3GTMJ

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtmJ00
1VF9A 2Y2ZA 2XRLA 1IV6A 1DU6A 3OSFA 2YS9A 4I76A 1TWAJ 3G1MA 1GVDA 3BR2A 5M5WJ 2MSYA 1X2NA 3QPSA 1SFOJ 4BBSJ 1HLVA 1GUUA 1QPIA 2LR8A 3BT9A 2LTPA 1JT6A 4B3AA 2E2JJ 2HOTA 3NAUA 3SDGA 4RDUA 2K9QA 2WB1N 2I10A 4FE7A 4G12A 5IP7J 1BL0A 1B8IA 3GTLJ 1I6HJ 3QQAA 2R92J 1D5YA 3SFIA 3L1PA 4HNVA 2R5ZA 1LFUP 3M4OJ 1DU0A 1ETYA 1MSEC 1X58A 2X48A 3JRDA 1U9OA 3UKGA 2ID6A 5IP6A 1JKPC 1Q1VA 1UG2A 4AYBN 3PO3J 9ANTA 3E7LA 1OCPA 1XS9A 3LNQA 1OJLA 1QVTA 2HQ5A 3F0CA 5M5XJ 1OFCX 4DW6A 2ID3A 1H88C 2O7OA 3BG9A 1HOMA 4BY7J 3S2DJ 3SJMA 5FKMA 1VNDA 3LOCA 3Q0VA 4M3GA 4MFDA 3WHCA 3S1RJ 1GV5A 4C3IJ 4DZJA 4A3LJ 3S15J 3FK6A 4QIWN 2IAIA 1HDDC 1MBEA 2EH3A 5JLWA 2YU9J 4JX5A 2JA6J 3HGGA 4JYKA 1AKHA 3TP3A 4AUXA 3HB9A 3RKQA 3HOUJ 3TW6A 5E3LA 2LLKA 1B72A 2O8KA 3JRCA 3Q0UA 2HXIA 1T33A 4CYCB 5EYRA 3MKLA 3BTLA 1NK3P 3IH3A 4QSHA 1JKQC 1AHDP 1HCRA 3I4NJ 5EGOA 1O4XA 2K9SA 3LSGA 4JX4A 3TEDA 4A3KJ 4D7NA 1GT0C 2DA3A 2R93J 3RQIA 2CQQA 5M3FJ 3JRFA 1JGGA 3Q0WA 3A03A 4A3JJ 3BG5A 2OF7A 2TRTA 1ZTRA 5JLXA 2KDZA 3BQYA 3MVPA 3H0GJ 2DA2A 4A93J 1RPWA 2EZKA 3ZQFA 4L5EA 4UUSB 3K7AJ 1ENHA 2WAQN 2E19A 3ZQCA 2NVYJ 4NDLA 2IBDA 4UUTA 1FTZA 1JUMA 1RKWA 1K61A 3BR5A 1ZR2A 1IJWC 2Y0SN 3HOZJ 4XRMA 1VFCA 1JJ6C 4D5CA 4A3GJ 4X6AJ 1ITYA 1GV2A 3GTQJ 1ZKGA 4C3JJ 2CU7A 3B6AA 3IV5A 4IHVA 1IDYA 2QF7A 4D7MA 3IH4A 3HM5A 4FE4A 5FLMJ 2JJ7A 3BR1A 3MN2A 5E3OA 4IHXA 5M3MJ 2CJJA 2KT0A 2JN6A 5C44J 2XGEA 3A01B 1PUFA 3CQZJ 3FKIJ 3G1LA 5IOYA 4BY1J 5K7HA 5HODA 2LP0A 4XK4A 2CUFA 3NARA 1E3OC 3BTIA 5DS9A 1TWFJ 1Y1VJ 5F0HA 4RBOA 3HOXJ 1ETVA 1LE8A 4ABZA 2HI3A 1BW6A 2JWTA 1JKOC 4V2GA 3BR3A 1A5JA 1LFBA 1JTYA 3Q3SA 2L7ZA 4C2MJ 5GPCA 3GBGA 5EG0B 4FCYA 5FLVA 4A3DJ 3QPLA 2HYJA 2R5YB 2Y9YA 2DA5A 3O8HA 3S1MJ 4A3CJ 2ELKA 2XGCA 2CQXA 5C4XJ 3BTJA 2FD5A 1IDZA 2H1KA 1QRYA 1TWGJ 2E1OA 2LK2A 5BNGA 1R9TJ 1JKRC 2K40A 5F04A 3JRBA 5EZGA 2NVQJ 3ZQHA 3JRIA 2DA4A 1UHSA 2NS8A 4EEFG 2AO9A 3LSJA 2FQ4A 4XICA 1H89C 4IHYA 3RZDJ 4B1RA 2M9HA 4JX6A 1MBJA 3JRHA 1WGXA 1Y1WJ 4DZPA 3S16J 2G0EA 2DMQA 1YRNB 1F43A 2GBYA 1X2MA 4FTHA 3BQZA 4UUSA 1BA5A 2VUMJ 1W0UA 1TWCJ 5F0FA 3CDLA 5IYBJ 2P81A 3HOWJ 1IUFA 1WCMJ 3S1NJ 2DJNA 3JRAA 2L7MP 1RETA 2H8RA 3PM1A 1BJZA 4DYCA 2XB0X 1MNMC 1I3QJ 4XRSG 3HDDA 1CQTA 2Y9ZA 2DMPA 1MH4A 2R0QC 3HEFA 1Z0XA 1WH7A 1MBGA 4M6VA 1WPKA 4A69C 5EDNA 3IH2A 5FJ8J 2X9DA 5C4JJ 5E3MA 1T56A 2D5VA 3HKZN 2NVTJ 4B4CA 2M34A 3WHBA 3ZQIA 2VI6A 2XPVA 2B63J 1RKTA 1FIPA 2R5ZB 1U8BA 3OOUA 1POGA 1NTCA 4M3EA 5IPAA 5IOZA 2LFBA 1VI0A 3ZQLA 4Y52J 4W1UA 4AC0A 2XPWA 2COBA 2OPTA 2DTZA 3W6VA 1NK2P 2MG4A 3S1QJ 2R5YA 5M5YJ 4A3MJ 3TW7A 2M0CA 1F36A 2DA6A 3FK7A 4MLOA 2E2IJ 2CUEA 3JR9A 1APLC 3BR0A 3TP0A 4DYRA 2N8GA 2MGQA 4X1EA 2FJ1A 3BTCA 1TWHJ 5GPAA 5J1UA 1FEXA 2Y31A 1ETOA 1W0TA 1HDPA 4M3FA 1WH5A 2IEKA 1XC5A 3LSRA 1IGNA 2JA5J 4M3BA 4A3EJ 4C3HJ 1AKHB 2DA7A 2M2EA 2NVXJ 1U78A 3ZQGA 3GTOJ 4W97A 1QVUA 2TCTA 5FKKA 1B72B 1MBHA 1U9NA 3DEWA 4JP0A 5DTDA 2JK3A 1JUSA 4A3FJ 1S7EA 2EZIA 3S14J 2DMUA 5EGOB 3ZOBA 1AU7A 1FIAA 4GFBA 4V2FA 5IP9J 1ORKA 5IYCJ 1HF0A 4XRSA 3VPRA 3GTGJ 1MBFA 1ZGWA 2VPRA 1JT0A 3D1NI 2R7ZJ 4CYCA 1A6IA 3OSGA 2DMTA 1ZK8A 1UMQA 1P7JA 2ZB9A 4BXXJ 5EZHA 5F27A 1MSFC 4S0HB 1ETKA 1IRZA 4D5FA 3M3YJ 3FIWA 1G2HA 2AHQA 3BG3A 3HOYJ 2LKXA 2PMZN 1EF4A 2ECCA 4BBRJ 2XB5A 3LSPA 1ZQ3P 3FISA 5IYDJ 2DN0A 1IG7A 4QTRA 5FKNA 1I50J 1H8AC 4J19A 1Z77A 2X6OA 2LD5A 1JTXA 2NOGA 1PUFB 1IC8A 2HOAA 3JRGA 3H3VK 5EF6A 3O8GA 2XSDC 2ME0A 5C3EJ 2Y30A 2XPUA 3JREA 1JJ8C 1LE8B 2NS7A 2M8GX 3RZOJ 2RAEA 2EQRA 4BKXA 5FKOA 2L7FP 3C2BA 2EZHA 2EZLA 4FISA 2DMNA 3A01A 4IHWA 1BW5A 5FKLA 1WI3A 2QCOA 4A3IJ 1TC3C 3S17J 1B8IB 3HBLA 2WV1A 1XG1A 4DYQA 3G1OA 2YUSA 2LVSA 1K83J 2VKEA 4MO7A 3GTJJ 2JMWA 5E3NA 2GLOA 5K7ZA 3OIOA 2GM4A 2JA7J 5J3LA 4MFEA 1FTTA 1ETQA 3BR6A 2HOSA 2ME6A 4MIMA 4Y7NJ 5EG0A 3GTPJ 1ETWA 2FX0A 3I4MJ 3K2AA 2DA1A 2K9NA 1MH3A 5F1JA 1MBKA 2EBIA 4IEJA 3HOVJ 2VKVA 2ECBA 4A3BJ 2L0KA 4LOCA 5F08A 1RR7A 2E2HJ 1JUPA 5F0CA 3GTMJ 2CRGA 2L9RA 5GP9A 3A02A 2W48A 1SANA 3PO2J 2HXOA 2XGDA 1GDTA 3GTKJ 1P7IA 3S2HJ 4I6ZA 1FJLA 3DCFA 3B6CA 2JA8J 4M3DA 5J1RA 5K7FA 1YRNA 3CMYA 2LY9A 1ZR4A 3CCYA 2MW8A 1RESA 5EEAA 4XIDA 1OCTC 1ETXA 2HDDA 5J1YA 2O9LA 3HGYA
chains in the Genus database with same CATH superfamily
4AVZA 2GIVA 3PIPF 1VQNI 1N75A 1A04A 1F1ZA 1FT9A 2MH9A 1KGSA 2YS9A 1TWAJ 3G1MA 2M5WA 1IXCA 4E7HA 3OIPA 3BR2A 2BVMA 5M5WJ 1P6RA 4KYWA 3QPSA 3CJNA 2VC0A 4I02A 1QPIA 1X3ZB 1LB2A 3K4JA 4KMUX 5D6EA 3F23A 3PSFA 4M9XA 2MD5A 5TRDA 3SDGA 2Z1DA 1ZGAA 3G4SI 2A6TA 3M8JA 3ZXSA 2HGCA 3RI4A 2ZCWA 1YTYA 2CFOA 2JSPA 3L1PA 1XN7A 4RB3C 1LFUP 1VQLI 1DU0A 3REOA 4EV0A 1X58A 1P4XA 1YJWI 3UKGA 2ID6A 4CGZA 3PO3J 3FXJA 3OS1A 2H8WA 3GXOA 1XS9A 3K10A 1OJLA 3H5AA 1Y56A 1IF1A 3FMQA 4KISA 2EINH 2HQNA 3S2DJ 3SJMA 3OMYA 2W25A 3Q0VA 5LHGA 2F4OB 5TISC 3HUGA 2KZGA 4KA4A 1GV5A 4DZJA 2AQEA 2XROA 3BJOA 1AOYA 2V79A 3FK6A 5H6QA 3HOSA 2PMUA 5KAFC 1WVRA 1HDDC 1MBEA 2JTVA 4RGRA 2YU9J 4KIGA 1O3SA 5FGMA 1NHAA 1MZBA 4ETSA 1OPCA 2R7WA 5CVJA 3HB9A 3AG1H 3S32A 5E3LA 2WY8Q 2LLKA 1B72A 2O8KA 3WTTC 2HXIA 3L7WA 1T33A 4MNUA 3KCCA 2QWWA 3FXRA 3X2QH 1RR8C 5E8GA 4QSHA 1JKQC 5DV5A 3CLQA 2JSCA 5K1YA 1IXRC 3MZ8A 5GTIC 3LFKA 5DCFA 5CYVA 2JPCA 4YRVA 5D4RA 1FYLA 1ZG1A 1O4XA 2VKDA 3TEDA 4LG3A 4Y15A 4ENJA 1WJEA 2NS0A 3I9V2 5FFXA 5M3FJ 1P4WA 1JGGA 4CSWA 4BGDA 1TQIA 3EQLF 2OJED 4PGGA 4ITVA 4CH7A 4OAYA 1ZTRA 3CESA 4AIKA 3ZMZA 2BY3A 3UNGC 1YX5A 2PLYA 4A93J 1RPWA 1S72I 2O5RA 2LNBA 3FXOA 3UR3C 1D5VA 4FT8A 2OTJI 3IKTA 1PP8F 3EUHA 2ZXJA 4PSXA 1JHHA 4BACA 2IBDA 2GWRA 2WBMA 3BR5A 5J8CA 2Y0SN 3LA7A 1JJ6C 4D5CA 3QU3A 1G4DA 3C2GA 1EH8A 3LWFA 4A3GJ 4M74A 2K02A 4CCNA 4FX0A 3IV5A 4HOBA 2EJRA 4ESBA 4BDYA 1YFHA 4IJAA 1BC8C 2H27A 2ESHA 4D7MA 1NG6A 3GVAA 3HM5A 4HEA2 3MN2A 3OYDA 4NC8A 1HSTA 5E3OA 2XAUA 3A01B 2BHYA 4XOTA 1SMYF 3F8NA 3FKIJ 3G1LA 4BY1J 1K6YA 3D5LA 3GEZA 1X1AA 5FRMA 3JSPA 1W5CC 3S3OA 1TWFJ 3WTZA 1Y1VJ 3EUKL 3C18A 2BBYA 3F8MA 2DPDA 2JT1A 4R1HA 3BR3A 5FLVA 4FCYA 4LMYA 2GIZA 2IS1A 2ZC2A 3LQQA 5ICCA 1HW2A 1OYWA 2HZTA 5FO5A 1H9GA 1X4PA 2IA2A 3ZCOA 4ENMA 1PUEE 3OIQA 1IW7F 3H9GA 1BIAA 4G7ZF 3BWGA 4PZJA 2E1OA 4G94A 3TL4X 4I2OA 1CF7B 4XLCA 4BAYA 1QA6A 1YS7A 2KRHA 3HTUA 3R0JA 2AO9A 2FMLA 2FQ4A 2Z99A 3V7SA 1H89C 2HQRA 4DBQA 2QBYA 2ELJA 3M8EA 1MBJA 3O3KA 1VQ7I 4YFNF 3JRHA 1Y1WJ 2ZXIA 2VONA 2QZ8A 2G0EA 2CO5A 1PVEA 1FNNA 3AG4H 1J7KA 1S8NA 3SEQA 4UUSA 1F4KA 2R7FA 2WADA 5DD4A 1UCRA 5IYBJ 2P81A 2K9LA 2EFNA 3HOWJ 4RLFA 4LB5A 3S1NJ 4AIJA 1PP7U 2W7NA 4AD9A 2LKSA 4ZZLA 2X1CA 1E3PA 1YW7A 2AXLA 2JRTA 3TOAA 4DYCA 1I3QJ 1MNMC 3NQOA 4RAZA 2V1DA 4KIBA 3KETA 2ADUA 4CCJA 1Z0XA 2ZJ2A 3QP6A 1UZCA 1MBGA 4S04A 4M6VA 3GYHX 4A69C 4G7HF 2KQRA 2X9DA 1T98A 2ISYA 5E3MA 3HKZN 4MEYF 4RA2A 1T6SA 2D45A 1MMGA 2M34A 5ICFA 1FLIA 2B63J 1U3EM 4HG2A 4G6DA 1VQOI 1U8BA 5KK1A 3TQNA 4GYGA 3WE3A 3CUQC 2A5WA 5IPAA 3CDHA 5GAHJ 4Y33A 1DGWY 4AC0A 5HLGA 4HF1A 1D0ZA 3T8TA 1K4SA 2DTZA 3LSIA 4WXCA 3W6VA 4B48A 4M6YA 4IRHA 1WRJA 2R5YA 3BJ6A 1RRJA 5M5YJ 1D1BA 2L54A 1F36A 1IN6A 1D1AA 3JR9A 3CP8A 3ECOA 4HQEA 1LDKB 4IOCF 2BXZA 2DQLA 2GA1A 5HDGA 3JTGA 3L2RA 5J1UA 1YX3A 3OV8A 3PQKA 4A6DA 4M3FA 2KZVA 4OIQF 4ZYHA 3I55I 3VYUB 1W4MA 4IOAF 3BROA 4A3EJ 4C3HJ 4LIUA 4KDPA 1U78A 4TV7A 1MBHA 2AXTC 3DEWA 4PK4A 3I53A 2JK3A 3FWEA 1JGSA 2BVLA 2R7UA 4IVNA 3CC4I 4AYBA 4PJNA 4GXOA 2DMUA 5EGOB 5CKTA 1AU7A 5KCMA 3N97A 4XRSA 2X6XA 4F7ZA 1DP7P 2H1LA 1ZGWA 2CV2A 2R7ZJ 2DODA 1U8RA 2M4KA 2VE9A 2ZJQF 5EEGA 2L2OA 3L2VA 5ICGA 4C2TA 2IGMA 2VC1A 5JHFA 4BXXJ 4B8XA 5F27A 1ON2A 5ICEA 2V1XA 1IRZA 1P2FA 3PNYA 2DJIA 3BC8A 2E1MB 3WTWC 1D8JA 4LG0B 1FSHA 3OYKA 1G2HA 2Q0OA 2ZSIB 1Z7LA 5H20A 4BJ6C 3OS2A 2LKXA 2ECCA 3LSPA 2XB5A 3HPHA 2EA2A 2I5UA 2ICWG 4L0YB 3KP3A 1O3RA 2X4HA 1VTNC 1I50J 1AWCA 2HWVA 3OYLA 1H8AC 3V4GA 3MZYA 3FF5A 3U1DA 3MFKA 1USTA 1LVAA 4HW0A 3QODA 1ZELA 1XCBA 2LD5A 2M45A 4NQWB 4HF0A 3JRGA 3N05A 3H3VK 3O8GA 1R49A 5ILUA 2DO7A 2ME0A 2Y30A 3GCMA 2XPUA 1YE9A 1WJAA 1OCZH 2CV0A 4FQGA 4R8HA 5B5EC 3H35A 3OYCA 4E7ZA 2M8GX 2L9SA 3G73A 1OMIA 4II2A 2WAQA 2PJPA 4BKXA 2L7KA 3H5RA 5FKOA 1SFUA 3CD6I 2XUBA 2EZLA 4FISA 3A01A 1BW5A 4A3IJ 4IRIA 4GDFA 3GZNB 3GFMA 2LVSA 3ZMSA 3J80K 2H6CA 3WG9A 2FBKA 4FASD 2JMWA 5E3NA 3E6MA 3CJRB 2GLOA 2OQGA 2GM4A 2JA7J 2JPBA 4HPQA 1ETQA 2MLKA 2HOSA 5D8LB 2KFDA 5FD6A 4MIMA 4P9FA 5BMZA 2Y75A 3LSMA 1ACIA 2VIXA 4U87A 2DA1A 3G3ZA 3L09A 4S05A 2BHZA 2WC2A 3EYIA 2E2HJ 5CVVA 1Y8QB 3A02A 2X1DA 2L5QA 1KU9A 4FHTA 4PJ0C 1LNWA 1CF7A 1X1BA 4HNTA 2O61A 3PO2J 4HBLA 4GGGA 3HRMA 3KIOA 1DPRA 4HLXA 1HQCA 4XOPA 4RAYA 3P7NA 3IAM2 3GTKJ 2MABA 2HDWA 1UHWA 1FJLA 3DBLB 3CLOA 3W2WA 4NUBA 3B6CA 1RNLA 1XSVA 4M3DA 2HNHA 1Z6TA 4KJZA 2K3FA 1D0XA 2LY9A 3CMYA 1ZRFA 4IX7A 2MW8A 1R1VA 2O6GE 4L9NA 2HDDA 4MQVA 4HA8A 5J1YA 5DYMA 2UZKA 2LYCA 2H6BA 2Z3YA 4EQQA 2KDOA 4KNYA 1DU6A 4WXHA 4I76A 2HS5A 2WY7Q 2L02A 4M9ZA 3MZHA 2HEOA 4O3MA 3JW4A 1QZZA 1R7JA 3GFIA 1GVDA 1Y39A 1IZ1A 2CH0A 3R61A 1X1DA 3P5JA 1BIBA 3MKWB 3V8LA 4RAFA 1SD7A 4HV6A 3NAUA 4C30A 2WB1N 2AQFA 2I10A 4G12A 1B8IA 4KMFA 4F91B 3SHFA 2R92J 2BY0A 4EATA 1FYMA 3L2UA 1MJ9A 3WGIA 1QBJA 3M4OJ 1MSEC 4QPQA 4BJTA 3M07A 1R1UA 1FP1D 2DOFA 2RNJA 1NH3A 1QVTA 2HQ5A 2CUJA 2P0WA 4Y13A 5M5XJ 1WKMA 1BI3A 1H88C 1R58A 5FKMA 1VNDA 3WHCA 3F3XA 4XM3A 3S93A 3S1RJ 5TJJA 1EJ9A 3AFHA 3IHUA 2DT5A 2FF4A 3GWZA 5D6FA 5DM7F 2R7DA 4A3LJ 4F93B 2BE5F 3E1SA 3BOQA 4AU7A 4QIWN 3EUHC 5BQTA 3ULQB 1BN5A 2IAIA 2YPRA 3A4CA 2D2WA 3WE2A 2GXBA 4JX5A 5L3BA 3R6SA 3HGGA 1QU3A 1FSEA 3TO6A 1E3HA 4RB0A 2P6TA 3VYRB 2XF6A 5E1WA 2ZSHB 5JR3A 5HOOA 1TL8A 2HPMA 3Q0UA 2XAHA 1V54H 2J5PA 2Q1ZB 4N9IA 4P55A 5EYRA 3A0HC 3MKLA 1NK3P 4E6KG 1ZN2A 4PJJA 3RTRA 5LFAA 3WODF 3QWLA 5EGOA 2O3FA 3PJRA 3BG7A 3QOEA 5A2QZ 3DKYA 3CF2A 4PUSA 5BS6A 4A3KJ 4E7LA 4D7NA 2DA3A 1SVMA 2K5CA 3RQIA 2PEXA 4YIIA 3QYEA 2HKXA 4L9JA 3A2KA 3BG5A 2OF7A 2UWMA 2TRTA 3JAMZ 1W7PA 3MVPA 3H0GJ 2VBWA 2LMDA 2XAGA 3OWTA 4DOZA 4UUSB 1ENHA 2E19A 3P9IA 4IL6C 2NVYJ 4BHPA 1JE8A 4XLAA 1XGMA 4LG0A 1RKWA 1K61A 2JZYA 6PAXA 1IJWC 1ZR2A 2IGNA 3CCVI 3HOZJ 3LAJA 2V4JC 4JK1X 1BI1A 3ABUA 1ITYA 2XHKA 1RC9A 4BHCA 2CU7A 4QLCU 2LC2A 1X4OA 1VQ4I 1WSUA 2QF7A 3FMRA 3RQ4A 2F5FA 4FE4A 2E1CA 1R00A 2EFPA 2EFOA 3CUOA 3DTIA 2KIMA 5C44J 2HOEA 1DP3A 4NQWA 3AAFA 3VFZA 5K7HA 2FBHA 3I59B 3IWFA 4F92B 2F48A 2LP0A 5HNFA 3L2WA 1WQ2A 2QYOA 5DS9A 3ZMDA 5F0HA 4RBOA 3M8FA 3C1DA 4ABZA 3RCOA 1JKOC 2PJRB 1J09A 1BI0A 4AIHA 1LFBA 1WHUA 3L2QA 1JTYA 3Q3SA 2L7ZA 3MWMA 3U9GA 4KUMA 5GPCA 3BY6A 4XORA 5CVUA 1S5LC 5EG0B 1KYWA 2OCEA 4IQ4A 3LSTA 2HYJA 3G6EI 2R5YB 4E7SA 2PMHA 4L9TA 3FXMA 2Y9YA 3AL0B 3BCBA 2CMPA 3I54A 1ZGJA 2EV6A 2XIGA 2ELKA 3PIOF 2CQXA 5DUIA 1FBSA 2FD5A 1T38A 4M9SA 4HV5A 4M71A 3HJEA 4OMYA 5LEKA 4ZTJA 4ZYDA 1R9TJ 2HVSA 4EJTA 1JKRC 2K40A 4GCVA 1ONVA 4LJZF 2ZNZA 1WJDA 1S3JA 3WU1B 2L01A 4J00A 2QENA 2PI0A 1R23A 5JVGF 4E4HA 1EH7A 2JUCA 5KHDA 2XRNA 5LHIA 3RZDJ 2M9HA 4F55A 2M8EA 4XONA 4WX9A 2YX7A 1QHGA 1MJAA 2DMQA 1TW2A 4RGXA 1YRNB 1F43A 1TTYA 3E97A 1MW7A 4FTHA 1TQPA 2KRCA 5E17F 1WJ5A 1XGOA 3FM5A 5J4VA 1BA5A 3CZ6A 1NG7A 2VT3A 5F0FA 4E70A 4D1QA 1R4NB 1JHFA 2HR3A 2PQ8A 3U21A 3JRAA 2DPUA 2L7MP 1R5HA 4L5IA 1SFXA 2OC6A 3PM1A 4HQMA 4M72A 1EV7A 1BJZA 1SFKA 4XRSG 3ABTA 3HSFA 5E20A 5CJ9A 1CQTA 3HOTA 2LRDA 1XDSA 5CLSA 2NNYA 3DEEA 1K6OA 1MH4A 5JHUA 3CJTB 3HEFA 2R0QC 2RDPA 4RS8A 3KZYA 1C0WA 1XMXA 5K5QA 3KP6A 1R5ID 1FC3A 5EDNA 3OYMA 4CHUA 2ETHA 2DI3A 5ED4A 1T56A 4B4CA 4MHGA 2K9MA 3WHBA 3HRUA 3CF5F 3ZRGA 4I7HA 2A6EF 2MYSA 2X1EA 2QSGX 1ZARA 4UVCA 1K78B 4XNFA 2PBIA 5IT9K 3J7AO 4M3EA 4I01A 5L3DA 3HXLA 2IA0A 2B0LA 1Z3YA 4ZDPA 3KEOA 5J47A 4Y52J 3N4MA 2XPWA 3K4BA 4IZZA 3DV8A 4UB6C 4CZZA 1OR7A 4MTDA 1T08B 1NK2P 1TT0A 3RDIA 2M0CA 4V19K 2RQQA 1J75A 4A12A 4P9UA 3H1CA 5AIPA 4WK8F 3K4MA 4LB6B 2XC7A 2TDXA 2N8GA 2MGQA 1IN8A 3KFWX 1T2KA 3PFIA 3W6JB 5A2QK 4IPAA 5GPAA 3WGGA 1FEXA 2QGUA 1T0FA 3OYFA 1HDPA 5DD8A 3CO7C 4LLLA 1WH5A 3LSRA 4R79A 4YG2F 3K70D 2E34A 3VWBA 5E79C 2PMZA 4OINF 2DA7A 1AKHB 3ZQGA 4W97A 4G7OF 2MC3A 4Y3OA 3ZN0A 1IN5A 1R5GA 1FMWA 1W1WE 3QRFF 1LEBA 2V6CA 3IUOA 3VEPA 3H9JA 2EZIA 3D5SC 3VYSB 2WWYA 2MLGA 3S14J 2KJBA 2VOPA 4HX8A 2JRMA 2P4WA 3FBIB 1LDDA 1FBQA 3S2WA 4N0BA 1PDNC 1ORKA 1UELB 2BEOA 3E6DA 2O0YA 2YU3A 4E7JA 3CCQI 5JVTA 3BPXA 1JT0A 2AS5F 1LVKA 1Z3XA 2PFBA 2DMTA 1HC8A 1MGTA 3ZR8X 1ZK8A 4OAZA 2B7EA 4IXAA 1M1EB 2K27A 1MMSA 2Y69H 1ZYRF 4ANJA 3S8PA 4UV8A 3FDYA 1YQAA 3G71I 4S0HB 3PNTA 4QPOA 4ZC3A 2X6WA 4D5FA 3M3YJ 1EA3A 3OYEA 3ZN1A 1E0EA 2R7SA 4PJMA 1DGRM 2KL4A 4CDGA 5B3SH 1ZQ3P 5BPDA 5FLXZ 3A0BC 5IYDJ 2DN0A 4LLGF 4QTRA 5FKNA 1TBXA 5B66C 3IL2A 1J59A 2OA4A 2P5VA 3KYLA 3EPZA 2M30A 3GMEA 4N4NB 2X6OA 2M87A 2IPQX 1PUFB 4ON0A 1IC8A 3FHZA 2EV5A 2M0MA 4HDUA 2FQ3A 2PG4A 3L9FA 2XSDC 4RB1A 1ZRDA 3QPHA 3VDXA 4D0PA 1LDJA 3CMMA 5ERIA 1LE8B 3HSEA 5AIQA 1PYVA 2DT6A 3ABKH 3RZOJ 2EQRA 2I8DA 2L7FP 2EZHA 4H4KC 1MMDA 2KPMA 2W00A 5FKLA 1OCOH 3S17J 1B8IB 2Y0SA 2G7HA 2WV1A 1HKTA 2BXYA 3I59A 1VQKI 4EJWA 5DM6F 4MO7A 4UVBA 1BM9A 3RKXA 2XV4S 5FD5A 1DQUA 1QNTA 2HTSA 1B4AA 1VQ9I 2P7VB 5J3LA 1FTTA 3E6BA 2VASA 2PJRA 4XRFA 3R60A 2PX9A 1Z9CA 4Y7NJ 1VQMI 5EG0A 5LGUA 1ETWA 4BE2A 2IA1A 2R4GA 4PCQA 3OS0A 2K9NA 3K1PA 1MH3A 3E6CC 1MBKA 4IEJA 2E36A 2VKVA 2MH2A 2Y48A 3HOVJ 2HTJA 4A3BJ 2EB7A 4LOCA 4ENNA 3E3VA 2JA2A 2F6CA 2XSJC 2ZFUA 2COMA 3ZMTA 1JI8A 1RUOA 2LKPA 1WWXA 2L3DA 2CRGA 2L9RA 5GP9A 2VKHA 1K79A 2R7XA 1SANA 4ENKA 1USSA 4YIRX 2XGDA 1GDTA 2L9NA 3VODA 2CSOA 1S6LA 2XKOA 4CCOA 2FE3A 2W1OA 1G3TA 3NWTA 5K5RA 1YRNA 5K7FA 1SEUA 4P1WA 2OD5A 3K69A 2ZJPF 5EEAA 4XIDA 5LGNA 3TKYA 4I09A 4RM2A 1VF9A 3RKWA 4IHSA 1LQ1A 2E5NA 2XRLA 4RAGA 3WU2C 2KRFA 2KIUA 1ODDA 3OSFA 3NEUA 2E7XA 1Z21A 2R7QA 3L00A 3OL4A 2MSYA 1X2NA 2V26A 2VJIA 1SFOJ 3LSKA 3WG7H 1HBXG 1ZHFA 1HLVA 1GUUA 1W7PB 2EIKH 2VJ5A 4KICA 1SMTA 2Q8KA 4MTEA 4UUVA 3KP4A 5LGTA 4B3AA 3BPVA 2STWA 2HOTA 5HNHA 2NNNA 2K9QA 1S29A 2XVCA 2A68F 4FE7A 1BL0A 5IP7J 3D0SA 4BQOA 2OCCH 2W4SA 1ZRCA 4JOMA 1KA8A 4BYYA 2BZTA 1MMAA 1D5YA 3SFIA 3ECHA 4HNVA 4ZDLA 3KEYA 1K78A 1V5EA 1QHHD 1FMVA 1ETYA 2UXXA 2CW7A 3ZPLA 2UXNA 1UB9A 2X48A 5D5WB 2OBPA 5HDKA 1ON1A 1WJBA 2BYVE 1Q1VA 9ANTA 5LLQA 1MIJA 3HKZA 3MEXA 4BQQA 2VQHA 3LNQA 3F0CA 2VQGA 3GFJA 4B44A 1OFCX 1KU3A 2M7AA 1IXSB 2FMYA 2ID3A 4A2UA 2FNPA 3KLNA 3BG9A 4HAMA 4I98B 1HOMA 3FM3A 3HZJA 4BY7J 3Q9SA 3I64A 4MFDA 4M3GA 3PQJA 3HRTA 2DK8A 3R4KA 1F5TA 1SC7A 1ERDA 4BJ5C 3VB2A 3DKWA 2OU2A 3HYIA 1BBYA 4C3IJ 4WXDA 5D5VB 3HG9A 1WI9A 1B9NA 3DLLF 4WWCA 2LSOA 2E1MC 3V8JA 5JLWA 2DT7B 4UXNA 2MBFA 5H6RA 1A36A 2X0LA 4JYKA 3OR2C 3TO9A 2EIMH 1AKHA 1D8KA 4KT6A 3RKQA 3CCEI 3QYFA 3HOUJ 3TW6A 3AKZA 1IRXA 4ESFA 3JRCA 1X1PA 3CO6C 1I6XA 4KT5C 3T8RA 4CYCB 4CCMA 3BTLA 3FXKA 3IH3A 3LL7A 4NNJA 3F8BA 3DFGA 3HSRA 2K9SA 3LSGA 4JX4A 1YG2A 2HVRA 3F6OA 3W2AA 3M9AA 2K85A 4XSXF 2ACJA 1BR2A 2XDVA 1UFMA 2R93J 2W57A 1U5TB 2CQQA 1YJNI 2QQ8A 4O6JA 3JRFA 1XGNA 2M1BA 3Q0WA 3I3LA 4XN0A 4EM1A 2KDZA 1Y6IA 2ZMEB 4ASNA 1E17A 3DU6A 3OR1C 1R36A 5LRSA 3KP5A 3KLOA 4HZFA 1JXSA 3EYYA 3CCRI 3ZQCA 3LA3A 2MC4A 4XBFA 2WA0A 4NDLA 1S7OA 4HX7A 2F5CA 1FTZA 5B1BH 1KQ9A 1DUXC 4XRMA 3I0TA 3SQNA 3MKZA 1GV2A 1ZKGA 4C3JJ 3GZ5A 4IHVA 3IAS2 1P9QC 1D0YA 4RM3A 1GVJA 5FLMJ 2H09A 4K2EA 4IHXA 5M3MJ 2CJJA 2KT0A 4OU0A 5LHHA 4DBRA 3CQZJ 1PUFA 2ZNYA 1I1SA 3DPLC 2CUFA 3NARA 3K70C 2XAJA 3BTIA 2RV8A 2HDCA 4A0YA 2BV6A 3H3ZA 1SVOA 3HOXJ 4ZTFA 3FMSA 1LE8A 2A69F 4MQ9F 4UNOA 2V9KA 2JWTA 3KPHA 1QQIA 5GTHC 3F21A 5EJCA 1A5JA 2GA2A 2QVOA 1G3YA 4A3DJ 4PDKA 2A07F 3ERMA 1QO0D 1Z05A 3SZGA 3HHHA 3DKXA 3RPUA 1DDNA 3RJPA 4HNUA 1G59A 1OCRH 4DGWB 5FRNA 2XGCA 4LGWA 3KZZA 2YSRA 4IO9F 5LD2C 2H1KA 1QRYA 1EH6A 1TWGJ 1FBUA 1FOKA 3E5QA 5F04A 4G8XA 3V8KA 3O2PE 1OLTA 5EZGA 1X19A 1XMAA 4ZH4F 3ZQHA 3JRIA 2NVQJ 5LEJA 3H9QA 4UB8C 4XLNF 1UHSA 4PFPA 3CCSI 2NS8A 1K4TA 1KQ0A 3H3UA 2R7TA 4WF2A 3ZGKA 4CO8A 5E8IA 4FETA 2M3AA 3SXYA 4IHYA 1P92A 2CW8A 2VBYA 2VXDA 2HYFA 1K7AA 1YIOA 3KE2A 3MKYB 1VQ8I 1WGXA 4DZPA 3QAHA 4OIRF 3MAJA 1X2MA 2P6SA 3OYAA 3VSLA 4RLQA 4J01A 2VUMJ 1S9HA 1TWCJ 2WAEA 1FOXA 2JQ7A 1SFEA 2WV0A 3OL3A 1IUFA 3ABMH 2DJNA 2Z9OA 3TO7A 1WFXA 4KN4X 4U7BA 1RETA 2Q2EB 3TDUC 2XASA 3HDDA 4IKFA 4N9HA 3CCUI 2IGKA 4UHTA 2DFHA 3H92A 4RGUA 1I27A 2A5YB 1W36D 3B02A 1FYKA 1WH7A 1T0FC 1HKQA 2DQRA 1WPKA 2C6YA 1X3UA 3FX3A 4Q4ZF 5FJ8J 5DDGA 5C4JJ 1OCCH 4XL9A 4CUGA 1IUYA 1N77A 2NVTJ 1Y0NA 2V6EA 3ZQIA 2VI6A 2XPVA 3H36A 4RMNA 1H9TA 1KQ8A 1RKTA 2STTA 2R5ZB 1O3TA 3ESWB 3ISPA 3OOUA 1Y0UA 4B43A 1TT5B 1IRFA 3OYNA 3ELKA 2DW4A 2A3SA 3MMYB 2LFBA 3ZQLA 2YR2A 4XLHA 2EV0A 3W2VA 1LJ9A 3I56I 3RSNA 3RPUD 2OPTA 1REPC 4YIFA 4CCLA 3K4NA 3ZMUA 2A61A 4YELA 4HRIA 3SZTA 4A3MJ 3K4CA 1L0OC 4BEHB 2DA6A 4MLOA 2EFWA 2CUEA 4YFKF 2ISZA 4BE1A 4II3A 2XF5A 4DYRA 4X1EA 4M6XA 2GXGA 5LBQA 1ETOA 5J4YA 2WB1A 3HTSB 5HLHA 3FZVA 3BCAA 1IAWA 1W5SA 3BJAA 2E7WA 4HF2A 3OOPA 2NVXJ 5HVQC 3GTOJ 1QVUA 2MA3A 2XAFA 1YJ9I 2VBXA 3U1KA 2M7BA 1V3FA 3FHNA 2CFXA 2QEXI 3DXJF 2NOJB 1JUSA 2G7UA 3QPTA 4A3FJ 3C7JA 4F3QA 1E2XA 2IP2A 2UUZA 3DWLE 2H94A 1FIAA 1FOYA 3TMOA 1MD0A 2EA4A 5IYCJ 1SAUA 2P5LC 4IQJA 4UY8I 1ULYA 3GTGJ 2VPRA 1GXQA 1MNEA 1V5GA 4NBQA 4CYCA 1ZH5A 3F8CA 3OSGA 2A6HF 5CQGA 4OIOF 4U0YA 4HYEA 4ZJZA 3KYDB 4JQFA 1P7JA 5TGTA 3DBHB 3P9CA 4CCKA 3GX4X 2EWNA 3RPQA 2XKPA 1MSFC 2LOOA 4XKCA 1O7LA 1SD5A 2HKOA 2F5EA 1MNDA 2L4AA 3J81Z 3B73A 4EJVA 1U5TA 2VLAA 3HOYJ 3BZ6A 5HDNA 1W7PD 4L18B 2G9WA 5F6FA 2PMZN 4XLPF 4BBRJ 4A5MA 5KAIC 4BH9A 2V1UA 3DU5A 4M73A 2RQPA 2VQCA 2ZMEA 4IRGA 5FB2A 1IG7A 1Z6RA 3PNVA 1IRGA 5K5OA 4J19A 2XGXA 1R1TA 3NRVA 2BY2A 1KZHA 2FOWA 3AL0C 2B9SA 3KEQA 2HOAA 3T1BA 5EF6A 1RIOH 2HVQA 4BXFA 2R7RA 1J9IA 2L9VA 1VQ6I 1YS6A 1Z7UA 2IT0A 3PUBA 2QM3A 2DBBA 3VSKA 1HXDA 2KMUA 1TW3A 2OUMA 4PFOA 5FROA 3VOEA 4ZYAA 1JJ8C 2DDAA 4A0ZA 1BR1A 5JFRA 1BJAA 5CVRA 1KU7A 4KN7X 1ZREA 3CJQB 5B1AH 2DMNA 4CYDA 1IV8A 2VT2A 3HBLA 1B9MA 2FU4A 1XG1A 3COAC 3G1OA 1QZEA 2YX4A 1K83J 5CQEA 1G3SA 2VN2A 5DUKA 4EM2A 3GTJJ 1Z91A 4KITB 3OIOA 5L3EA 2QQ9A 2FUG2 4L0ZB 3BG6A 1I1GA 2WTEA 4F52A 2NYXA 2M4GA 2O8XA 3D5RC 5HLIA 4Q47A 2LY2A 1N78A 2HFHA 4XLFA 1KU2A 2QSHX 1HW1A 5CPRB 2DXIA 1B1BA 2KLOA 2RGVA 2ECBA 2F4IA 2L0KA 1RR7A 2CS3A 4H0EA 3T5XA 2KIQA 5J40A 1OKRA 3I71A 3FXUA 4C9YA 1ZAOA 1I3AA 1OYIA 5F0CA 3GTMJ 3I4PA 4AM3A 1MKMA 2GOMA 3HHGA 2FBIA 2XAQA 4XSZF 1HSJA 3DTKA 3F8FA 4Y4RA 2OQRA 3FKJA 2DLLA 3SZPA 3WTUC 3ASNH 2MFZA 3DPUA 1P7IA 2ZXHA 5GAGJ 3S2HJ 3JAMK 3FXLA 3PSIA 2K4JA 2K86A 2FA5A 3DCFA 2Z5UA 2JA8J 1J0RA 1LPQA 4O5VA 4ZYEA 4L9VA 1ZR4A 3HC7A 4Q5SF 3TOBA 2Y2ZA 4NC7A 2OAZA 1IV6A 3KX2A 2E1NA 5E18F 3F9KA 1R6RA 3S3NA 1YOVB 1S7AA 1G6NA 1XDUA 2Q2EA 3M7GA 4BBSJ 4LK0F 3I58A 3ZQQA 2IVMA 4UVAA 2R7VA 2LR8A 4XKWA 2QQBA 2LTPA 2QUFA 3BT9A 3GF2A 1JT6A 1QGPA 2DFIA 3DPTA 2DOAA 2GOXB 3LFUA 5CVIA 2E2JJ 2VPLA 2KKOA 4RDUA 2QLZA 1VQ5I 2VJJA 2DU9A 1OISA 2K3PA 1YITI 1TQMA 1STZA 3CDIA 1YHQI 3GTLJ 1I6HJ 5LRRA 2EPFA 3QQAA 4G9YA 2V9VA 2R5ZA 1YLFA 4MGRA 2EFQA 4CXFA 2O03A 5D5UB 2VB6A 2WAFA 2KISA 3ONQA 4GO1A 1WJCA 3L2CA 3JRDA 1U9OA 4Y17A 3ZP5A 2KIFA 2R7OA 5IP6A 5D5XB 1JKPC 5FFZA 5BOXA 1UG2A 4AYBN 3S3MA 1FPQA 2RVCA 2BY1A 3E7LA 1OCPA 1U0JA 1FOWA 3G2BA 4X0GA 4DW6A 5J8FA 1EKEA 2IW5A 3WU0A 2V7FA 2O7OA 3OYHA 4KIFA 2DCEA 4BEHA 2LBFB 3MCZA 3J7ZI 3DBRB 3LOCA 2MD0A 2L4MA 3CC7I 3SYTA 3MQ0A 3J80Z 2RN7A 3CUQB 2QSFX 4OOIA 5IY5H 5H2FC 3DF8A 3CC2I 3S15J 2OTLI 4NC6A 3J81K 3WTXC 3WTVC 3M1EA 2ZFWA 3F72A 2EH3A 3GZ6A 1AA7A 2JA6J 4RGSA 2X6YA 3TP3A 4AUXA 4RB2C 2FNAA 2GZWA 1LKXA 3EETA 1U2WA 5HS7A 1G3WA 2ELHA 2IRFG 2E71A 5EEHA 1YIJI 3PFYA 3V7CA 3NWSA 4BXUA 5E1ZB 1AHDP 1HCRA 3I4NJ 4XLEA 1W36C 5HLTA 4ZYGA 2FRHA 2P7CB 2E35A 1GT0C 1LUJB 2VQLA 4P5OA 1G8XA 1QPMA 4HSRA 1ZG3A 3BDDA 5AONA 3SFZA 4ZZDA 3A03A 1J5YA 4A3JJ 1X1CA 2UV1A 2GAUA 4U0WA 3BQYA 5JLXA 3ABLH 2DA2A 3E0JB 1XD7A 2VE8A 2DFFA 3V7RA 2EZKA 3ZQFA 4L5EA 4NHJA 2ZO4A 3K7AJ 1GHCA 2WAQN 2ZXWH 4LFUA 1FWZA 2W84A 2E60A 1BI2A 4UUTA 4BE0A 1JUMA 3M1CA 2HQAA 3LQRA 2ESNA 4G6TB 1VFCA 3V42A 4B47A 3K6GA 3CCMI 4X6AJ 2KJCA 4U7DA 4ZDOA 3GTQJ 2HYGD 3B6AA 1IDYA 1O7FA 1SAXA 3LAPA 2RKHA 1V5FA 3IH4A 1T95A 1T8IA 2JJ7A 3BR1A 2JN6A 3C3WA 2XGEA 5DCMB 1YW9A 5IOYA 1A6QA 1HW5A 2HZDA 2IJLA 1FY7A 4ESJA 4I99C 1XPXA 1RZ4A 1DPUA 5HODA 1WJFA 4XK4A 3P9KA 3U2RA 3W6KB 1B59A 1E3OC 1XSXA 3KYCB 2NVUB 1TP4A 4U0VA 4KFCA 1ETVA 1FP2A 2HI3A 4A0XA 1BW6A 2DFEA 3JSOA 3DQVC 4N4OB 4A5NA 4LD5A 1R4MB 2CQNA 3WTYC 5KVRA 4LLNA 4OMZA 4V2GA 1L3LA 4C2MJ 2VBZA 3GBGA 4C2UA 2EILH 2BW3B 2X51A 3E5XA 4EM0B 2DDBA 3QPLA 4MEXF 1TLHB 3ERED 2FSWA 3O6BB 2DK5A 1YO5C 2DA5A 2OZUA 4CA0A 3O8HA 3S1MJ 4A3CJ 3I5UA 3GLXA 3WTSC 5C4XJ 3BTJA 1U6GA 2Z2SB 2Z16A 1IDZA 2D1HA 2R3SA 3GW2A 3F6VA 2CQKA 2JUGA 2LK2A 3CCLI 5BNGA 2NRAC 2OV7A 1YI2I 1QZYA 3JRBA 4BL0B 1HA8A 2W85A 2EIJH 2CGPA 2DA4A 1B6AA 1ZLJA 4EEFG 1P4AA 3LSJA 3QU6A 2VL8A 2IXSA 4XICA 3K1MA 1UG0A 2HU9A 4G6QA 3IRQA 4B1RA 3Q9VA 4JX6A 4BHBA 2DYSH 1YYVA 1CGPA 1RUNA 1MDMB 1RI7A 1H0MA 3S16J 4D9JA 2GBYA 1IN7A 1ZLKA 4PGHA 4HX4A 3BQZA 2W24A 2LY1A 3GLLA 2BOLA 1W0UA 3HPGA 1LFPA 3CDLA 3HL2A 2ZBKA 4IF4A 1Q1HA 1R22A 1WCMJ 4HDVA 1T39A 4BDZA 2CV1A 2X85A 1GXPA 2H8RA 5FLXK 2K4BA 2XB0X 3OYIA 3ZMVA 4NB5A 2Y9ZA 3DTEA 1VZ0A 2DMPA 2ZJRF 4BUPA 3IP4B 5J6XA 2W82A 3DLAA 4B09A 3QOPA 4BU2A 2LH9A 3IH2A 3GO5A 2JVGA 2D5VA 2JVHA 1BOAA 2F2EA 3LMMA 4PJLA 2QKLB 3GFLA 3PUFA 1O57A 2DAOA 1FIPA 4AWXB 1YW8A 3QP5A 1POGA 4YEJA 4AIDA 1NTCA 5IOZA 1I5ZA 1F9NA 1VI0A 4E7KA 2GQQA 1BOBA 2F4MB 2DYRH 4W1UA 5D8KB 2A05A 2COBA 3PL8A 4DNCA 3K0LA 4XR6A 3TDZC 2MG4A 3S1QJ 3CP2A 5JI6A 2CWEA 5HS9A 3MD2A 1BR4A 5IT3A 3TW7A 4BQNA 2XF7A 4DIQA 5L3CA 3H0DA 4E7IA 3FK7A 1PJRA 2E2IJ 4EJUA 1APLC 5GADJ 3BR0A 3KP2A 3HUGB 3TP0A 5L3FA 4BS9A 2QA4I 3OYBA 1LEAA 5DEQA 2FJ1A 3BTCA 5D4SA 3Q5FA 1TWHJ 3OYJA 2Y31A 1W0TA 1BC7C 1WZ2A 3IKVA 3K4KA 2VXZA 3EUAA 2IEKA 1XC5A 4A6EA 3K4LA 1IGNA 1XMKA 2IGOA 1XX5A 2JA5J 1U5TC 4M3BA 1UAAA 2ZKZA 3KP7A 1D1CA 2RREA 2M2EA 1X3WB 4B3XA 2LBFA 3IRRA 2LDUA 1D3YA 1TNSA 2K7LA 4CZCA 2TCTA 3K1NA 5FKKA 2NAZA 1B72B 2ZMEC 3LA2A 1U9NA 2CG4A 1XB4A 4JP0A 3TBIA 1MMNA 3CUQA 5DTDA 2HPIA 5ILSA 2EK5A 1XTAA 1S7EA 1KONA 4I0AA 1A35A 3ZOBA 3RIRA 4BNCA 4GFBA 2P8TA 4V2FA 3BLYA 1VQPI 5IP9J 1XSDA 4P96A 4EVIA 1HF0A 2VJ4A 2FOKA 3VPRA 4JBAA 1TNTA 1MBFA 2GXAA 1Z1DA 3OYGA 1IO2A 1O3QA 3D1NI 2QKMB 3AG2H 3T0YA 1A6IA 3FXQA 4QWQA 2IS2A 3CMEI 3C2HA 4UV9A 4Z2YA 1UMQA 5F1RA 3CMAI 2ZB9A 2QQAA 4L5JA 2LF7A 2P5KA 4EGZA 5EZHA 3J7YJ 5KNLA 2O9LA 1GLNA 1ETKA 2DTRA 2NXNB 5E1XA 2FXAA 3FIWA 1SVLA 2AHQA 1MJBA 3K9TA 3BG3A 3OY9A 2F5VA 2CUZA 1HKSA 2Y0MA 1EF4A 4AVPA 1FZPB 2RNGA 4XKVA 3FISA 1Y8RB 1KYZA 5ILVA 4XKBA 4DQ2A 3F22A 4DJAA 4HLYA 2FEZA 1OR7C 3R0AA 1XCVA 3AG3H 4LITA 4EJOA 1Z77A 4U88A 1JTXA 3SDBA 2NOGA 4I0BA 2Z33A 1UJ8A 1Z67A 1XGSA 4XN3A 4XQFA 4OIPF 3RYRA 5L3GA 5C3EJ 2V9PA 5BPIA 2VODA 3HIFA 3JREA 2NS7A 4EMSA 4BQAA 4LK1F 2RAEA 3ASOH 5IT9Z 3DEUA 3E5UA 3J7AY 2IS6A 3C2BA 3KZIC 4IHWA 5DCMA 3GUDA 1WI3A 2QCOA 1TC3C 5GAEJ 4DYQA 2CW0F 2YUSA 2LF8A 2D1VA 2VKEA 3FBNB 4CICA 3CTAA 3W3CA 3QYBA 3HRSA 5K7ZA 3JTHA 1UHMA 3BZCA 3WGHA 1ZG5A 2V1NA 4MFEA 3ML6A 3ROUA 3BR6A 4Q48A 2CYYA 3H5NA 2ME6A 5HS8A 1SD4A 2BW3A 3IWZA 3GTPJ 2FX0A 2PN6A 2OZ6A 1OYYA 4PSWA 3K2AA 3I4MJ 3K2ZA 3RYPA 3RKYA 4IHTA 2BGCA 3SEZA 1I39A 2KP6A 5F1JA 2EBIA 1OQYA 2LREA 2QBYB 5F08A 3DP7A 3EDPA 3LSHA 1W5TA 1JUPA 1R71A 2J5OA 5F64A 2KHMA 2VOOA 3VYTB 3BP8A 2W48A 3A1YA 4LIVA 3TGNA 3BZKA 4WCGA 1N25A 1IN4A 2IS4A 2HXOA 3ZQ7A 4Z6YA 1SD6A 2E5ZA 1V55H 2CQ7A 3IC7A 4GYIA 3CCJI 1V4RA 4I6ZA 4FX4A 3JCUC 4EGYA 4HSTA 1MDMA 2RC4A 4YFXF 5J1RA 4XMYA 2LG4A 1TZLA 1FX7A 2F5DA 3CCYA 1RESA 1J2XA 1OCTC 1ETXA 4GRIA 4OWRB 1A31A 2DOEA 3HGYA
chains in the Genus database with same CATH topology
1VF9A 2Y2ZA 2XRLA 1IV6A 1DU6A 3OSFA 2YS9A 4I76A 1TWAJ 3G1MA 1GVDA 3BR2A 5M5WJ 2MSYA 1X2NA 3QPSA 1SFOJ 4BBSJ 1HLVA 1GUUA 1QPIA 2LR8A 3BT9A 2LTPA 1JT6A 4B3AA 2E2JJ 2HOTA 3NAUA 3SDGA 4RDUA 2K9QA 2WB1N 2I10A 4FE7A 4G12A 5IP7J 1BL0A 1B8IA 3GTLJ 1I6HJ 3QQAA 2R92J 1D5YA 3SFIA 3L1PA 4HNVA 2R5ZA 1LFUP 3M4OJ 1DU0A 1ETYA 1MSEC 1X58A 2X48A 3JRDA 1U9OA 3UKGA 2ID6A 5IP6A 1JKPC 1Q1VA 1UG2A 4AYBN 3PO3J 9ANTA 3E7LA 1OCPA 1XS9A 3LNQA 1OJLA 1QVTA 2HQ5A 3F0CA 5M5XJ 1OFCX 4DW6A 2ID3A 1H88C 2O7OA 3BG9A 1HOMA 4BY7J 3S2DJ 3SJMA 5FKMA 1VNDA 3LOCA 3Q0VA 4M3GA 4MFDA 3WHCA 3S1RJ 1GV5A 4C3IJ 4DZJA 4A3LJ 3S15J 3FK6A 4QIWN 2IAIA 1HDDC 1MBEA 2EH3A 5JLWA 2YU9J 4JX5A 2JA6J 3HGGA 4JYKA 1AKHA 3TP3A 4AUXA 3HB9A 3RKQA 3HOUJ 3TW6A 5E3LA 2LLKA 1B72A 2O8KA 3JRCA 3Q0UA 2HXIA 1T33A 4CYCB 5EYRA 3MKLA 3BTLA 1NK3P 3IH3A 4QSHA 1JKQC 1AHDP 1HCRA 3I4NJ 5EGOA 1O4XA 2K9SA 3LSGA 4JX4A 3TEDA 4A3KJ 4D7NA 1GT0C 2DA3A 2R93J 3RQIA 2CQQA 5M3FJ 3JRFA 1JGGA 3Q0WA 3A03A 4A3JJ 3BG5A 2OF7A 2TRTA 1ZTRA 5JLXA 2KDZA 3BQYA 3MVPA 3H0GJ 2DA2A 4A93J 1RPWA 2EZKA 3ZQFA 4L5EA 4UUSB 3K7AJ 1ENHA 2WAQN 2E19A 3ZQCA 2NVYJ 4NDLA 2IBDA 4UUTA 1FTZA 1JUMA 1RKWA 1K61A 3BR5A 1ZR2A 1IJWC 2Y0SN 3HOZJ 4XRMA 1VFCA 1JJ6C 4D5CA 4A3GJ 4X6AJ 1ITYA 1GV2A 3GTQJ 1ZKGA 4C3JJ 2CU7A 3B6AA 3IV5A 4IHVA 1IDYA 2QF7A 4D7MA 3IH4A 3HM5A 4FE4A 5FLMJ 2JJ7A 3BR1A 3MN2A 5E3OA 4IHXA 5M3MJ 2CJJA 2KT0A 2JN6A 5C44J 2XGEA 3A01B 1PUFA 3CQZJ 3FKIJ 3G1LA 5IOYA 4BY1J 5K7HA 5HODA 2LP0A 4XK4A 2CUFA 3NARA 1E3OC 3BTIA 5DS9A 1TWFJ 1Y1VJ 5F0HA 4RBOA 3HOXJ 1ETVA 1LE8A 4ABZA 2HI3A 1BW6A 2JWTA 1JKOC 4V2GA 3BR3A 1A5JA 1LFBA 1JTYA 3Q3SA 2L7ZA 4C2MJ 5GPCA 3GBGA 5EG0B 4FCYA 5FLVA 4A3DJ 3QPLA 2HYJA 2R5YB 2Y9YA 2DA5A 3O8HA 3S1MJ 4A3CJ 2ELKA 2XGCA 2CQXA 5C4XJ 3BTJA 2FD5A 1IDZA 2H1KA 1QRYA 1TWGJ 2E1OA 2LK2A 5BNGA 1R9TJ 1JKRC 2K40A 5F04A 3JRBA 5EZGA 2NVQJ 3ZQHA 3JRIA 2DA4A 1UHSA 2NS8A 4EEFG 2AO9A 3LSJA 2FQ4A 4XICA 1H89C 4IHYA 3RZDJ 4B1RA 2M9HA 4JX6A 1MBJA 3JRHA 1WGXA 1Y1WJ 4DZPA 3S16J 2G0EA 2DMQA 1YRNB 1F43A 2GBYA 1X2MA 4FTHA 3BQZA 4UUSA 1BA5A 2VUMJ 1W0UA 1TWCJ 5F0FA 3CDLA 5IYBJ 2P81A 3HOWJ 1IUFA 1WCMJ 3S1NJ 2DJNA 3JRAA 2L7MP 1RETA 2H8RA 3PM1A 1BJZA 4DYCA 2XB0X 1MNMC 1I3QJ 4XRSG 3HDDA 1CQTA 2Y9ZA 2DMPA 1MH4A 2R0QC 3HEFA 1Z0XA 1WH7A 1MBGA 4M6VA 1WPKA 4A69C 5EDNA 3IH2A 5FJ8J 2X9DA 5C4JJ 5E3MA 1T56A 2D5VA 3HKZN 2NVTJ 4B4CA 2M34A 3WHBA 3ZQIA 2VI6A 2XPVA 2B63J 1RKTA 1FIPA 2R5ZB 1U8BA 3OOUA 1POGA 1NTCA 4M3EA 5IPAA 5IOZA 2LFBA 1VI0A 3ZQLA 4Y52J 4W1UA 4AC0A 2XPWA 2COBA 2OPTA 2DTZA 3W6VA 1NK2P 2MG4A 3S1QJ 2R5YA 5M5YJ 4A3MJ 3TW7A 2M0CA 1F36A 2DA6A 3FK7A 4MLOA 2E2IJ 2CUEA 3JR9A 1APLC 3BR0A 3TP0A 4DYRA 2N8GA 2MGQA 4X1EA 2FJ1A 3BTCA 1TWHJ 5GPAA 5J1UA 1FEXA 2Y31A 1ETOA 1W0TA 1HDPA 4M3FA 1WH5A 2IEKA 1XC5A 3LSRA 1IGNA 2JA5J 4M3BA 4A3EJ 4C3HJ 1AKHB 2DA7A 2M2EA 2NVXJ 1U78A 3ZQGA 3GTOJ 4W97A 1QVUA 2TCTA 5FKKA 1B72B 1MBHA 1U9NA 3DEWA 4JP0A 5DTDA 2JK3A 1JUSA 4A3FJ 1S7EA 2EZIA 3S14J 2DMUA 5EGOB 3ZOBA 1AU7A 1FIAA 4GFBA 4V2FA 5IP9J 1ORKA 5IYCJ 1HF0A 4XRSA 3VPRA 3GTGJ 1MBFA 1ZGWA 2VPRA 1JT0A 3D1NI 2R7ZJ 4CYCA 1A6IA 3OSGA 2DMTA 1ZK8A 1UMQA 1P7JA 2ZB9A 4BXXJ 5EZHA 5F27A 1MSFC 4S0HB 1ETKA 1IRZA 4D5FA 3M3YJ 3FIWA 1G2HA 2AHQA 3BG3A 3HOYJ 2LKXA 2PMZN 1EF4A 2ECCA 4BBRJ 2XB5A 3LSPA 1ZQ3P 3FISA 5IYDJ 2DN0A 1IG7A 4QTRA 5FKNA 1I50J 1H8AC 4J19A 1Z77A 2X6OA 2LD5A 1JTXA 2NOGA 1PUFB 1IC8A 2HOAA 3JRGA 3H3VK 5EF6A 3O8GA 2XSDC 2ME0A 5C3EJ 2Y30A 2XPUA 3JREA 1JJ8C 1LE8B 2NS7A 2M8GX 3RZOJ 2RAEA 2EQRA 4BKXA 5FKOA 2L7FP 3C2BA 2EZHA 2EZLA 4FISA 2DMNA 3A01A 4IHWA 1BW5A 5FKLA 1WI3A 2QCOA 4A3IJ 1TC3C 3S17J 1B8IB 3HBLA 2WV1A 1XG1A 4DYQA 3G1OA 2YUSA 2LVSA 1K83J 2VKEA 4MO7A 3GTJJ 2JMWA 5E3NA 2GLOA 5K7ZA 3OIOA 2GM4A 2JA7J 5J3LA 4MFEA 1FTTA 1ETQA 3BR6A 2HOSA 2ME6A 4MIMA 4Y7NJ 5EG0A 3GTPJ 1ETWA 2FX0A 3I4MJ 3K2AA 2DA1A 2K9NA 1MH3A 5F1JA 1MBKA 2EBIA 4IEJA 3HOVJ 2VKVA 2ECBA 4A3BJ 2L0KA 4LOCA 5F08A 1RR7A 2E2HJ 1JUPA 5F0CA 3GTMJ 2CRGA 2L9RA 5GP9A 3A02A 2W48A 1SANA 3PO2J 2HXOA 2XGDA 1GDTA 3GTKJ 1P7IA 3S2HJ 4I6ZA 1FJLA 3DCFA 3B6CA 2JA8J 4M3DA 5J1RA 5K7FA 1YRNA 3CMYA 2LY9A 1ZR4A 3CCYA 2MW8A 1RESA 5EEAA 4XIDA 1OCTC 1ETXA 2HDDA 5J1YA 2O9LA 3HGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF9 A;  2Y2Z A;  2XRL A;  1IV6 A;  1DU6 A;  3OSF A;  2YS9 A;  4I76 A;  1TWA J;  3G1M A;  1GVD A;  3BR2 A;  5M5W J;  2MSY A;  1X2N A;  3QPS A;  1SFO J;  4BBS J;  1HLV A;  1GUU A;  1QPI A;  2LR8 A;  3BT9 A;  2LTP A;  1JT6 A;  4B3A A;  2E2J J;  2HOT A;  3NAU A;  3SDG A;  4RDU A;  2K9Q A;  2WB1 N;  2I10 A;  4FE7 A;  4G12 A;  5IP7 J;  1BL0 A;  1B8I A;  3GTL J;  1I6H J;  3QQA A;  2R92 J;  1D5Y A;  3SFI A;  3L1P A;  4HNV A;  2R5Z A;  1LFU P;  3M4O J;  1DU0 A;  1ETY A;  1MSE C;  1X58 A;  2X48 A;  3JRD A;  1U9O A;  3UKG A;  2ID6 A;  5IP6 A;  1JKP C;  1Q1V A;  1UG2 A;  4AYB N;  3PO3 J;  9ANT A;  3E7L A;  1OCP A;  1XS9 A;  3LNQ A;  1OJL A;  1QVT A;  2HQ5 A;  3F0C A;  5M5X J;  1OFC X;  4DW6 A;  2ID3 A;  1H88 C;  2O7O A;  3BG9 A;  1HOM A;  4BY7 J;  3S2D J;  3SJM A;  5FKM A;  1VND A;  3LOC A;  3Q0V A;  4M3G A;  4MFD A;  3WHC A;  3S1R J;  1GV5 A;  4C3I J;  4DZJ A;  4A3L J;  3S15 J;  3FK6 A;  4QIW N;  2IAI A;  1HDD C;  1MBE A;  2EH3 A;  5JLW A;  2YU9 J;  4JX5 A;  2JA6 J;  3HGG A;  4JYK A;  1AKH A;  3TP3 A;  4AUX A;  3HB9 A;  3RKQ A;  3HOU J;  3TW6 A;  5E3L A;  2LLK A;  1B72 A;  2O8K A;  3JRC A;  3Q0U A;  2HXI A;  1T33 A;  4CYC B;  5EYR A;  3MKL A;  3BTL A;  1NK3 P;  3IH3 A;  4QSH A;  1JKQ C;  1AHD P;  1HCR A;  3I4N J;  5EGO A;  1O4X A;  2K9S A;  3LSG A;  4JX4 A;  3TED A;  4A3K J;  4D7N A;  1GT0 C;  2DA3 A;  2R93 J;  3RQI A;  2CQQ A;  5M3F J;  3JRF A;  1JGG A;  3Q0W A;  3A03 A;  4A3J J;  3BG5 A;  2OF7 A;  2TRT A;  1ZTR A;  5JLX A;  2KDZ A;  3BQY A;  3MVP A;  3H0G J;  2DA2 A;  4A93 J;  1RPW A;  2EZK A;  3ZQF A;  4L5E A;  4UUS B;  3K7A J;  1ENH A;  2WAQ N;  2E19 A;  3ZQC A;  2NVY J;  4NDL A;  2IBD A;  4UUT A;  1FTZ A;  1JUM A;  1RKW A;  1K61 A;  3BR5 A;  1ZR2 A;  1IJW C;  2Y0S N;  3HOZ J;  4XRM A;  1VFC A;  1JJ6 C;  4D5C A;  4A3G J;  4X6A J;  1ITY A;  1GV2 A;  3GTQ J;  1ZKG A;  4C3J J;  2CU7 A;  3B6A A;  3IV5 A;  4IHV A;  1IDY A;  2QF7 A;  4D7M A;  3IH4 A;  3HM5 A;  4FE4 A;  5FLM J;  2JJ7 A;  3BR1 A;  3MN2 A;  5E3O A;  4IHX A;  5M3M J;  2CJJ A;  2KT0 A;  2JN6 A;  5C44 J;  2XGE A;  3A01 B;  1PUF A;  3CQZ J;  3FKI J;  3G1L A;  5IOY A;  4BY1 J;  5K7H A;  5HOD A;  2LP0 A;  4XK4 A;  2CUF A;  3NAR A;  1E3O C;  3BTI A;  5DS9 A;  1TWF J;  1Y1V J;  5F0H A;  4RBO A;  3HOX J;  1ETV A;  1LE8 A;  4ABZ A;  2HI3 A;  1BW6 A;  2JWT A;  1JKO C;  4V2G A;  3BR3 A;  1A5J A;  1LFB A;  1JTY A;  3Q3S A;  2L7Z A;  4C2M J;  5GPC A;  3GBG A;  5EG0 B;  4FCY A;  5FLV A;  4A3D J;  3QPL A;  2HYJ A;  2R5Y B;  2Y9Y A;  2DA5 A;  3O8H A;  3S1M J;  4A3C J;  2ELK A;  2XGC A;  2CQX A;  5C4X J;  3BTJ A;  2FD5 A;  1IDZ A;  2H1K A;  1QRY A;  1TWG J;  2E1O A;  2LK2 A;  5BNG A;  1R9T J;  1JKR C;  2K40 A;  5F04 A;  3JRB A;  5EZG A;  2NVQ J;  3ZQH A;  3JRI A;  2DA4 A;  1UHS A;  2NS8 A;  4EEF G;  2AO9 A;  3LSJ A;  2FQ4 A;  4XIC A;  1H89 C;  4IHY A;  3RZD J;  4B1R A;  2M9H A;  4JX6 A;  1MBJ A;  3JRH A;  1WGX A;  1Y1W J;  4DZP A;  3S16 J;  2G0E A;  2DMQ A;  1YRN B;  1F43 A;  2GBY A;  1X2M A;  4FTH A;  3BQZ A;  4UUS A;  1BA5 A;  2VUM J;  1W0U A;  1TWC J;  5F0F A;  3CDL A;  5IYB J;  2P81 A;  3HOW J;  1IUF A;  1WCM J;  3S1N J;  2DJN A;  3JRA A;  2L7M P;  1RET A;  2H8R A;  3PM1 A;  1BJZ A;  4DYC A;  2XB0 X;  1MNM C;  1I3Q J;  4XRS G;  3HDD A;  1CQT A;  2Y9Z A;  2DMP A;  1MH4 A;  2R0Q C;  3HEF A;  1Z0X A;  1WH7 A;  1MBG A;  4M6V A;  1WPK A;  4A69 C;  5EDN A;  3IH2 A;  5FJ8 J;  2X9D A;  5C4J J;  5E3M A;  1T56 A;  2D5V A;  3HKZ N;  2NVT J;  4B4C A;  2M34 A;  3WHB A;  3ZQI A;  2VI6 A;  2XPV A;  2B63 J;  1RKT A;  1FIP A;  2R5Z B;  1U8B A;  3OOU A;  1POG A;  1NTC A;  4M3E A;  5IPA A;  5IOZ A;  2LFB A;  1VI0 A;  3ZQL A;  4Y52 J;  4W1U A;  4AC0 A;  2XPW A;  2COB A;  2OPT A;  2DTZ A;  3W6V A;  1NK2 P;  2MG4 A;  3S1Q J;  2R5Y A;  5M5Y J;  4A3M J;  3TW7 A;  2M0C A;  1F36 A;  2DA6 A;  3FK7 A;  4MLO A;  2E2I J;  2CUE A;  3JR9 A;  1APL C;  3BR0 A;  3TP0 A;  4DYR A;  2N8G A;  2MGQ A;  4X1E A;  2FJ1 A;  3BTC A;  1TWH J;  5GPA A;  5J1U A;  1FEX A;  2Y31 A;  1ETO A;  1W0T A;  1HDP A;  4M3F A;  1WH5 A;  2IEK A;  1XC5 A;  3LSR A;  1IGN A;  2JA5 J;  4M3B A;  4A3E J;  4C3H J;  1AKH B;  2DA7 A;  2M2E A;  2NVX J;  1U78 A;  3ZQG A;  3GTO J;  4W97 A;  1QVU A;  2TCT A;  5FKK A;  1B72 B;  1MBH A;  1U9N A;  3DEW A;  4JP0 A;  5DTD A;  2JK3 A;  1JUS A;  4A3F J;  1S7E A;  2EZI A;  3S14 J;  2DMU A;  5EGO B;  3ZOB A;  1AU7 A;  1FIA A;  4GFB A;  4V2F A;  5IP9 J;  1ORK A;  5IYC J;  1HF0 A;  4XRS A;  3VPR A;  3GTG J;  1MBF A;  1ZGW A;  2VPR A;  1JT0 A;  3D1N I;  2R7Z J;  4CYC A;  1A6I A;  3OSG A;  2DMT A;  1ZK8 A;  1UMQ A;  1P7J A;  2ZB9 A;  4BXX J;  5EZH A;  5F27 A;  1MSF C;  4S0H B;  1ETK A;  1IRZ A;  4D5F A;  3M3Y J;  3FIW A;  1G2H A;  2AHQ A;  3BG3 A;  3HOY J;  2LKX A;  2PMZ N;  1EF4 A;  2ECC A;  4BBR J;  2XB5 A;  3LSP A;  1ZQ3 P;  3FIS A;  5IYD J;  2DN0 A;  1IG7 A;  4QTR A;  5FKN A;  1I50 J;  1H8A C;  4J19 A;  1Z77 A;  2X6O A;  2LD5 A;  1JTX A;  2NOG A;  1PUF B;  1IC8 A;  2HOA A;  3JRG A;  3H3V K;  5EF6 A;  3O8G A;  2XSD C;  2ME0 A;  5C3E J;  2Y30 A;  2XPU A;  3JRE A;  1JJ8 C;  1LE8 B;  2NS7 A;  2M8G X;  3RZO J;  2RAE A;  2EQR A;  4BKX A;  5FKO A;  2L7F P;  3C2B A;  2EZH A;  2EZL A;  4FIS A;  2DMN A;  3A01 A;  4IHW A;  1BW5 A;  5FKL A;  1WI3 A;  2QCO A;  4A3I J;  1TC3 C;  3S17 J;  1B8I B;  3HBL A;  2WV1 A;  1XG1 A;  4DYQ A;  3G1O A;  2YUS A;  2LVS A;  1K83 J;  2VKE A;  4MO7 A;  3GTJ J;  2JMW A;  5E3N A;  2GLO A;  5K7Z A;  3OIO A;  2GM4 A;  2JA7 J;  5J3L A;  4MFE A;  1FTT A;  1ETQ A;  3BR6 A;  2HOS A;  2ME6 A;  4MIM A;  4Y7N J;  5EG0 A;  3GTP J;  1ETW A;  2FX0 A;  3I4M J;  3K2A A;  2DA1 A;  2K9N A;  1MH3 A;  5F1J A;  1MBK A;  2EBI A;  4IEJ A;  3HOV J;  2VKV A;  2ECB A;  4A3B J;  2L0K A;  4LOC A;  5F08 A;  1RR7 A;  2E2H J;  1JUP A;  5F0C A;  3GTM J;  2CRG A;  2L9R A;  5GP9 A;  3A02 A;  2W48 A;  1SAN A;  3PO2 J;  2HXO A;  2XGD A;  1GDT A;  3GTK J;  1P7I A;  3S2H J;  4I6Z A;  1FJL A;  3DCF A;  3B6C A;  2JA8 J;  4M3D A;  5J1R A;  5K7F A;  1YRN A;  3CMY A;  2LY9 A;  1ZR4 A;  3CCY A;  2MW8 A;  1RES A;  5EEA A;  4XID A;  1OCT C;  1ETX A;  2HDD A;  5J1Y A;  2O9L A;  3HGY A; 
#chains in the Genus database with same CATH topology
 4AVZ A;  2GIV A;  3PIP F;  1VQN I;  1N75 A;  1A04 A;  1F1Z A;  1FT9 A;  2MH9 A;  1KGS A;  2YS9 A;  1TWA J;  3G1M A;  2M5W A;  1IXC A;  4E7H A;  3OIP A;  3BR2 A;  2BVM A;  5M5W J;  1P6R A;  4KYW A;  3QPS A;  3CJN A;  2VC0 A;  4I02 A;  1QPI A;  1X3Z B;  1LB2 A;  3K4J A;  4KMU X;  5D6E A;  3F23 A;  3PSF A;  4M9X A;  2MD5 A;  5TRD A;  3SDG A;  2Z1D A;  1ZGA A;  3G4S I;  2A6T A;  3M8J A;  3ZXS A;  2HGC A;  3RI4 A;  2ZCW A;  1YTY A;  2CFO A;  2JSP A;  3L1P A;  1XN7 A;  4RB3 C;  1LFU P;  1VQL I;  1DU0 A;  3REO A;  4EV0 A;  1X58 A;  1P4X A;  1YJW I;  3UKG A;  2ID6 A;  4CGZ A;  3PO3 J;  3FXJ A;  3OS1 A;  2H8W A;  3GXO A;  1XS9 A;  3K10 A;  1OJL A;  3H5A A;  1Y56 A;  1IF1 A;  3FMQ A;  4KIS A;  2EIN H;  2HQN A;  3S2D J;  3SJM A;  3OMY A;  2W25 A;  3Q0V A;  5LHG A;  2F4O B;  5TIS C;  3HUG A;  2KZG A;  4KA4 A;  1GV5 A;  4DZJ A;  2AQE A;  2XRO A;  3BJO A;  1AOY A;  2V79 A;  3FK6 A;  5H6Q A;  3HOS A;  2PMU A;  5KAF C;  1WVR A;  1HDD C;  1MBE A;  2JTV A;  4RGR A;  2YU9 J;  4KIG A;  1O3S A;  5FGM A;  1NHA A;  1MZB A;  4ETS A;  1OPC A;  2R7W A;  5CVJ A;  3HB9 A;  3AG1 H;  3S32 A;  5E3L A;  2WY8 Q;  2LLK A;  1B72 A;  2O8K A;  3WTT C;  2HXI A;  3L7W A;  1T33 A;  4MNU A;  3KCC A;  2QWW A;  3FXR A;  3X2Q H;  1RR8 C;  5E8G A;  4QSH A;  1JKQ C;  5DV5 A;  3CLQ A;  2JSC A;  5K1Y A;  1IXR C;  3MZ8 A;  5GTI C;  3LFK A;  5DCF A;  5CYV A;  2JPC A;  4YRV A;  5D4R A;  1FYL A;  1ZG1 A;  1O4X A;  2VKD A;  3TED A;  4LG3 A;  4Y15 A;  4ENJ A;  1WJE A;  2NS0 A;  3I9V 2;  5FFX A;  5M3F J;  1P4W A;  1JGG A;  4CSW A;  4BGD A;  1TQI A;  3EQL F;  2OJE D;  4PGG A;  4ITV A;  4CH7 A;  4OAY A;  1ZTR A;  3CES A;  4AIK A;  3ZMZ A;  2BY3 A;  3UNG C;  1YX5 A;  2PLY A;  4A93 J;  1RPW A;  1S72 I;  2O5R A;  2LNB A;  3FXO A;  3UR3 C;  1D5V A;  4FT8 A;  2OTJ I;  3IKT A;  1PP8 F;  3EUH A;  2ZXJ A;  4PSX A;  1JHH A;  4BAC A;  2IBD A;  2GWR A;  2WBM A;  3BR5 A;  5J8C A;  2Y0S N;  3LA7 A;  1JJ6 C;  4D5C A;  3QU3 A;  1G4D A;  3C2G A;  1EH8 A;  3LWF A;  4A3G J;  4M74 A;  2K02 A;  4CCN A;  4FX0 A;  3IV5 A;  4HOB A;  2EJR A;  4ESB A;  4BDY A;  1YFH A;  4IJA A;  1BC8 C;  2H27 A;  2ESH A;  4D7M A;  1NG6 A;  3GVA A;  3HM5 A;  4HEA 2;  3MN2 A;  3OYD A;  4NC8 A;  1HST A;  5E3O A;  2XAU A;  3A01 B;  2BHY A;  4XOT A;  1SMY F;  3F8N A;  3FKI J;  3G1L A;  4BY1 J;  1K6Y A;  3D5L A;  3GEZ A;  1X1A A;  5FRM A;  3JSP A;  1W5C C;  3S3O A;  1TWF J;  3WTZ A;  1Y1V J;  3EUK L;  3C18 A;  2BBY A;  3F8M A;  2DPD A;  2JT1 A;  4R1H A;  3BR3 A;  5FLV A;  4FCY A;  4LMY A;  2GIZ A;  2IS1 A;  2ZC2 A;  3LQQ A;  5ICC A;  1HW2 A;  1OYW A;  2HZT A;  5FO5 A;  1H9G A;  1X4P A;  2IA2 A;  3ZCO A;  4ENM A;  1PUE E;  3OIQ A;  1IW7 F;  3H9G A;  1BIA A;  4G7Z F;  3BWG A;  4PZJ A;  2E1O A;  4G94 A;  3TL4 X;  4I2O A;  1CF7 B;  4XLC A;  4BAY A;  1QA6 A;  1YS7 A;  2KRH A;  3HTU A;  3R0J A;  2AO9 A;  2FML A;  2FQ4 A;  2Z99 A;  3V7S A;  1H89 C;  2HQR A;  4DBQ A;  2QBY A;  2ELJ A;  3M8E A;  1MBJ A;  3O3K A;  1VQ7 I;  4YFN F;  3JRH A;  1Y1W J;  2ZXI A;  2VON A;  2QZ8 A;  2G0E A;  2CO5 A;  1PVE A;  1FNN A;  3AG4 H;  1J7K A;  1S8N A;  3SEQ A;  4UUS A;  1F4K A;  2R7F A;  2WAD A;  5DD4 A;  1UCR A;  5IYB J;  2P81 A;  2K9L A;  2EFN A;  3HOW J;  4RLF A;  4LB5 A;  3S1N J;  4AIJ A;  1PP7 U;  2W7N A;  4AD9 A;  2LKS A;  4ZZL A;  2X1C A;  1E3P A;  1YW7 A;  2AXL A;  2JRT A;  3TOA A;  4DYC A;  1I3Q J;  1MNM C;  3NQO A;  4RAZ A;  2V1D A;  4KIB A;  3KET A;  2ADU A;  4CCJ A;  1Z0X A;  2ZJ2 A;  3QP6 A;  1UZC A;  1MBG A;  4S04 A;  4M6V A;  3GYH X;  4A69 C;  4G7H F;  2KQR A;  2X9D A;  1T98 A;  2ISY A;  5E3M A;  3HKZ N;  4MEY F;  4RA2 A;  1T6S A;  2D45 A;  1MMG A;  2M34 A;  5ICF A;  1FLI A;  2B63 J;  1U3E M;  4HG2 A;  4G6D A;  1VQO I;  1U8B A;  5KK1 A;  3TQN A;  4GYG A;  3WE3 A;  3CUQ C;  2A5W A;  5IPA A;  3CDH A;  5GAH J;  4Y33 A;  1DGW Y;  4AC0 A;  5HLG A;  4HF1 A;  1D0Z A;  3T8T A;  1K4S A;  2DTZ A;  3LSI A;  4WXC A;  3W6V A;  4B48 A;  4M6Y A;  4IRH A;  1WRJ A;  2R5Y A;  3BJ6 A;  1RRJ A;  5M5Y J;  1D1B A;  2L54 A;  1F36 A;  1IN6 A;  1D1A A;  3JR9 A;  3CP8 A;  3ECO A;  4HQE A;  1LDK B;  4IOC F;  2BXZ A;  2DQL A;  2GA1 A;  5HDG A;  3JTG A;  3L2R A;  5J1U A;  1YX3 A;  3OV8 A;  3PQK A;  4A6D A;  4M3F A;  2KZV A;  4OIQ F;  4ZYH A;  3I55 I;  3VYU B;  1W4M A;  4IOA F;  3BRO A;  4A3E J;  4C3H J;  4LIU A;  4KDP A;  1U78 A;  4TV7 A;  1MBH A;  2AXT C;  3DEW A;  4PK4 A;  3I53 A;  2JK3 A;  3FWE A;  1JGS A;  2BVL A;  2R7U A;  4IVN A;  3CC4 I;  4AYB A;  4PJN A;  4GXO A;  2DMU A;  5EGO B;  5CKT A;  1AU7 A;  5KCM A;  3N97 A;  4XRS A;  2X6X A;  4F7Z A;  1DP7 P;  2H1L A;  1ZGW A;  2CV2 A;  2R7Z J;  2DOD A;  1U8R A;  2M4K A;  2VE9 A;  2ZJQ F;  5EEG A;  2L2O A;  3L2V A;  5ICG A;  4C2T A;  2IGM A;  2VC1 A;  5JHF A;  4BXX J;  4B8X A;  5F27 A;  1ON2 A;  5ICE A;  2V1X A;  1IRZ A;  1P2F A;  3PNY A;  2DJI A;  3BC8 A;  2E1M B;  3WTW C;  1D8J A;  4LG0 B;  1FSH A;  3OYK A;  1G2H A;  2Q0O A;  2ZSI B;  1Z7L A;  5H20 A;  4BJ6 C;  3OS2 A;  2LKX A;  2ECC A;  3LSP A;  2XB5 A;  3HPH A;  2EA2 A;  2I5U A;  2ICW G;  4L0Y B;  3KP3 A;  1O3R A;  2X4H A;  1VTN C;  1I50 J;  1AWC A;  2HWV A;  3OYL A;  1H8A C;  3V4G A;  3MZY A;  3FF5 A;  3U1D A;  3MFK A;  1UST A;  1LVA A;  4HW0 A;  3QOD A;  1ZEL A;  1XCB A;  2LD5 A;  2M45 A;  4NQW B;  4HF0 A;  3JRG A;  3N05 A;  3H3V K;  3O8G A;  1R49 A;  5ILU A;  2DO7 A;  2ME0 A;  2Y30 A;  3GCM A;  2XPU A;  1YE9 A;  1WJA A;  1OCZ H;  2CV0 A;  4FQG A;  4R8H A;  5B5E C;  3H35 A;  3OYC A;  4E7Z A;  2M8G X;  2L9S A;  3G73 A;  1OMI A;  4II2 A;  2WAQ A;  2PJP A;  4BKX A;  2L7K A;  3H5R A;  5FKO A;  1SFU A;  3CD6 I;  2XUB A;  2EZL A;  4FIS A;  3A01 A;  1BW5 A;  4A3I J;  4IRI A;  4GDF A;  3GZN B;  3GFM A;  2LVS A;  3ZMS A;  3J80 K;  2H6C A;  3WG9 A;  2FBK A;  4FAS D;  2JMW A;  5E3N A;  3E6M A;  3CJR B;  2GLO A;  2OQG A;  2GM4 A;  2JA7 J;  2JPB A;  4HPQ A;  1ETQ A;  2MLK A;  2HOS A;  5D8L B;  2KFD A;  5FD6 A;  4MIM A;  4P9F A;  5BMZ A;  2Y75 A;  3LSM A;  1ACI A;  2VIX A;  4U87 A;  2DA1 A;  3G3Z A;  3L09 A;  4S05 A;  2BHZ A;  2WC2 A;  3EYI A;  2E2H J;  5CVV A;  1Y8Q B;  3A02 A;  2X1D A;  2L5Q A;  1KU9 A;  4FHT A;  4PJ0 C;  1LNW A;  1CF7 A;  1X1B A;  4HNT A;  2O61 A;  3PO2 J;  4HBL A;  4GGG A;  3HRM A;  3KIO A;  1DPR A;  4HLX A;  1HQC A;  4XOP A;  4RAY A;  3P7N A;  3IAM 2;  3GTK J;  2MAB A;  2HDW A;  1UHW A;  1FJL A;  3DBL B;  3CLO A;  3W2W A;  4NUB A;  3B6C A;  1RNL A;  1XSV A;  4M3D A;  2HNH A;  1Z6T A;  4KJZ A;  2K3F A;  1D0X A;  2LY9 A;  3CMY A;  1ZRF A;  4IX7 A;  2MW8 A;  1R1V A;  2O6G E;  4L9N A;  2HDD A;  4MQV A;  4HA8 A;  5J1Y A;  5DYM A;  2UZK A;  2LYC A;  2H6B A;  2Z3Y A;  4EQQ A;  2KDO A;  4KNY A;  1DU6 A;  4WXH A;  4I76 A;  2HS5 A;  2WY7 Q;  2L02 A;  4M9Z A;  3MZH A;  2HEO A;  4O3M A;  3JW4 A;  1QZZ A;  1R7J A;  3GFI A;  1GVD A;  1Y39 A;  1IZ1 A;  2CH0 A;  3R61 A;  1X1D A;  3P5J A;  1BIB A;  3MKW B;  3V8L A;  4RAF A;  1SD7 A;  4HV6 A;  3NAU A;  4C30 A;  2WB1 N;  2AQF A;  2I10 A;  4G12 A;  1B8I A;  4KMF A;  4F91 B;  3SHF A;  2R92 J;  2BY0 A;  4EAT A;  1FYM A;  3L2U A;  1MJ9 A;  3WGI A;  1QBJ A;  3M4O J;  1MSE C;  4QPQ A;  4BJT A;  3M07 A;  1R1U A;  1FP1 D;  2DOF A;  2RNJ A;  1NH3 A;  1QVT A;  2HQ5 A;  2CUJ A;  2P0W A;  4Y13 A;  5M5X J;  1WKM A;  1BI3 A;  1H88 C;  1R58 A;  5FKM A;  1VND A;  3WHC A;  3F3X A;  4XM3 A;  3S93 A;  3S1R J;  5TJJ A;  1EJ9 A;  3AFH A;  3IHU A;  2DT5 A;  2FF4 A;  3GWZ A;  5D6F A;  5DM7 F;  2R7D A;  4A3L J;  4F93 B;  2BE5 F;  3E1S A;  3BOQ A;  4AU7 A;  4QIW N;  3EUH C;  5BQT A;  3ULQ B;  1BN5 A;  2IAI A;  2YPR A;  3A4C A;  2D2W A;  3WE2 A;  2GXB A;  4JX5 A;  5L3B A;  3R6S A;  3HGG A;  1QU3 A;  1FSE A;  3TO6 A;  1E3H A;  4RB0 A;  2P6T A;  3VYR B;  2XF6 A;  5E1W A;  2ZSH B;  5JR3 A;  5HOO A;  1TL8 A;  2HPM A;  3Q0U A;  2XAH A;  1V54 H;  2J5P A;  2Q1Z B;  4N9I A;  4P55 A;  5EYR A;  3A0H C;  3MKL A;  1NK3 P;  4E6K G;  1ZN2 A;  4PJJ A;  3RTR A;  5LFA A;  3WOD F;  3QWL A;  5EGO A;  2O3F A;  3PJR A;  3BG7 A;  3QOE A;  5A2Q Z;  3DKY A;  3CF2 A;  4PUS A;  5BS6 A;  4A3K J;  4E7L A;  4D7N A;  2DA3 A;  1SVM A;  2K5C A;  3RQI A;  2PEX A;  4YII A;  3QYE A;  2HKX A;  4L9J A;  3A2K A;  3BG5 A;  2OF7 A;  2UWM A;  2TRT A;  3JAM Z;  1W7P A;  3MVP A;  3H0G J;  2VBW A;  2LMD A;  2XAG A;  3OWT A;  4DOZ A;  4UUS B;  1ENH A;  2E19 A;  3P9I A;  4IL6 C;  2NVY J;  4BHP A;  1JE8 A;  4XLA A;  1XGM A;  4LG0 A;  1RKW A;  1K61 A;  2JZY A;  6PAX A;  1IJW C;  1ZR2 A;  2IGN A;  3CCV I;  3HOZ J;  3LAJ A;  2V4J C;  4JK1 X;  1BI1 A;  3ABU A;  1ITY A;  2XHK A;  1RC9 A;  4BHC A;  2CU7 A;  4QLC U;  2LC2 A;  1X4O A;  1VQ4 I;  1WSU A;  2QF7 A;  3FMR A;  3RQ4 A;  2F5F A;  4FE4 A;  2E1C A;  1R00 A;  2EFP A;  2EFO A;  3CUO A;  3DTI A;  2KIM A;  5C44 J;  2HOE A;  1DP3 A;  4NQW A;  3AAF A;  3VFZ A;  5K7H A;  2FBH A;  3I59 B;  3IWF A;  4F92 B;  2F48 A;  2LP0 A;  5HNF A;  3L2W A;  1WQ2 A;  2QYO A;  5DS9 A;  3ZMD A;  5F0H A;  4RBO A;  3M8F A;  3C1D A;  4ABZ A;  3RCO A;  1JKO C;  2PJR B;  1J09 A;  1BI0 A;  4AIH A;  1LFB A;  1WHU A;  3L2Q A;  1JTY A;  3Q3S A;  2L7Z A;  3MWM A;  3U9G A;  4KUM A;  5GPC A;  3BY6 A;  4XOR A;  5CVU A;  1S5L C;  5EG0 B;  1KYW A;  2OCE A;  4IQ4 A;  3LST A;  2HYJ A;  3G6E I;  2R5Y B;  4E7S A;  2PMH A;  4L9T A;  3FXM A;  2Y9Y A;  3AL0 B;  3BCB A;  2CMP A;  3I54 A;  1ZGJ A;  2EV6 A;  2XIG A;  2ELK A;  3PIO F;  2CQX A;  5DUI A;  1FBS A;  2FD5 A;  1T38 A;  4M9S A;  4HV5 A;  4M71 A;  3HJE A;  4OMY A;  5LEK A;  4ZTJ A;  4ZYD A;  1R9T J;  2HVS A;  4EJT A;  1JKR C;  2K40 A;  4GCV A;  1ONV A;  4LJZ F;  2ZNZ A;  1WJD A;  1S3J A;  3WU1 B;  2L01 A;  4J00 A;  2QEN A;  2PI0 A;  1R23 A;  5JVG F;  4E4H A;  1EH7 A;  2JUC A;  5KHD A;  2XRN A;  5LHI A;  3RZD J;  2M9H A;  4F55 A;  2M8E A;  4XON A;  4WX9 A;  2YX7 A;  1QHG A;  1MJA A;  2DMQ A;  1TW2 A;  4RGX A;  1YRN B;  1F43 A;  1TTY A;  3E97 A;  1MW7 A;  4FTH A;  1TQP A;  2KRC A;  5E17 F;  1WJ5 A;  1XGO A;  3FM5 A;  5J4V A;  1BA5 A;  3CZ6 A;  1NG7 A;  2VT3 A;  5F0F A;  4E70 A;  4D1Q A;  1R4N B;  1JHF A;  2HR3 A;  2PQ8 A;  3U21 A;  3JRA A;  2DPU A;  2L7M P;  1R5H A;  4L5I A;  1SFX A;  2OC6 A;  3PM1 A;  4HQM A;  4M72 A;  1EV7 A;  1BJZ A;  1SFK A;  4XRS G;  3ABT A;  3HSF A;  5E20 A;  5CJ9 A;  1CQT A;  3HOT A;  2LRD A;  1XDS A;  5CLS A;  2NNY A;  3DEE A;  1K6O A;  1MH4 A;  5JHU A;  3CJT B;  3HEF A;  2R0Q C;  2RDP A;  4RS8 A;  3KZY A;  1C0W A;  1XMX A;  5K5Q A;  3KP6 A;  1R5I D;  1FC3 A;  5EDN A;  3OYM A;  4CHU A;  2ETH A;  2DI3 A;  5ED4 A;  1T56 A;  4B4C A;  4MHG A;  2K9M A;  3WHB A;  3HRU A;  3CF5 F;  3ZRG A;  4I7H A;  2A6E F;  2MYS A;  2X1E A;  2QSG X;  1ZAR A;  4UVC A;  1K78 B;  4XNF A;  2PBI A;  5IT9 K;  3J7A O;  4M3E A;  4I01 A;  5L3D A;  3HXL A;  2IA0 A;  2B0L A;  1Z3Y A;  4ZDP A;  3KEO A;  5J47 A;  4Y52 J;  3N4M A;  2XPW A;  3K4B A;  4IZZ A;  3DV8 A;  4UB6 C;  4CZZ A;  1OR7 A;  4MTD A;  1T08 B;  1NK2 P;  1TT0 A;  3RDI A;  2M0C A;  4V19 K;  2RQQ A;  1J75 A;  4A12 A;  4P9U A;  3H1C A;  5AIP A;  4WK8 F;  3K4M A;  4LB6 B;  2XC7 A;  2TDX A;  2N8G A;  2MGQ A;  1IN8 A;  3KFW X;  1T2K A;  3PFI A;  3W6J B;  5A2Q K;  4IPA A;  5GPA A;  3WGG A;  1FEX A;  2QGU A;  1T0F A;  3OYF A;  1HDP A;  5DD8 A;  3CO7 C;  4LLL A;  1WH5 A;  3LSR A;  4R79 A;  4YG2 F;  3K70 D;  2E34 A;  3VWB A;  5E79 C;  2PMZ A;  4OIN F;  2DA7 A;  1AKH B;  3ZQG A;  4W97 A;  4G7O F;  2MC3 A;  4Y3O A;  3ZN0 A;  1IN5 A;  1R5G A;  1FMW A;  1W1W E;  3QRF F;  1LEB A;  2V6C A;  3IUO A;  3VEP A;  3H9J A;  2EZI A;  3D5S C;  3VYS B;  2WWY A;  2MLG A;  3S14 J;  2KJB A;  2VOP A;  4HX8 A;  2JRM A;  2P4W A;  3FBI B;  1LDD A;  1FBQ A;  3S2W A;  4N0B A;  1PDN C;  1ORK A;  1UEL B;  2BEO A;  3E6D A;  2O0Y A;  2YU3 A;  4E7J A;  3CCQ I;  5JVT A;  3BPX A;  1JT0 A;  2AS5 F;  1LVK A;  1Z3X A;  2PFB A;  2DMT A;  1HC8 A;  1MGT A;  3ZR8 X;  1ZK8 A;  4OAZ A;  2B7E A;  4IXA A;  1M1E B;  2K27 A;  1MMS A;  2Y69 H;  1ZYR F;  4ANJ A;  3S8P A;  4UV8 A;  3FDY A;  1YQA A;  3G71 I;  4S0H B;  3PNT A;  4QPO A;  4ZC3 A;  2X6W A;  4D5F A;  3M3Y J;  1EA3 A;  3OYE A;  3ZN1 A;  1E0E A;  2R7S A;  4PJM A;  1DGR M;  2KL4 A;  4CDG A;  5B3S H;  1ZQ3 P;  5BPD A;  5FLX Z;  3A0B C;  5IYD J;  2DN0 A;  4LLG F;  4QTR A;  5FKN A;  1TBX A;  5B66 C;  3IL2 A;  1J59 A;  2OA4 A;  2P5V A;  3KYL A;  3EPZ A;  2M30 A;  3GME A;  4N4N B;  2X6O A;  2M87 A;  2IPQ X;  1PUF B;  4ON0 A;  1IC8 A;  3FHZ A;  2EV5 A;  2M0M A;  4HDU A;  2FQ3 A;  2PG4 A;  3L9F A;  2XSD C;  4RB1 A;  1ZRD A;  3QPH A;  3VDX A;  4D0P A;  1LDJ A;  3CMM A;  5ERI A;  1LE8 B;  3HSE A;  5AIQ A;  1PYV A;  2DT6 A;  3ABK H;  3RZO J;  2EQR A;  2I8D A;  2L7F P;  2EZH A;  4H4K C;  1MMD A;  2KPM A;  2W00 A;  5FKL A;  1OCO H;  3S17 J;  1B8I B;  2Y0S A;  2G7H A;  2WV1 A;  1HKT A;  2BXY A;  3I59 A;  1VQK I;  4EJW A;  5DM6 F;  4MO7 A;  4UVB A;  1BM9 A;  3RKX A;  2XV4 S;  5FD5 A;  1DQU A;  1QNT A;  2HTS A;  1B4A A;  1VQ9 I;  2P7V B;  5J3L A;  1FTT A;  3E6B A;  2VAS A;  2PJR A;  4XRF A;  3R60 A;  2PX9 A;  1Z9C A;  4Y7N J;  1VQM I;  5EG0 A;  5LGU A;  1ETW A;  4BE2 A;  2IA1 A;  2R4G A;  4PCQ A;  3OS0 A;  2K9N A;  3K1P A;  1MH3 A;  3E6C C;  1MBK A;  4IEJ A;  2E36 A;  2VKV A;  2MH2 A;  2Y48 A;  3HOV J;  2HTJ A;  4A3B J;  2EB7 A;  4LOC A;  4ENN A;  3E3V A;  2JA2 A;  2F6C A;  2XSJ C;  2ZFU A;  2COM A;  3ZMT A;  1JI8 A;  1RUO A;  2LKP A;  1WWX A;  2L3D A;  2CRG A;  2L9R A;  5GP9 A;  2VKH A;  1K79 A;  2R7X A;  1SAN A;  4ENK A;  1USS A;  4YIR X;  2XGD A;  1GDT A;  2L9N A;  3VOD A;  2CSO A;  1S6L A;  2XKO A;  4CCO A;  2FE3 A;  2W1O A;  1G3T A;  3NWT A;  5K5R A;  1YRN A;  5K7F A;  1SEU A;  4P1W A;  2OD5 A;  3K69 A;  2ZJP F;  5EEA A;  4XID A;  5LGN A;  3TKY A;  4I09 A;  4RM2 A;  1VF9 A;  3RKW A;  4IHS A;  1LQ1 A;  2E5N A;  2XRL A;  4RAG A;  3WU2 C;  2KRF A;  2KIU A;  1ODD A;  3OSF A;  3NEU A;  2E7X A;  1Z21 A;  2R7Q A;  3L00 A;  3OL4 A;  2MSY A;  1X2N A;  2V26 A;  2VJI A;  1SFO J;  3LSK A;  3WG7 H;  1HBX G;  1ZHF A;  1HLV A;  1GUU A;  1W7P B;  2EIK H;  2VJ5 A;  4KIC A;  1SMT A;  2Q8K A;  4MTE A;  4UUV A;  3KP4 A;  5LGT A;  4B3A A;  3BPV A;  2STW A;  2HOT A;  5HNH A;  2NNN A;  2K9Q A;  1S29 A;  2XVC A;  2A68 F;  4FE7 A;  1BL0 A;  5IP7 J;  3D0S A;  4BQO A;  2OCC H;  2W4S A;  1ZRC A;  4JOM A;  1KA8 A;  4BYY A;  2BZT A;  1MMA A;  1D5Y A;  3SFI A;  3ECH A;  4HNV A;  4ZDL A;  3KEY A;  1K78 A;  1V5E A;  1QHH D;  1FMV A;  1ETY A;  2UXX A;  2CW7 A;  3ZPL A;  2UXN A;  1UB9 A;  2X48 A;  5D5W B;  2OBP A;  5HDK A;  1ON1 A;  1WJB A;  2BYV E;  1Q1V A;  9ANT A;  5LLQ A;  1MIJ A;  3HKZ A;  3MEX A;  4BQQ A;  2VQH A;  3LNQ A;  3F0C A;  2VQG A;  3GFJ A;  4B44 A;  1OFC X;  1KU3 A;  2M7A A;  1IXS B;  2FMY A;  2ID3 A;  4A2U A;  2FNP A;  3KLN A;  3BG9 A;  4HAM A;  4I98 B;  1HOM A;  3FM3 A;  3HZJ A;  4BY7 J;  3Q9S A;  3I64 A;  4MFD A;  4M3G A;  3PQJ A;  3HRT A;  2DK8 A;  3R4K A;  1F5T A;  1SC7 A;  1ERD A;  4BJ5 C;  3VB2 A;  3DKW A;  2OU2 A;  3HYI A;  1BBY A;  4C3I J;  4WXD A;  5D5V B;  3HG9 A;  1WI9 A;  1B9N A;  3DLL F;  4WWC A;  2LSO A;  2E1M C;  3V8J A;  5JLW A;  2DT7 B;  4UXN A;  2MBF A;  5H6R A;  1A36 A;  2X0L A;  4JYK A;  3OR2 C;  3TO9 A;  2EIM H;  1AKH A;  1D8K A;  4KT6 A;  3RKQ A;  3CCE I;  3QYF A;  3HOU J;  3TW6 A;  3AKZ A;  1IRX A;  4ESF A;  3JRC A;  1X1P A;  3CO6 C;  1I6X A;  4KT5 C;  3T8R A;  4CYC B;  4CCM A;  3BTL A;  3FXK A;  3IH3 A;  3LL7 A;  4NNJ A;  3F8B A;  3DFG A;  3HSR A;  2K9S A;  3LSG A;  4JX4 A;  1YG2 A;  2HVR A;  3F6O A;  3W2A A;  3M9A A;  2K85 A;  4XSX F;  2ACJ A;  1BR2 A;  2XDV A;  1UFM A;  2R93 J;  2W57 A;  1U5T B;  2CQQ A;  1YJN I;  2QQ8 A;  4O6J A;  3JRF A;  1XGN A;  2M1B A;  3Q0W A;  3I3L A;  4XN0 A;  4EM1 A;  2KDZ A;  1Y6I A;  2ZME B;  4ASN A;  1E17 A;  3DU6 A;  3OR1 C;  1R36 A;  5LRS A;  3KP5 A;  3KLO A;  4HZF A;  1JXS A;  3EYY A;  3CCR I;  3ZQC A;  3LA3 A;  2MC4 A;  4XBF A;  2WA0 A;  4NDL A;  1S7O A;  4HX7 A;  2F5C A;  1FTZ A;  5B1B H;  1KQ9 A;  1DUX C;  4XRM A;  3I0T A;  3SQN A;  3MKZ A;  1GV2 A;  1ZKG A;  4C3J J;  3GZ5 A;  4IHV A;  3IAS 2;  1P9Q C;  1D0Y A;  4RM3 A;  1GVJ A;  5FLM J;  2H09 A;  4K2E A;  4IHX A;  5M3M J;  2CJJ A;  2KT0 A;  4OU0 A;  5LHH A;  4DBR A;  3CQZ J;  1PUF A;  2ZNY A;  1I1S A;  3DPL C;  2CUF A;  3NAR A;  3K70 C;  2XAJ A;  3BTI A;  2RV8 A;  2HDC A;  4A0Y A;  2BV6 A;  3H3Z A;  1SVO A;  3HOX J;  4ZTF A;  3FMS A;  1LE8 A;  2A69 F;  4MQ9 F;  4UNO A;  2V9K A;  2JWT A;  3KPH A;  1QQI A;  5GTH C;  3F21 A;  5EJC A;  1A5J A;  2GA2 A;  2QVO A;  1G3Y A;  4A3D J;  4PDK A;  2A07 F;  3ERM A;  1QO0 D;  1Z05 A;  3SZG A;  3HHH A;  3DKX A;  3RPU A;  1DDN A;  3RJP A;  4HNU A;  1G59 A;  1OCR H;  4DGW B;  5FRN A;  2XGC A;  4LGW A;  3KZZ A;  2YSR A;  4IO9 F;  5LD2 C;  2H1K A;  1QRY A;  1EH6 A;  1TWG J;  1FBU A;  1FOK A;  3E5Q A;  5F04 A;  4G8X A;  3V8K A;  3O2P E;  1OLT A;  5EZG A;  1X19 A;  1XMA A;  4ZH4 F;  3ZQH A;  3JRI A;  2NVQ J;  5LEJ A;  3H9Q A;  4UB8 C;  4XLN F;  1UHS A;  4PFP A;  3CCS I;  2NS8 A;  1K4T A;  1KQ0 A;  3H3U A;  2R7T A;  4WF2 A;  3ZGK A;  4CO8 A;  5E8I A;  4FET A;  2M3A A;  3SXY A;  4IHY A;  1P92 A;  2CW8 A;  2VBY A;  2VXD A;  2HYF A;  1K7A A;  1YIO A;  3KE2 A;  3MKY B;  1VQ8 I;  1WGX A;  4DZP A;  3QAH A;  4OIR F;  3MAJ A;  1X2M A;  2P6S A;  3OYA A;  3VSL A;  4RLQ A;  4J01 A;  2VUM J;  1S9H A;  1TWC J;  2WAE A;  1FOX A;  2JQ7 A;  1SFE A;  2WV0 A;  3OL3 A;  1IUF A;  3ABM H;  2DJN A;  2Z9O A;  3TO7 A;  1WFX A;  4KN4 X;  4U7B A;  1RET A;  2Q2E B;  3TDU C;  2XAS A;  3HDD A;  4IKF A;  4N9H A;  3CCU I;  2IGK A;  4UHT A;  2DFH A;  3H92 A;  4RGU A;  1I27 A;  2A5Y B;  1W36 D;  3B02 A;  1FYK A;  1WH7 A;  1T0F C;  1HKQ A;  2DQR A;  1WPK A;  2C6Y A;  1X3U A;  3FX3 A;  4Q4Z F;  5FJ8 J;  5DDG A;  5C4J J;  1OCC H;  4XL9 A;  4CUG A;  1IUY A;  1N77 A;  2NVT J;  1Y0N A;  2V6E A;  3ZQI A;  2VI6 A;  2XPV A;  3H36 A;  4RMN A;  1H9T A;  1KQ8 A;  1RKT A;  2STT A;  2R5Z B;  1O3T A;  3ESW B;  3ISP A;  3OOU A;  1Y0U A;  4B43 A;  1TT5 B;  1IRF A;  3OYN A;  3ELK A;  2DW4 A;  2A3S A;  3MMY B;  2LFB A;  3ZQL A;  2YR2 A;  4XLH A;  2EV0 A;  3W2V A;  1LJ9 A;  3I56 I;  3RSN A;  3RPU D;  2OPT A;  1REP C;  4YIF A;  4CCL A;  3K4N A;  3ZMU A;  2A61 A;  4YEL A;  4HRI A;  3SZT A;  4A3M J;  3K4C A;  1L0O C;  4BEH B;  2DA6 A;  4MLO A;  2EFW A;  2CUE A;  4YFK F;  2ISZ A;  4BE1 A;  4II3 A;  2XF5 A;  4DYR A;  4X1E A;  4M6X A;  2GXG A;  5LBQ A;  1ETO A;  5J4Y A;  2WB1 A;  3HTS B;  5HLH A;  3FZV A;  3BCA A;  1IAW A;  1W5S A;  3BJA A;  2E7W A;  4HF2 A;  3OOP A;  2NVX J;  5HVQ C;  3GTO J;  1QVU A;  2MA3 A;  2XAF A;  1YJ9 I;  2VBX A;  3U1K A;  2M7B A;  1V3F A;  3FHN A;  2CFX A;  2QEX I;  3DXJ F;  2NOJ B;  1JUS A;  2G7U A;  3QPT A;  4A3F J;  3C7J A;  4F3Q A;  1E2X A;  2IP2 A;  2UUZ A;  3DWL E;  2H94 A;  1FIA A;  1FOY A;  3TMO A;  1MD0 A;  2EA4 A;  5IYC J;  1SAU A;  2P5L C;  4IQJ A;  4UY8 I;  1ULY A;  3GTG J;  2VPR A;  1GXQ A;  1MNE A;  1V5G A;  4NBQ A;  4CYC A;  1ZH5 A;  3F8C A;  3OSG A;  2A6H F;  5CQG A;  4OIO F;  4U0Y A;  4HYE A;  4ZJZ A;  3KYD B;  4JQF A;  1P7J A;  5TGT A;  3DBH B;  3P9C A;  4CCK A;  3GX4 X;  2EWN A;  3RPQ A;  2XKP A;  1MSF C;  2LOO A;  4XKC A;  1O7L A;  1SD5 A;  2HKO A;  2F5E A;  1MND A;  2L4A A;  3J81 Z;  3B73 A;  4EJV A;  1U5T A;  2VLA A;  3HOY J;  3BZ6 A;  5HDN A;  1W7P D;  4L18 B;  2G9W A;  5F6F A;  2PMZ N;  4XLP F;  4BBR J;  4A5M A;  5KAI C;  4BH9 A;  2V1U A;  3DU5 A;  4M73 A;  2RQP A;  2VQC A;  2ZME A;  4IRG A;  5FB2 A;  1IG7 A;  1Z6R A;  3PNV A;  1IRG A;  5K5O A;  4J19 A;  2XGX A;  1R1T A;  3NRV A;  2BY2 A;  1KZH A;  2FOW A;  3AL0 C;  2B9S A;  3KEQ A;  2HOA A;  3T1B A;  5EF6 A;  1RIO H;  2HVQ A;  4BXF A;  2R7R A;  1J9I A;  2L9V A;  1VQ6 I;  1YS6 A;  1Z7U A;  2IT0 A;  3PUB A;  2QM3 A;  2DBB A;  3VSK A;  1HXD A;  2KMU A;  1TW3 A;  2OUM A;  4PFO A;  5FRO A;  3VOE A;  4ZYA A;  1JJ8 C;  2DDA A;  4A0Z A;  1BR1 A;  5JFR A;  1BJA A;  5CVR A;  1KU7 A;  4KN7 X;  1ZRE A;  3CJQ B;  5B1A H;  2DMN A;  4CYD A;  1IV8 A;  2VT2 A;  3HBL A;  1B9M A;  2FU4 A;  1XG1 A;  3COA C;  3G1O A;  1QZE A;  2YX4 A;  1K83 J;  5CQE A;  1G3S A;  2VN2 A;  5DUK A;  4EM2 A;  3GTJ J;  1Z91 A;  4KIT B;  3OIO A;  5L3E A;  2QQ9 A;  2FUG 2;  4L0Z B;  3BG6 A;  1I1G A;  2WTE A;  4F52 A;  2NYX A;  2M4G A;  2O8X A;  3D5R C;  5HLI A;  4Q47 A;  2LY2 A;  1N78 A;  2HFH A;  4XLF A;  1KU2 A;  2QSH X;  1HW1 A;  5CPR B;  2DXI A;  1B1B A;  2KLO A;  2RGV A;  2ECB A;  2F4I A;  2L0K A;  1RR7 A;  2CS3 A;  4H0E A;  3T5X A;  2KIQ A;  5J40 A;  1OKR A;  3I71 A;  3FXU A;  4C9Y A;  1ZAO A;  1I3A A;  1OYI A;  5F0C A;  3GTM J;  3I4P A;  4AM3 A;  1MKM A;  2GOM A;  3HHG A;  2FBI A;  2XAQ A;  4XSZ F;  1HSJ A;  3DTK A;  3F8F A;  4Y4R A;  2OQR A;  3FKJ A;  2DLL A;  3SZP A;  3WTU C;  3ASN H;  2MFZ A;  3DPU A;  1P7I A;  2ZXH A;  5GAG J;  3S2H J;  3JAM K;  3FXL A;  3PSI A;  2K4J A;  2K86 A;  2FA5 A;  3DCF A;  2Z5U A;  2JA8 J;  1J0R A;  1LPQ A;  4O5V A;  4ZYE A;  4L9V A;  1ZR4 A;  3HC7 A;  4Q5S F;  3TOB A;  2Y2Z A;  4NC7 A;  2OAZ A;  1IV6 A;  3KX2 A;  2E1N A;  5E18 F;  3F9K A;  1R6R A;  3S3N A;  1YOV B;  1S7A A;  1G6N A;  1XDU A;  2Q2E A;  3M7G A;  4BBS J;  4LK0 F;  3I58 A;  3ZQQ A;  2IVM A;  4UVA A;  2R7V A;  2LR8 A;  4XKW A;  2QQB A;  2LTP A;  2QUF A;  3BT9 A;  3GF2 A;  1JT6 A;  1QGP A;  2DFI A;  3DPT A;  2DOA A;  2GOX B;  3LFU A;  5CVI A;  2E2J J;  2VPL A;  2KKO A;  4RDU A;  2QLZ A;  1VQ5 I;  2VJJ A;  2DU9 A;  1OIS A;  2K3P A;  1YIT I;  1TQM A;  1STZ A;  3CDI A;  1YHQ I;  3GTL J;  1I6H J;  5LRR A;  2EPF A;  3QQA A;  4G9Y A;  2V9V A;  2R5Z A;  1YLF A;  4MGR A;  2EFQ A;  4CXF A;  2O03 A;  5D5U B;  2VB6 A;  2WAF A;  2KIS A;  3ONQ A;  4GO1 A;  1WJC A;  3L2C A;  3JRD A;  1U9O A;  4Y17 A;  3ZP5 A;  2KIF A;  2R7O A;  5IP6 A;  5D5X B;  1JKP C;  5FFZ A;  5BOX A;  1UG2 A;  4AYB N;  3S3M A;  1FPQ A;  2RVC A;  2BY1 A;  3E7L A;  1OCP A;  1U0J A;  1FOW A;  3G2B A;  4X0G A;  4DW6 A;  5J8F A;  1EKE A;  2IW5 A;  3WU0 A;  2V7F A;  2O7O A;  3OYH A;  4KIF A;  2DCE A;  4BEH A;  2LBF B;  3MCZ A;  3J7Z I;  3DBR B;  3LOC A;  2MD0 A;  2L4M A;  3CC7 I;  3SYT A;  3MQ0 A;  3J80 Z;  2RN7 A;  3CUQ B;  2QSF X;  4OOI A;  5IY5 H;  5H2F C;  3DF8 A;  3CC2 I;  3S15 J;  2OTL I;  4NC6 A;  3J81 K;  3WTX C;  3WTV C;  3M1E A;  2ZFW A;  3F72 A;  2EH3 A;  3GZ6 A;  1AA7 A;  2JA6 J;  4RGS A;  2X6Y A;  3TP3 A;  4AUX A;  4RB2 C;  2FNA A;  2GZW A;  1LKX A;  3EET A;  1U2W A;  5HS7 A;  1G3W A;  2ELH A;  2IRF G;  2E71 A;  5EEH A;  1YIJ I;  3PFY A;  3V7C A;  3NWS A;  4BXU A;  5E1Z B;  1AHD P;  1HCR A;  3I4N J;  4XLE A;  1W36 C;  5HLT A;  4ZYG A;  2FRH A;  2P7C B;  2E35 A;  1GT0 C;  1LUJ B;  2VQL A;  4P5O A;  1G8X A;  1QPM A;  4HSR A;  1ZG3 A;  3BDD A;  5AON A;  3SFZ A;  4ZZD A;  3A03 A;  1J5Y A;  4A3J J;  1X1C A;  2UV1 A;  2GAU A;  4U0W A;  3BQY A;  5JLX A;  3ABL H;  2DA2 A;  3E0J B;  1XD7 A;  2VE8 A;  2DFF A;  3V7R A;  2EZK A;  3ZQF A;  4L5E A;  4NHJ A;  2ZO4 A;  3K7A J;  1GHC A;  2WAQ N;  2ZXW H;  4LFU A;  1FWZ A;  2W84 A;  2E60 A;  1BI2 A;  4UUT A;  4BE0 A;  1JUM A;  3M1C A;  2HQA A;  3LQR A;  2ESN A;  4G6T B;  1VFC A;  3V42 A;  4B47 A;  3K6G A;  3CCM I;  4X6A J;  2KJC A;  4U7D A;  4ZDO A;  3GTQ J;  2HYG D;  3B6A A;  1IDY A;  1O7F A;  1SAX A;  3LAP A;  2RKH A;  1V5F A;  3IH4 A;  1T95 A;  1T8I A;  2JJ7 A;  3BR1 A;  2JN6 A;  3C3W A;  2XGE A;  5DCM B;  1YW9 A;  5IOY A;  1A6Q A;  1HW5 A;  2HZD A;  2IJL A;  1FY7 A;  4ESJ A;  4I99 C;  1XPX A;  1RZ4 A;  1DPU A;  5HOD A;  1WJF A;  4XK4 A;  3P9K A;  3U2R A;  3W6K B;  1B59 A;  1E3O C;  1XSX A;  3KYC B;  2NVU B;  1TP4 A;  4U0V A;  4KFC A;  1ETV A;  1FP2 A;  2HI3 A;  4A0X A;  1BW6 A;  2DFE A;  3JSO A;  3DQV C;  4N4O B;  4A5N A;  4LD5 A;  1R4M B;  2CQN A;  3WTY C;  5KVR A;  4LLN A;  4OMZ A;  4V2G A;  1L3L A;  4C2M J;  2VBZ A;  3GBG A;  4C2U A;  2EIL H;  2BW3 B;  2X51 A;  3E5X A;  4EM0 B;  2DDB A;  3QPL A;  4MEX F;  1TLH B;  3ERE D;  2FSW A;  3O6B B;  2DK5 A;  1YO5 C;  2DA5 A;  2OZU A;  4CA0 A;  3O8H A;  3S1M J;  4A3C J;  3I5U A;  3GLX A;  3WTS C;  5C4X J;  3BTJ A;  1U6G A;  2Z2S B;  2Z16 A;  1IDZ A;  2D1H A;  2R3S A;  3GW2 A;  3F6V A;  2CQK A;  2JUG A;  2LK2 A;  3CCL I;  5BNG A;  2NRA C;  2OV7 A;  1YI2 I;  1QZY A;  3JRB A;  4BL0 B;  1HA8 A;  2W85 A;  2EIJ H;  2CGP A;  2DA4 A;  1B6A A;  1ZLJ A;  4EEF G;  1P4A A;  3LSJ A;  3QU6 A;  2VL8 A;  2IXS A;  4XIC A;  3K1M A;  1UG0 A;  2HU9 A;  4G6Q A;  3IRQ A;  4B1R A;  3Q9V A;  4JX6 A;  4BHB A;  2DYS H;  1YYV A;  1CGP A;  1RUN A;  1MDM B;  1RI7 A;  1H0M A;  3S16 J;  4D9J A;  2GBY A;  1IN7 A;  1ZLK A;  4PGH A;  4HX4 A;  3BQZ A;  2W24 A;  2LY1 A;  3GLL A;  2BOL A;  1W0U A;  3HPG A;  1LFP A;  3CDL A;  3HL2 A;  2ZBK A;  4IF4 A;  1Q1H A;  1R22 A;  1WCM J;  4HDV A;  1T39 A;  4BDZ A;  2CV1 A;  2X85 A;  1GXP A;  2H8R A;  5FLX K;  2K4B A;  2XB0 X;  3OYI A;  3ZMV A;  4NB5 A;  2Y9Z A;  3DTE A;  1VZ0 A;  2DMP A;  2ZJR F;  4BUP A;  3IP4 B;  5J6X A;  2W82 A;  3DLA A;  4B09 A;  3QOP A;  4BU2 A;  2LH9 A;  3IH2 A;  3GO5 A;  2JVG A;  2D5V A;  2JVH A;  1BOA A;  2F2E A;  3LMM A;  4PJL A;  2QKL B;  3GFL A;  3PUF A;  1O57 A;  2DAO A;  1FIP A;  4AWX B;  1YW8 A;  3QP5 A;  1POG A;  4YEJ A;  4AID A;  1NTC A;  5IOZ A;  1I5Z A;  1F9N A;  1VI0 A;  4E7K A;  2GQQ A;  1BOB A;  2F4M B;  2DYR H;  4W1U A;  5D8K B;  2A05 A;  2COB A;  3PL8 A;  4DNC A;  3K0L A;  4XR6 A;  3TDZ C;  2MG4 A;  3S1Q J;  3CP2 A;  5JI6 A;  2CWE A;  5HS9 A;  3MD2 A;  1BR4 A;  5IT3 A;  3TW7 A;  4BQN A;  2XF7 A;  4DIQ A;  5L3C A;  3H0D A;  4E7I A;  3FK7 A;  1PJR A;  2E2I J;  4EJU A;  1APL C;  5GAD J;  3BR0 A;  3KP2 A;  3HUG B;  3TP0 A;  5L3F A;  4BS9 A;  2QA4 I;  3OYB A;  1LEA A;  5DEQ A;  2FJ1 A;  3BTC A;  5D4S A;  3Q5F A;  1TWH J;  3OYJ A;  2Y31 A;  1W0T A;  1BC7 C;  1WZ2 A;  3IKV A;  3K4K A;  2VXZ A;  3EUA A;  2IEK A;  1XC5 A;  4A6E A;  3K4L A;  1IGN A;  1XMK A;  2IGO A;  1XX5 A;  2JA5 J;  1U5T C;  4M3B A;  1UAA A;  2ZKZ A;  3KP7 A;  1D1C A;  2RRE A;  2M2E A;  1X3W B;  4B3X A;  2LBF A;  3IRR A;  2LDU A;  1D3Y A;  1TNS A;  2K7L A;  4CZC A;  2TCT A;  3K1N A;  5FKK A;  2NAZ A;  1B72 B;  2ZME C;  3LA2 A;  1U9N A;  2CG4 A;  1XB4 A;  4JP0 A;  3TBI A;  1MMN A;  3CUQ A;  5DTD A;  2HPI A;  5ILS A;  2EK5 A;  1XTA A;  1S7E A;  1KON A;  4I0A A;  1A35 A;  3ZOB A;  3RIR A;  4BNC A;  4GFB A;  2P8T A;  4V2F A;  3BLY A;  1VQP I;  5IP9 J;  1XSD A;  4P96 A;  4EVI A;  1HF0 A;  2VJ4 A;  2FOK A;  3VPR A;  4JBA A;  1TNT A;  1MBF A;  2GXA A;  1Z1D A;  3OYG A;  1IO2 A;  1O3Q A;  3D1N I;  2QKM B;  3AG2 H;  3T0Y A;  1A6I A;  3FXQ A;  4QWQ A;  2IS2 A;  3CME I;  3C2H A;  4UV9 A;  4Z2Y A;  1UMQ A;  5F1R A;  3CMA I;  2ZB9 A;  2QQA A;  4L5J A;  2LF7 A;  2P5K A;  4EGZ A;  5EZH A;  3J7Y J;  5KNL A;  2O9L A;  1GLN A;  1ETK A;  2DTR A;  2NXN B;  5E1X A;  2FXA A;  3FIW A;  1SVL A;  2AHQ A;  1MJB A;  3K9T A;  3BG3 A;  3OY9 A;  2F5V A;  2CUZ A;  1HKS A;  2Y0M A;  1EF4 A;  4AVP A;  1FZP B;  2RNG A;  4XKV A;  3FIS A;  1Y8R B;  1KYZ A;  5ILV A;  4XKB A;  4DQ2 A;  3F22 A;  4DJA A;  4HLY A;  2FEZ A;  1OR7 C;  3R0A A;  1XCV A;  3AG3 H;  4LIT A;  4EJO A;  1Z77 A;  4U88 A;  1JTX A;  3SDB A;  2NOG A;  4I0B A;  2Z33 A;  1UJ8 A;  1Z67 A;  1XGS A;  4XN3 A;  4XQF A;  4OIP F;  3RYR A;  5L3G A;  5C3E J;  2V9P A;  5BPI A;  2VOD A;  3HIF A;  3JRE A;  2NS7 A;  4EMS A;  4BQA A;  4LK1 F;  2RAE A;  3ASO H;  5IT9 Z;  3DEU A;  3E5U A;  3J7A Y;  2IS6 A;  3C2B A;  3KZI C;  4IHW A;  5DCM A;  3GUD A;  1WI3 A;  2QCO A;  1TC3 C;  5GAE J;  4DYQ A;  2CW0 F;  2YUS A;  2LF8 A;  2D1V A;  2VKE A;  3FBN B;  4CIC A;  3CTA A;  3W3C A;  3QYB A;  3HRS A;  5K7Z A;  3JTH A;  1UHM A;  3BZC A;  3WGH A;  1ZG5 A;  2V1N A;  4MFE A;  3ML6 A;  3ROU A;  3BR6 A;  4Q48 A;  2CYY A;  3H5N A;  2ME6 A;  5HS8 A;  1SD4 A;  2BW3 A;  3IWZ A;  3GTP J;  2FX0 A;  2PN6 A;  2OZ6 A;  1OYY A;  4PSW A;  3K2A A;  3I4M J;  3K2Z A;  3RYP A;  3RKY A;  4IHT A;  2BGC A;  3SEZ A;  1I39 A;  2KP6 A;  5F1J A;  2EBI A;  1OQY A;  2LRE A;  2QBY B;  5F08 A;  3DP7 A;  3EDP A;  3LSH A;  1W5T A;  1JUP A;  1R71 A;  2J5O A;  5F64 A;  2KHM A;  2VOO A;  3VYT B;  3BP8 A;  2W48 A;  3A1Y A;  4LIV A;  3TGN A;  3BZK A;  4WCG A;  1N25 A;  1IN4 A;  2IS4 A;  2HXO A;  3ZQ7 A;  4Z6Y A;  1SD6 A;  2E5Z A;  1V55 H;  2CQ7 A;  3IC7 A;  4GYI A;  3CCJ I;  1V4R A;  4I6Z A;  4FX4 A;  3JCU C;  4EGY A;  4HST A;  1MDM A;  2RC4 A;  4YFX F;  5J1R A;  4XMY A;  2LG4 A;  1TZL A;  1FX7 A;  2F5D A;  3CCY A;  1RES A;  1J2X A;  1OCT C;  1ETX A;  4GRI A;  4OWR B;  1A31 A;  2DOE A;  3HGY A; 
#chains in the Genus database with same CATH homology
 1VF9 A;  2Y2Z A;  2XRL A;  1IV6 A;  1DU6 A;  3OSF A;  2YS9 A;  4I76 A;  1TWA J;  3G1M A;  1GVD A;  3BR2 A;  5M5W J;  2MSY A;  1X2N A;  3QPS A;  1SFO J;  4BBS J;  1HLV A;  1GUU A;  1QPI A;  2LR8 A;  3BT9 A;  2LTP A;  1JT6 A;  4B3A A;  2E2J J;  2HOT A;  3NAU A;  3SDG A;  4RDU A;  2K9Q A;  2WB1 N;  2I10 A;  4FE7 A;  4G12 A;  5IP7 J;  1BL0 A;  1B8I A;  3GTL J;  1I6H J;  3QQA A;  2R92 J;  1D5Y A;  3SFI A;  3L1P A;  4HNV A;  2R5Z A;  1LFU P;  3M4O J;  1DU0 A;  1ETY A;  1MSE C;  1X58 A;  2X48 A;  3JRD A;  1U9O A;  3UKG A;  2ID6 A;  5IP6 A;  1JKP C;  1Q1V A;  1UG2 A;  4AYB N;  3PO3 J;  9ANT A;  3E7L A;  1OCP A;  1XS9 A;  3LNQ A;  1OJL A;  1QVT A;  2HQ5 A;  3F0C A;  5M5X J;  1OFC X;  4DW6 A;  2ID3 A;  1H88 C;  2O7O A;  3BG9 A;  1HOM A;  4BY7 J;  3S2D J;  3SJM A;  5FKM A;  1VND A;  3LOC A;  3Q0V A;  4M3G A;  4MFD A;  3WHC A;  3S1R J;  1GV5 A;  4C3I J;  4DZJ A;  4A3L J;  3S15 J;  3FK6 A;  4QIW N;  2IAI A;  1HDD C;  1MBE A;  2EH3 A;  5JLW A;  2YU9 J;  4JX5 A;  2JA6 J;  3HGG A;  4JYK A;  1AKH A;  3TP3 A;  4AUX A;  3HB9 A;  3RKQ A;  3HOU J;  3TW6 A;  5E3L A;  2LLK A;  1B72 A;  2O8K A;  3JRC A;  3Q0U A;  2HXI A;  1T33 A;  4CYC B;  5EYR A;  3MKL A;  3BTL A;  1NK3 P;  3IH3 A;  4QSH A;  1JKQ C;  1AHD P;  1HCR A;  3I4N J;  5EGO A;  1O4X A;  2K9S A;  3LSG A;  4JX4 A;  3TED A;  4A3K J;  4D7N A;  1GT0 C;  2DA3 A;  2R93 J;  3RQI A;  2CQQ A;  5M3F J;  3JRF A;  1JGG A;  3Q0W A;  3A03 A;  4A3J J;  3BG5 A;  2OF7 A;  2TRT A;  1ZTR A;  5JLX A;  2KDZ A;  3BQY A;  3MVP A;  3H0G J;  2DA2 A;  4A93 J;  1RPW A;  2EZK A;  3ZQF A;  4L5E A;  4UUS B;  3K7A J;  1ENH A;  2WAQ N;  2E19 A;  3ZQC A;  2NVY J;  4NDL A;  2IBD A;  4UUT A;  1FTZ A;  1JUM A;  1RKW A;  1K61 A;  3BR5 A;  1ZR2 A;  1IJW C;  2Y0S N;  3HOZ J;  4XRM A;  1VFC A;  1JJ6 C;  4D5C A;  4A3G J;  4X6A J;  1ITY A;  1GV2 A;  3GTQ J;  1ZKG A;  4C3J J;  2CU7 A;  3B6A A;  3IV5 A;  4IHV A;  1IDY A;  2QF7 A;  4D7M A;  3IH4 A;  3HM5 A;  4FE4 A;  5FLM J;  2JJ7 A;  3BR1 A;  3MN2 A;  5E3O A;  4IHX A;  5M3M J;  2CJJ A;  2KT0 A;  2JN6 A;  5C44 J;  2XGE A;  3A01 B;  1PUF A;  3CQZ J;  3FKI J;  3G1L A;  5IOY A;  4BY1 J;  5K7H A;  5HOD A;  2LP0 A;  4XK4 A;  2CUF A;  3NAR A;  1E3O C;  3BTI A;  5DS9 A;  1TWF J;  1Y1V J;  5F0H A;  4RBO A;  3HOX J;  1ETV A;  1LE8 A;  4ABZ A;  2HI3 A;  1BW6 A;  2JWT A;  1JKO C;  4V2G A;  3BR3 A;  1A5J A;  1LFB A;  1JTY A;  3Q3S A;  2L7Z A;  4C2M J;  5GPC A;  3GBG A;  5EG0 B;  4FCY A;  5FLV A;  4A3D J;  3QPL A;  2HYJ A;  2R5Y B;  2Y9Y A;  2DA5 A;  3O8H A;  3S1M J;  4A3C J;  2ELK A;  2XGC A;  2CQX A;  5C4X J;  3BTJ A;  2FD5 A;  1IDZ A;  2H1K A;  1QRY A;  1TWG J;  2E1O A;  2LK2 A;  5BNG A;  1R9T J;  1JKR C;  2K40 A;  5F04 A;  3JRB A;  5EZG A;  2NVQ J;  3ZQH A;  3JRI A;  2DA4 A;  1UHS A;  2NS8 A;  4EEF G;  2AO9 A;  3LSJ A;  2FQ4 A;  4XIC A;  1H89 C;  4IHY A;  3RZD J;  4B1R A;  2M9H A;  4JX6 A;  1MBJ A;  3JRH A;  1WGX A;  1Y1W J;  4DZP A;  3S16 J;  2G0E A;  2DMQ A;  1YRN B;  1F43 A;  2GBY A;  1X2M A;  4FTH A;  3BQZ A;  4UUS A;  1BA5 A;  2VUM J;  1W0U A;  1TWC J;  5F0F A;  3CDL A;  5IYB J;  2P81 A;  3HOW J;  1IUF A;  1WCM J;  3S1N J;  2DJN A;  3JRA A;  2L7M P;  1RET A;  2H8R A;  3PM1 A;  1BJZ A;  4DYC A;  2XB0 X;  1MNM C;  1I3Q J;  4XRS G;  3HDD A;  1CQT A;  2Y9Z A;  2DMP A;  1MH4 A;  2R0Q C;  3HEF A;  1Z0X A;  1WH7 A;  1MBG A;  4M6V A;  1WPK A;  4A69 C;  5EDN A;  3IH2 A;  5FJ8 J;  2X9D A;  5C4J J;  5E3M A;  1T56 A;  2D5V A;  3HKZ N;  2NVT J;  4B4C A;  2M34 A;  3WHB A;  3ZQI A;  2VI6 A;  2XPV A;  2B63 J;  1RKT A;  1FIP A;  2R5Z B;  1U8B A;  3OOU A;  1POG A;  1NTC A;  4M3E A;  5IPA A;  5IOZ A;  2LFB A;  1VI0 A;  3ZQL A;  4Y52 J;  4W1U A;  4AC0 A;  2XPW A;  2COB A;  2OPT A;  2DTZ A;  3W6V A;  1NK2 P;  2MG4 A;  3S1Q J;  2R5Y A;  5M5Y J;  4A3M J;  3TW7 A;  2M0C A;  1F36 A;  2DA6 A;  3FK7 A;  4MLO A;  2E2I J;  2CUE A;  3JR9 A;  1APL C;  3BR0 A;  3TP0 A;  4DYR A;  2N8G A;  2MGQ A;  4X1E A;  2FJ1 A;  3BTC A;  1TWH J;  5GPA A;  5J1U A;  1FEX A;  2Y31 A;  1ETO A;  1W0T A;  1HDP A;  4M3F A;  1WH5 A;  2IEK A;  1XC5 A;  3LSR A;  1IGN A;  2JA5 J;  4M3B A;  4A3E J;  4C3H J;  1AKH B;  2DA7 A;  2M2E A;  2NVX J;  1U78 A;  3ZQG A;  3GTO J;  4W97 A;  1QVU A;  2TCT A;  5FKK A;  1B72 B;  1MBH A;  1U9N A;  3DEW A;  4JP0 A;  5DTD A;  2JK3 A;  1JUS A;  4A3F J;  1S7E A;  2EZI A;  3S14 J;  2DMU A;  5EGO B;  3ZOB A;  1AU7 A;  1FIA A;  4GFB A;  4V2F A;  5IP9 J;  1ORK A;  5IYC J;  1HF0 A;  4XRS A;  3VPR A;  3GTG J;  1MBF A;  1ZGW A;  2VPR A;  1JT0 A;  3D1N I;  2R7Z J;  4CYC A;  1A6I A;  3OSG A;  2DMT A;  1ZK8 A;  1UMQ A;  1P7J A;  2ZB9 A;  4BXX J;  5EZH A;  5F27 A;  1MSF C;  4S0H B;  1ETK A;  1IRZ A;  4D5F A;  3M3Y J;  3FIW A;  1G2H A;  2AHQ A;  3BG3 A;  3HOY J;  2LKX A;  2PMZ N;  1EF4 A;  2ECC A;  4BBR J;  2XB5 A;  3LSP A;  1ZQ3 P;  3FIS A;  5IYD J;  2DN0 A;  1IG7 A;  4QTR A;  5FKN A;  1I50 J;  1H8A C;  4J19 A;  1Z77 A;  2X6O A;  2LD5 A;  1JTX A;  2NOG A;  1PUF B;  1IC8 A;  2HOA A;  3JRG A;  3H3V K;  5EF6 A;  3O8G A;  2XSD C;  2ME0 A;  5C3E J;  2Y30 A;  2XPU A;  3JRE A;  1JJ8 C;  1LE8 B;  2NS7 A;  2M8G X;  3RZO J;  2RAE A;  2EQR A;  4BKX A;  5FKO A;  2L7F P;  3C2B A;  2EZH A;  2EZL A;  4FIS A;  2DMN A;  3A01 A;  4IHW A;  1BW5 A;  5FKL A;  1WI3 A;  2QCO A;  4A3I J;  1TC3 C;  3S17 J;  1B8I B;  3HBL A;  2WV1 A;  1XG1 A;  4DYQ A;  3G1O A;  2YUS A;  2LVS A;  1K83 J;  2VKE A;  4MO7 A;  3GTJ J;  2JMW A;  5E3N A;  2GLO A;  5K7Z A;  3OIO A;  2GM4 A;  2JA7 J;  5J3L A;  4MFE A;  1FTT A;  1ETQ A;  3BR6 A;  2HOS A;  2ME6 A;  4MIM A;  4Y7N J;  5EG0 A;  3GTP J;  1ETW A;  2FX0 A;  3I4M J;  3K2A A;  2DA1 A;  2K9N A;  1MH3 A;  5F1J A;  1MBK A;  2EBI A;  4IEJ A;  3HOV J;  2VKV A;  2ECB A;  4A3B J;  2L0K A;  4LOC A;  5F08 A;  1RR7 A;  2E2H J;  1JUP A;  5F0C A;  3GTM J;  2CRG A;  2L9R A;  5GP9 A;  3A02 A;  2W48 A;  1SAN A;  3PO2 J;  2HXO A;  2XGD A;  1GDT A;  3GTK J;  1P7I A;  3S2H J;  4I6Z A;  1FJL A;  3DCF A;  3B6C A;  2JA8 J;  4M3D A;  5J1R A;  5K7F A;  1YRN A;  3CMY A;  2LY9 A;  1ZR4 A;  3CCY A;  2MW8 A;  1RES A;  5EEA A;  4XID A;  1OCT C;  1ETX A;  2HDD A;  5J1Y A;  2O9L A;  3HGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...