WJ5 A;  3I4N J;  2R7T A;  2HKO A;  1D5V A;  1P4A A;  3NEU A;  2M1B A;  2FQ4 A;  4WWC A;  2HVR A;  1T8I A;  4HLX A;  1FY7 A;  3OYJ A;  2M0M A;  2H1K A;  4KIC A;  2QA4 I;  3ROU A;  2X6Y A;  4ZYE A;  5IP7 J;  4IHT A;  2DMN A;  3PM1 A;  4GDF A;  1TP4 A;  1MKM A;  1JTX A;  3K9T A;  5F0C A;  3SFI A;  3K4N A;  1REP C;  2IT0 A;  1B72 B;  4BH9 A;  3CF2 A;  4XIC A;  3HEF A;  1WJE A;  5DCM B;  3G1L A;  1ZLJ A;  2M2E A;  2X1E A;  2YX7 A;  1PUE E;  4F52 A;  1W0U A;  4QWQ A;  1E3O C;  2FXA A;  5D5V B;  3QYE A;  1X1B A;  2M34 A;  3R6S A;  2GZW A;  1JE8 A;  5HNH A;  1S6L A;  3IUO A;  4RAY A;  2DOE A;  1RNL A;  2MD0 A;  3AG3 H;  2HKX A;  4IF4 A;  4YRV A;  2QBY A;  2ZXW H;  1KQ0 A;  4JOM A;  5ILS A;  1IN8 A;  3IAM 2;  1OIS A;  1X1P A;  1JT0 A;  3F6V A;  3FMS A;  3F6O A;  3LA3 A;  1Y39 A;  1LUJ B;  4EAT A;  4I02 A;  5JR3 A;  2M87 A;  1WCM J;  3VYR B;  3QP5 A; 
#chains in the Genus database with same CATH homology
 2P81 A;  4FE4 A;  2N8G A;  3JRA A;  3D1N I;  1IC8 A;  1BW5 A;  1NK2 P;  5EZH A;  3PO2 J;  2EZI A;  4M3B A;  1IUF A;  2FX0 A;  2R5Y B;  3BR6 A;  5M5X J;  1GT0 C;  2Y9Z A;  4LOC A;  4JX5 A;  3TP3 A;  1U78 A;  1AKH A;  3FK7 A;  1HCR A;  5J1Y A;  2XPV A;  3Q0W A;  1A6I A;  2QF7 A;  5EGO B;  4M3E A;  1B72 A;  1JJ6 C;  1QPI A;  3QQA A;  5GPC A;  3CDL A;  4CYC B;  1U9O A;  3BR1 A;  2LFB A;  1ETX A;  2WAQ N;  2ID6 A;  3LSG A;  1RR7 A;  2DA7 A;  3HOW J;  2MSY A;  4A3E J;  2XB0 X;  2HXI A;  1Q1V A;  1MBJ A;  2EZK A;  1YRN A;  3LNQ A;  3F0C A;  4A3F J;  2WB1 N;  2IAI A;  1OJL A;  5IP9 J;  1IDZ A;  3S2H J;  4MFD A;  2H8R A;  2COB A;  1MBF A;  1CQT A;  2VKV A;  5E3O A;  2R5Y A;  2ECC A;  1XC5 A;  2EZL A;  2LVS A;  3GBG A;  3BTI A;  2R92 J;  2R93 J;  2GLO A;  1JTY A;  1APL C;  5E3N A;  2JK3 A;  1RPW A;  1UMQ A;  3ZQC A;  3TP0 A;  5JLW A;  5FKO A;  3TW6 A;  3WHC A;  4UUT A;  1DU6 A;  2WV1 A;  1AU7 A;  1HOM A;  1JUS A;  1X58 A;  3GTQ J;  1MH4 A;  4M3F A;  3GTP J;  1MBH A;  1TC3 C;  3A02 A;  4EEF G;  1QRY A;  3RQI A;  1TWH J;  4M6V A;  4UUS A;  2MW8 A;  5M3F J;  2O9L A;  5FKN A;  1W0T A;  3QPS A;  1WGX A;  1MBK A;  2M8G X;  5DTD A;  5J1R A;  3S16 J;  4ABZ A;  1K83 J;  4JP0 A;  4UUS B;  1VI0 A;  2NVY J;  2E19 A;  5E3M A;  5F04 A;  3B6C A;  5E3L A;  2K9S A;  4AC0 A;  3VPR A;  1OCT C;  3I4M J;  4M3D A;  5EDN A;  3O8H A;  2XB5 A;  2L7M P;  1S7E A;  5FLV A;  1QVU A;  1NTC A;  3ZOB A;  2B63 J;  3S1M J;  5IYD J;  2L7Z A;  2D5V A;  1JUM A;  1I3Q J;  2W48 A;  4G12 A;  4QSH A;  4I76 A;  3OIO A;  3MKL A;  1JKQ C;  3OOU A;  4XID A;  1FIA A;  3RZD J;  4Y52 J;  3S1N J;  1TWF J;  3SJM A;  3HOU J;  3BR0 A;  4V2G A;  9ANT A;  1BJZ A;  1JT6 A;  3A03 A;  4A3D J;  3NAU A;  3HOX J;  1BL0 A;  2LKX A;  2E2J J;  2CUF A;  5EF6 A;  4XRS A;  3K7A J;  2YUS A;  3HOV J;  2NS8 A;  4L5E A;  2LK2 A;  3ZQI A;  1ZK8 A;  3JRB A;  2K9Q A;  1XS9 A;  2KT0 A;  2PMZ N;  2CQQ A;  2HOT A;  1P7J A;  3JRC A;  3NAR A;  2DN0 A;  1ETQ A;  2JA5 J;  5FJ8 J;  5IP6 A;  1F43 A;  3BTL A;  4D5C A;  5F1J A;  2DA6 A;  3ZQG A;  3CQZ J;  1IV6 A;  4A3B J;  3ZQL A;  1D5Y A;  2NVQ J;  1MNM C;  2CJJ A;  1Y1V J;  1WPK A;  3BTC A;  4D7N A;  1T33 A;  1FIP A;  1X2M A;  2HXO A;  2VI6 A;  3LOC A;  5M3M J;  1VFC A;  1PUF A;  4BBS J;  3TED A;  2DMP A;  2L7F P;  1IDY A;  4FCY A;  3HB9 A;  1K61 A;  4C3J J;  4C3I J;  1Z0X A;  5HOD A;  1X2N A;  4FIS A;  1GUU A;  3CCY A;  1GV2 A;  1ETW A;  4D5F A;  3BT9 A;  4B4C A;  2JWT A;  4I6Z A;  2DMQ A;  1NK3 P;  1ETV A;  2XRL A;  3UKG A;  1O4X A;  4AYB N;  1ZQ3 P;  5EGO A;  2Y30 A;  4MLO A;  5FLM J;  1MBG A;  5C44 J;  2Y2Z A;  4A3I J;  3ZQH A;  1LE8 A;  3JRH A;  2G0E A;  3DCF A;  5IOY A;  2M9H A;  2HQ5 A;  3IH2 A;  3JRE A;  4W97 A;  4XK4 A;  3LSP A;  1ZR2 A;  2JJ7 A;  5F0F A;  1WH5 A;  2K40 A;  1F36 A;  3O8G A;  3G1M A;  2XPU A;  2CRG A;  1RKW A;  3OSG A;  2HYJ A;  1TWG J;  5EG0 B;  1U8B A;  5IPA A;  4BY7 J;  2L9R A;  1ETK A;  3HGG A;  2TRT A;  1ITY A;  3A01 B;  3S14 J;  3LSJ A;  1MBE A;  2I10 A;  4XRS G;  4NDL A;  1G2H A;  2JA6 J;  4AUX A;  4A93 J;  3BG9 A;  2DA1 A;  3K2A A;  1I6H J;  1LFU P;  3JR9 A;  4RDU A;  1FTZ A;  1ZGW A;  3JRG A;  2VKE A;  3PO3 J;  1IJW C;  2LR8 A;  3WHB A;  3M3Y J;  2AO9 A;  2XGC A;  4IEJ A;  1ZR4 A;  1ENH A;  3BQZ A;  3BR5 A;  2EZH A;  4D7M A;  1HF0 A;  1MSE C;  1BA5 A;  2DA5 A;  3TW7 A;  5K7H A;  2XGE A;  2O8K A;  4V2F A;  1I50 J;  4DZJ A;  2ME0 A;  4S0H B;  2DMU A;  1POG A;  2CUE A;  4MO7 A;  2ID3 A;  1A5J A;  1ETO A;  2JN6 A;  2EH3 A;  2CU7 A;  3CMY A;  4DYR A;  1R9T J;  2E1O A;  5DS9 A;  1ETY A;  3S15 J;  4JYK A;  3W6V A;  2FD5 A;  4MFE A;  3GTG J;  3HM5 A;  2R7Z J;  4DZP A;  2MGQ A;  3OSF A;  2ECB A;  2MG4 A;  2ME6 A;  2OPT A;  2XSD C;  1AHD P;  2XGD A;  1GV5 A;  2L0K A;  3IH3 A;  4DW6 A;  1JJ8 C;  1H8A C;  2YU9 J;  2HOA A;  2IBD A;  1FJL A;  2KDZ A;  3L1P A;  2TCT A;  2X9D A;  1UHS A;  1Z77 A;  5IOZ A;  2M0C A;  2FJ1 A;  5EZG A;  2EBI A;  1MSF C;  2LY9 A;  4A3J J;  1WI3 A;  1HDP A;  2DJN A;  2LLK A;  4XRM A;  1EF4 A;  3GTJ J;  2OF7 A;  5GP9 A;  2NVX J;  3BR2 A;  3Q0V A;  1JUP A;  2E2H J;  5GPA A;  1B8I A;  2R0Q C;  4A3K J;  4C2M J;  4MIM A;  4J19 A;  5JLX A;  4A3C J;  1TWC J;  4BBR J;  4W1U A;  3GTM J;  2AHQ A;  1IGN A;  4IHY A;  3HOY J;  1HLV A;  1LFB A;  4B1R A;  4JX6 A;  2E2I J;  1IRZ A;  1TWA J;  3HBL A;  1B8I B;  4X6A J;  2R5Z A;  3S2D J;  2Y31 A;  3BG5 A;  4X1E A;  5F08 A;  1LE8 B;  2HI3 A;  4FTH A;  1OCP A;  1GDT A;  1ZKG A;  3FIS A;  3MVP A;  1FTT A;  1RET A;  5FKL A;  5M5Y J;  5J1U A;  2NOG A;  4A69 C;  1ORK A;  1UG2 A;  1H88 C;  2LTP A;  2R5Z B;  2EQR A;  1P7I A;  5C4J J;  3A01 A;  1RKT A;  1FEX A;  2RAE A;  3HKZ N;  3Q0U A;  2JMW A;  2NS7 A;  5J3L A;  1U9N A;  1JKP C;  4BY1 J;  4FE7 A;  3H3V K;  3BTJ A;  1WH7 A;  5EG0 A;  2X48 A;  2Y9Y A;  4A3G J;  1IG7 A;  1SFO J;  2DTZ A;  1T56 A;  2ELK A;  3M4O J;  3FK6 A;  5BNG A;  1PUF B;  2XPW A;  1VND A;  3HDD A;  4DYQ A;  5FKK A;  3DEW A;  3LSR A;  1ZTR A;  2DA3 A;  3B6A A;  3FKI J;  3HOZ J;  5IYB J;  4BKX A;  3SDG A;  3HGY A;  4JX4 A;  1RES A;  3Q3S A;  1MH3 A;  3ZQF A;  2QCO A;  2DA2 A;  1GVD A;  1YRN B;  5M5W J;  1XG1 A;  5FKM A;  2LP0 A;  4BXX J;  3BR3 A;  2GBY A;  4CYC A;  3JRF A;  2JA7 J;  4GFB A;  4A3M J;  4HNV A;  3S17 J;  3IV5 A;  1OFC X;  3MN2 A;  3S1Q J;  2DA4 A;  2CQX A;  2IEK A;  2Y0S N;  2NVT J;  3I4N J;  5K7F A;  4A3L J;  2FQ4 A;  5C3E J;  4IHW A;  3GTL J;  2H1K A;  4RBO A;  5K7Z A;  5IP7 J;  2DMN A;  3PM1 A;  2GM4 A;  2K9N A;  1JTX A;  3H0G J;  3JRD A;  2HOS A;  2VPR A;  5F0C A;  3C2B A;  3SFI A;  5EEA A;  1B72 B;  3JRI A;  1JKO C;  5EYR A;  1SAN A;  3HEF A;  4XIC A;  4QTR A;  3BQY A;  2JA8 J;  3GTO J;  2ZB9 A;  3G1L A;  2M2E A;  1W0U A;  4Y7N J;  3GTK J;  1E3O C;  3BG3 A;  2X6O A;  1AKH B;  5IYC J;  3G1O A;  1VF9 A;  3FIW A;  2DMT A;  5F27 A;  2M34 A;  2O7O A;  1DU0 A;  3QPL A;  4C3H J;  1QVT A;  3RKQ A;  5F0H A;  1JGG A;  2VUM J;  4IHX A;  3RZO J;  3IH4 A;  4M3G A;  3S1R J;  2LD5 A;  1Y1W J;  1HDD C;  4B3A A;  4DYC A;  4IHV A;  3E7L A;  1JT0 A;  1BW6 A;  1H89 C;  2YS9 A;  1JKR C;  2HDD A;  1WCM J;  5C4X J;  4QIW N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...