3GTLJ

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtlJ00
3BG9A 3RZOJ 5M5YJ 3TP3A 3HEFA 3BTIA 2JA6J 3I4MJ 3CMYA 2VKVA 3GTQJ 2CJJA 4Y52J 3HKZN 3GTJJ 1JT0A 2OF7A 3JR9A 1MH3A 1JKOC 1SFOJ 3HB9A 3JRDA 1MBKA 5JLWA 2L9RA 2K9SA 1HOMA 4B4CA 1F43A 5IP9J 3GBGA 5IP6A 4C3HJ 2X48A 3ZQLA 3OOUA 3LSPA 4MFDA 3H3VK 1RESA 1ITYA 3BG3A 5IOZA 1TWGJ 4X1EA 1GT0C 4JX5A 2WV1A 4A3CJ 1B8IA 2NOGA 2KT0A 5GPCA 1ETXA 1F36A 3S2HJ 1GVDA 2MG4A 4XRSG 5M5WJ 4BY1J 1UHSA 1VF9A 3S1NJ 3CDLA 1LFUP 2XPWA 1SANA 1R9TJ 3HOVJ 5E3OA 1ZTRA 4BXXJ 4M3BA 2ME6A 4M3EA 1UMQA 3I4NJ 5F08A 2N8GA 3TW7A 1VI0A 4A3JJ 2Y0SN 5EGOB 2NVTJ 3GTOJ 3HGGA 3CQZJ 4DW6A 1IGNA 3IH3A 4BBRJ 2E2HJ 3MN2A 4A3LJ 4M6VA 1GV5A 3TP0A 2COBA 2LKXA 2PMZN 2E1OA 3BR3A 1MBGA 2EQRA 4A3DJ 3S15J 2WAQN 2L7MP 3JRGA 4DYRA 1ETKA 1ENHA 2NVQJ 4RDUA 1TWFJ 1UG2A 2DMUA 4FTHA 2E19A 3FK7A 1U9NA 4MLOA 2DA7A 2K9NA 3OSFA 2YU9J 1IDZA 2VI6A 1OCPA 3HOYJ 4FE7A 1QVUA 4M3FA 2O8KA 5BNGA 5E3LA 1RKWA 3W6VA 2LK2A 5M5XJ 4UUSB 2R5ZB 1K61A 3S17J 1U8BA 2JMWA 3G1MA 2EBIA 3O8HA 2JA5J 1MSEC 1T33A 2WB1N 4FCYA 4A93J 1JJ8C 1DU6A 5F0CA 1ETQA 1OFCX 1JKPC 1H89C 4JX4A 3E7LA 5M3FJ 1RKTA 3PO2J 2K40A 4V2GA 4A3BJ 1JTXA 2GLOA 3UKGA 2TRTA 3F0CA 3ZOBA 1WH7A 3HM5A 3BR6A 4DZPA 5EEAA 2GBYA 4D7NA 3RQIA 1WCMJ 2MGQA 5EGOA 2EZLA 1IG7A 2DA2A 1W0TA 3TW6A 2O7OA 1Q1VA 2FD5A 3SDGA 1Z77A 4AC0A 3JRAA 2JWTA 1HDDC 2JA8J 2NS7A 2DMPA 2R92J 1IDYA 1W0UA 3GTGJ 3LOCA 2H8RA 5EYRA 2DMNA 1Z0XA 1TWCJ 2IEKA 4V2FA 2DN0A 5K7ZA 3GTMJ 1MH4A 1MSFC 1QVTA 4DYCA 5EF6A 4AYBN 2QCOA 3LSGA 4DYQA 4B3AA 2HI3A 3BTLA 2Y31A 1IC8A 3K2AA 4W1UA 1ETVA 2XB5A 4I6ZA 3S14J 2LFBA 1OCTC 4UUSA 4A3EJ 2R5ZA 4C3JJ 1IV6A 3Q3SA 2XGDA 5JLXA 3HOUJ 2ME0A 3BT9A 1O4XA 5GPAA 5J1UA 5C3EJ 3Q0VA 3ZQFA 2LLKA 2DA5A 1VNDA 3BQYA 1X2MA 1MBFA 5FLVA 4UUTA 1AU7A 3IH4A 2R93J 1XC5A 3ZQIA 1PUFB 4M3DA 4C3IJ 1JKQC 5C4JJ 1K83J 1POGA 3S1RJ 1ZR4A 3K7AJ 2VUMJ 3ZQHA 1WI3A 2X9DA 3IV5A 3JRBA 1TWHJ 2LY9A 3G1LA 2E2IJ 2B63J 2M2EA 2Y9YA 3B6AA 1FTTA 2MSYA 3PM1A 3ZQGA 2EH3A 2M8GX 1T56A 2VPRA 4QIWN 4C2MJ 5M3MJ 1B72B 2D5VA 1RETA 1Y1WJ 3S1MJ 2G0EA 5GP9A 3Q0WA 1IJWC 2YS9A 3BR0A 5DTDA 2M9HA 2LVSA 4A3FJ 4IHVA 2R7ZJ 3DCFA 2DJNA 4Y7NJ 3GTKJ 3S1QJ 5FKKA 1HDPA 2AO9A 2HOTA 1U9OA 3PO3J 5F0HA 4I76A 4IHYA 2R0QC 2DA4A 4XICA 1Y1VJ 3JRIA 1U78A 5EG0B 3HBLA 3MVPA 1JGGA 4IHXA 4D5CA 1GUUA 4J19A 1APLC 2NS8A 2KDZA 1ZQ3P 3NAUA 2H1KA 2DA6A 2ID3A 4BY7J 5K7HA 1H8AC 4BBSJ 2Y30A 3HOWJ 2TCTA 1ZR2A 4GFBA 1HCRA 2ECCA 5FKLA 1ZKGA 5IYBJ 2R5YB 2IBDA 1BW6A 1PUFA 1JJ6C 4M3GA 1IUFA 4W97A 4NDLA 4RBOA 3L1PA 3QPLA 5F04A 1TWAJ 3D1NI 3IH2A 3LSRA 2JN6A 2NVXJ 3FIWA 1FTZA 2XRLA 1MBHA 2ID6A 3BR5A 3BR1A 3SFIA 4MO7A 3JREA 5IPAA 4D7MA 2CQXA 2W48A 2K9QA 1MBJA 1B72A 3JRFA 2E2JJ 3OSGA 2DMQA 2QF7A 2XPVA 1NK2P 5FJ8J 1WPKA 5EZHA 2XGEA 1A6IA 2Y9ZA 1I6HJ 2MW8A 5J3LA 3MKLA 1D5YA 2EZKA 2M0CA 4AUXA 4A69C 3JRCA 1DU0A 1I50J 3WHBA 3JRHA 2LD5A 5EDNA 3OIOA 1GV2A 2VKEA 5J1YA 1XG1A 3GTPJ 2HYJA 5IYCJ 5J1RA 3Q0UA 5E3MA 1I3QJ 3BTJA 3M3YJ 2L0KA 3HOZJ 4MFEA 4QTRA 4XIDA 4MIMA 1YRNB 1FJLA 1G2HA 4JP0A 5EG0A 3WHCA 1LFBA 3RKQA 4IEJA 4L5EA 4ABZA 4CYCB 1AKHB 1P7IA 5K7FA 1JKRC 1IRZA 1LE8B 1WGXA 5C4XJ 2M34A 2EZIA 5FKNA 4XK4A 5F27A 3VPRA 4XRSA 2HQ5A 3BQZA 3C2BA 4B1RA 3SJMA 3HOXJ 2R5YA 5FKOA 3A01A 1E3OC 2DA3A 3QPSA 1RR7A 1ZGWA 3M4OJ 1FIAA 3A03A 5F1JA 2EZHA 3LSJA 3BTCA 1ETYA 2HOSA 4A3IJ 4A3GJ 4BKXA 3NARA 4EEFG 4JX6A 3O8GA 1NK3P 2LP0A 1QPIA 2GM4A 4S0HB 1CQTA 2FX0A 4JYKA 4G12A 1EF4A 4QSHA 2I10A 2Y2ZA 3HDDA 5FKMA 1MNMC 1JT6A 2XGCA 3QQAA 2JA7J 2HXOA 5IP7J 3BG5A 3RZDJ 2LTPA 1VFCA 2XB0X 3ZQCA 2XPUA 3TEDA 3FISA 3G1OA 2CUFA 3HGYA 4IHWA 2CU7A 5IYDJ 2FQ4A 2ECBA 2JK3A 1XS9A 2X6OA 2L7ZA 2XSDC 1OJLA 2HDDA 2HXIA 2P81A 2LR8A 1X58A 3FK6A 1FIPA 1NTCA 1A5JA 1JUPA 1RPWA 5C44J 3CCYA 5IOYA 1X2NA 1S7EA 1YRNA 1BW5A 4DZJA 5HODA 4A3MJ 1P7JA 2ZB9A 3BR2A 4HNVA 5DS9A 2FJ1A 2ELKA 1FEXA 1HLVA 1ETWA 1HF0A 3DEWA 1TC3C 1B8IB 4CYCA 3LNQA 1AKHA 2RAEA 3A01B 2DMTA 1LE8A 1JUMA 2JJ7A 2HOAA 5EZGA 1ZK8A 4FE4A 1WH5A 1QRYA 1ETOA 5F0FA 1AHDP 1JUSA 2OPTA 9ANTA 1GDTA 1ORKA 1MBEA 2IAIA 3GTLJ 5FLMJ 2CUEA 4A3KJ 4LOCA 2DTZA 2L7FP 1BJZA 1JTYA 2O9LA 4FISA 3H0GJ 3FKIJ 3S2DJ 2AHQA 2DA1A 4X6AJ 3B6CA 2CQQA 4D5FA 4XRMA 1H88C 1BA5A 3S16J 5E3NA 1BL0A 2YUSA 3A02A 2NVYJ 2CRGA
chains in the Genus database with same CATH superfamily
2KHMA 3I59B 3V4GA 4CZZA 4F55A 5M5YJ 3CCVI 3CF5F 3LAPA 1H9GA 4KT6A 3I4MJ 3E97A 1USTA 1YE9A 2V9VA 1H9TA 1N75A 3H92A 1Y8QB 1T98A 5LRSA 2QQAA 1MH3A 2M7AA 4LK1F 1D1AA 3RQ4A 4QLCU 3G73A 2RQPA 5JLWA 4L5JA 1HOMA 2ZFUA 2W25A 3V8JA 4L9JA 3A0BC 3GBGA 2LBFB 4RLQA 1FP2A 1IRXA 1RESA 3H3VK 1ITYA 5K5QA 1K6OA 1ZGJA 1R22A 3DPUA 1TWGJ 1LUJB 1ON1A 2FMLA 1R36A 1BC7C 2AXTC 1WZ2A 2HS5A 1B8IA 3LA2A 3V7SA 1F36A 5KK1A 4Y13A 3BCAA 5M5WJ 3FHNA 3KX2A 4RGXA 1UHSA 3IAM2 4IJAA 1TBXA 4PZJA 1LFUP 1YO5C 4BY1J 2ZCWA 1SANA 3SZPA 3O2PE 1W36D 2L54A 1ZAOA 2KRCA 3ERMA 2O8XA 3N97A 2N8GA 2F5FA 3TW7A 1VI0A 2M8EA 1YIJI 4IOAF 2Y0SN 5EGOB 1RI7A 1TQMA 4E7ZA 2E71A 4I99C 3AG4H 4KIFA 2M45A 2COMA 3FXMA 1GV5A 2FRHA 4G6QA 3TP0A 4BEHB 2B7EA 4RMNA 1WJFA 4QPQA 2Y69H 3KEQA 2PI0A 4DIQA 3BR3A 2KIQA 4ON0A 2EIMH 1MBGA 3QPTA 5TGTA 1R49A 2E7XA 2EQRA 3NWTA 2NS0A 3TKYA 5B3SH 1P2FA 3I58A 3JRGA 2UXXA 1I39A 3DQVC 4IL6C 4PDKA 1ETKA 2KJCA 3E3VA 4DYRA 3FDYA 4RDUA 4FTHA 4MLOA 2DA7A 2KRHA 1SFXA 2YU9J 3HUGB 4CCJA 2K3FA 5CQGA 2BY0A 3HOYJ 4FE7A 1CF7A 3V8KA 1QVUA 4M3FA 2FOWA 5HOOA 1ZHFA 2VC0A 4ESBA 3IC7A 1R6RA 1R5ID 4UUSB 5CQEA 2VBZA 1N78A 2JMWA 5EEGA 2VODA 2HKXA 3O8HA 3HJEA 1U8RA 4HX4A 3ZXSA 2DPDA 2OJED 4XRFA 4BQQA 2DXIA 3GFMA 2V7FA 4AIHA 1SMTA 2RNJA 1H89C 2ZXIA 4JX4A 3F9KA 1HKQA 4L9NA 2B9SA 2WBMA 1FC3A 3PO2J 3I5UA 3CJRB 4KJZA 5K5RA 1SVMA 4XR6A 3HM5A 3VFZA 1OPCA 4XLCA 4DZPA 2P6SA 1YTYA 4CCNA 2L9SA 1JI8A 2MGQA 5CPRB 2ZJRF 3AFHA 3GVAA 3U1DA 4EJWA 4LG0B 3IKVA 2X0LA 3TW6A 2O7OA 3FF5A 3JRAA 2JA8J 1U0JA 1GVJA 2DMPA 5HNFA 4XLEA 3V7RA 2DMNA 2FEZA 1QHHD 1BN5A 3QPHA 3FBIB 2VC1A 3VWBA 4BL0B 4I02A 5CLSA 2MBFA 2E1CA 1UCRA 2IGNA 4DYCA 2MLKA 2Z99A 3OIPA 1RNLA 3QOEA 5GAHJ 1R1UA 5EF6A 4AYBN 3ABUA 1YIOA 1R4NB 2ESHA 3ZMTA 3RYPA 4RGUA 4AM3A 4EM0B 2RN7A 4KMUX 2Y31A 1IC8A 5E17F 3OYBA 3K2AA 3M07A 2X51A 1X1BA 3KE2A 4DJAA 2Z1DA 3OR1C 3S14J 1HSJA 3WTSC 4M9ZA 4LIVA 4HF0A 1TTYA 1V3FA 4IXAA 5K1YA 3BT9A 4F93B 2K02A 1BR2A 2FQ3A 3OS0A 2O61A 2JUCA 3Q0VA 2LLKA 1VNDA 2ZSHB 4XKWA 2MA3A 2ISYA 3KZYA 4UUTA 3IH4A 2MH2A 4IQJA 3ZQIA 1XCVA 2I8DA 4PJ0C 4RGSA 2GZWA 3MCZA 1SFEA 5DD4A 1K83J 2H27A 3K7AJ 5TISC 3OOPA 3IV5A 3JRBA 1TNTA 3DEEA 3WTWC 2B63J 2G9WA 4OOIA 4YEJA 3FXQA 3B6AA 1XX5A 3VYSB 5LGNA 2R7FA 2A5WA 4E6KG 3EUKL 2E60A 1VQKI 2IRFG 3ZCOA 2HZTA 1Y1WJ 1LJ9A 4HA8A 3Q0WA 3BR0A 2M9HA 5DD8A 1QZZA 2FA5A 3KLOA 3PL8A 4HG2A 2CG4A 2IA0A 4B43A 5HDKA 4DBRA 6PAXA 5DDGA 1IN8A 4KN7X 3GO5A 5H20A 2KZVA 4HLXA 5FKKA 4YIRX 5GAGJ 4ZTFA 2A5YB 2HOTA 2QYOA 1Y6IA 4I76A 2HFHA 3OV8A 1MKMA 2R0QC 1QU3A 1XSVA 4XICA 1NHAA 1FT9A 1A04A 1YX3A 3E6BA 4D5CA 1APLC 5LGUA 4CCLA 2K86A 3T1BA 5LHHA 2KDZA 2WY7Q 3E0JB 3NAUA 3HG9A 2H1KA 2DA6A 5K7HA 1JXSA 3WG9A 3HOWJ 3QYBA 4PCQA 2L5QA 3BJ6A 2HR3A 4GFBA 2ECCA 1LDJA 1OYYA 2HYGD 4S05A 4DNCA 1P9QC 2KIUA 4HF2A 1JJ6C 2EFPA 3WTVC 2Z2SB 1TQIA 4QPOA 2E35A 3U9GA 3AL0B 1D5VA 3ZGKA 4JBAA 3ZP5A 1AOYA 4ENMA 3LSRA 2NVXJ 2DQLA 2VXZA 1E17A 3G2BA 3AG1H 1BI1A 1SD4A 3BC8A 4KA4A 2EV5A 2O5RA 2QA4I 1S29A 1G6NA 3OYHA 3JSOA 1P4WA 2CQXA 2JZYA 1G3YA 1FOKA 5ILUA 2VXDA 1MW7A 3MKWB 1MBJA 1KU7A 1B72A 2XKPA 5FFZA 2ESNA 1OMIA 2IP2A 4EJVA 5FJ8J 3HHGA 2P4WA 2XGEA 2ZKZA 1T8IA 1EH7A 2QM3A 2EZKA 3DFGA 4A0YA 3BZKA 3L2WA 1MJBA 2MABA 1F4KA 3REOA 3MZHA 3WHBA 1ZG1A 3P5JA 3JRHA 2LD5A 2HEOA 1EA3A 1GV2A 3HRUA 2HYJA 4CICA 3W2WA 2DODA 2ACJA 4QTRA 3GEZA 3DTEA 2VQHA 1G2HA 1Z91A 3HTUA 2GIZA 2QBYB 1LFBA 4XLAA 3K10A 3IAS2 1G3SA 2D1VA 5BQTA 4LB6B 2GXAA 2F2EA 5FLXZ 3ELKA 3H5AA 3CO6C 4DGWB 5C4XJ 3CP2A 5F27A 4BH9A 4XRSA 4B1RA 3HOXJ 2R5YA 3ZQ7A 3I55I 1FY7A 4MEYF 2RQQA 2LY2A 3ABKH 3GF2A 1ZGWA 2NOJB 2YU3A 4XMYA 3CUOA 4C2UA 3DKYA 4F52A 1IAWA 4A3IJ 3LMMA 3HPHA 1K7AA 4JX6A 4CYDA 1OYIA 1TQPA 3O8GA 1IXCA 4A6DA 3NWSA 4RB2C 3KYDB 1FPQA 4S0HB 4XOPA 2FX0A 1WJCA 4GXOA 4ANJA 5FRMA 2AQFA 2I10A 3HDDA 2VQLA 3EPZA 5FKMA 3ZMUA 5ED4A 3MWMA 2DI3A 3IHUA 3BG5A 2XB0X 2FBIA 2ELHA 1T6SA 2F48A 3QYFA 2V6CA 3DF8A 5LGTA 1PYVA 2CUFA 2DOEA 3K70C 1NG7A 2LKPA 2JPBA 3HSFA 3QOPA 3EQLF 4BGDA 1V5EA 5BPDA 3TO6A 3I59A 3CCRI 1TNSA 1SFUA 1H0MA 4ZDPA 2VL8A 4HAMA 2XSDC 1OJLA 3CC4I 3LFUA 1GHCA 2HDDA 2HXIA 5AIPA 4Y15A 3ROUA 2P7VB 2IS2A 2CS3A 5C44J 3BG7A 5FD6A 2MC3A 3OWTA 4B44A 2CWEA 1BW5A 4A3MJ 4BHCA 5DS9A 2FJ1A 1YJWI 5F1RA 3VYRB 3HRSA 1ETWA 3DEWA 3TL4X 2EFOA 3H3ZA 4AD9A 3LNQA 1AKHA 4E7LA 2DMTA 2VJJA 2JJ7A 1FMWA 3CCSI 2HOAA 3W6KB 1YW8A 4IZZA 2M4GA 3TQNA 4FE4A 4PK4A 4HPQA 1EV7A 3VSLA 2RDPA 1ERDA 1Y0UA 2ZMEA 4MNUA 3ABTA 1MBEA 3GTLJ 3PSIA 3VODA 3C3WA 2CGPA 3S1NJ 1FWZA 3K6GA 4Y3OA 2Z3YA 4JOMA 3S8PA 2AHQA 2YPRA 3R0AA 4D5FA 4XRMA 2IS4A 3K0LA 1BA5A 1FOWA 5E3NA 2YUSA 2R7VA 3H3UA 3OYCA 3HL2A 2HVQA 2CV2A 3OS2A 3AG2H 3BTIA 3GXOA 2JA6J 1YW9A 4I0BA 4L9VA 5GAEJ 2XF6A 4G9YA 5ICEA 2CJJA 3HKZN 1XB4A 2NAZA 3L2UA 3J7YJ 2OF7A 3JR9A 4LLLA 1WQ2A 3P7NA 1JKOC 2LSOA 2A68F 4AU7A 1VQ7I 4NC7A 2P7CB 1T2KA 3FX3A 4EJUA 5D8KB 4A12A 4DQ2A 2K9SA 4B4CA 1F43A 2X1DA 4XLPF 2QLZA 3J80K 3DWLE 2AS5F 3ZQLA 5H6RA 2BV6A 3CCMI 1Z6TA 4EJTA 2D1HA 4A0XA 4ASNA 4BE0A 1PDNC 3UNGC 4MFDA 3BG3A 4BU2A 1XSXA 3C2GA 4NQWA 1O3TA 4O3MA 2HTSA 3ZQQA 1T0FC 1ZARA 3H9QA 1BI3A 2IA1A 2WV1A 4A3CJ 2ZMEC 1S8NA 2NOGA 4E7HA 1ETXA 2H8WA 2HNHA 1SMYF 2Z5UA 3R4KA 1VF9A 3CDLA 2BY3A 4UB6C 1R23A 4YELA 1WRJA 5D4SA 1R9TJ 3RIRA 2JQ7A 4XN3A 5B1AH 2VOPA 1ZTRA 1QGPA 4II3A 5L3GA 4M3BA 4H4KC 1OLTA 4HNTA 5F08A 1DP3A 4IPAA 3ZRGA 4A3JJ 1FOYA 2E5ZA 4CH7A 3CQZJ 4BNCA 1IGNA 1UJ8A 3WGHA 4BBRJ 3T8TA 3MN2A 4KFCA 1FSHA 2V9PA 5IT9K 2COBA 4PGHA 2P5VA 1WFXA 2YX4A 2VJ4A 3CO7C 2AXLA 3SZTA 2OZUA 3SEZA 2QQ8A 2IT0A 1W5SA 2CFOA 1MMDA 4A3DJ 1Q1HA 1VZ0A 1OR7C 2BW3B 2M5WA 2XGXA 1R5GA 2A6HF 3BROA 5BS6A 2DU9A 3ESWB 3M9AA 3JAMK 3FK7A 2FU4A 1U9NA 4E7SA 3ZR8X 1IDZA 2OC6A 3C1DA 1XMXA 3HXLA 1OCPA 1HA8A 1B1BA 1IRFA 1SD7A 3QU6A 3CJQB 3OYNA 5HS7A 1FYKA 3KP4A 4K2EA 2TDXA 5E3LA 1S72I 1RKWA 2DCEA 2VONA 4EJOA 3W6VA 2HQNA 2ADUA 3OS1A 2R5ZB 1K61A 2GA2A 4U7DA 1U8BA 3G1MA 3KEOA 2JA5J 1JJ8C 4C9YA 2VJIA 1Z3YA 5F0CA 5F6FA 3HHHA 1JKPC 2CW7A 4ESJA 4GYGA 3M7GA 2HKOA 3MD2A 1KA8A 1RKTA 2B0LA 3KP2A 1E0EA 2Q0OA 2TRTA 3G6EI 2E34A 3ZOBA 1KONA 3HC7A 5DUKA 3SHFA 4LLGF 2GBYA 3RQIA 4II2A 4XKCA 2LREA 4HRIA 5DCMB 3WTUC 1RR8C 1IG7A 4Z6YA 2CW8A 3DPLC 3LWFA 1UB9A 4AWXB 1P6RA 1Y56A 1SD6A 2FD5A 3CESA 3PJRA 2JWTA 1HDDC 1Z3XA 5KVRA 2UWMA 4I98B 1IN5A 1W0UA 3P9IA 2H8RA 5EYRA 3F22A 2PJRA 2ZNYA 3F23A 1TWCJ 2VBXA 4U0YA 1R71A 2IEKA 4V2FA 4XLNF 5JR3A 2DN0A 5K7ZA 2Q2EB 4BXUA 1J59A 3KPHA 1QVTA 2BHZA 3BDDA 2KKOA 4Y33A 2A6TA 3HZJA 5KCMA 5AIQA 2CQKA 2R7RA 1BIAA 3A0HC 2BVMA 4P1WA 4Q47A 3DU6A 1STZA 4W1UA 1ETVA 4I6ZA 2PG4A 1IXRC 2P6TA 3R60A 3R0JA 5KNLA 2LFBA 1ZREA 1S7OA 1IV6A 1O57A 2XGDA 2F6CA 4HV6A 5ILSA 3DP7A 3HOUJ 3GCMA 2ME0A 5D5VB 1X1AA 5GPAA 5J1UA 1SD5A 1XTAA 1OCCH 2ZXHA 4ZYGA 4PJMA 5C3EJ 1HW1A 2W24A 5CKTA 4LG3A 4CA0A 3BQYA 1X2MA 1GXQA 1MBFA 5FLVA 1LDDA 1G59A 4G7ZF 2WAFA 2VB6A 3H36A 1PUFB 4M3DA 4C3IJ 5C4JJ 1POGA 1ZR4A 1YS6A 3PIPF 2OZ6A 3Q9VA 3ISPA 1E3PA 1WI3A 3BPXA 3DTIA 2X9DA 4HF1A 4MQ9F 3L7WA 4B8XA 3G1LA 3W2AA 2M2EA 1ZG3A 1TW3A 4HOBA 2M87A 2MSYA 3ZQGA 1K78A 4QIWN 1R5HA 2X6YA 3BJAA 5F64A 1O3SA 2D5VA 2XVCA 2G0EA 5GP9A 3L2CA 3SFZA 1IJWC 4ETSA 1W36C 3HOSA 1TP4A 4A3FJ 2R7ZJ 2IPQX 4IRIA 4IHSA 1S3JA 2STTA 2DJNA 2DQRA 1U5TA 2OV7A 3CC7I 4ZTJA 1UELB 4OAZA 4BE1A 3S1QJ 3LL7A 2UZKA 4CCKA 4OIOF 2M30A 1BI0A 2AO9A 4EMSA 2OU2A 4OINF 3WE3A 1YI2I 4RA2A 5FB2A 4XQFA 5F0HA 2LNBA 5DCFA 3PQKA 2YSRA 2DA4A 4KICA 1D0ZA 3CJNA 2EA4A 4HQMA 3JRIA 5EG0B 1JGGA 2FF4A 3MVPA 2GOMA 5L3CA 1B59A 4M74A 2EV0A 1GUUA 2W00A 1Z67A 3K1PA 2P0WA 3HIFA 1S6LA 3EYIA 2CMPA 4BY7J 1RC9A 3TO9A 4KNYA 2JTVA 2V4JC 4CGZA 2E1MC 2WV0A 3WGGA 3GZ5A 4OMZA 3BPVA 1HXDA 1ZKGA 2K4BA 3L2RA 1SEUA 3SYTA 2G7HA 2BXYA 2JT1A 1BW6A 5E8GA 1X19A 1P92A 4DOZA 4M3GA 3HOTA 3MKYB 3NEUA 1ZH5A 4RBOA 5BPIA 3G71I 2KQRA 4MTDA 3KIOA 2DFFA 3WTTC 3V8LA 3E6DA 3RPUA 2XRLA 3KZIC 3MZYA 2RV8A 2ID6A 3CF2A 3BR1A 3SFIA 1DUXC 4BJ6C 4G94A 2W48A 5JFRA 5DUIA 1PP8F 1D0YA 3JRFA 3J7AO 2QKLB 3CMAI 2VE8A 3BJOA 2QF7A 3C18A 1U6GA 3E1SA 2VLAA 3FM3A 3RPUD 1A6IA 2MW8A 3PNYA 1D5YA 2M0CA 2VPLA 4A69C 1DU0A 1HQCA 3CLQA 4L18B 2LH9A 2VN2A 3OIOA 2XAFA 3F8FA 5J1YA 2PLYA 3Q0UA 3I71A 1BIBA 2EIJH 5ICFA 4MFEA 3RKWA 4ENNA 3QYEA 4BE2A 4MIMA 3NRVA 1YRNB 4JP0A 2QVOA 3WHCA 1FSEA 3RKQA 3F8BA 5E20A 5HLHA 3CC2I 4EGYA 1T08B 3EUHA 4ABZA 3IL2A 4CYCB 5LEKA 5K7FA 2EIKH 3K4BA 2XIGA 1FBQA 3OIQA 2M34A 5ILVA 3RI4A 3Q5FA 1YJ9I 5D8LB 4XK4A 5J47A 4BQAA 2JSCA 4FHTA 1JHFA 2MFZA 1YOVB 2HZDA 1RR7A 1ULYA 3LA3A 3GWZA 3GLLA 2I5UA 1OQYA 4S04A 2VT2A 2X6WA 3BLYA 3LSJA 4U0WA 4OIPF 4L9TA 4HLYA 4R1HA 2Y75A 4RS8A 1G8XA 4YG2F 1SC7A 4A3GJ 3H9GA 3NARA 1IF1A 3KCCA 3OYFA 3WU0A 4U7BA 2EILH 1KQ0A 3B02A 3DPTA 4PJJA 3ZMVA 1NK3P 4EM2A 4ZYHA 1WJDA 1EF4A 1UHWA 1KU2A 3K4MA 4ZDLA 3DKXA 3A2KA 1AA7A 1VQNI 4A6EA 1W7PA 3MQ0A 1JT6A 3QQAA 1MNMC 3JTHA 2QSGX 2ZJ2A 3FKJA 5IP7J 4ZDOA 2KP6A 3ZQCA 2DAOA 2XPUA 3ML6A 2FE3A 4I09A 1SAXA 2BY1A 1MZBA 5J4VA 3OYAA 1MMNA 5IYDJ 2A69F 5CVRA 5CVJA 4PUSA 1WJ5A 2XUBA 3RDIA 1MNEA 2W7NA 1TL8A 1XDSA 2OD5A 4RAYA 3W6JB 1WHUA 4M9SA 3TMOA 1VQOI 1W7PD 4DBQA 4R79A 1ZGAA 2PMHA 1L3LA 1B4AA 3FK6A 1FIPA 1A5JA 4E7IA 5IOYA 4YFNF 3WE2A 4DZJA 4WXHA 5JVGF 4JK1X 5HODA 1P7JA 3BR2A 2FXAA 1V4RA 3M8JA 1HLVA 1I5ZA 5JVTA 2K7LA 2P5LC 1B8IB 1VQLI 1EH8A 2EJRA 3QODA 1KYZA 5B66C 1LE8A 3LAJA 4I2OA 3E5UA 2PMZA 4HX7A 5EZGA 1MJAA 4LD5A 1ZK8A 3M1EA 1IO2A 2DW4A 2OQRA 2JUGA 2XDVA 3OYIA 1EJ9A 1VQ4I 4WXDA 1R58A 1YHQI 1ORKA 1PP7U 4I0AA 2QKMB 1KU3A 1TW2A 2CUEA 2KFDA 3J7AY 5FROA 1YLFA 4A3KJ 1MMAA 4LOCA 4ZH4F 3CCEI 3H0GJ 1KGSA 2E1MB 2XAQA 3O6BB 1Z1DA 2BZTA 1FBUA 3K4KA 2CQQA 1YITI 4X6AJ 3S16J 3KEYA 3K4CA 1R00A 4WXCA 3MFKA 4E7JA 3D5SC 3F72A 2NVYJ 3BG9A 2EV6A 3TP3A 4ENJA 5J8CA 3IRRA 3VEPA 5CJ9A 5K5OA 1BJAA 3KP6A 4Y52J 3F8NA 3CUQA 2XASA 1JT0A 2J5OA 3LSKA 4M73A 4MTEA 1HW2A 1CF7B 3HB9A 4NHJA 2CUZA 2CO5A 1MBKA 3VSKA 2LDUA 2GWRA 1FLIA 2L9RA 2W1OA 1V54H 2XV4S 1N77A 2JSPA 5IP9J 1B6AA 2X48A 4C3HJ 3LSPA 4MQVA 4OU0A 2EA2A 5D4RA 1WJBA 1GT0C 3PQJA 3N05A 4KIBA 2VOOA 4TV7A 3I64A 2KT0A 2QQ9A 2FBKA 4WX9A 2X1EA 1FX7A 5D6EA 1GVDA 2MG4A 4XRSG 3M1CA 4CCOA 4RM3A 2XPWA 5GADJ 3ERED 3HSEA 4NB5A 4XORA 5L3EA 5E3OA 3GX4X 2W85A 5FGMA 4BXXJ 3PFYA 5DM6F 4M3EA 1UMQA 1MDMA 2NVTJ 3GTOJ 2R4GA 3HGGA 1KZHA 5D5XB 4FX0A 4BHPA 3E5QA 4DW6A 3X2QH 3WGIA 2E2HJ 5J6XA 4M6VA 3ASNH 3HPGA 5DCMA 1X3UA 2DFHA 2LKXA 4M6XA 2E1OA 4P9UA 4KMFA 3H5RA 3L9FA 3S15J 3FMRA 3AAFA 3FXUA 5EJCA 2L7MP 3E6MA 1UFMA 3R61A 3EUAA 1LVKA 1ACIA 2FSWA 1ENHA 3DBRB 2NVQJ 1TWFJ 4L0ZB 2XAGA 2Q2EA 4PJLA 5D6FA 3JCUC 1JHHA 1YYVA 5HLGA 1IZ1A 4N0BA 4HV5A 3ULQB 3SQNA 5AONA 2K4JA 2EK5A 3WG7H 5M5XJ 5B1BH 1SAUA 2HTJA 2LBFA 3I9V2 4UHTA 2KLOA 4L0YB 2EBIA 3CP8A 2EB7A 3QWLA 2K5CA 1QZYA 1T33A 2WB1N 1DU6A 2HDCA 2IS1A 1YS7A 1K79A 1Z9CA 4RB0A 2QUFA 1SVOA 3E7LA 4A5MA 3K4NA 4V2GA 5FRNA 1ZN2A 3L09A 5DYMA 2GLOA 3F0CA 4IHTA 1MD0A 3U1KA 2D45A 2L9VA 1WH7A 3I0TA 1WKMA 1WI9A 4G6TB 5EEAA 2EFNA 4EVIA 2JA2A 3U21A 4D7NA 4LGWA 5DEQA 5EGOA 2A6EF 3ECOA 2Y48A 4UUVA 3BZ6A 1WWXA 5KAIC 4ZYEA 1Q1VA 3SDGA 4AC0A 1XGNA 2W84A 2NVUB 4BEHA 5E1XA 4ZC3A 2R92J 2C6YA 1IDYA 3GTGJ 3WU2C 1SVLA 1D8JA 1R4MB 1J7KA 2L7KA 4P96A 4BHBA 4NNJA 3K1NA 3KP5A 2LKSA 2WB1A 1Z0XA 3OL4A 3FMQA 2H1LA 3GTMJ 2LG4A 1MSFC 2W4SA 1QQIA 1P4AA 2QCOA 3GLXA 3LSGA 2QGUA 4XKVA 3HUGA 1FNNA 1WJAA 2E1NA 4DYQA 2BGCA 1HC8A 5FD5A 4D1QA 2XB5A 4OWRB 2V1XA 1F9NA 2UV1A 1J75A 1EKEA 1OCTC 5LRRA 4UUSA 1ZLKA 4C3JJ 2V26A 1BOBA 3Q3SA 4F91B 3E6CC 4NUBA 1LQ1A 5JLXA 2UUZA 1O4XA 4NBQA 2DYSH 2GAUA 2R7SA 2CYYA 4MEXF 1V5FA 2A61A 3ZQFA 2DA5A 3TOBA 1DDNA 2CW0F 1S9HA 1WSUA 4B47A 4BAYA 2A3SA 3G3ZA 3ONQA 1MMSA 5H6QA 2OCCH 2ZFWA 1J2XA 5LHGA 1ZG5A 1RUOA 5HDGA 4IO9F 1ODDA 2F4IA 3S1RJ 2WAEA 2ISZA 2VUMJ 3D0SA 3ZQHA 1TLHB 4O5VA 3VYTB 3ECHA 3HSRA 1TWHJ 2O0YA 2P8TA 3K69A 3P9KA 5FO5A 3V42A 4A0ZA 3LSHA 1LPQA 1XN7A 5A2QZ 4LG0A 3CCQI 4N9HA 3FZVA 3LQRA 3FXKA 1ZRCA 3CD6I 4CXFA 2OCEA 1T56A 3L2VA 5JHUA 5M3MJ 1A31A 1B72B 1RETA 2IGKA 3J7ZI 4KDPA 2XF7A 2V1UA 3QAHA 4J01A 4IHVA 3DCFA 2W57A 5E1ZB 3WU1B 3PFIA 3TDUC 5LFAA 2KISA 1KQ9A 2OBPA 1FBSA 3GTKJ 4BYYA 1J0RA 1G3TA 1ZRDA 2DK8A 2UXNA 1Z7LA 2A05A 2M0MA 4Y4RA 2XC7A 2WTEA 2MH9A 1HDPA 2HVRA 1U9OA 5IY5H 3PO3J 4IHYA 1W4MA 3MKZA 3DLLF 1HBXG 1A36A 2QZ8A 1Y1VJ 4CDGA 3HBLA 3CCJI 2JPCA 3L00A 2Q8KA 3KLNA 4J19A 1R7JA 2H09A 3DTKA 3TGNA 4XLFA 1LFPA 4OIQF 1J09A 2QSHX 1RUNA 1ZQ3P 2DOAA 4M72A 3A4CA 2ID3A 2HPMA 2LC2A 3DEUA 2Y30A 3H0DA 1QO0D 3I53A 4IX7A 1H8AC 4BBSJ 1LEAA 4D9JA 2DT6A 4PJNA 2R5YB 4UY8I 1OYWA 2L01A 2ZNZA 2PMUA 3LQQA 2P5KA 3V7CA 2Y0MA 3D1NI 2M7BA 1REPC 3IH2A 3CCLI 2R3SA 3TDZC 1DGRM 2XRNA 3TOAA 2IXSA 1FYMA 2BXZA 1FTZA 1QBJA 4YIFA 3K2ZA 2F5EA 3A1YA 4PFPA 3BR5A 3W3CA 2JVGA 3MMYB 1W5TA 4BXFA 1RIOH 4LK0F 5IPAA 1VQ6I 2X6XA 1U2WA 3G4SI 4KYWA 1MIJA 2K9QA 2FUG2 3FMSA 4NC6A 2OTLI 3GMEA 3F6VA 4ZYDA 2E2JJ 1QHGA 1IRGA 2HWVA 2DMQA 2KJBA 3KFWX 4KT5C 3BOQA 4G7HF 2ZXWH 2XPVA 3FXJA 1WPKA 5EZHA 2CSOA 1I6HJ 1E2XA 1T38A 2J5PA 4XN0A 5E79C 3MKLA 5J3LA 3H9JA 2M3AA 2RNGA 2PFBA 4CO8A 2R7QA 1I50J 2HVSA 1IV8A 1K4SA 3P9CA 5EDNA 3PNTA 5CYVA 2VKEA 3GTPJ 1XG1A 2FNAA 4IF4A 2GA1A 5J1RA 5E3MA 1ONVA 2HOEA 1I3QJ 1D0XA 2XHKA 3BTJA 3OR2C 3OYDA 2DJIA 4RAZA 4E4HA 3FXLA 1TT0A 4Q5SF 1LB2A 3UR3C 5CVIA 1G4DA 1F1ZA 4G7OF 4BACA 3NQOA 2RC4A 3JTGA 1UHMA 1AKHB 1JKRC 2WY8Q 3RPQA 4E70A 2VQGA 1WGXA 2BE5F 3O3KA 4GDFA 2EZIA 2MD0A 5FKNA 5J40A 3D5LA 1L0OC 2BVLA 3SJMA 1WJEA 3FBNB 5FKOA 2YR2A 1E3OC 3QPSA 1D8KA 3M4OJ 2HYFA 1BOAA 2EZHA 3BTCA 1ETYA 2ZMEB 2HOSA 2GOXB 3BZCA 4CZCA 4FETA 3F8CA 4BKXA 4EEFG 2PBIA 5CVVA 1T95A 1FZPB 1QPIA 1CQTA 4JYKA 2DYRH 1HKTA 3LSMA 3I3LA 4PFOA 1MGTA 2EWNA 5FLXK 2OTJI 4EV0A 3GZ6A 2XKOA 2XGCA 2MLGA 2HXOA 3IKTA 4WK8F 2ZXJA 3RYRA 4X0GA 2VQCA 3EDPA 3FISA 3HGYA 4IHWA 4XL9A 3DBHB 4GCVA 5ICGA 2FQ4A 4EM1A 2ECBA 1I27A 3F21A 4LMYA 1RZ4A 3IUOA 2JK3A 1XS9A 2X6OA 4YFXF 2IGMA 2IJLA 1D3YA 5FFXA 1A6QA 2LR8A 1R1TA 2GXGA 1NTCA 1JUPA 2KMUA 1RPWA 3S93A 3T5XA 3AKZA 3BY6A 3CCYA 1X2NA 3KYCB 2K3PA 5TJJA 1BR4A 2QBYA 2Y0SA 2ZB9A 2CFXA 4NC8A 4NQWB 4RB3C 2ELKA 3PUBA 3AL0C 1FEXA 3F6OA 2KIFA 3KZZA 3TBIA 2R7OA 3WTYC 3KETA 2EINH 1TC3C 3K9TA 3SEQA 1C0WA 3A01B 3OYMA 3DLAA 1W5CC 3VDXA 1FYLA 1JUMA 4AVPA 1FOXA 2BOLA 4RB1A 2M1BA 1DGWY 2QEXI 1PUEE 4M6YA 1E3HA 1QRYA 2HPIA 3DXJF 5F0FA 2IGOA 4CHUA 2QSFX 3S3MA 1UZCA 1YG2A 2OPTA 3WTZA 9ANTA 1XD7A 1GDTA 1U5TC 1RRJA 2PQ8A 3CLOA 4OIRF 3GFIA 2NNNA 3CZ6A 4GYIA 1YX5A 2VKDA 5B5EC 1BR1A 1X1CA 2DTZA 3HRTA 2KZGA 4FISA 2DOFA 1Y0NA 3S2DJ 1I1SA 1I3AA 3JW4A 3J80Z 2DA1A 1D1CA 4ZJZA 3B6CA 4LB5A 5DV5A 5D5UB 2Z9OA 1H88C 1D1BA 3OYJA 1VQPI 1PJRA 1XMAA 1BL0A 2OA4A 3MAJA 3A02A 1YJNI 4HDVA 5KHDA 3RZOJ 2V1NA 5L3BA 3HEFA 1A35A 1OKRA 4UVBA 4A5NA 4Q4ZF 2DTRA 4Z2YA 2H94A 3CMYA 2VKVA 3GTQJ 3D5RC 3N4MA 2LF7A 3GTJJ 1O7LA 4U87A 3SXYA 3S3NA 4C2TA 5H2FC 3OL3A 1SFOJ 5HS9A 2MYSA 3JRDA 5BMZA 3JSPA 3I4PA 2XSJC 2F5DA 5HLIA 4C30A 1KYWA 2Z16A 1GXPA 1Z7UA 5IP6A 3OOUA 3CMEI 5BOXA 5IOZA 4X1EA 4XBFA 5IT9Z 4JX5A 4UV9A 3CCUI 3I54A 2XAJA 5GPCA 2K9LA 2MD5A 3S2HJ 1LKXA 4UVCA 3GUDA 4HX8A 1MMGA 3WODF 2F5CA 3HOVJ 1HSTA 4I01A 2DK5A 2ME6A 2R7WA 3I4NJ 1BM9A 4WF2A 3JAMZ 2LYCA 3BWGA 1K6YA 1ZELA 1UG0A 2F5VA 1S5LC 1K4TA 3H1CA 1BBYA 3IH3A 1XGSA 3K4JA 4A3LJ 4AYBA 5DM7F 2NYXA 3U2RA 4HDUA 1GLNA 3RCOA 5E8IA 2PMZN 2PJRB 3RKYA 2DFEA 4FQGA 4IRGA 4OMYA 2ZO4A 2L4AA 4UXNA 1YW7A 3IWFA 3ABMH 4EGZA 2KRFA 1MJ9A 2WAQN 1FMVA 3EUHC 4D0PA 1IW7F 2DMUA 1UG2A 1X3WB 2E19A 3OSFA 2K9NA 4PSWA 2JRMA 2VI6A 2ICWG 2DFIA 2L9NA 1XDUA 4Y17A 3QRFF 2O8KA 5BNGA 4HEA2 1R1VA 3J81Z 2PEXA 3R6SA 3SDBA 2QWWA 2A07F 2LK2A 5A2QK 3S17J 3ZMSA 4BUPA 5JHFA 2PJPA 1MSEC 2BY2A 1U3EM 4UV8A 4FCYA 4A93J 4CCMA 2XROA 1V55H 1LVAA 4ESFA 1ETQA 1OFCX 2CQNA 3FWEA 1KQ8A 1ZRFA 4IRHA 4LFUA 2BBYA 4LITA 2VBWA 5M3FJ 2K40A 4A3BJ 2F4MB 1JTXA 3ASOH 4BS9A 2WAQA 3UKGA 1XGOA 4WCGA 2XAUA 4CUGA 5LHIA 5HS8A 5IT3A 1T39A 3BR6A 1I1GA 4GO1A 5GTIC 1WCMJ 2QENA 2O6GE 2EZLA 1I6XA 1Z6RA 2DA2A 1W0TA 1QZEA 1TZLA 2OQGA 2NRAC 1IUYA 4U0VA 4AIDA 1Z77A 4B09A 3S2WA 3HTSB 2GIVA 5L3FA 1DPUA 2NS7A 3GW2A 4MHGA 1K78B 3TO7A 2L02A 1O3QA 2ELJA 3LOCA 2DPUA 1P4XA 2PX9A 3PSFA 1VQMI 3PNVA 3BG6A 2XAHA 4B3XA 4FX4A 4XKBA 2WC2A 4YFKF 2BW3A 2WADA 2NNYA 2GXBA 1CGPA 1XPXA 3CJTB 3FXRA 1MH4A 4HZFA 1U5TB 5J4YA 4LJZF 4KN4X 1ZLJA 4QWQA 3M8EA 1N25A 4B3AA 3T8RA 2HI3A 3BTLA 1VQ8I 4BQOA 1NG6A 3ZMZA 3VYUB 2EFQA 1G3WA 2K85A 3M8FA 3LSIA 4A3EJ 2OAZA 2R5ZA 1ON2A 3E5XA 3ZPLA 5E1WA 2FBHA 4N4NB 4XONA 2STWA 1QPMA 1X4PA 2RREA 3LA7A 1YQAA 4UB8C 2DBBA 3OMYA 1NH3A 1X3ZB 3RSNA 3K4LA 4FT8A 2K9MA 3RJPA 3PUFA 3FHZA 3H5NA 4XM3A 1TT5B 5LLQA 1J5YA 2CUJA 3Q9SA 3KP7A 5D5WB 2RGVA 4AIKA 5E18F 4BQNA 1AU7A 2R93J 1XC5A 2L3DA 2H6BA 2GQQA 2IA2A 1JKQC 5KAFC 3S32A 1B9MA 2AQEA 3K70D 5LBQA 2E36A 3K1MA 3OYKA 2LY9A 3CUQC 2E2IJ 2VKHA 3I56I 3IWZA 2VBYA 1WVRA 2Y9YA 1DQUA 2IVMA 1FTTA 3HRMA 2Q1ZB 1W1WE 1OCZH 2DDAA 2EH3A 3PM1A 4KIGA 1IXSB 2L2OA 2M8GX 2VPRA 1KU9A 4P9FA 2BEOA 2X1CA 4C2MJ 5HVQC 2HGCA 3S1MJ 2X4HA 2F4OB 4PSXA 2YS9A 5DTDA 2R7DA 2VASA 2VE9A 4AIJA 2LVSA 4HBLA 4F7ZA 3DBLB 3DV8A 4Y7NJ 3IRQA 1AWCA 1QA6A 4F3QA 2EFWA 1OCRH 1QNTA 3QU3A 4UVAA 4XSXF 2PN6A 1Y39A 4BDZA 1BC8C 2DDBA 2VJ5A 3F8MA 2V9KA 1DPRA 1LDKB 2KL4A 4BDYA 1U78A 4V19K 1BI2A 4IHXA 2ETHA 4HSRA 3WTXC 3KP3A 3GZNB 4F92B 2V6EA 4IOCF 2NS8A 1X4OA 2CQ7A 2FOKA 5TRDA 1YFHA 3QP5A 4B48A 1OCOH 2LRDA 2TCTA 4YRVA 1ZR2A 1HCRA 5FKLA 3L2QA 5IYBJ 2IBDA 3W2VA 3B73A 4IKFA 1F5TA 1ZYRF 1PUFA 2CH0A 4EQQA 3VOEA 1IUFA 2ZJPF 3FM5A 4W97A 4NDLA 2ZJQF 2LF8A 3L1PA 3QPLA 2RVCA 1TWAJ 5F04A 3ZMDA 2JN6A 2L4MA 2R7XA 3ABLH 4E7KA 3FIWA 3RKXA 1T0FA 2EPFA 2LOOA 2O03A 1MBHA 4LLNA 4Q48A 3ZN0A 2KIMA 3CDIA 4AVZA 2E7WA 3OYGA 1B9NA 1HW5A 4G6DA 4MO7A 4H0EA 4RGRA 4ZYAA 4D7MA 4WWCA 3JREA 1W7PB 3QP6A 3T0YA 4IVNA 5HDNA 3OSGA 3FXOA 4HNUA 1UAAA 4GRIA 2ZBKA 3RTRA 3BP8A 1NK2P 4HQEA 4L5IA 2Y9ZA 2K27A 1JGSA 2NXNB 3CTAA 4AUXA 1IN4A 3JRCA 2O3FA 2DO7A 4YIIA 5LD2C 4KUMA 1MNDA 4P5OA 3CMMA 5IYCJ 5EEHA 3LSTA 2BHYA 2V1DA 2L0KA 3LFKA 3HOZJ 3M3YJ 2IW5A 4HYEA 4XIDA 3MEXA 1FJLA 1LEBA 2RKHA 1OR7A 5EG0A 2V79A 1PVEA 4XSZF 1X1PA 4IEJA 4L5EA 3PIOF 2KDOA 1P7IA 2LMDA 4ITVA 2CV1A 1IRZA 1LE8B 4RAGA 4RM2A 4BJ5C 1Z05A 4BJTA 4A2UA 4UNOA 2JVHA 3VPRA 2HQ5A 3BQZA 3C2BA 1Y8RB 3A01A 4I7HA 2DA3A 1HKSA 1FIAA 3A03A 5F1JA 4ZZLA 3F3XA 2ZC2A 3GFLA 3KYLA 2OUMA 4PGGA 3HKZA 2WWYA 2KPMA 2QQBA 2W82A 2LP0A 4HW0A 2GM4A 4J00A 1J9IA 4G12A 2R7TA 2IS6A 4IQ4A 2HU9A 3DKWA 4O6JA 4QSHA 2HQAA 2Y2ZA 3DU5A 1S7AA 2LY1A 2X85A 2XF5A 2JA7J 1X1DA 1IN6A 1SFKA 3C7JA 4HSTA 3RZDJ 1VFCA 2LTPA 1XSDA 3OY9A 2D2WA 4MGRA 3TEDA 4KISA 3G1OA 5HNHA 5J8FA 1VQ5I 1VTNC 3CUQB 1EH6A 1USSA 2CU7A 2H6CA 2MC4A 4JQFA 3COAC 2DLLA 2M4KA 3MZ8A 4M71A 4RAFA 1Z21A 5L3DA 3BCBA 3EYYA 4RLFA 3ZN1A 1IN7A 1VQ9I 2WA0A 2L7ZA 4G8XA 1DP7P 3C2HA 4N9IA 4P55A 3CDHA 2G7UA 2P81A 1X58A 1O3RA 2VIXA 2BYVE 5CVUA 1S7EA 1YRNA 4M9XA 3OYEA 4HNVA 4R8HA 1HF0A 3GFJA 3VB2A 3IP4B 1V5GA 1O7FA 4CYCA 2RAEA 4FASD 3S3OA 4CSWA 2ZSIB 2E5NA 2HQRA 5JI6A 3SZGA 3EETA 1WH5A 1FP1D 1ETOA 2JRTA 1MDMB 1AHDP 5LEJA 1JUSA 1XCBA 1OISA 5ERIA 4XOTA 4EATA 1XMKA 2IAIA 4ENKA 4N4OB 3J81K 5FLMJ 1LNWA 3OYLA 4XLHA 4KITB 4GGGA 1M1EB 1XGMA 4LIUA 2FNPA 2L7FP 1BJZA 1JTYA 5GTHC 3HYIA 2CV0A 2O9LA 2YX7A 3AG3H 3FKIJ 3H35A 2FMYA 4U88A 4ZZDA 3GYHX 2R7UA 2VT3A 2DT7B 2DT5A 4OAYA 5ICCA 2Z33A 4XNFA 2HDWA 5HLTA 1JE8A 2CRGA
chains in the Genus database with same CATH topology
3BG9A 3RZOJ 5M5YJ 3TP3A 3HEFA 3BTIA 2JA6J 3I4MJ 3CMYA 2VKVA 3GTQJ 2CJJA 4Y52J 3HKZN 3GTJJ 1JT0A 2OF7A 3JR9A 1MH3A 1JKOC 1SFOJ 3HB9A 3JRDA 1MBKA 5JLWA 2L9RA 2K9SA 1HOMA 4B4CA 1F43A 5IP9J 3GBGA 5IP6A 4C3HJ 2X48A 3ZQLA 3OOUA 3LSPA 4MFDA 3H3VK 1RESA 1ITYA 3BG3A 5IOZA 1TWGJ 4X1EA 1GT0C 4JX5A 2WV1A 4A3CJ 1B8IA 2NOGA 2KT0A 5GPCA 1ETXA 1F36A 3S2HJ 1GVDA 2MG4A 4XRSG 5M5WJ 4BY1J 1UHSA 1VF9A 3S1NJ 3CDLA 1LFUP 2XPWA 1SANA 1R9TJ 3HOVJ 5E3OA 1ZTRA 4BXXJ 4M3BA 2ME6A 4M3EA 1UMQA 3I4NJ 5F08A 2N8GA 3TW7A 1VI0A 4A3JJ 2Y0SN 5EGOB 2NVTJ 3GTOJ 3HGGA 3CQZJ 4DW6A 1IGNA 3IH3A 4BBRJ 2E2HJ 3MN2A 4A3LJ 4M6VA 1GV5A 3TP0A 2COBA 2LKXA 2PMZN 2E1OA 3BR3A 1MBGA 2EQRA 4A3DJ 3S15J 2WAQN 2L7MP 3JRGA 4DYRA 1ETKA 1ENHA 2NVQJ 4RDUA 1TWFJ 1UG2A 2DMUA 4FTHA 2E19A 3FK7A 1U9NA 4MLOA 2DA7A 2K9NA 3OSFA 2YU9J 1IDZA 2VI6A 1OCPA 3HOYJ 4FE7A 1QVUA 4M3FA 2O8KA 5BNGA 5E3LA 1RKWA 3W6VA 2LK2A 5M5XJ 4UUSB 2R5ZB 1K61A 3S17J 1U8BA 2JMWA 3G1MA 2EBIA 3O8HA 2JA5J 1MSEC 1T33A 2WB1N 4FCYA 4A93J 1JJ8C 1DU6A 5F0CA 1ETQA 1OFCX 1JKPC 1H89C 4JX4A 3E7LA 5M3FJ 1RKTA 3PO2J 2K40A 4V2GA 4A3BJ 1JTXA 2GLOA 3UKGA 2TRTA 3F0CA 3ZOBA 1WH7A 3HM5A 3BR6A 4DZPA 5EEAA 2GBYA 4D7NA 3RQIA 1WCMJ 2MGQA 5EGOA 2EZLA 1IG7A 2DA2A 1W0TA 3TW6A 2O7OA 1Q1VA 2FD5A 3SDGA 1Z77A 4AC0A 3JRAA 2JWTA 1HDDC 2JA8J 2NS7A 2DMPA 2R92J 1IDYA 1W0UA 3GTGJ 3LOCA 2H8RA 5EYRA 2DMNA 1Z0XA 1TWCJ 2IEKA 4V2FA 2DN0A 5K7ZA 3GTMJ 1MH4A 1MSFC 1QVTA 4DYCA 5EF6A 4AYBN 2QCOA 3LSGA 4DYQA 4B3AA 2HI3A 3BTLA 2Y31A 1IC8A 3K2AA 4W1UA 1ETVA 2XB5A 4I6ZA 3S14J 2LFBA 1OCTC 4UUSA 4A3EJ 2R5ZA 4C3JJ 1IV6A 3Q3SA 2XGDA 5JLXA 3HOUJ 2ME0A 3BT9A 1O4XA 5GPAA 5J1UA 5C3EJ 3Q0VA 3ZQFA 2LLKA 2DA5A 1VNDA 3BQYA 1X2MA 1MBFA 5FLVA 4UUTA 1AU7A 3IH4A 2R93J 1XC5A 3ZQIA 1PUFB 4M3DA 4C3IJ 1JKQC 5C4JJ 1K83J 1POGA 3S1RJ 1ZR4A 3K7AJ 2VUMJ 3ZQHA 1WI3A 2X9DA 3IV5A 3JRBA 1TWHJ 2LY9A 3G1LA 2E2IJ 2B63J 2M2EA 2Y9YA 3B6AA 1FTTA 2MSYA 3PM1A 3ZQGA 2EH3A 2M8GX 1T56A 2VPRA 4QIWN 4C2MJ 5M3MJ 1B72B 2D5VA 1RETA 1Y1WJ 3S1MJ 2G0EA 5GP9A 3Q0WA 1IJWC 2YS9A 3BR0A 5DTDA 2M9HA 2LVSA 4A3FJ 4IHVA 2R7ZJ 3DCFA 2DJNA 4Y7NJ 3GTKJ 3S1QJ 5FKKA 1HDPA 2AO9A 2HOTA 1U9OA 3PO3J 5F0HA 4I76A 4IHYA 2R0QC 2DA4A 4XICA 1Y1VJ 3JRIA 1U78A 5EG0B 3HBLA 3MVPA 1JGGA 4IHXA 4D5CA 1GUUA 4J19A 1APLC 2NS8A 2KDZA 1ZQ3P 3NAUA 2H1KA 2DA6A 2ID3A 4BY7J 5K7HA 1H8AC 4BBSJ 2Y30A 3HOWJ 2TCTA 1ZR2A 4GFBA 1HCRA 2ECCA 5FKLA 1ZKGA 5IYBJ 2R5YB 2IBDA 1BW6A 1PUFA 1JJ6C 4M3GA 1IUFA 4W97A 4NDLA 4RBOA 3L1PA 3QPLA 5F04A 1TWAJ 3D1NI 3IH2A 3LSRA 2JN6A 2NVXJ 3FIWA 1FTZA 2XRLA 1MBHA 2ID6A 3BR5A 3BR1A 3SFIA 4MO7A 3JREA 5IPAA 4D7MA 2CQXA 2W48A 2K9QA 1MBJA 1B72A 3JRFA 2E2JJ 3OSGA 2DMQA 2QF7A 2XPVA 1NK2P 5FJ8J 1WPKA 5EZHA 2XGEA 1A6IA 2Y9ZA 1I6HJ 2MW8A 5J3LA 3MKLA 1D5YA 2EZKA 2M0CA 4AUXA 4A69C 3JRCA 1DU0A 1I50J 3WHBA 3JRHA 2LD5A 5EDNA 3OIOA 1GV2A 2VKEA 5J1YA 1XG1A 3GTPJ 2HYJA 5IYCJ 5J1RA 3Q0UA 5E3MA 1I3QJ 3BTJA 3M3YJ 2L0KA 3HOZJ 4MFEA 4QTRA 4XIDA 4MIMA 1YRNB 1FJLA 1G2HA 4JP0A 5EG0A 3WHCA 1LFBA 3RKQA 4IEJA 4L5EA 4ABZA 4CYCB 1AKHB 1P7IA 5K7FA 1JKRC 1IRZA 1LE8B 1WGXA 5C4XJ 2M34A 2EZIA 5FKNA 4XK4A 5F27A 3VPRA 4XRSA 2HQ5A 3BQZA 3C2BA 4B1RA 3SJMA 3HOXJ 2R5YA 5FKOA 3A01A 1E3OC 2DA3A 3QPSA 1RR7A 1ZGWA 3M4OJ 1FIAA 3A03A 5F1JA 2EZHA 3LSJA 3BTCA 1ETYA 2HOSA 4A3IJ 4A3GJ 4BKXA 3NARA 4EEFG 4JX6A 3O8GA 1NK3P 2LP0A 1QPIA 2GM4A 4S0HB 1CQTA 2FX0A 4JYKA 4G12A 1EF4A 4QSHA 2I10A 2Y2ZA 3HDDA 5FKMA 1MNMC 1JT6A 2XGCA 3QQAA 2JA7J 2HXOA 5IP7J 3BG5A 3RZDJ 2LTPA 1VFCA 2XB0X 3ZQCA 2XPUA 3TEDA 3FISA 3G1OA 2CUFA 3HGYA 4IHWA 2CU7A 5IYDJ 2FQ4A 2ECBA 2JK3A 1XS9A 2X6OA 2L7ZA 2XSDC 1OJLA 2HDDA 2HXIA 2P81A 2LR8A 1X58A 3FK6A 1FIPA 1NTCA 1A5JA 1JUPA 1RPWA 5C44J 3CCYA 5IOYA 1X2NA 1S7EA 1YRNA 1BW5A 4DZJA 5HODA 4A3MJ 1P7JA 2ZB9A 3BR2A 4HNVA 5DS9A 2FJ1A 2ELKA 1FEXA 1HLVA 1ETWA 1HF0A 3DEWA 1TC3C 1B8IB 4CYCA 3LNQA 1AKHA 2RAEA 3A01B 2DMTA 1LE8A 1JUMA 2JJ7A 2HOAA 5EZGA 1ZK8A 4FE4A 1WH5A 1QRYA 1ETOA 5F0FA 1AHDP 1JUSA 2OPTA 9ANTA 1GDTA 1ORKA 1MBEA 2IAIA 3GTLJ 5FLMJ 2CUEA 4A3KJ 4LOCA 2DTZA 2L7FP 1BJZA 1JTYA 2O9LA 4FISA 3H0GJ 3FKIJ 3S2DJ 2AHQA 2DA1A 4X6AJ 3B6CA 2CQQA 4D5FA 4XRMA 1H88C 1BA5A 3S16J 5E3NA 1BL0A 2YUSA 3A02A 2NVYJ 2CRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG9 A;  3RZO J;  5M5Y J;  3TP3 A;  3HEF A;  3BTI A;  2JA6 J;  3I4M J;  3CMY A;  2VKV A;  3GTQ J;  2CJJ A;  4Y52 J;  3HKZ N;  3GTJ J;  1JT0 A;  2OF7 A;  3JR9 A;  1MH3 A;  1JKO C;  1SFO J;  3HB9 A;  3JRD A;  1MBK A;  5JLW A;  2L9R A;  2K9S A;  1HOM A;  4B4C A;  1F43 A;  5IP9 J;  3GBG A;  5IP6 A;  4C3H J;  2X48 A;  3ZQL A;  3OOU A;  3LSP A;  4MFD A;  3H3V K;  1RES A;  1ITY A;  3BG3 A;  5IOZ A;  1TWG J;  4X1E A;  1GT0 C;  4JX5 A;  2WV1 A;  4A3C J;  1B8I A;  2NOG A;  2KT0 A;  5GPC A;  1ETX A;  1F36 A;  3S2H J;  1GVD A;  2MG4 A;  4XRS G;  5M5W J;  4BY1 J;  1UHS A;  1VF9 A;  3S1N J;  3CDL A;  1LFU P;  2XPW A;  1SAN A;  1R9T J;  3HOV J;  5E3O A;  1ZTR A;  4BXX J;  4M3B A;  2ME6 A;  4M3E A;  1UMQ A;  3I4N J;  5F08 A;  2N8G A;  3TW7 A;  1VI0 A;  4A3J J;  2Y0S N;  5EGO B;  2NVT J;  3GTO J;  3HGG A;  3CQZ J;  4DW6 A;  1IGN A;  3IH3 A;  4BBR J;  2E2H J;  3MN2 A;  4A3L J;  4M6V A;  1GV5 A;  3TP0 A;  2COB A;  2LKX A;  2PMZ N;  2E1O A;  3BR3 A;  1MBG A;  2EQR A;  4A3D J;  3S15 J;  2WAQ N;  2L7M P;  3JRG A;  4DYR A;  1ETK A;  1ENH A;  2NVQ J;  4RDU A;  1TWF J;  1UG2 A;  2DMU A;  4FTH A;  2E19 A;  3FK7 A;  1U9N A;  4MLO A;  2DA7 A;  2K9N A;  3OSF A;  2YU9 J;  1IDZ A;  2VI6 A;  1OCP A;  3HOY J;  4FE7 A;  1QVU A;  4M3F A;  2O8K A;  5BNG A;  5E3L A;  1RKW A;  3W6V A;  2LK2 A;  5M5X J;  4UUS B;  2R5Z B;  1K61 A;  3S17 J;  1U8B A;  2JMW A;  3G1M A;  2EBI A;  3O8H A;  2JA5 J;  1MSE C;  1T33 A;  2WB1 N;  4FCY A;  4A93 J;  1JJ8 C;  1DU6 A;  5F0C A;  1ETQ A;  1OFC X;  1JKP C;  1H89 C;  4JX4 A;  3E7L A;  5M3F J;  1RKT A;  3PO2 J;  2K40 A;  4V2G A;  4A3B J;  1JTX A;  2GLO A;  3UKG A;  2TRT A;  3F0C A;  3ZOB A;  1WH7 A;  3HM5 A;  3BR6 A;  4DZP A;  5EEA A;  2GBY A;  4D7N A;  3RQI A;  1WCM J;  2MGQ A;  5EGO A;  2EZL A;  1IG7 A;  2DA2 A;  1W0T A;  3TW6 A;  2O7O A;  1Q1V A;  2FD5 A;  3SDG A;  1Z77 A;  4AC0 A;  3JRA A;  2JWT A;  1HDD C;  2JA8 J;  2NS7 A;  2DMP A;  2R92 J;  1IDY A;  1W0U A;  3GTG J;  3LOC A;  2H8R A;  5EYR A;  2DMN A;  1Z0X A;  1TWC J;  2IEK A;  4V2F A;  2DN0 A;  5K7Z A;  3GTM J;  1MH4 A;  1MSF C;  1QVT A;  4DYC A;  5EF6 A;  4AYB N;  2QCO A;  3LSG A;  4DYQ A;  4B3A A;  2HI3 A;  3BTL A;  2Y31 A;  1IC8 A;  3K2A A;  4W1U A;  1ETV A;  2XB5 A;  4I6Z A;  3S14 J;  2LFB A;  1OCT C;  4UUS A;  4A3E J;  2R5Z A;  4C3J J;  1IV6 A;  3Q3S A;  2XGD A;  5JLX A;  3HOU J;  2ME0 A;  3BT9 A;  1O4X A;  5GPA A;  5J1U A;  5C3E J;  3Q0V A;  3ZQF A;  2LLK A;  2DA5 A;  1VND A;  3BQY A;  1X2M A;  1MBF A;  5FLV A;  4UUT A;  1AU7 A;  3IH4 A;  2R93 J;  1XC5 A;  3ZQI A;  1PUF B;  4M3D A;  4C3I J;  1JKQ C;  5C4J J;  1K83 J;  1POG A;  3S1R J;  1ZR4 A;  3K7A J;  2VUM J;  3ZQH A;  1WI3 A;  2X9D A;  3IV5 A;  3JRB A;  1TWH J;  2LY9 A;  3G1L A;  2E2I J;  2B63 J;  2M2E A;  2Y9Y A;  3B6A A;  1FTT A;  2MSY A;  3PM1 A;  3ZQG A;  2EH3 A;  2M8G X;  1T56 A;  2VPR A;  4QIW N;  4C2M J;  5M3M J;  1B72 B;  2D5V A;  1RET A;  1Y1W J;  3S1M J;  2G0E A;  5GP9 A;  3Q0W A;  1IJW C;  2YS9 A;  3BR0 A;  5DTD A;  2M9H A;  2LVS A;  4A3F J;  4IHV A;  2R7Z J;  3DCF A;  2DJN A;  4Y7N J;  3GTK J;  3S1Q J;  5FKK A;  1HDP A;  2AO9 A;  2HOT A;  1U9O A;  3PO3 J;  5F0H A;  4I76 A;  4IHY A;  2R0Q C;  2DA4 A;  4XIC A;  1Y1V J;  3JRI A;  1U78 A;  5EG0 B;  3HBL A;  3MVP A;  1JGG A;  4IHX A;  4D5C A;  1GUU A;  4J19 A;  1APL C;  2NS8 A;  2KDZ A;  1ZQ3 P;  3NAU A;  2H1K A;  2DA6 A;  2ID3 A;  4BY7 J;  5K7H A;  1H8A C;  4BBS J;  2Y30 A;  3HOW J;  2TCT A;  1ZR2 A;  4GFB A;  1HCR A;  2ECC A;  5FKL A;  1ZKG A;  5IYB J;  2R5Y B;  2IBD A;  1BW6 A;  1PUF A;  1JJ6 C;  4M3G A;  1IUF A;  4W97 A;  4NDL A;  4RBO A;  3L1P A;  3QPL A;  5F04 A;  1TWA J;  3D1N I;  3IH2 A;  3LSR A;  2JN6 A;  2NVX J;  3FIW A;  1FTZ A;  2XRL A;  1MBH A;  2ID6 A;  3BR5 A;  3BR1 A;  3SFI A;  4MO7 A;  3JRE A;  5IPA A;  4D7M A;  2CQX A;  2W48 A;  2K9Q A;  1MBJ A;  1B72 A;  3JRF A;  2E2J J;  3OSG A;  2DMQ A;  2QF7 A;  2XPV A;  1NK2 P;  5FJ8 J;  1WPK A;  5EZH A;  2XGE A;  1A6I A;  2Y9Z A;  1I6H J;  2MW8 A;  5J3L A;  3MKL A;  1D5Y A;  2EZK A;  2M0C A;  4AUX A;  4A69 C;  3JRC A;  1DU0 A;  1I50 J;  3WHB A;  3JRH A;  2LD5 A;  5EDN A;  3OIO A;  1GV2 A;  2VKE A;  5J1Y A;  1XG1 A;  3GTP J;  2HYJ A;  5IYC J;  5J1R A;  3Q0U A;  5E3M A;  1I3Q J;  3BTJ A;  3M3Y J;  2L0K A;  3HOZ J;  4MFE A;  4QTR A;  4XID A;  4MIM A;  1YRN B;  1FJL A;  1G2H A;  4JP0 A;  5EG0 A;  3WHC A;  1LFB A;  3RKQ A;  4IEJ A;  4L5E A;  4ABZ A;  4CYC B;  1AKH B;  1P7I A;  5K7F A;  1JKR C;  1IRZ A;  1LE8 B;  1WGX A;  5C4X J;  2M34 A;  2EZI A;  5FKN A;  4XK4 A;  5F27 A;  3VPR A;  4XRS A;  2HQ5 A;  3BQZ A;  3C2B A;  4B1R A;  3SJM A;  3HOX J;  2R5Y A;  5FKO A;  3A01 A;  1E3O C;  2DA3 A;  3QPS A;  1RR7 A;  1ZGW A;  3M4O J;  1FIA A;  3A03 A;  5F1J A;  2EZH A;  3LSJ A;  3BTC A;  1ETY A;  2HOS A;  4A3I J;  4A3G J;  4BKX A;  3NAR A;  4EEF G;  4JX6 A;  3O8G A;  1NK3 P;  2LP0 A;  1QPI A;  2GM4 A;  4S0H B;  1CQT A;  2FX0 A;  4JYK A;  4G12 A;  1EF4 A;  4QSH A;  2I10 A;  2Y2Z A;  3HDD A;  5FKM A;  1MNM C;  1JT6 A;  2XGC A;  3QQA A;  2JA7 J;  2HXO A;  5IP7 J;  3BG5 A;  3RZD J;  2LTP A;  1VFC A;  2XB0 X;  3ZQC A;  2XPU A;  3TED A;  3FIS A;  3G1O A;  2CUF A;  3HGY A;  4IHW A;  2CU7 A;  5IYD J;  2FQ4 A;  2ECB A;  2JK3 A;  1XS9 A;  2X6O A;  2L7Z A;  2XSD C;  1OJL A;  2HDD A;  2HXI A;  2P81 A;  2LR8 A;  1X58 A;  3FK6 A;  1FIP A;  1NTC A;  1A5J A;  1JUP A;  1RPW A;  5C44 J;  3CCY A;  5IOY A;  1X2N A;  1S7E A;  1YRN A;  1BW5 A;  4DZJ A;  5HOD A;  4A3M J;  1P7J A;  2ZB9 A;  3BR2 A;  4HNV A;  5DS9 A;  2FJ1 A;  2ELK A;  1FEX A;  1HLV A;  1ETW A;  1HF0 A;  3DEW A;  1TC3 C;  1B8I B;  4CYC A;  3LNQ A;  1AKH A;  2RAE A;  3A01 B;  2DMT A;  1LE8 A;  1JUM A;  2JJ7 A;  2HOA A;  5EZG A;  1ZK8 A;  4FE4 A;  1WH5 A;  1QRY A;  1ETO A;  5F0F A;  1AHD P;  1JUS A;  2OPT A;  9ANT A;  1GDT A;  1ORK A;  1MBE A;  2IAI A;  3GTL J;  5FLM J;  2CUE A;  4A3K J;  4LOC A;  2DTZ A;  2L7F P;  1BJZ A;  1JTY A;  2O9L A;  4FIS A;  3H0G J;  3FKI J;  3S2D J;  2AHQ A;  2DA1 A;  4X6A J;  3B6C A;  2CQQ A;  4D5F A;  4XRM A;  1H88 C;  1BA5 A;  3S16 J;  5E3N A;  1BL0 A;  2YUS A;  3A02 A;  2NVY J;  2CRG A; 
#chains in the Genus database with same CATH topology
 2KHM A;  3I59 B;  3V4G A;  4CZZ A;  4F55 A;  5M5Y J;  3CCV I;  3CF5 F;  3LAP A;  1H9G A;  4KT6 A;  3I4M J;  3E97 A;  1UST A;  1YE9 A;  2V9V A;  1H9T A;  1N75 A;  3H92 A;  1Y8Q B;  1T98 A;  5LRS A;  2QQA A;  1MH3 A;  2M7A A;  4LK1 F;  1D1A A;  3RQ4 A;  4QLC U;  3G73 A;  2RQP A;  5JLW A;  4L5J A;  1HOM A;  2ZFU A;  2W25 A;  3V8J A;  4L9J A;  3A0B C;  3GBG A;  2LBF B;  4RLQ A;  1FP2 A;  1IRX A;  1RES A;  3H3V K;  1ITY A;  5K5Q A;  1K6O A;  1ZGJ A;  1R22 A;  3DPU A;  1TWG J;  1LUJ B;  1ON1 A;  2FML A;  1R36 A;  1BC7 C;  2AXT C;  1WZ2 A;  2HS5 A;  1B8I A;  3LA2 A;  3V7S A;  1F36 A;  5KK1 A;  4Y13 A;  3BCA A;  5M5W J;  3FHN A;  3KX2 A;  4RGX A;  1UHS A;  3IAM 2;  4IJA A;  1TBX A;  4PZJ A;  1LFU P;  1YO5 C;  4BY1 J;  2ZCW A;  1SAN A;  3SZP A;  3O2P E;  1W36 D;  2L54 A;  1ZAO A;  2KRC A;  3ERM A;  2O8X A;  3N97 A;  2N8G A;  2F5F A;  3TW7 A;  1VI0 A;  2M8E A;  1YIJ I;  4IOA F;  2Y0S N;  5EGO B;  1RI7 A;  1TQM A;  4E7Z A;  2E71 A;  4I99 C;  3AG4 H;  4KIF A;  2M45 A;  2COM A;  3FXM A;  1GV5 A;  2FRH A;  4G6Q A;  3TP0 A;  4BEH B;  2B7E A;  4RMN A;  1WJF A;  4QPQ A;  2Y69 H;  3KEQ A;  2PI0 A;  4DIQ A;  3BR3 A;  2KIQ A;  4ON0 A;  2EIM H;  1MBG A;  3QPT A;  5TGT A;  1R49 A;  2E7X A;  2EQR A;  3NWT A;  2NS0 A;  3TKY A;  5B3S H;  1P2F A;  3I58 A;  3JRG A;  2UXX A;  1I39 A;  3DQV C;  4IL6 C;  4PDK A;  1ETK A;  2KJC A;  3E3V A;  4DYR A;  3FDY A;  4RDU A;  4FTH A;  4MLO A;  2DA7 A;  2KRH A;  1SFX A;  2YU9 J;  3HUG B;  4CCJ A;  2K3F A;  5CQG A;  2BY0 A;  3HOY J;  4FE7 A;  1CF7 A;  3V8K A;  1QVU A;  4M3F A;  2FOW A;  5HOO A;  1ZHF A;  2VC0 A;  4ESB A;  3IC7 A;  1R6R A;  1R5I D;  4UUS B;  5CQE A;  2VBZ A;  1N78 A;  2JMW A;  5EEG A;  2VOD A;  2HKX A;  3O8H A;  3HJE A;  1U8R A;  4HX4 A;  3ZXS A;  2DPD A;  2OJE D;  4XRF A;  4BQQ A;  2DXI A;  3GFM A;  2V7F A;  4AIH A;  1SMT A;  2RNJ A;  1H89 C;  2ZXI A;  4JX4 A;  3F9K A;  1HKQ A;  4L9N A;  2B9S A;  2WBM A;  1FC3 A;  3PO2 J;  3I5U A;  3CJR B;  4KJZ A;  5K5R A;  1SVM A;  4XR6 A;  3HM5 A;  3VFZ A;  1OPC A;  4XLC A;  4DZP A;  2P6S A;  1YTY A;  4CCN A;  2L9S A;  1JI8 A;  2MGQ A;  5CPR B;  2ZJR F;  3AFH A;  3GVA A;  3U1D A;  4EJW A;  4LG0 B;  3IKV A;  2X0L A;  3TW6 A;  2O7O A;  3FF5 A;  3JRA A;  2JA8 J;  1U0J A;  1GVJ A;  2DMP A;  5HNF A;  4XLE A;  3V7R A;  2DMN A;  2FEZ A;  1QHH D;  1BN5 A;  3QPH A;  3FBI B;  2VC1 A;  3VWB A;  4BL0 B;  4I02 A;  5CLS A;  2MBF A;  2E1C A;  1UCR A;  2IGN A;  4DYC A;  2MLK A;  2Z99 A;  3OIP A;  1RNL A;  3QOE A;  5GAH J;  1R1U A;  5EF6 A;  4AYB N;  3ABU A;  1YIO A;  1R4N B;  2ESH A;  3ZMT A;  3RYP A;  4RGU A;  4AM3 A;  4EM0 B;  2RN7 A;  4KMU X;  2Y31 A;  1IC8 A;  5E17 F;  3OYB A;  3K2A A;  3M07 A;  2X51 A;  1X1B A;  3KE2 A;  4DJA A;  2Z1D A;  3OR1 C;  3S14 J;  1HSJ A;  3WTS C;  4M9Z A;  4LIV A;  4HF0 A;  1TTY A;  1V3F A;  4IXA A;  5K1Y A;  3BT9 A;  4F93 B;  2K02 A;  1BR2 A;  2FQ3 A;  3OS0 A;  2O61 A;  2JUC A;  3Q0V A;  2LLK A;  1VND A;  2ZSH B;  4XKW A;  2MA3 A;  2ISY A;  3KZY A;  4UUT A;  3IH4 A;  2MH2 A;  4IQJ A;  3ZQI A;  1XCV A;  2I8D A;  4PJ0 C;  4RGS A;  2GZW A;  3MCZ A;  1SFE A;  5DD4 A;  1K83 J;  2H27 A;  3K7A J;  5TIS C;  3OOP A;  3IV5 A;  3JRB A;  1TNT A;  3DEE A;  3WTW C;  2B63 J;  2G9W A;  4OOI A;  4YEJ A;  3FXQ A;  3B6A A;  1XX5 A;  3VYS B;  5LGN A;  2R7F A;  2A5W A;  4E6K G;  3EUK L;  2E60 A;  1VQK I;  2IRF G;  3ZCO A;  2HZT A;  1Y1W J;  1LJ9 A;  4HA8 A;  3Q0W A;  3BR0 A;  2M9H A;  5DD8 A;  1QZZ A;  2FA5 A;  3KLO A;  3PL8 A;  4HG2 A;  2CG4 A;  2IA0 A;  4B43 A;  5HDK A;  4DBR A;  6PAX A;  5DDG A;  1IN8 A;  4KN7 X;  3GO5 A;  5H20 A;  2KZV A;  4HLX A;  5FKK A;  4YIR X;  5GAG J;  4ZTF A;  2A5Y B;  2HOT A;  2QYO A;  1Y6I A;  4I76 A;  2HFH A;  3OV8 A;  1MKM A;  2R0Q C;  1QU3 A;  1XSV A;  4XIC A;  1NHA A;  1FT9 A;  1A04 A;  1YX3 A;  3E6B A;  4D5C A;  1APL C;  5LGU A;  4CCL A;  2K86 A;  3T1B A;  5LHH A;  2KDZ A;  2WY7 Q;  3E0J B;  3NAU A;  3HG9 A;  2H1K A;  2DA6 A;  5K7H A;  1JXS A;  3WG9 A;  3HOW J;  3QYB A;  4PCQ A;  2L5Q A;  3BJ6 A;  2HR3 A;  4GFB A;  2ECC A;  1LDJ A;  1OYY A;  2HYG D;  4S05 A;  4DNC A;  1P9Q C;  2KIU A;  4HF2 A;  1JJ6 C;  2EFP A;  3WTV C;  2Z2S B;  1TQI A;  4QPO A;  2E35 A;  3U9G A;  3AL0 B;  1D5V A;  3ZGK A;  4JBA A;  3ZP5 A;  1AOY A;  4ENM A;  3LSR A;  2NVX J;  2DQL A;  2VXZ A;  1E17 A;  3G2B A;  3AG1 H;  1BI1 A;  1SD4 A;  3BC8 A;  4KA4 A;  2EV5 A;  2O5R A;  2QA4 I;  1S29 A;  1G6N A;  3OYH A;  3JSO A;  1P4W A;  2CQX A;  2JZY A;  1G3Y A;  1FOK A;  5ILU A;  2VXD A;  1MW7 A;  3MKW B;  1MBJ A;  1KU7 A;  1B72 A;  2XKP A;  5FFZ A;  2ESN A;  1OMI A;  2IP2 A;  4EJV A;  5FJ8 J;  3HHG A;  2P4W A;  2XGE A;  2ZKZ A;  1T8I A;  1EH7 A;  2QM3 A;  2EZK A;  3DFG A;  4A0Y A;  3BZK A;  3L2W A;  1MJB A;  2MAB A;  1F4K A;  3REO A;  3MZH A;  3WHB A;  1ZG1 A;  3P5J A;  3JRH A;  2LD5 A;  2HEO A;  1EA3 A;  1GV2 A;  3HRU A;  2HYJ A;  4CIC A;  3W2W A;  2DOD A;  2ACJ A;  4QTR A;  3GEZ A;  3DTE A;  2VQH A;  1G2H A;  1Z91 A;  3HTU A;  2GIZ A;  2QBY B;  1LFB A;  4XLA A;  3K10 A;  3IAS 2;  1G3S A;  2D1V A;  5BQT A;  4LB6 B;  2GXA A;  2F2E A;  5FLX Z;  3ELK A;  3H5A A;  3CO6 C;  4DGW B;  5C4X J;  3CP2 A;  5F27 A;  4BH9 A;  4XRS A;  4B1R A;  3HOX J;  2R5Y A;  3ZQ7 A;  3I55 I;  1FY7 A;  4MEY F;  2RQQ A;  2LY2 A;  3ABK H;  3GF2 A;  1ZGW A;  2NOJ B;  2YU3 A;  4XMY A;  3CUO A;  4C2U A;  3DKY A;  4F52 A;  1IAW A;  4A3I J;  3LMM A;  3HPH A;  1K7A A;  4JX6 A;  4CYD A;  1OYI A;  1TQP A;  3O8G A;  1IXC A;  4A6D A;  3NWS A;  4RB2 C;  3KYD B;  1FPQ A;  4S0H B;  4XOP A;  2FX0 A;  1WJC A;  4GXO A;  4ANJ A;  5FRM A;  2AQF A;  2I10 A;  3HDD A;  2VQL A;  3EPZ A;  5FKM A;  3ZMU A;  5ED4 A;  3MWM A;  2DI3 A;  3IHU A;  3BG5 A;  2XB0 X;  2FBI A;  2ELH A;  1T6S A;  2F48 A;  3QYF A;  2V6C A;  3DF8 A;  5LGT A;  1PYV A;  2CUF A;  2DOE A;  3K70 C;  1NG7 A;  2LKP A;  2JPB A;  3HSF A;  3QOP A;  3EQL F;  4BGD A;  1V5E A;  5BPD A;  3TO6 A;  3I59 A;  3CCR I;  1TNS A;  1SFU A;  1H0M A;  4ZDP A;  2VL8 A;  4HAM A;  2XSD C;  1OJL A;  3CC4 I;  3LFU A;  1GHC A;  2HDD A;  2HXI A;  5AIP A;  4Y15 A;  3ROU A;  2P7V B;  2IS2 A;  2CS3 A;  5C44 J;  3BG7 A;  5FD6 A;  2MC3 A;  3OWT A;  4B44 A;  2CWE A;  1BW5 A;  4A3M J;  4BHC A;  5DS9 A;  2FJ1 A;  1YJW I;  5F1R A;  3VYR B;  3HRS A;  1ETW A;  3DEW A;  3TL4 X;  2EFO A;  3H3Z A;  4AD9 A;  3LNQ A;  1AKH A;  4E7L A;  2DMT A;  2VJJ A;  2JJ7 A;  1FMW A;  3CCS I;  2HOA A;  3W6K B;  1YW8 A;  4IZZ A;  2M4G A;  3TQN A;  4FE4 A;  4PK4 A;  4HPQ A;  1EV7 A;  3VSL A;  2RDP A;  1ERD A;  1Y0U A;  2ZME A;  4MNU A;  3ABT A;  1MBE A;  3GTL J;  3PSI A;  3VOD A;  3C3W A;  2CGP A;  3S1N J;  1FWZ A;  3K6G A;  4Y3O A;  2Z3Y A;  4JOM A;  3S8P A;  2AHQ A;  2YPR A;  3R0A A;  4D5F A;  4XRM A;  2IS4 A;  3K0L A;  1BA5 A;  1FOW A;  5E3N A;  2YUS A;  2R7V A;  3H3U A;  3OYC A;  3HL2 A;  2HVQ A;  2CV2 A;  3OS2 A;  3AG2 H;  3BTI A;  3GXO A;  2JA6 J;  1YW9 A;  4I0B A;  4L9V A;  5GAE J;  2XF6 A;  4G9Y A;  5ICE A;  2CJJ A;  3HKZ N;  1XB4 A;  2NAZ A;  3L2U A;  3J7Y J;  2OF7 A;  3JR9 A;  4LLL A;  1WQ2 A;  3P7N A;  1JKO C;  2LSO A;  2A68 F;  4AU7 A;  1VQ7 I;  4NC7 A;  2P7C B;  1T2K A;  3FX3 A;  4EJU A;  5D8K B;  4A12 A;  4DQ2 A;  2K9S A;  4B4C A;  1F43 A;  2X1D A;  4XLP F;  2QLZ A;  3J80 K;  3DWL E;  2AS5 F;  3ZQL A;  5H6R A;  2BV6 A;  3CCM I;  1Z6T A;  4EJT A;  2D1H A;  4A0X A;  4ASN A;  4BE0 A;  1PDN C;  3UNG C;  4MFD A;  3BG3 A;  4BU2 A;  1XSX A;  3C2G A;  4NQW A;  1O3T A;  4O3M A;  2HTS A;  3ZQQ A;  1T0F C;  1ZAR A;  3H9Q A;  1BI3 A;  2IA1 A;  2WV1 A;  4A3C J;  2ZME C;  1S8N A;  2NOG A;  4E7H A;  1ETX A;  2H8W A;  2HNH A;  1SMY F;  2Z5U A;  3R4K A;  1VF9 A;  3CDL A;  2BY3 A;  4UB6 C;  1R23 A;  4YEL A;  1WRJ A;  5D4S A;  1R9T J;  3RIR A;  2JQ7 A;  4XN3 A;  5B1A H;  2VOP A;  1ZTR A;  1QGP A;  4II3 A;  5L3G A;  4M3B A;  4H4K C;  1OLT A;  4HNT A;  5F08 A;  1DP3 A;  4IPA A;  3ZRG A;  4A3J J;  1FOY A;  2E5Z A;  4CH7 A;  3CQZ J;  4BNC A;  1IGN A;  1UJ8 A;  3WGH A;  4BBR J;  3T8T A;  3MN2 A;  4KFC A;  1FSH A;  2V9P A;  5IT9 K;  2COB A;  4PGH A;  2P5V A;  1WFX A;  2YX4 A;  2VJ4 A;  3CO7 C;  2AXL A;  3SZT A;  2OZU A;  3SEZ A;  2QQ8 A;  2IT0 A;  1W5S A;  2CFO A;  1MMD A;  4A3D J;  1Q1H A;  1VZ0 A;  1OR7 C;  2BW3 B;  2M5W A;  2XGX A;  1R5G A;  2A6H F;  3BRO A;  5BS6 A;  2DU9 A;  3ESW B;  3M9A A;  3JAM K;  3FK7 A;  2FU4 A;  1U9N A;  4E7S A;  3ZR8 X;  1IDZ A;  2OC6 A;  3C1D A;  1XMX A;  3HXL A;  1OCP A;  1HA8 A;  1B1B A;  1IRF A;  1SD7 A;  3QU6 A;  3CJQ B;  3OYN A;  5HS7 A;  1FYK A;  3KP4 A;  4K2E A;  2TDX A;  5E3L A;  1S72 I;  1RKW A;  2DCE A;  2VON A;  4EJO A;  3W6V A;  2HQN A;  2ADU A;  3OS1 A;  2R5Z B;  1K61 A;  2GA2 A;  4U7D A;  1U8B A;  3G1M A;  3KEO A;  2JA5 J;  1JJ8 C;  4C9Y A;  2VJI A;  1Z3Y A;  5F0C A;  5F6F A;  3HHH A;  1JKP C;  2CW7 A;  4ESJ A;  4GYG A;  3M7G A;  2HKO A;  3MD2 A;  1KA8 A;  1RKT A;  2B0L A;  3KP2 A;  1E0E A;  2Q0O A;  2TRT A;  3G6E I;  2E34 A;  3ZOB A;  1KON A;  3HC7 A;  5DUK A;  3SHF A;  4LLG F;  2GBY A;  3RQI A;  4II2 A;  4XKC A;  2LRE A;  4HRI A;  5DCM B;  3WTU C;  1RR8 C;  1IG7 A;  4Z6Y A;  2CW8 A;  3DPL C;  3LWF A;  1UB9 A;  4AWX B;  1P6R A;  1Y56 A;  1SD6 A;  2FD5 A;  3CES A;  3PJR A;  2JWT A;  1HDD C;  1Z3X A;  5KVR A;  2UWM A;  4I98 B;  1IN5 A;  1W0U A;  3P9I A;  2H8R A;  5EYR A;  3F22 A;  2PJR A;  2ZNY A;  3F23 A;  1TWC J;  2VBX A;  4U0Y A;  1R71 A;  2IEK A;  4V2F A;  4XLN F;  5JR3 A;  2DN0 A;  5K7Z A;  2Q2E B;  4BXU A;  1J59 A;  3KPH A;  1QVT A;  2BHZ A;  3BDD A;  2KKO A;  4Y33 A;  2A6T A;  3HZJ A;  5KCM A;  5AIQ A;  2CQK A;  2R7R A;  1BIA A;  3A0H C;  2BVM A;  4P1W A;  4Q47 A;  3DU6 A;  1STZ A;  4W1U A;  1ETV A;  4I6Z A;  2PG4 A;  1IXR C;  2P6T A;  3R60 A;  3R0J A;  5KNL A;  2LFB A;  1ZRE A;  1S7O A;  1IV6 A;  1O57 A;  2XGD A;  2F6C A;  4HV6 A;  5ILS A;  3DP7 A;  3HOU J;  3GCM A;  2ME0 A;  5D5V B;  1X1A A;  5GPA A;  5J1U A;  1SD5 A;  1XTA A;  1OCC H;  2ZXH A;  4ZYG A;  4PJM A;  5C3E J;  1HW1 A;  2W24 A;  5CKT A;  4LG3 A;  4CA0 A;  3BQY A;  1X2M A;  1GXQ A;  1MBF A;  5FLV A;  1LDD A;  1G59 A;  4G7Z F;  2WAF A;  2VB6 A;  3H36 A;  1PUF B;  4M3D A;  4C3I J;  5C4J J;  1POG A;  1ZR4 A;  1YS6 A;  3PIP F;  2OZ6 A;  3Q9V A;  3ISP A;  1E3P A;  1WI3 A;  3BPX A;  3DTI A;  2X9D A;  4HF1 A;  4MQ9 F;  3L7W A;  4B8X A;  3G1L A;  3W2A A;  2M2E A;  1ZG3 A;  1TW3 A;  4HOB A;  2M87 A;  2MSY A;  3ZQG A;  1K78 A;  4QIW N;  1R5H A;  2X6Y A;  3BJA A;  5F64 A;  1O3S A;  2D5V A;  2XVC A;  2G0E A;  5GP9 A;  3L2C A;  3SFZ A;  1IJW C;  4ETS A;  1W36 C;  3HOS A;  1TP4 A;  4A3F J;  2R7Z J;  2IPQ X;  4IRI A;  4IHS A;  1S3J A;  2STT A;  2DJN A;  2DQR A;  1U5T A;  2OV7 A;  3CC7 I;  4ZTJ A;  1UEL B;  4OAZ A;  4BE1 A;  3S1Q J;  3LL7 A;  2UZK A;  4CCK A;  4OIO F;  2M30 A;  1BI0 A;  2AO9 A;  4EMS A;  2OU2 A;  4OIN F;  3WE3 A;  1YI2 I;  4RA2 A;  5FB2 A;  4XQF A;  5F0H A;  2LNB A;  5DCF A;  3PQK A;  2YSR A;  2DA4 A;  4KIC A;  1D0Z A;  3CJN A;  2EA4 A;  4HQM A;  3JRI A;  5EG0 B;  1JGG A;  2FF4 A;  3MVP A;  2GOM A;  5L3C A;  1B59 A;  4M74 A;  2EV0 A;  1GUU A;  2W00 A;  1Z67 A;  3K1P A;  2P0W A;  3HIF A;  1S6L A;  3EYI A;  2CMP A;  4BY7 J;  1RC9 A;  3TO9 A;  4KNY A;  2JTV A;  2V4J C;  4CGZ A;  2E1M C;  2WV0 A;  3WGG A;  3GZ5 A;  4OMZ A;  3BPV A;  1HXD A;  1ZKG A;  2K4B A;  3L2R A;  1SEU A;  3SYT A;  2G7H A;  2BXY A;  2JT1 A;  1BW6 A;  5E8G A;  1X19 A;  1P92 A;  4DOZ A;  4M3G A;  3HOT A;  3MKY B;  3NEU A;  1ZH5 A;  4RBO A;  5BPI A;  3G71 I;  2KQR A;  4MTD A;  3KIO A;  2DFF A;  3WTT C;  3V8L A;  3E6D A;  3RPU A;  2XRL A;  3KZI C;  3MZY A;  2RV8 A;  2ID6 A;  3CF2 A;  3BR1 A;  3SFI A;  1DUX C;  4BJ6 C;  4G94 A;  2W48 A;  5JFR A;  5DUI A;  1PP8 F;  1D0Y A;  3JRF A;  3J7A O;  2QKL B;  3CMA I;  2VE8 A;  3BJO A;  2QF7 A;  3C18 A;  1U6G A;  3E1S A;  2VLA A;  3FM3 A;  3RPU D;  1A6I A;  2MW8 A;  3PNY A;  1D5Y A;  2M0C A;  2VPL A;  4A69 C;  1DU0 A;  1HQC A;  3CLQ A;  4L18 B;  2LH9 A;  2VN2 A;  3OIO A;  2XAF A;  3F8F A;  5J1Y A;  2PLY A;  3Q0U A;  3I71 A;  1BIB A;  2EIJ H;  5ICF A;  4MFE A;  3RKW A;  4ENN A;  3QYE A;  4BE2 A;  4MIM A;  3NRV A;  1YRN B;  4JP0 A;  2QVO A;  3WHC A;  1FSE A;  3RKQ A;  3F8B A;  5E20 A;  5HLH A;  3CC2 I;  4EGY A;  1T08 B;  3EUH A;  4ABZ A;  3IL2 A;  4CYC B;  5LEK A;  5K7F A;  2EIK H;  3K4B A;  2XIG A;  1FBQ A;  3OIQ A;  2M34 A;  5ILV A;  3RI4 A;  3Q5F A;  1YJ9 I;  5D8L B;  4XK4 A;  5J47 A;  4BQA A;  2JSC A;  4FHT A;  1JHF A;  2MFZ A;  1YOV B;  2HZD A;  1RR7 A;  1ULY A;  3LA3 A;  3GWZ A;  3GLL A;  2I5U A;  1OQY A;  4S04 A;  2VT2 A;  2X6W A;  3BLY A;  3LSJ A;  4U0W A;  4OIP F;  4L9T A;  4HLY A;  4R1H A;  2Y75 A;  4RS8 A;  1G8X A;  4YG2 F;  1SC7 A;  4A3G J;  3H9G A;  3NAR A;  1IF1 A;  3KCC A;  3OYF A;  3WU0 A;  4U7B A;  2EIL H;  1KQ0 A;  3B02 A;  3DPT A;  4PJJ A;  3ZMV A;  1NK3 P;  4EM2 A;  4ZYH A;  1WJD A;  1EF4 A;  1UHW A;  1KU2 A;  3K4M A;  4ZDL A;  3DKX A;  3A2K A;  1AA7 A;  1VQN I;  4A6E A;  1W7P A;  3MQ0 A;  1JT6 A;  3QQA A;  1MNM C;  3JTH A;  2QSG X;  2ZJ2 A;  3FKJ A;  5IP7 J;  4ZDO A;  2KP6 A;  3ZQC A;  2DAO A;  2XPU A;  3ML6 A;  2FE3 A;  4I09 A;  1SAX A;  2BY1 A;  1MZB A;  5J4V A;  3OYA A;  1MMN A;  5IYD J;  2A69 F;  5CVR A;  5CVJ A;  4PUS A;  1WJ5 A;  2XUB A;  3RDI A;  1MNE A;  2W7N A;  1TL8 A;  1XDS A;  2OD5 A;  4RAY A;  3W6J B;  1WHU A;  4M9S A;  3TMO A;  1VQO I;  1W7P D;  4DBQ A;  4R79 A;  1ZGA A;  2PMH A;  1L3L A;  1B4A A;  3FK6 A;  1FIP A;  1A5J A;  4E7I A;  5IOY A;  4YFN F;  3WE2 A;  4DZJ A;  4WXH A;  5JVG F;  4JK1 X;  5HOD A;  1P7J A;  3BR2 A;  2FXA A;  1V4R A;  3M8J A;  1HLV A;  1I5Z A;  5JVT A;  2K7L A;  2P5L C;  1B8I B;  1VQL I;  1EH8 A;  2EJR A;  3QOD A;  1KYZ A;  5B66 C;  1LE8 A;  3LAJ A;  4I2O A;  3E5U A;  2PMZ A;  4HX7 A;  5EZG A;  1MJA A;  4LD5 A;  1ZK8 A;  3M1E A;  1IO2 A;  2DW4 A;  2OQR A;  2JUG A;  2XDV A;  3OYI A;  1EJ9 A;  1VQ4 I;  4WXD A;  1R58 A;  1YHQ I;  1ORK A;  1PP7 U;  4I0A A;  2QKM B;  1KU3 A;  1TW2 A;  2CUE A;  2KFD A;  3J7A Y;  5FRO A;  1YLF A;  4A3K J;  1MMA A;  4LOC A;  4ZH4 F;  3CCE I;  3H0G J;  1KGS A;  2E1M B;  2XAQ A;  3O6B B;  1Z1D A;  2BZT A;  1FBU A;  3K4K A;  2CQQ A;  1YIT I;  4X6A J;  3S16 J;  3KEY A;  3K4C A;  1R00 A;  4WXC A;  3MFK A;  4E7J A;  3D5S C;  3F72 A;  2NVY J;  3BG9 A;  2EV6 A;  3TP3 A;  4ENJ A;  5J8C A;  3IRR A;  3VEP A;  5CJ9 A;  5K5O A;  1BJA A;  3KP6 A;  4Y52 J;  3F8N A;  3CUQ A;  2XAS A;  1JT0 A;  2J5O A;  3LSK A;  4M73 A;  4MTE A;  1HW2 A;  1CF7 B;  3HB9 A;  4NHJ A;  2CUZ A;  2CO5 A;  1MBK A;  3VSK A;  2LDU A;  2GWR A;  1FLI A;  2L9R A;  2W1O A;  1V54 H;  2XV4 S;  1N77 A;  2JSP A;  5IP9 J;  1B6A A;  2X48 A;  4C3H J;  3LSP A;  4MQV A;  4OU0 A;  2EA2 A;  5D4R A;  1WJB A;  1GT0 C;  3PQJ A;  3N05 A;  4KIB A;  2VOO A;  4TV7 A;  3I64 A;  2KT0 A;  2QQ9 A;  2FBK A;  4WX9 A;  2X1E A;  1FX7 A;  5D6E A;  1GVD A;  2MG4 A;  4XRS G;  3M1C A;  4CCO A;  4RM3 A;  2XPW A;  5GAD J;  3ERE D;  3HSE A;  4NB5 A;  4XOR A;  5L3E A;  5E3O A;  3GX4 X;  2W85 A;  5FGM A;  4BXX J;  3PFY A;  5DM6 F;  4M3E A;  1UMQ A;  1MDM A;  2NVT J;  3GTO J;  2R4G A;  3HGG A;  1KZH A;  5D5X B;  4FX0 A;  4BHP A;  3E5Q A;  4DW6 A;  3X2Q H;  3WGI A;  2E2H J;  5J6X A;  4M6V A;  3ASN H;  3HPG A;  5DCM A;  1X3U A;  2DFH A;  2LKX A;  4M6X A;  2E1O A;  4P9U A;  4KMF A;  3H5R A;  3L9F A;  3S15 J;  3FMR A;  3AAF A;  3FXU A;  5EJC A;  2L7M P;  3E6M A;  1UFM A;  3R61 A;  3EUA A;  1LVK A;  1ACI A;  2FSW A;  1ENH A;  3DBR B;  2NVQ J;  1TWF J;  4L0Z B;  2XAG A;  2Q2E A;  4PJL A;  5D6F A;  3JCU C;  1JHH A;  1YYV A;  5HLG A;  1IZ1 A;  4N0B A;  4HV5 A;  3ULQ B;  3SQN A;  5AON A;  2K4J A;  2EK5 A;  3WG7 H;  5M5X J;  5B1B H;  1SAU A;  2HTJ A;  2LBF A;  3I9V 2;  4UHT A;  2KLO A;  4L0Y B;  2EBI A;  3CP8 A;  2EB7 A;  3QWL A;  2K5C A;  1QZY A;  1T33 A;  2WB1 N;  1DU6 A;  2HDC A;  2IS1 A;  1YS7 A;  1K79 A;  1Z9C A;  4RB0 A;  2QUF A;  1SVO A;  3E7L A;  4A5M A;  3K4N A;  4V2G A;  5FRN A;  1ZN2 A;  3L09 A;  5DYM A;  2GLO A;  3F0C A;  4IHT A;  1MD0 A;  3U1K A;  2D45 A;  2L9V A;  1WH7 A;  3I0T A;  1WKM A;  1WI9 A;  4G6T B;  5EEA A;  2EFN A;  4EVI A;  2JA2 A;  3U21 A;  4D7N A;  4LGW A;  5DEQ A;  5EGO A;  2A6E F;  3ECO A;  2Y48 A;  4UUV A;  3BZ6 A;  1WWX A;  5KAI C;  4ZYE A;  1Q1V A;  3SDG A;  4AC0 A;  1XGN A;  2W84 A;  2NVU B;  4BEH A;  5E1X A;  4ZC3 A;  2R92 J;  2C6Y A;  1IDY A;  3GTG J;  3WU2 C;  1SVL A;  1D8J A;  1R4M B;  1J7K A;  2L7K A;  4P96 A;  4BHB A;  4NNJ A;  3K1N A;  3KP5 A;  2LKS A;  2WB1 A;  1Z0X A;  3OL4 A;  3FMQ A;  2H1L A;  3GTM J;  2LG4 A;  1MSF C;  2W4S A;  1QQI A;  1P4A A;  2QCO A;  3GLX A;  3LSG A;  2QGU A;  4XKV A;  3HUG A;  1FNN A;  1WJA A;  2E1N A;  4DYQ A;  2BGC A;  1HC8 A;  5FD5 A;  4D1Q A;  2XB5 A;  4OWR B;  2V1X A;  1F9N A;  2UV1 A;  1J75 A;  1EKE A;  1OCT C;  5LRR A;  4UUS A;  1ZLK A;  4C3J J;  2V26 A;  1BOB A;  3Q3S A;  4F91 B;  3E6C C;  4NUB A;  1LQ1 A;  5JLX A;  2UUZ A;  1O4X A;  4NBQ A;  2DYS H;  2GAU A;  2R7S A;  2CYY A;  4MEX F;  1V5F A;  2A61 A;  3ZQF A;  2DA5 A;  3TOB A;  1DDN A;  2CW0 F;  1S9H A;  1WSU A;  4B47 A;  4BAY A;  2A3S A;  3G3Z A;  3ONQ A;  1MMS A;  5H6Q A;  2OCC H;  2ZFW A;  1J2X A;  5LHG A;  1ZG5 A;  1RUO A;  5HDG A;  4IO9 F;  1ODD A;  2F4I A;  3S1R J;  2WAE A;  2ISZ A;  2VUM J;  3D0S A;  3ZQH A;  1TLH B;  4O5V A;  3VYT B;  3ECH A;  3HSR A;  1TWH J;  2O0Y A;  2P8T A;  3K69 A;  3P9K A;  5FO5 A;  3V42 A;  4A0Z A;  3LSH A;  1LPQ A;  1XN7 A;  5A2Q Z;  4LG0 A;  3CCQ I;  4N9H A;  3FZV A;  3LQR A;  3FXK A;  1ZRC A;  3CD6 I;  4CXF A;  2OCE A;  1T56 A;  3L2V A;  5JHU A;  5M3M J;  1A31 A;  1B72 B;  1RET A;  2IGK A;  3J7Z I;  4KDP A;  2XF7 A;  2V1U A;  3QAH A;  4J01 A;  4IHV A;  3DCF A;  2W57 A;  5E1Z B;  3WU1 B;  3PFI A;  3TDU C;  5LFA A;  2KIS A;  1KQ9 A;  2OBP A;  1FBS A;  3GTK J;  4BYY A;  1J0R A;  1G3T A;  1ZRD A;  2DK8 A;  2UXN A;  1Z7L A;  2A05 A;  2M0M A;  4Y4R A;  2XC7 A;  2WTE A;  2MH9 A;  1HDP A;  2HVR A;  1U9O A;  5IY5 H;  3PO3 J;  4IHY A;  1W4M A;  3MKZ A;  3DLL F;  1HBX G;  1A36 A;  2QZ8 A;  1Y1V J;  4CDG A;  3HBL A;  3CCJ I;  2JPC A;  3L00 A;  2Q8K A;  3KLN A;  4J19 A;  1R7J A;  2H09 A;  3DTK A;  3TGN A;  4XLF A;  1LFP A;  4OIQ F;  1J09 A;  2QSH X;  1RUN A;  1ZQ3 P;  2DOA A;  4M72 A;  3A4C A;  2ID3 A;  2HPM A;  2LC2 A;  3DEU A;  2Y30 A;  3H0D A;  1QO0 D;  3I53 A;  4IX7 A;  1H8A C;  4BBS J;  1LEA A;  4D9J A;  2DT6 A;  4PJN A;  2R5Y B;  4UY8 I;  1OYW A;  2L01 A;  2ZNZ A;  2PMU A;  3LQQ A;  2P5K A;  3V7C A;  2Y0M A;  3D1N I;  2M7B A;  1REP C;  3IH2 A;  3CCL I;  2R3S A;  3TDZ C;  1DGR M;  2XRN A;  3TOA A;  2IXS A;  1FYM A;  2BXZ A;  1FTZ A;  1QBJ A;  4YIF A;  3K2Z A;  2F5E A;  3A1Y A;  4PFP A;  3BR5 A;  3W3C A;  2JVG A;  3MMY B;  1W5T A;  4BXF A;  1RIO H;  4LK0 F;  5IPA A;  1VQ6 I;  2X6X A;  1U2W A;  3G4S I;  4KYW A;  1MIJ A;  2K9Q A;  2FUG 2;  3FMS A;  4NC6 A;  2OTL I;  3GME A;  3F6V A;  4ZYD A;  2E2J J;  1QHG A;  1IRG A;  2HWV A;  2DMQ A;  2KJB A;  3KFW X;  4KT5 C;  3BOQ A;  4G7H F;  2ZXW H;  2XPV A;  3FXJ A;  1WPK A;  5EZH A;  2CSO A;  1I6H J;  1E2X A;  1T38 A;  2J5P A;  4XN0 A;  5E79 C;  3MKL A;  5J3L A;  3H9J A;  2M3A A;  2RNG A;  2PFB A;  4CO8 A;  2R7Q A;  1I50 J;  2HVS A;  1IV8 A;  1K4S A;  3P9C A;  5EDN A;  3PNT A;  5CYV A;  2VKE A;  3GTP J;  1XG1 A;  2FNA A;  4IF4 A;  2GA1 A;  5J1R A;  5E3M A;  1ONV A;  2HOE A;  1I3Q J;  1D0X A;  2XHK A;  3BTJ A;  3OR2 C;  3OYD A;  2DJI A;  4RAZ A;  4E4H A;  3FXL A;  1TT0 A;  4Q5S F;  1LB2 A;  3UR3 C;  5CVI A;  1G4D A;  1F1Z A;  4G7O F;  4BAC A;  3NQO A;  2RC4 A;  3JTG A;  1UHM A;  1AKH B;  1JKR C;  2WY8 Q;  3RPQ A;  4E70 A;  2VQG A;  1WGX A;  2BE5 F;  3O3K A;  4GDF A;  2EZI A;  2MD0 A;  5FKN A;  5J40 A;  3D5L A;  1L0O C;  2BVL A;  3SJM A;  1WJE A;  3FBN B;  5FKO A;  2YR2 A;  1E3O C;  3QPS A;  1D8K A;  3M4O J;  2HYF A;  1BOA A;  2EZH A;  3BTC A;  1ETY A;  2ZME B;  2HOS A;  2GOX B;  3BZC A;  4CZC A;  4FET A;  3F8C A;  4BKX A;  4EEF G;  2PBI A;  5CVV A;  1T95 A;  1FZP B;  1QPI A;  1CQT A;  4JYK A;  2DYR H;  1HKT A;  3LSM A;  3I3L A;  4PFO A;  1MGT A;  2EWN A;  5FLX K;  2OTJ I;  4EV0 A;  3GZ6 A;  2XKO A;  2XGC A;  2MLG A;  2HXO A;  3IKT A;  4WK8 F;  2ZXJ A;  3RYR A;  4X0G A;  2VQC A;  3EDP A;  3FIS A;  3HGY A;  4IHW A;  4XL9 A;  3DBH B;  4GCV A;  5ICG A;  2FQ4 A;  4EM1 A;  2ECB A;  1I27 A;  3F21 A;  4LMY A;  1RZ4 A;  3IUO A;  2JK3 A;  1XS9 A;  2X6O A;  4YFX F;  2IGM A;  2IJL A;  1D3Y A;  5FFX A;  1A6Q A;  2LR8 A;  1R1T A;  2GXG A;  1NTC A;  1JUP A;  2KMU A;  1RPW A;  3S93 A;  3T5X A;  3AKZ A;  3BY6 A;  3CCY A;  1X2N A;  3KYC B;  2K3P A;  5TJJ A;  1BR4 A;  2QBY A;  2Y0S A;  2ZB9 A;  2CFX A;  4NC8 A;  4NQW B;  4RB3 C;  2ELK A;  3PUB A;  3AL0 C;  1FEX A;  3F6O A;  2KIF A;  3KZZ A;  3TBI A;  2R7O A;  3WTY C;  3KET A;  2EIN H;  1TC3 C;  3K9T A;  3SEQ A;  1C0W A;  3A01 B;  3OYM A;  3DLA A;  1W5C C;  3VDX A;  1FYL A;  1JUM A;  4AVP A;  1FOX A;  2BOL A;  4RB1 A;  2M1B A;  1DGW Y;  2QEX I;  1PUE E;  4M6Y A;  1E3H A;  1QRY A;  2HPI A;  3DXJ F;  5F0F A;  2IGO A;  4CHU A;  2QSF X;  3S3M A;  1UZC A;  1YG2 A;  2OPT A;  3WTZ A;  9ANT A;  1XD7 A;  1GDT A;  1U5T C;  1RRJ A;  2PQ8 A;  3CLO A;  4OIR F;  3GFI A;  2NNN A;  3CZ6 A;  4GYI A;  1YX5 A;  2VKD A;  5B5E C;  1BR1 A;  1X1C A;  2DTZ A;  3HRT A;  2KZG A;  4FIS A;  2DOF A;  1Y0N A;  3S2D J;  1I1S A;  1I3A A;  3JW4 A;  3J80 Z;  2DA1 A;  1D1C A;  4ZJZ A;  3B6C A;  4LB5 A;  5DV5 A;  5D5U B;  2Z9O A;  1H88 C;  1D1B A;  3OYJ A;  1VQP I;  1PJR A;  1XMA A;  1BL0 A;  2OA4 A;  3MAJ A;  3A02 A;  1YJN I;  4HDV A;  5KHD A;  3RZO J;  2V1N A;  5L3B A;  3HEF A;  1A35 A;  1OKR A;  4UVB A;  4A5N A;  4Q4Z F;  2DTR A;  4Z2Y A;  2H94 A;  3CMY A;  2VKV A;  3GTQ J;  3D5R C;  3N4M A;  2LF7 A;  3GTJ J;  1O7L A;  4U87 A;  3SXY A;  3S3N A;  4C2T A;  5H2F C;  3OL3 A;  1SFO J;  5HS9 A;  2MYS A;  3JRD A;  5BMZ A;  3JSP A;  3I4P A;  2XSJ C;  2F5D A;  5HLI A;  4C30 A;  1KYW A;  2Z16 A;  1GXP A;  1Z7U A;  5IP6 A;  3OOU A;  3CME I;  5BOX A;  5IOZ A;  4X1E A;  4XBF A;  5IT9 Z;  4JX5 A;  4UV9 A;  3CCU I;  3I54 A;  2XAJ A;  5GPC A;  2K9L A;  2MD5 A;  3S2H J;  1LKX A;  4UVC A;  3GUD A;  4HX8 A;  1MMG A;  3WOD F;  2F5C A;  3HOV J;  1HST A;  4I01 A;  2DK5 A;  2ME6 A;  2R7W A;  3I4N J;  1BM9 A;  4WF2 A;  3JAM Z;  2LYC A;  3BWG A;  1K6Y A;  1ZEL A;  1UG0 A;  2F5V A;  1S5L C;  1K4T A;  3H1C A;  1BBY A;  3IH3 A;  1XGS A;  3K4J A;  4A3L J;  4AYB A;  5DM7 F;  2NYX A;  3U2R A;  4HDU A;  1GLN A;  3RCO A;  5E8I A;  2PMZ N;  2PJR B;  3RKY A;  2DFE A;  4FQG A;  4IRG A;  4OMY A;  2ZO4 A;  2L4A A;  4UXN A;  1YW7 A;  3IWF A;  3ABM H;  4EGZ A;  2KRF A;  1MJ9 A;  2WAQ N;  1FMV A;  3EUH C;  4D0P A;  1IW7 F;  2DMU A;  1UG2 A;  1X3W B;  2E19 A;  3OSF A;  2K9N A;  4PSW A;  2JRM A;  2VI6 A;  2ICW G;  2DFI A;  2L9N A;  1XDU A;  4Y17 A;  3QRF F;  2O8K A;  5BNG A;  4HEA 2;  1R1V A;  3J81 Z;  2PEX A;  3R6S A;  3SDB A;  2QWW A;  2A07 F;  2LK2 A;  5A2Q K;  3S17 J;  3ZMS A;  4BUP A;  5JHF A;  2PJP A;  1MSE C;  2BY2 A;  1U3E M;  4UV8 A;  4FCY A;  4A93 J;  4CCM A;  2XRO A;  1V55 H;  1LVA A;  4ESF A;  1ETQ A;  1OFC X;  2CQN A;  3FWE A;  1KQ8 A;  1ZRF A;  4IRH A;  4LFU A;  2BBY A;  4LIT A;  2VBW A;  5M3F J;  2K40 A;  4A3B J;  2F4M B;  1JTX A;  3ASO H;  4BS9 A;  2WAQ A;  3UKG A;  1XGO A;  4WCG A;  2XAU A;  4CUG A;  5LHI A;  5HS8 A;  5IT3 A;  1T39 A;  3BR6 A;  1I1G A;  4GO1 A;  5GTI C;  1WCM J;  2QEN A;  2O6G E;  2EZL A;  1I6X A;  1Z6R A;  2DA2 A;  1W0T A;  1QZE A;  1TZL A;  2OQG A;  2NRA C;  1IUY A;  4U0V A;  4AID A;  1Z77 A;  4B09 A;  3S2W A;  3HTS B;  2GIV A;  5L3F A;  1DPU A;  2NS7 A;  3GW2 A;  4MHG A;  1K78 B;  3TO7 A;  2L02 A;  1O3Q A;  2ELJ A;  3LOC A;  2DPU A;  1P4X A;  2PX9 A;  3PSF A;  1VQM I;  3PNV A;  3BG6 A;  2XAH A;  4B3X A;  4FX4 A;  4XKB A;  2WC2 A;  4YFK F;  2BW3 A;  2WAD A;  2NNY A;  2GXB A;  1CGP A;  1XPX A;  3CJT B;  3FXR A;  1MH4 A;  4HZF A;  1U5T B;  5J4Y A;  4LJZ F;  4KN4 X;  1ZLJ A;  4QWQ A;  3M8E A;  1N25 A;  4B3A A;  3T8R A;  2HI3 A;  3BTL A;  1VQ8 I;  4BQO A;  1NG6 A;  3ZMZ A;  3VYU B;  2EFQ A;  1G3W A;  2K85 A;  3M8F A;  3LSI A;  4A3E J;  2OAZ A;  2R5Z A;  1ON2 A;  3E5X A;  3ZPL A;  5E1W A;  2FBH A;  4N4N B;  4XON A;  2STW A;  1QPM A;  1X4P A;  2RRE A;  3LA7 A;  1YQA A;  4UB8 C;  2DBB A;  3OMY A;  1NH3 A;  1X3Z B;  3RSN A;  3K4L A;  4FT8 A;  2K9M A;  3RJP A;  3PUF A;  3FHZ A;  3H5N A;  4XM3 A;  1TT5 B;  5LLQ A;  1J5Y A;  2CUJ A;  3Q9S A;  3KP7 A;  5D5W B;  2RGV A;  4AIK A;  5E18 F;  4BQN A;  1AU7 A;  2R93 J;  1XC5 A;  2L3D A;  2H6B A;  2GQQ A;  2IA2 A;  1JKQ C;  5KAF C;  3S32 A;  1B9M A;  2AQE A;  3K70 D;  5LBQ A;  2E36 A;  3K1M A;  3OYK A;  2LY9 A;  3CUQ C;  2E2I J;  2VKH A;  3I56 I;  3IWZ A;  2VBY A;  1WVR A;  2Y9Y A;  1DQU A;  2IVM A;  1FTT A;  3HRM A;  2Q1Z B;  1W1W E;  1OCZ H;  2DDA A;  2EH3 A;  3PM1 A;  4KIG A;  1IXS B;  2L2O A;  2M8G X;  2VPR A;  1KU9 A;  4P9F A;  2BEO A;  2X1C A;  4C2M J;  5HVQ C;  2HGC A;  3S1M J;  2X4H A;  2F4O B;  4PSX A;  2YS9 A;  5DTD A;  2R7D A;  2VAS A;  2VE9 A;  4AIJ A;  2LVS A;  4HBL A;  4F7Z A;  3DBL B;  3DV8 A;  4Y7N J;  3IRQ A;  1AWC A;  1QA6 A;  4F3Q A;  2EFW A;  1OCR H;  1QNT A;  3QU3 A;  4UVA A;  4XSX F;  2PN6 A;  1Y39 A;  4BDZ A;  1BC8 C;  2DDB A;  2VJ5 A;  3F8M A;  2V9K A;  1DPR A;  1LDK B;  2KL4 A;  4BDY A;  1U78 A;  4V19 K;  1BI2 A;  4IHX A;  2ETH A;  4HSR A;  3WTX C;  3KP3 A;  3GZN B;  4F92 B;  2V6E A;  4IOC F;  2NS8 A;  1X4O A;  2CQ7 A;  2FOK A;  5TRD A;  1YFH A;  3QP5 A;  4B48 A;  1OCO H;  2LRD A;  2TCT A;  4YRV A;  1ZR2 A;  1HCR A;  5FKL A;  3L2Q A;  5IYB J;  2IBD A;  3W2V A;  3B73 A;  4IKF A;  1F5T A;  1ZYR F;  1PUF A;  2CH0 A;  4EQQ A;  3VOE A;  1IUF A;  2ZJP F;  3FM5 A;  4W97 A;  4NDL A;  2ZJQ F;  2LF8 A;  3L1P A;  3QPL A;  2RVC A;  1TWA J;  5F04 A;  3ZMD A;  2JN6 A;  2L4M A;  2R7X A;  3ABL H;  4E7K A;  3FIW A;  3RKX A;  1T0F A;  2EPF A;  2LOO A;  2O03 A;  1MBH A;  4LLN A;  4Q48 A;  3ZN0 A;  2KIM A;  3CDI A;  4AVZ A;  2E7W A;  3OYG A;  1B9N A;  1HW5 A;  4G6D A;  4MO7 A;  4H0E A;  4RGR A;  4ZYA A;  4D7M A;  4WWC A;  3JRE A;  1W7P B;  3QP6 A;  3T0Y A;  4IVN A;  5HDN A;  3OSG A;  3FXO A;  4HNU A;  1UAA A;  4GRI A;  2ZBK A;  3RTR A;  3BP8 A;  1NK2 P;  4HQE A;  4L5I A;  2Y9Z A;  2K27 A;  1JGS A;  2NXN B;  3CTA A;  4AUX A;  1IN4 A;  3JRC A;  2O3F A;  2DO7 A;  4YII A;  5LD2 C;  4KUM A;  1MND A;  4P5O A;  3CMM A;  5IYC J;  5EEH A;  3LST A;  2BHY A;  2V1D A;  2L0K A;  3LFK A;  3HOZ J;  3M3Y J;  2IW5 A;  4HYE A;  4XID A;  3MEX A;  1FJL A;  1LEB A;  2RKH A;  1OR7 A;  5EG0 A;  2V79 A;  1PVE A;  4XSZ F;  1X1P A;  4IEJ A;  4L5E A;  3PIO F;  2KDO A;  1P7I A;  2LMD A;  4ITV A;  2CV1 A;  1IRZ A;  1LE8 B;  4RAG A;  4RM2 A;  4BJ5 C;  1Z05 A;  4BJT A;  4A2U A;  4UNO A;  2JVH A;  3VPR A;  2HQ5 A;  3BQZ A;  3C2B A;  1Y8R B;  3A01 A;  4I7H A;  2DA3 A;  1HKS A;  1FIA A;  3A03 A;  5F1J A;  4ZZL A;  3F3X A;  2ZC2 A;  3GFL A;  3KYL A;  2OUM A;  4PGG A;  3HKZ A;  2WWY A;  2KPM A;  2QQB A;  2W82 A;  2LP0 A;  4HW0 A;  2GM4 A;  4J00 A;  1J9I A;  4G12 A;  2R7T A;  2IS6 A;  4IQ4 A;  2HU9 A;  3DKW A;  4O6J A;  4QSH A;  2HQA A;  2Y2Z A;  3DU5 A;  1S7A A;  2LY1 A;  2X85 A;  2XF5 A;  2JA7 J;  1X1D A;  1IN6 A;  1SFK A;  3C7J A;  4HST A;  3RZD J;  1VFC A;  2LTP A;  1XSD A;  3OY9 A;  2D2W A;  4MGR A;  3TED A;  4KIS A;  3G1O A;  5HNH A;  5J8F A;  1VQ5 I;  1VTN C;  3CUQ B;  1EH6 A;  1USS A;  2CU7 A;  2H6C A;  2MC4 A;  4JQF A;  3COA C;  2DLL A;  2M4K A;  3MZ8 A;  4M71 A;  4RAF A;  1Z21 A;  5L3D A;  3BCB A;  3EYY A;  4RLF A;  3ZN1 A;  1IN7 A;  1VQ9 I;  2WA0 A;  2L7Z A;  4G8X A;  1DP7 P;  3C2H A;  4N9I A;  4P55 A;  3CDH A;  2G7U A;  2P81 A;  1X58 A;  1O3R A;  2VIX A;  2BYV E;  5CVU A;  1S7E A;  1YRN A;  4M9X A;  3OYE A;  4HNV A;  4R8H A;  1HF0 A;  3GFJ A;  3VB2 A;  3IP4 B;  1V5G A;  1O7F A;  4CYC A;  2RAE A;  4FAS D;  3S3O A;  4CSW A;  2ZSI B;  2E5N A;  2HQR A;  5JI6 A;  3SZG A;  3EET A;  1WH5 A;  1FP1 D;  1ETO A;  2JRT A;  1MDM B;  1AHD P;  5LEJ A;  1JUS A;  1XCB A;  1OIS A;  5ERI A;  4XOT A;  4EAT A;  1XMK A;  2IAI A;  4ENK A;  4N4O B;  3J81 K;  5FLM J;  1LNW A;  3OYL A;  4XLH A;  4KIT B;  4GGG A;  1M1E B;  1XGM A;  4LIU A;  2FNP A;  2L7F P;  1BJZ A;  1JTY A;  5GTH C;  3HYI A;  2CV0 A;  2O9L A;  2YX7 A;  3AG3 H;  3FKI J;  3H35 A;  2FMY A;  4U88 A;  4ZZD A;  3GYH X;  2R7U A;  2VT3 A;  2DT7 B;  2DT5 A;  4OAY A;  5ICC A;  2Z33 A;  4XNF A;  2HDW A;  5HLT A;  1JE8 A;  2CRG A; 
#chains in the Genus database with same CATH homology
 3BG9 A;  3RZO J;  5M5Y J;  3TP3 A;  3HEF A;  3BTI A;  2JA6 J;  3I4M J;  3CMY A;  2VKV A;  3GTQ J;  2CJJ A;  4Y52 J;  3HKZ N;  3GTJ J;  1JT0 A;  2OF7 A;  3JR9 A;  1MH3 A;  1JKO C;  1SFO J;  3HB9 A;  3JRD A;  1MBK A;  5JLW A;  2L9R A;  2K9S A;  1HOM A;  4B4C A;  1F43 A;  5IP9 J;  3GBG A;  5IP6 A;  4C3H J;  2X48 A;  3ZQL A;  3OOU A;  3LSP A;  4MFD A;  3H3V K;  1RES A;  1ITY A;  3BG3 A;  5IOZ A;  1TWG J;  4X1E A;  1GT0 C;  4JX5 A;  2WV1 A;  4A3C J;  1B8I A;  2NOG A;  2KT0 A;  5GPC A;  1ETX A;  1F36 A;  3S2H J;  1GVD A;  2MG4 A;  4XRS G;  5M5W J;  4BY1 J;  1UHS A;  1VF9 A;  3S1N J;  3CDL A;  1LFU P;  2XPW A;  1SAN A;  1R9T J;  3HOV J;  5E3O A;  1ZTR A;  4BXX J;  4M3B A;  2ME6 A;  4M3E A;  1UMQ A;  3I4N J;  5F08 A;  2N8G A;  3TW7 A;  1VI0 A;  4A3J J;  2Y0S N;  5EGO B;  2NVT J;  3GTO J;  3HGG A;  3CQZ J;  4DW6 A;  1IGN A;  3IH3 A;  4BBR J;  2E2H J;  3MN2 A;  4A3L J;  4M6V A;  1GV5 A;  3TP0 A;  2COB A;  2LKX A;  2PMZ N;  2E1O A;  3BR3 A;  1MBG A;  2EQR A;  4A3D J;  3S15 J;  2WAQ N;  2L7M P;  3JRG A;  4DYR A;  1ETK A;  1ENH A;  2NVQ J;  4RDU A;  1TWF J;  1UG2 A;  2DMU A;  4FTH A;  2E19 A;  3FK7 A;  1U9N A;  4MLO A;  2DA7 A;  2K9N A;  3OSF A;  2YU9 J;  1IDZ A;  2VI6 A;  1OCP A;  3HOY J;  4FE7 A;  1QVU A;  4M3F A;  2O8K A;  5BNG A;  5E3L A;  1RKW A;  3W6V A;  2LK2 A;  5M5X J;  4UUS B;  2R5Z B;  1K61 A;  3S17 J;  1U8B A;  2JMW A;  3G1M A;  2EBI A;  3O8H A;  2JA5 J;  1MSE C;  1T33 A;  2WB1 N;  4FCY A;  4A93 J;  1JJ8 C;  1DU6 A;  5F0C A;  1ETQ A;  1OFC X;  1JKP C;  1H89 C;  4JX4 A;  3E7L A;  5M3F J;  1RKT A;  3PO2 J;  2K40 A;  4V2G A;  4A3B J;  1JTX A;  2GLO A;  3UKG A;  2TRT A;  3F0C A;  3ZOB A;  1WH7 A;  3HM5 A;  3BR6 A;  4DZP A;  5EEA A;  2GBY A;  4D7N A;  3RQI A;  1WCM J;  2MGQ A;  5EGO A;  2EZL A;  1IG7 A;  2DA2 A;  1W0T A;  3TW6 A;  2O7O A;  1Q1V A;  2FD5 A;  3SDG A;  1Z77 A;  4AC0 A;  3JRA A;  2JWT A;  1HDD C;  2JA8 J;  2NS7 A;  2DMP A;  2R92 J;  1IDY A;  1W0U A;  3GTG J;  3LOC A;  2H8R A;  5EYR A;  2DMN A;  1Z0X A;  1TWC J;  2IEK A;  4V2F A;  2DN0 A;  5K7Z A;  3GTM J;  1MH4 A;  1MSF C;  1QVT A;  4DYC A;  5EF6 A;  4AYB N;  2QCO A;  3LSG A;  4DYQ A;  4B3A A;  2HI3 A;  3BTL A;  2Y31 A;  1IC8 A;  3K2A A;  4W1U A;  1ETV A;  2XB5 A;  4I6Z A;  3S14 J;  2LFB A;  1OCT C;  4UUS A;  4A3E J;  2R5Z A;  4C3J J;  1IV6 A;  3Q3S A;  2XGD A;  5JLX A;  3HOU J;  2ME0 A;  3BT9 A;  1O4X A;  5GPA A;  5J1U A;  5C3E J;  3Q0V A;  3ZQF A;  2LLK A;  2DA5 A;  1VND A;  3BQY A;  1X2M A;  1MBF A;  5FLV A;  4UUT A;  1AU7 A;  3IH4 A;  2R93 J;  1XC5 A;  3ZQI A;  1PUF B;  4M3D A;  4C3I J;  1JKQ C;  5C4J J;  1K83 J;  1POG A;  3S1R J;  1ZR4 A;  3K7A J;  2VUM J;  3ZQH A;  1WI3 A;  2X9D A;  3IV5 A;  3JRB A;  1TWH J;  2LY9 A;  3G1L A;  2E2I J;  2B63 J;  2M2E A;  2Y9Y A;  3B6A A;  1FTT A;  2MSY A;  3PM1 A;  3ZQG A;  2EH3 A;  2M8G X;  1T56 A;  2VPR A;  4QIW N;  4C2M J;  5M3M J;  1B72 B;  2D5V A;  1RET A;  1Y1W J;  3S1M J;  2G0E A;  5GP9 A;  3Q0W A;  1IJW C;  2YS9 A;  3BR0 A;  5DTD A;  2M9H A;  2LVS A;  4A3F J;  4IHV A;  2R7Z J;  3DCF A;  2DJN A;  4Y7N J;  3GTK J;  3S1Q J;  5FKK A;  1HDP A;  2AO9 A;  2HOT A;  1U9O A;  3PO3 J;  5F0H A;  4I76 A;  4IHY A;  2R0Q C;  2DA4 A;  4XIC A;  1Y1V J;  3JRI A;  1U78 A;  5EG0 B;  3HBL A;  3MVP A;  1JGG A;  4IHX A;  4D5C A;  1GUU A;  4J19 A;  1APL C;  2NS8 A;  2KDZ A;  1ZQ3 P;  3NAU A;  2H1K A;  2DA6 A;  2ID3 A;  4BY7 J;  5K7H A;  1H8A C;  4BBS J;  2Y30 A;  3HOW J;  2TCT A;  1ZR2 A;  4GFB A;  1HCR A;  2ECC A;  5FKL A;  1ZKG A;  5IYB J;  2R5Y B;  2IBD A;  1BW6 A;  1PUF A;  1JJ6 C;  4M3G A;  1IUF A;  4W97 A;  4NDL A;  4RBO A;  3L1P A;  3QPL A;  5F04 A;  1TWA J;  3D1N I;  3IH2 A;  3LSR A;  2JN6 A;  2NVX J;  3FIW A;  1FTZ A;  2XRL A;  1MBH A;  2ID6 A;  3BR5 A;  3BR1 A;  3SFI A;  4MO7 A;  3JRE A;  5IPA A;  4D7M A;  2CQX A;  2W48 A;  2K9Q A;  1MBJ A;  1B72 A;  3JRF A;  2E2J J;  3OSG A;  2DMQ A;  2QF7 A;  2XPV A;  1NK2 P;  5FJ8 J;  1WPK A;  5EZH A;  2XGE A;  1A6I A;  2Y9Z A;  1I6H J;  2MW8 A;  5J3L A;  3MKL A;  1D5Y A;  2EZK A;  2M0C A;  4AUX A;  4A69 C;  3JRC A;  1DU0 A;  1I50 J;  3WHB A;  3JRH A;  2LD5 A;  5EDN A;  3OIO A;  1GV2 A;  2VKE A;  5J1Y A;  1XG1 A;  3GTP J;  2HYJ A;  5IYC J;  5J1R A;  3Q0U A;  5E3M A;  1I3Q J;  3BTJ A;  3M3Y J;  2L0K A;  3HOZ J;  4MFE A;  4QTR A;  4XID A;  4MIM A;  1YRN B;  1FJL A;  1G2H A;  4JP0 A;  5EG0 A;  3WHC A;  1LFB A;  3RKQ A;  4IEJ A;  4L5E A;  4ABZ A;  4CYC B;  1AKH B;  1P7I A;  5K7F A;  1JKR C;  1IRZ A;  1LE8 B;  1WGX A;  5C4X J;  2M34 A;  2EZI A;  5FKN A;  4XK4 A;  5F27 A;  3VPR A;  4XRS A;  2HQ5 A;  3BQZ A;  3C2B A;  4B1R A;  3SJM A;  3HOX J;  2R5Y A;  5FKO A;  3A01 A;  1E3O C;  2DA3 A;  3QPS A;  1RR7 A;  1ZGW A;  3M4O J;  1FIA A;  3A03 A;  5F1J A;  2EZH A;  3LSJ A;  3BTC A;  1ETY A;  2HOS A;  4A3I J;  4A3G J;  4BKX A;  3NAR A;  4EEF G;  4JX6 A;  3O8G A;  1NK3 P;  2LP0 A;  1QPI A;  2GM4 A;  4S0H B;  1CQT A;  2FX0 A;  4JYK A;  4G12 A;  1EF4 A;  4QSH A;  2I10 A;  2Y2Z A;  3HDD A;  5FKM A;  1MNM C;  1JT6 A;  2XGC A;  3QQA A;  2JA7 J;  2HXO A;  5IP7 J;  3BG5 A;  3RZD J;  2LTP A;  1VFC A;  2XB0 X;  3ZQC A;  2XPU A;  3TED A;  3FIS A;  3G1O A;  2CUF A;  3HGY A;  4IHW A;  2CU7 A;  5IYD J;  2FQ4 A;  2ECB A;  2JK3 A;  1XS9 A;  2X6O A;  2L7Z A;  2XSD C;  1OJL A;  2HDD A;  2HXI A;  2P81 A;  2LR8 A;  1X58 A;  3FK6 A;  1FIP A;  1NTC A;  1A5J A;  1JUP A;  1RPW A;  5C44 J;  3CCY A;  5IOY A;  1X2N A;  1S7E A;  1YRN A;  1BW5 A;  4DZJ A;  5HOD A;  4A3M J;  1P7J A;  2ZB9 A;  3BR2 A;  4HNV A;  5DS9 A;  2FJ1 A;  2ELK A;  1FEX A;  1HLV A;  1ETW A;  1HF0 A;  3DEW A;  1TC3 C;  1B8I B;  4CYC A;  3LNQ A;  1AKH A;  2RAE A;  3A01 B;  2DMT A;  1LE8 A;  1JUM A;  2JJ7 A;  2HOA A;  5EZG A;  1ZK8 A;  4FE4 A;  1WH5 A;  1QRY A;  1ETO A;  5F0F A;  1AHD P;  1JUS A;  2OPT A;  9ANT A;  1GDT A;  1ORK A;  1MBE A;  2IAI A;  3GTL J;  5FLM J;  2CUE A;  4A3K J;  4LOC A;  2DTZ A;  2L7F P;  1BJZ A;  1JTY A;  2O9L A;  4FIS A;  3H0G J;  3FKI J;  3S2D J;  2AHQ A;  2DA1 A;  4X6A J;  3B6C A;  2CQQ A;  4D5F A;  4XRM A;  1H88 C;  1BA5 A;  3S16 J;  5E3N A;  1BL0 A;  2YUS A;  3A02 A;  2NVY J;  2CRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...