3GTMJ

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtmJ00
2K9SA 1YRNA 4XICA 2O8KA 2CU7A 2ME6A 1RETA 5IYDJ 1ZQ3P 3C2BA 1WPKA 2CQXA 2DMTA 5IYBJ 3HOWJ 2MGQA 3LSPA 2CUEA 3SFIA 2WAQN 3G1OA 2YS9A 3G1LA 3H0GJ 2P81A 3JRHA 4A3CJ 5EZHA 4M3FA 5IPAA 4BY1J 3O8GA 5HODA 1FJLA 1TWAJ 2PMZN 2XPWA 3HOZJ 1BL0A 1ZK8A 4C3JJ 2LY9A 4HNVA 5J1UA 2JA6J 5F0FA 4A3MJ 1F36A 2OF7A 5M3MJ 1JJ8C 2WB1N 3Q0UA 3B6CA 3ZQGA 2VUMJ 3ZQLA 1B8IB 1TWCJ 1GUUA 3BR1A 1F43A 2DA4A 2OPTA 5EGOB 4BBSJ 5DS9A 2KDZA 1JKOC 3QPLA 1UMQA 3TP3A 1QPIA 2Y9ZA 4A3GJ 1ETQA 1TC3C 4D5FA 4RDUA 2VKEA 3TEDA 3JREA 1BW6A 4XRSA 3BTIA 1SFOJ 4A3JJ 2ECCA 3ZOBA 3PM1A 5JLXA 3A01B 2ME0A 3OSFA 5F27A 3SDGA 3GTMJ 3JRAA 3O8HA 3BQZA 2LLKA 4JX6A 2Y31A 1LE8B 1ZKGA 2L7MP 2DMUA 2EZHA 2HQ5A 2RAEA 1RESA 3PO3J 4XRSG 2XPVA 4L5EA 1O4XA 4BKXA 1ZR4A 2LR8A 2ID3A 3HOUJ 2FQ4A 5FKLA 5BNGA 1RPWA 1K83J 3BG9A 3FK6A 3DCFA 3DEWA 3W6VA 1SANA 1IRZA 3ZQHA 2R0QC 1EF4A 4JYKA 2NS8A 1ETVA 2EH3A 1X58A 2M2EA 3CCYA 3HOXJ 1JT0A 4M3BA 1P7IA 1R9TJ 1WGXA 1YRNB 4IHWA 2X6OA 5IOZA 4RBOA 1A6IA 1IUFA 2TRTA 5FKNA 3E7LA 2XPUA 5EEAA 4S0HB 1B8IA 1I50J 3A02A 9ANTA 3NAUA 5E3MA 3K7AJ 2FD5A 3F0CA 3QQAA 2CRGA 3QPSA 1ORKA 3HGYA 1POGA 1WCMJ 2EZIA 2HOSA 2Y30A 5JLWA 5GP9A 2HXOA 2JK3A 3TP0A 3M3YJ 4M6VA 4C3IJ 3BT9A 5E3LA 5E3NA 1FEXA 2E2HJ 2VKVA 2K40A 5EYRA 1D5YA 2HDDA 1APLC 5EG0A 2JMWA 1UG2A 2H8RA 2IAIA 1LFUP 3RZDJ 2GM4A 4CYCA 2XGCA 3S2HJ 2HOAA 5IP9J 2JA7J 2DJNA 5K7FA 1W0TA 1DU6A 3RQIA 1JTYA 1HDDC 1NTCA 3BR3A 1AKHB 2LKXA 1MBJA 1BA5A 3WHBA 2L9RA 1H8AC 2Y2ZA 4C2MJ 3GTOJ 5IYCJ 2CJJA 2M9HA 4D7NA 3H3VK 2IBDA 5K7ZA 1FTTA 2AO9A 3BG5A 4IHXA 2DMPA 3L1PA 1ETOA 3JRFA 3Q0VA 3PO2J 3HGGA 4MIMA 2E1OA 4FE4A 4MLOA 3S2DJ 2M0CA 5F0CA 2HXIA 4ABZA 3GTLJ 1HCRA 4QSHA 3BR5A 1FIPA 1JKRC 5J3LA 1ITYA 4AC0A 2NOGA 3ZQFA 1IC8A 1MBGA 4A3FJ 3IH2A 5IP7J 1GT0C 4FE7A 2XGDA 2LD5A 1FIAA 2IEKA 1U9OA 1JJ6C 1RR7A 1GVDA 3BTJA 2R93J 3IH3A 1U9NA 1P7JA 3BTLA 4D5CA 4X6AJ 2R7ZJ 4IEJA 1JUMA 1HOMA 1U8BA 2M8GX 4A3DJ 2E2JJ 2DN0A 5C44J 2JJ7A 2I10A 4LOCA 4B4CA 3D1NI 1OCPA 3MKLA 5EZGA 1LFBA 3M4OJ 1AHDP 4JX5A 1H88C 4BXXJ 4W97A 5M5XJ 2MSYA 4BBRJ 2X48A 2FJ1A 2W48A 1XG1A 2ECBA 1ZTRA 3LNQA 5GPCA 3LOCA 4UUTA 2DA1A 2HI3A 1JKQC 3CMYA 1DU0A 1ETKA 5C3EJ 2H1KA 2LFBA 4M3EA 5IOYA 4A93J 4GFBA 5EGOA 4IHVA 3LSJA 3HEFA 3HB9A 2DMQA 3S1QJ 2R92J 1ENHA 2Y9YA 1VFCA 2HOTA 1X2NA 3Q0WA 5C4XJ 1Z0XA 2O9LA 5M5YJ 4FTHA 1ETXA 2L7FP 5FKMA 1G2HA 5F0HA 4Y7NJ 1MNMC 4M3GA 1AKHA 3GTKJ 1MH3A 3OSGA 1ZGWA 2VPRA 4DZJA 4X1EA 2GLOA 2DA7A 4DW6A 2D5VA 1IG7A 2WV1A 3Q3SA 4MO7A 1T33A 2YUSA 1ZR2A 3S17J 3BQYA 5M5WJ 4W1UA 5C4JJ 4M3DA 4EEFG 1VF9A 1I3QJ 1JTXA 5E3OA 4DYQA 2DA3A 3MVPA 4XK4A 1ETWA 2R5YB 1GDTA 4G12A 2B63J 1BW5A 4A3KJ 4MFDA 3UKGA 5DTDA 5K7HA 1A5JA 3CQZJ 2VI6A 1Q1VA 1WH7A 3K2AA 3BR0A 1HLVA 1IJWC 1B72B 3HOYJ 1MH4A 3A03A 3FISA 2L7ZA 4C3HJ 3GTGJ 1WH5A 2GBYA 4XRMA 4A3LJ 2AHQA 3S16J 5FKOA 1LE8A 4FISA 1E3OC 5J1RA 1ETYA 1PUFB 3HBLA 2ZB9A 1PUFA 3B6AA 4AYBN 4B3AA 3GTJJ 2E19A 5F1JA 2R5ZA 1AU7A 1IDZA 5FLMJ 1JUPA 2NVYJ 1MBKA 4V2GA 1QRYA 2DA2A 2EZLA 2EBIA 2JA5J 3BTCA 4JP0A 3IH4A 1MBEA 2Y0SN 1W0UA 3JRDA 2FX0A 1IV6A 5FKKA 2ELKA 2O7OA 4QIWN 1HDPA 5F04A 2NVXJ 1RKTA 4UUSB 3JRBA 1VI0A 3G1MA 2LP0A 1IDYA 2JN6A 3JRCA 1XS9A 3RZOJ 1Y1WJ 3OOUA 1VNDA 4NDLA 4A3IJ 2R5ZB 1TWGJ 2DMNA 1QVTA 1WI3A 2NVTJ 3OIOA 3GTQJ 1XC5A 4B1RA 5IP6A 1GV5A 4V2FA 3ZQCA 1T56A 4XIDA 3I4NJ 1MSEC 1U78A 1TWFJ 1MBFA 1HF0A 1I6HJ 4A69C 1JGGA 3SJMA 2MG4A 5EDNA 2R5YA 2E2IJ 4IHYA 1UHSA 5F08A 3A01A 3BR2A 2XB0X 3JRGA 4A3BJ 1TWHJ 4DYRA 3TW7A 1QVUA 3TW6A 3GBGA 1X2MA 2ID6A 2QF7A 4UUSA 2MW8A 4DYCA 3I4MJ 2CUFA 3S1RJ 5EF6A 1FTZA 1OCTC 2TCTA 1RKWA 3HKZN 3S15J 2X9DA 5EG0B 1Z77A 1Y1VJ 3S1MJ 3S1NJ 2K9QA 2DTZA 1JKPC 2LTPA 1OFCX 3S14J 2XRLA 2HYJA 2N8GA 1OJLA 1BJZA 3IV5A 3NARA 4CYCB 2G0EA 1CQTA 3JR9A 2L0KA 2CQQA 3LSRA 5M3FJ 4D7MA 2XGEA 2COBA 3HOVJ 1JUSA 3VPRA 5FJ8J 4QTRA 5J1YA 2LVSA 4BY7J 1MBHA 1JT6A 2JA8J 4FCYA 4AUXA 2NS7A 1H89C 1IGNA 3GTPJ 2XSDC 4J19A 2QCOA 3CDLA 4I6ZA 3BR6A 1K61A 2EQRA 2JWTA 4MFEA 1MSFC 3MN2A 3RKQA 1NK2P 3HDDA 2K9NA 2LK2A 3ZQIA 2YU9J 2DA5A 1GV2A 5GPAA 3JRIA 1NK3P 4DZPA 3FK7A 2DA6A 3LSGA 3WHCA 3FIWA 3FKIJ 4Y52J 4I76A 2NVQJ 3HM5A 1B72A 3BG3A 5FLVA 4A3EJ 2EZKA 4JX4A 2M34A 2XB5A 2KT0A 1S7EA
chains in the Genus database with same CATH superfamily
1RUOA 4UV8A 4KIBA 3L2VA 5FRNA 2IS6A 2ME6A 4BQAA 2EFQA 3CZ6A 1ZQ3P 2RNJA 5GAHJ 1QA6A 2CQXA 4BAYA 3L2UA 2QBYB 5D5XB 2WAEA 1SD7A 2J5PA 1J2XA 2CUEA 2HR3A 2FMYA 3J81Z 1IXSB 2NXNB 3C7JA 3GCMA 2DTRA 4L9TA 4KA4A 4GYIA 1IRFA 4XLNF 2LBFB 2VE8A 4YIIA 3EQLF 4XLFA 1OKRA 2OJED 1DP7P 5EZHA 2RN7A 1WFXA 3O8GA 2EIKH 3FM3A 2HFHA 5HODA 1Z3XA 2PMZN 1BL0A 1ZK8A 3M8JA 2F5DA 3ZQ7A 3TO7A 4WXCA 1R58A 5F0FA 4II3A 3FXUA 3P5JA 1KYZA 2QYOA 2M7BA 2WB1N 3Q0UA 3ZQGA 4UNOA 3CCVI 2DK8A 3ZQLA 3ISPA 4NQWB 1R00A 3BG6A 5FGMA 2IP2A 3ABUA 3BR1A 4YG2F 3B02A 2EA4A 2P0WA 1I5ZA 1Y56A 2ADUA 3TGNA 3IAS2 2IRFG 4XQFA 3MKYB 2DODA 2LF8A 5H20A 1BW6A 2K5CA 1SFOJ 4A3JJ 3VYSB 1W36D 1L3LA 4HAMA 3A01B 1FNNA 1Z9CA 2F5EA 2Y69H 3E5XA 3BQZA 3TL4X 2FE3A 1BR1A 4HV5A 4JX6A 4BGDA 3J80K 2ISZA 3BJ6A 2HQ5A 4I7HA 4KMFA 1E3PA 2DO7A 4IRGA 3CLQA 3HOUJ 4ENMA 1BN5A 1G8XA 4I09A 2G7HA 3AG4H 5FKLA 3PIPF 1E0EA 1BM9A 2FUG2 1IW7F 1K83J 2KKOA 3CJRB 3LQRA 3RPQA 2VKDA 1QZEA 3F21A 3SQNA 1A31A 4LFUA 2KRCA 4BACA 4JYKA 2NS8A 2WAQA 4U0YA 2L9SA 4L9JA 2DCEA 2E7WA 2M2EA 1WZ2A 1TLHB 1LQ1A 1YIOA 2AQEA 1P7IA 3OS1A 1ZGJA 1B6AA 2GZWA 5GAGJ 2RREA 2ZJRF 1IRGA 4JK1X 1Z1DA 3E7LA 2A6EF 4IXAA 4IKFA 1YJNI 3RPUD 2HS5A 1D8JA 2MLKA 2R7OA 2W84A 4IVNA 3CCLI 1I50J 3A02A 1WJCA 2BXYA 3IRRA 9ANTA 1SAXA 2FD5A 2W00A 4LIVA 1KZHA 4P9FA 2EILH 1T0FA 3QPSA 2MD5A 4B8XA 1X1CA 4N0BA 2B9SA 2Z1DA 2W82A 1WJFA 4DIQA 1R22A 3LSKA 4G9YA 5GP9A 2K7LA 4G7ZF 5J47A 1G3SA 2DFEA 3Q5FA 3KP5A 5BMZA 4CZCA 3H5RA 4BHPA 2DFHA 4N9IA 3CDIA 3BT9A 3HRSA 4XRFA 1Z05A 2VKVA 2CO5A 2MH2A 2PJRB 2BZTA 2CQNA 2K4JA 5EG0A 2CFOA 2L9NA 3WE2A 2JMWA 4A0ZA 1R36A 4MNUA 3MZYA 3K4CA 1W7PD 2DK5A 2R7RA 1UZCA 3OYAA 5FFZA 2GM4A 4I98B 4NC8A 2GIVA 1QBJA 2P5KA 4GXOA 5D5VB 3DQVC 4YFXF 1CF7B 2JA7J 3KZYA 2JUCA 5K7FA 1R1TA 1SEUA 1JTYA 1HDDC 2EFPA 2NAZA 2KRFA 3MAJA 3MCZA 4KICA 3RJPA 1AKHB 5BQTA 1BA5A 3MD2A 3WHBA 2L9RA 4I99C 1H8AC 4EGZA 1T95A 3OYBA 3KP6A 2Z2SB 2OCCH 5IYCJ 1VZ0A 3I54A 1N25A 1EJ9A 3H3VK 2AO9A 2KLOA 3GFJA 2DAOA 2DMPA 4LB5A 1NG7A 2XF6A 1R5ID 3FWEA 3OYNA 3PO2J 2BYVE 1I6XA 3HOTA 1XSXA 2PMZA 3MKZA 2F4IA 2HYFA 4ZZDA 4FE4A 3NWSA 4L0ZB 4ABZA 2EV0A 3ZMVA 4QSHA 3P9CA 4P5OA 2QUFA 4XLHA 4EJVA 5J3LA 4QPOA 4BJ6C 3IH2A 3E6DA 4FE7A 1U8RA 6PAXA 1P6RA 3G71I 3W6JB 2LD5A 1FIAA 2HDWA 2IGOA 4C9YA 1U9OA 3GEZA 3EYIA 2A6TA 4PZJA 3RDIA 3FXLA 1U9NA 4PSWA 1T38A 2R7FA 1HKQA 4LD5A 4IHTA 4RB3C 2M8GX 2LREA 4IQJA 2DN0A 2I10A 1OCPA 4XLAA 1ODDA 3H5AA 3M4OJ 4UVCA 5FROA 5M5XJ 2MSYA 2FJ1A 4B3XA 3TO9A 4F91B 3T8RA 2W48A 3C2GA 1ZTRA 5EJCA 2ZKZA 5DDGA 3LNQA 2KIQA 2JUGA 3UNGC 1QU3A 3I59B 1JKQC 2WY7Q 4HDVA 5C3EJ 2EFWA 3WU0A 3L2CA 5E1XA 1FLIA 1OCZH 3L00A 4M3EA 1FOYA 2HQAA 2L3DA 3BC8A 5TRDA 3PJRA 4IHSA 5H6RA 3KYLA 1ENHA 1XX5A 2Y9YA 1D3YA 1VFCA 4WF2A 4FX4A 3N05A 1G59A 1Z0XA 2JRTA 1KGSA 1PVEA 2BY2A 5FKMA 3T5XA 1O7FA 4M9ZA 1FP1D 3PIOF 1LDDA 3DLLF 2ELJA 3KPHA 1WJDA 2VPRA 4DZJA 1KONA 2DA7A 1T0FC 5LGUA 2D5VA 2WV1A 4YFKF 3L9FA 3WTXC 1ZR2A 4XOTA 1Q1HA 4RS8A 5M5WJ 3ML6A 1Z21A 2WBMA 5C4JJ 3R60A 4M3DA 2DW4A 3M1EA 5E17F 1LEBA 2E7XA 3G6EI 3BLYA 3KYCB 4DYQA 2F48A 2DA3A 1GDTA 1ETWA 3BCAA 4A3KJ 4MFDA 3B73A 1T2KA 4DBRA 1IJWC 2HEOA 4CHUA 2D2WA 4HBLA 5TJJA 3FISA 2JT1A 2A61A 4L5IA 3GTGJ 1OYIA 3D5SC 4AVZA 2AQFA 3N97A 4NC7A 1WH5A 2DT5A 5FFXA 4RB1A 3K70C 3C2HA 3WU2C 2AHQA 1YHQI 2VE9A 4PSXA 5FKOA 1ZLKA 4EATA 1ETYA 5H6QA 1PUFB 1UAAA 1OCOH 1P92A 1V5FA 4WWCA 1PUFA 3ABKH 3AG1H 5F1JA 1HW2A 1X4PA 4MTEA 5D8KB 3H35A 4K2EA 1JUPA 2O3FA 4C30A 1QRYA 3SHFA 4EJOA 5LGNA 5FLMJ 3K1NA 3CP2A 3BTCA 5AONA 1QPMA 3BDDA 1W0UA 3BWGA 5LFAA 2ZBKA 4F93B 2FX0A 2HQRA 1WHUA 5E8GA 3J7YJ 2EINH 3VEPA 4QIWN 1HDPA 4P1WA 3SXYA 2QSHX 1TQIA 4BS9A 5F04A 4Z2YA 2IGNA 4UUSB 4M9SA 3G1MA 3I59A 4XORA 4A0YA 2M5WA 4JBAA 4A3IJ 2Y48A 3TDUC 2H94A 2DMNA 2W24A 2WWYA 1WI3A 1DUXC 2STTA 1HW5A 1D0YA 4FQGA 5KNLA 2OQRA 3OIOA 2COMA 1XC5A 1X19A 5IP6A 2AXLA 2Z33A 3ZQCA 3U2RA 3WG7H 2IGMA 2BY0A 2L5QA 3I4NJ 1U78A 3QOEA 2NRAC 4A2UA 1R4NB 4A69C 2LNBA 5KHDA 2MG4A 5D4RA 1ZARA 4XKBA 2VONA 1W5CC 1R4MB 2EA2A 2CGPA 1X4OA 3E6MA 4DYRA 1BR2A 1QVUA 1W1WE 3P7NA 5JFRA 4UHTA 2IW5A 2MW8A 4DYCA 1BI1A 2R7QA 1LVAA 2BE5F 3MKWB 2XHKA 3DF8A 5EF6A 2TCTA 3K2ZA 4Y15A 2NS0A 3ASOH 1FOWA 3WTVC 1WWXA 2K9QA 3S1NJ 3D5RC 1R23A 2DTZA 1F1ZA 2ZXHA 5HDGA 2HYJA 2N8GA 3CUQC 3WGGA 1BJZA 4LITA 3S3NA 2R7TA 2G0EA 4AIDA 1Y8QB 1HSTA 2L0KA 1JI8A 3U21A 2COBA 3HOVJ 2UXNA 3H0DA 5J1YA 1YS6A 3I56I 1JT6A 3W3CA 4AUXA 4XKVA 1A04A 3WE3A 4EVIA 2KFDA 3G73A 2RQPA 3GTPJ 2R7XA 4LB6B 2QCOA 1U3EM 1F5TA 3DKXA 5L3GA 1N75A 4EJWA 4HDUA 1K79A 1FSHA 4MHGA 3CUQB 3DBRB 5D4SA 4PUSA 3KP3A 4Q48A 2BY1A 2K9NA 3HSFA 3K4JA 5HDKA 1WKMA 1ACIA 1NK3P 1IXRC 2FEZA 1MMDA 4DJAA 3F22A 2X4HA 1Y0NA 2WTEA 3CF5F 4NHJA 2B7EA 3H1CA 1QZZA 1TQPA 4LMYA 1ZYRF 1N78A 3HM5A 1XN7A 3CF2A 3TQNA 3TMOA 2K9SA 2JRMA 1YRNA 4IPAA 2QWWA 2VXZA 4HA8A 4XBFA 2R7SA 2Y0SA 3P9IA 2DMTA 4C2UA 3CTAA 2MGQA 3SZTA 4ZH4F 2E34A 4BU2A 2WAQN 4G6DA 3QAHA 3G1LA 1W7PA 3JTGA 2V9VA 3CCQI 1Y0UA 4QLCU 2P81A 3JRHA 4CA0A 1ZGAA 4LLLA 2IPQX 2DLLA 3EETA 1LDJA 5LD2C 3QYBA 2GOMA 1G4DA 2W4SA 4WXHA 2BVMA 2V7FA 1RIOH 2XPWA 3HOZJ 4HNVA 4C3JJ 3DKWA 5ERIA 5J1UA 3FXKA 4L9VA 2KP6A 4NUBA 3M8FA 1O7LA 2PMUA 2KIUA 1DPUA 5M3MJ 3B6CA 3K4KA 4EM0B 1HBXG 1TWCJ 2IS2A 2OV7A 2LH9A 3FXJA 4UV9A 4CXFA 3FMSA 1U5TC 1V5GA 1XSVA 5CVIA 4FX0A 5DS9A 1JKOC 3QPLA 3V7CA 4OMYA 3DU6A 1AOYA 2TDXA 1J5YA 3BY6A 1TC3C 3KCCA 1FMVA 1NH3A 2VBYA 3PSIA 3M07A 1QNTA 3Q9VA 4XRSA 1Y6IA 3HXLA 3HPGA 3PM1A 2QQ9A 4EV0A 4DNCA 3OSFA 3SDGA 3GTMJ 1R1VA 1NHAA 1LE8B 3DBHB 3JW4A 3K4BA 1FC3A 1ZKGA 2L7MP 3DLAA 2E1NA 4N9HA 1KQ9A 5JVGF 3PO3J 2B0LA 3FKJA 2BVLA 2EB7A 3V7SA 1BBYA 3BCBA 2ZMEA 4CICA 5KAFC 2IA2A 3JAMK 3BG9A 3FK6A 2W85A 2FF4A 3KZIC 4HX4A 3DCFA 3O3KA 1SANA 1BC8C 3F8CA 1TP4A 5E1ZB 3ZQHA 1D5VA 1XDSA 3OR2C 5JHFA 2EFNA 3PUBA 1XMAA 1KQ8A 3RCOA 2EH3A 1RRJA 1Z67A 5ILUA 4LLGF 1TBXA 4M3BA 3PFIA 1SFUA 1K78B 2CW8A 4IRIA 1X1BA 5IOZA 1C0WA 3SEQA 4B09A 4L9NA 5FKNA 3RKYA 5D8LB 4KYWA 2OQGA 2XPUA 3HL2A 4S0HB 2DBBA 5CPRB 1B9NA 5E3MA 2VOOA 1I27A 2QZ8A 2V4JC 2PN6A 5K5QA 3MZ8A 3F0CA 2KIMA 2KDOA 1WCMJ 1KYWA 1KU9A 5GADJ 2Y30A 2UZKA 3GLLA 1XCBA 2GA2A 3O2PE 4M6VA 3M8EA 4C3IJ 3G3ZA 2X51A 5E3NA 1BI3A 2E2HJ 4BE0A 1IN6A 1S3JA 1D5YA 2PEXA 4OIRF 4IX7A 2HDCA 1YO5C 4LJZF 4RGRA 2FOWA 3W2VA 3ONQA 2IAIA 2LY2A 3TBIA 4RAFA 1GXPA 3V8JA 3WTWC 4PDKA 2PBIA 3U1KA 1K4SA 3OYFA 1VQLI 4PJLA 5IP9J 3IUOA 5E8IA 3KEQA 2DJNA 3DBLB 5DCFA 3RQIA 4DGWB 3C3WA 2PJRA 1NTCA 2O8XA 2ESNA 3L2WA 2LKXA 2XAJA 1YX5A 4G7OF 2VBWA 4AYBA 1WJEA 2Y2ZA 1L0OC 3GWZA 3WTUC 2CJJA 3H92A 4KT5C 3QP5A 2DXIA 2XUBA 3A4CA 2E60A 2IBDA 1FTTA 5LLQA 1BJAA 2DOAA 2IJLA 4IHXA 1FYKA 2GIZA 2ZXWH 1ETOA 3JRFA 3Q0VA 5ICGA 5GTHC 4KITB 4MIMA 4NC6A 1YW7A 3W6KB 1F9NA 1SVOA 2K85A 4MLOA 4AWXB 2M0CA 5F0CA 4BE1A 3GTLJ 1G3YA 2XRNA 1FIPA 4CO8A 4ESFA 2GXBA 1Z3YA 3LMMA 1IC8A 5IP7J 1Y39A 3SDBA 2XGDA 3DPUA 1RR8C 4D0PA 1T6SA 2HKXA 2M8EA 2XAGA 3ERMA 2F4MB 2EK5A 2CQKA 3ZR8X 1R6RA 2R93J 3IH3A 3CUOA 1FBSA 5J8CA 1P7JA 3G4SI 4BQOA 4M71A 2R7ZJ 3NRVA 2VJ5A 4OAYA 3VWBA 1HOMA 1U8BA 2F5FA 4ZC3A 2E2JJ 1U2WA 1W7PB 2KZGA 4B4CA 4MEXF 4LLNA 3MKLA 5EZGA 4RAYA 4JOMA 4JX5A 4OOIA 1H88C 4BXFA 4BXXJ 5LHHA 2Y75A 4BBRJ 2X48A 1IAWA 3N4MA 2IVMA 3LWFA 5HLIA 2D1VA 4E7KA 3S2WA 2DA1A 2ZJQF 2BW3A 2H1KA 3M9AA 5HLTA 1VQOI 1FPQA 2L02A 2LFBA 4GFBA 2ZSHB 2XAFA 2DDAA 3QP6A 4AU7A 2P5VA 3HEFA 3HB9A 3K10A 1HC8A 2FQ3A 2DPDA 4C2TA 4O3MA 2R92J 2XROA 2KRHA 5D6FA 3DKYA 4Q4ZF 1V54H 1X2NA 2LRDA 1XTAA 2M3AA 2XAQA 3AKZA 5C4XJ 5E1WA 4FTHA 1HW1A 1WQ2A 1BI2A 2BV6A 2CQ7A 1G2HA 4OAZA 4Y7NJ 3E6BA 1MNMC 1MH3A 1KU3A 4YELA 2Q2EA 4ZYDA 1X1PA 4HLXA 2HTSA 5B1BH 2W7NA 1VQ6I 4XLCA 1G6NA 4ESBA 5LRSA 5KVRA 3I5UA 1IG7A 1IF1A 4MO7A 5CVVA 1XSDA 3QU3A 3S17J 4EQQA 4W1UA 1D0XA 2BY3A 3OL4A 3OYEA 2CV2A 2Z99A 3HG9A 2HPMA 1I3QJ 4AD9A 3JCUC 4E4HA 1SD5A 4DQ2A 5CVRA 3W2AA 1RZ4A 2IA1A 4BUPA 4XK4A 1BW5A 3ASNH 1IUYA 4LK1F 3CQZJ 2NOJB 1QGPA 4NB5A 1HLVA 1B72B 1S6LA 2DYSH 2MBFA 3HOYJ 4GDFA 3GF2A 4BHCA 1HXDA 1TW2A 4XRMA 4A3LJ 2M7AA 4FISA 5LEKA 4ESJA 2ZB9A 1OCRH 1V3FA 2V9KA 2X6XA 2QBYA 3B6AA 2R7DA 1AU7A 4UXNA 1REPC 1IDZA 1MBKA 2NVYJ 1T98A 4AM3A 2ZJPF 4OIQF 2OD5A 1MBEA 1IRXA 5AIPA 2H8WA 2VQGA 2MLGA 2YPRA 1FY7A 3FBNB 2M4KA 4BEHA 5FLXZ 2YSRA 1D8KA 4F92B 2VJ4A 2AXTC 2QSFX 1RKTA 3JTHA 1ZREA 2V1DA 1XS9A 3JRCA 2H09A 2HYGD 3H9GA 4XL9A 4HEA2 3J81K 4RA2A 3JAMZ 2KJBA 3FXMA 1VNDA 3OOUA 4ITVA 5DD4A 2BXZA 2VB6A 4HZFA 1BIAA 4ASNA 3K69A 1FBQA 3EDPA 4EM2A 1GV5A 2LSOA 4V2FA 2PLYA 1R71A 4E7HA 3RSNA 1Z7UA 2K02A 2LKPA 3IL2A 1TWFJ 3K6GA 1HF0A 3HUGB 4AIHA 3J7ZI 1I6HJ 3PQJA 3ZQQA 3RIRA 3SJMA 2EWNA 3M7GA 2R5YA 3CJTB 4HF1A 1MW7A 3ZP5A 5F08A 3SYTA 4PFOA 2ZXJA 4RM2A 2XB0X 5HLHA 4A3BJ 3V42A 2K3FA 2QENA 1TWHJ 3R4KA 1DDNA 2X85A 4BQQA 1SMYF 1G3TA 1X2MA 1UG0A 2L4AA 3I4MJ 5L3EA 2PMHA 1RKWA 2KIFA 3IHUA 2QM3A 2X9DA 5J8FA 1YW9A 2ZNZA 3I64A 1P4AA 3DWLE 3L2QA 3T0YA 3S14J 2K9MA 3HYIA 1VQNI 3IV5A 3FF5A 1HA8A 1AWCA 1ZG5A 2CQQA 2F5CA 5M3FJ 2XGEA 2MC4A 4IF4A 4B44A 1BI0A 3VPRA 4A5MA 5L3CA 2K4BA 2XAUA 3FHZA 3OYKA 3E97A 4PJJA 3RYRA 3KETA 3H36A 2NS7A 1MJAA 4KN4X 4ZDOA 4L0YB 1OISA 2VIXA 2IA0A 1WJAA 2VXDA 2CV0A 2HOEA 3RQ4A 4J19A 2XSJC 3ZN0A 3OMYA 4I6ZA 4N4NB 3F8FA 1FZPB 4HF2A 2C6YA 4Q5SF 1Z91A 2ZFWA 3ABLH 2KMUA 2LC2A 4LIUA 1UB9A 1I39A 5DYMA 3KIOA 2ZO4A 2CMPA 4R8HA 1TT0A 2LK2A 1W5TA 3VSLA 2VJIA 3ZQIA 1O3TA 4GO1A 1USSA 1GVJA 5LRRA 2QQBA 1XMXA 1KU7A 3LA7A 1FWZA 3LSGA 4AIJA 1MNEA 3KLOA 4I76A 1B72A 3F9KA 2EZKA 3LFKA 4JX4A 3CMYA 4MQVA 4XICA 4KNYA 2O8KA 1WVRA 2O61A 1G3WA 1VQ4I 1IXCA 4XMYA 2IGKA 2JPCA 1B1BA 5IYBJ 3GZ5A 1K6OA 2VJJA 3LSPA 1I1SA 2FOKA 3SFIA 3G1OA 3SZGA 1KQ0A 4X0GA 5LHGA 1PUEE 3H0GJ 1S9HA 4HF0A 4E7SA 3S32A 2E36A 4A3CJ 3PQKA 2MYSA 4ZYAA 3ZRGA 2HZTA 1HSJA 4M3FA 3ZCOA 4ZYEA 1PDNC 5IPAA 1ZH5A 1IV8A 1FJLA 2L01A 2Y0MA 1IO2A 1ZRCA 2LY9A 2V1XA 3HSRA 5GAEJ 2EFOA 5FD5A 1BR4A 3E5UA 1F36A 2WY8Q 2OF7A 3CP8A 1JJ8C 3MEXA 2LY1A 5ILVA 2CWEA 3RKXA 1B8IB 1W5SA 5FRMA 1GUUA 2WC2A 2VODA 4UY8I 2OPTA 1OLTA 5B3SH 4XR6A 1UMQA 1QPIA 1ZRDA 2VQCA 2FRHA 1MJ9A 2L9VA 4XM3A 1ETQA 1VQ9I 2VKEA 3R61A 3JREA 3ZMZA 1PP8F 1S8NA 4B48A 2V26A 3S93A 1TQMA 2LOOA 2XDVA 3PFYA 5HS9A 5JLXA 3ZOBA 5IT9Z 4G94A 3JRAA 3O8HA 2LLKA 4E7LA 2Y31A 5J4VA 2DMUA 2ZC2A 3U1DA 1CGPA 2RAEA 2JQ7A 4U87A 1LJ9A 1TNSA 1SVMA 4BKXA 1ZR4A 2ID3A 2FQ4A 2X1DA 1FX7A 1MMSA 2PQ8A 3MQ0A 2ZNYA 4LGWA 4YIFA 2OTLI 2M0MA 2XV4S 3BP8A 3DEWA 4D9JA 5K5OA 1E2XA 3AFHA 3CD6I 2DT7B 3WTYC 1Y8RB 5EEHA 2ACJA 4BL0B 2UWMA 2H27A 4HW0A 3ULQB 3PUFA 1FYLA 1O57A 1ETVA 3GXOA 1X58A 3CCYA 5ILSA 2BOLA 1VQPI 5DM7F 1R9TJ 1WGXA 5DUKA 4IHWA 2X6OA 3EUHC 2IXSA 4RBOA 3GFIA 2OCEA 1A6IA 2JSCA 3H9QA 3OV8A 4RGSA 5EEAA 2YX7A 1T39A 1R5GA 1BC7C 3QODA 4HPQA 3NQOA 3LA2A 3TDZC 3K4LA 1LDKB 3K7AJ 3ZGKA 4EM1A 4ZYGA 4ON0A 5HOOA 1MNDA 2VC0A 3QQAA 5JR3A 1XDUA 2HNHA 3HGYA 4RLFA 3JSOA 2DFIA 2EZIA 4I2OA 5D6EA 4WCGA 1HQCA 2HXOA 5TISC 2XIGA 3TP0A 4CZZA 3M3YJ 1VQMI 3ECHA 4L5JA 3V4GA 4FASD 5FD6A 4MGRA 5E3LA 4IO9F 1FEXA 5J6XA 5EYRA 2WADA 4RAGA 2VC1A 1EV7A 2HDDA 1APLC 2E71A 5HDNA 2H8RA 5FB2A 3AAFA 3Q9SA 2LMDA 3BZKA 3H3UA 3PNTA 1LFUP 1B4AA 2UXXA 4F3QA 1H0MA 1WJBA 4BNCA 2HOAA 3V7RA 2JSPA 3BPXA 2X1EA 3COAC 1MD0A 4D1QA 2CSOA 2EIMH 3TO6A 4ZYHA 1W0TA 3VDXA 2ESHA 2JTVA 3CCUI 1K7AA 1MBJA 4R79A 4IL6C 5J4YA 2R7UA 1SD4A 2DOEA 3GTOJ 3FXRA 1U5TA 1X1DA 3OYMA 2A05A 2M9HA 4U0VA 4ZDPA 3BJOA 5K7ZA 4YRVA 4PCQA 4GCVA 2VN2A 4XKCA 3BG5A 1O3QA 1M1EB 1ZHFA 2OZ6A 4H4KC 2PX9A 4L18B 4Q47A 1A35A 2ICWG 3LAPA 3L2RA 1XCVA 4ANJA 1R5HA 2HXIA 2ZSIB 4F7ZA 1HCRA 3DV8A 5DEQA 1JGSA 1J9IA 1D1CA 4AC0A 2CV1A 2NOGA 2E1MC 2Q8KA 1RUNA 4A3FJ 4XSXF 3I71A 5GTIC 1EH8A 4BXUA 2IEKA 1BIBA 5B66C 1S72I 2FMLA 2F2EA 3ZMTA 3BTJA 1FBUA 3A1YA 2UUZA 3D0SA 4AVPA 4QWQA 3BJAA 4X6AJ 2CUJA 1ZAOA 2XVCA 4IEJA 2FNPA 1UJ8A 4I02A 3H5NA 1S7AA 1HKSA 3EUKL 1BOBA 4A3DJ 3HSEA 5C44J 2BBYA 4LOCA 2W25A 1LFBA 1STZA 3F6OA 4F55A 1RI7A 1AHDP 1V4RA 2LG4A 4OU0A 2F6CA 4W97A 4WXDA 3DFGA 2LYCA 4GGGA 3VODA 1A36A 4HSRA 3R6SA 2ECBA 2QA4I 3S8PA 3DP7A 2G9WA 1LB2A 5GPCA 1VTNC 2CG4A 1IN5A 2A68F 2JA2A 2RKHA 3LOCA 4RAZA 2R3SA 3CLOA 2HI3A 4UUTA 3ZXSA 1J59A 1DU0A 1A6QA 3OWTA 5B5EC 3DPTA 3FMRA 2BHZA 4IQ4A 4HOBA 2E5NA 5A2QK 5IOYA 4A93J 4I0BA 5EGOA 4PK4A 4CUGA 3OYLA 4ENKA 5F6FA 5LHIA 2ZMEC 4KDPA 1PJRA 3DXJF 2V6EA 3HTSB 3L09A 2CW7A 2YR2A 4XKWA 5ICFA 5CQGA 1B9MA 5M5YJ 2O9LA 1ETXA 4BJTA 4XOPA 3ERED 4U0WA 2O0YA 4WX9A 1S7OA 2XAHA 3GZNB 2W1OA 1ZGWA 2GLOA 4X1EA 2HVQA 5JHUA 5IT3A 3S3MA 1DP3A 2WV0A 3Q3SA 5EEGA 3GFLA 3RTRA 3CCMI 2QEXI 2YUSA 2FBKA 1ZG1A 2DDBA 2DT6A 1YJ9I 2FNAA 2A6HF 3FM5A 4EEFG 1VF9A 3ZMUA 3OYDA 1JTXA 3TOBA 2GQQA 2R7WA 5E3OA 3EUHA 3PSFA 3MVPA 2Z5UA 4G12A 1LFPA 3PNYA 3UKGA 3TOAA 5K7HA 1T08B 1A5JA 2Q1ZB 4JQFA 1Q1VA 1WH7A 1JHFA 2FBIA 4ZZLA 4HRIA 4P55A 2KPMA 4E7JA 5LEJA 1MH4A 2G7UA 1RNLA 2L7ZA 1P4XA 3QYEA 2GBYA 2FSWA 1XMKA 1IN7A 3KP7A 3GYHX 3WGHA 5BS6A 1LE8A 5J1RA 3MFKA 3F72A 1ON2A 4AYBN 4B3AA 3GTJJ 1MMAA 1YX3A 3I55I 3HRTA 2IS1A 2EZLA 2DA2A 3HRMA 2EBIA 4U7DA 2DOFA 2KHMA 4JP0A 3IH4A 2Y0SN 3A0BC 3HKZA 1YQAA 4PFPA 4ZJZA 1FMWA 2Z9OA 4OIPF 2ELKA 5FKKA 2O7OA 4HQEA 1F4KA 5ICEA 3QPTA 4HX8A 3U9GA 1V55H 4G6QA 2NVXJ 3HJEA 4OIOF 3ZMDA 3AL0B 1VI0A 2HWVA 1IDYA 3V8KA 4G7HF 1S5LC 4HG2A 5ICCA 1YIJI 1SD6A 1TWGJ 2M1BA 3REOA 2P7VB 2OBPA 3SFZA 3VYUB 1FOXA 5HNFA 3DU5A 3FBIB 2HPIA 2X1CA 3VYTB 1MDMA 2VPLA 4KMUX 3CMEI 3GTQJ 4B1RA 4ETSA 2ZMEB 2V1NA 1T56A 2JVGA 1Z6TA 3NEUA 4XLEA 1N77A 2L4MA 4N4OB 2GXAA 2XKOA 2RVCA 1DGWY 4XIDA 3S3OA 1MBFA 2CFXA 2J5OA 1B59A 1D1AA 5EDNA 3OYIA 1SFKA 3LA3A 4OWRB 1LUJB 3IC7A 2A07F 3BG7A 3J7AO 2HZDA 4BHBA 3TW7A 5DUIA 5H2FC 3GBGA 4UB6C 2ZFUA 2ID6A 3GUDA 4S04A 4UUSA 3HPHA 1IN8A 4OINF 3OOPA 2CUFA 1QO0D 3S1RJ 1OYYA 1VQ5I 1FTZA 2MH9A 3HKZN 5EG0B 3FXQA 1Z77A 3R0AA 1Y1VJ 3GX4X 1UHMA 1X3WB 2KISA 1ZN2A 1JKPC 3VSKA 2KJCA 2LF7A 1XGOA 2X0LA 3A2KA 1OJLA 2A3SA 1XGMA 3NARA 2H6CA 1D0ZA 1RC9A 4BH9A 4CYCB 1H9GA 2V9PA 2RQQA 3IP4B 4A6DA 2XKPA 1ZG3A 4BDYA 3VFZA 4LG3A 5FO5A 1JUSA 4QTRA 3HTUA 2LVSA 4KN7X 4M74A 4FCYA 4ZTFA 2D1HA 3EUAA 4KUMA 3CC2I 1TTYA 1I1GA 1XB4A 2OU2A 1MZBA 3BZ6A 5J40A 3BPVA 1QQIA 3BR6A 2NVUB 2EQRA 5CVUA 3FMQA 4HYEA 2PFBA 2JWTA 1MDMB 2VOPA 1MKMA 2HTJA 4BDZA 1X3ZB 4MFEA 5CYVA 2V6CA 1MSFC 1OQYA 2WA0A 3MN2A 3RKQA 2K86A 3EPZA 4WK8F 1NK2P 3HDDA 2YU9J 2FBHA 4HNTA 3IAM2 3I9V2 3CMAI 1GV2A 5GPAA 3JRIA 3FK7A 2P7CB 4DOZA 3PL8A 2LKSA 1JE8A 3KEOA 3WHCA 3FIWA 3QRFF 3FKIJ 4Y52J 4RLQA 4PGGA 1XPXA 2NVQJ 4UVAA 3BG3A 1QZYA 2M34A 2XB5A 3FDYA 5BPIA 4IOAF 1VQ7I 1W4MA 2D45A 1K78A 2O6GE 2CU7A 1RETA 4U88A 2R7VA 5IYDJ 4FHTA 5HLGA 1W36C 2L54A 2A5WA 3C2BA 1J75A 3K1MA 4ENNA 1WPKA 1WSUA 4TV7A 3HOWJ 1Z6RA 3DTIA 4XSZF 4KIGA 4GYGA 1DQUA 2VQLA 2YS9A 1R7JA 3HC7A 4RM3A 4MTDA 3OYCA 2LBFA 4CGZA 2NNYA 3OS2A 2RNGA 1YLFA 5B1AH 3DEUA 1OPCA 4BY1J 4EGYA 5CJ9A 2P8TA 1TWAJ 1P2FA 5BPDA 2JA6J 3MMYB 2XC7A 3WODF 3QWLA 2IS4A 4A3MJ 4CH7A 2A69F 2I5UA 3WG9A 3OYGA 2X6WA 3L7WA 2VUMJ 2QVOA 1Z7LA 1DGRM 4E7IA 1F43A 2DA4A 2P5LC 3DTEA 2KL4A 3RKWA 4A6EA 4RGXA 5EGOB 4BBSJ 4PJMA 1J09A 3LSHA 4RB0A 4PJNA 2KDZA 1P9QC 3ZN1A 2L2OA 3TP3A 3W2WA 4MQ9F 2QQ8A 2Y9ZA 4IRHA 3HZJA 1ULYA 3UR3C 4A3GJ 3ZMSA 4Y3OA 2VL8A 3IKVA 3RYPA 4D5FA 1I3AA 5A2QZ 3EYYA 1BOAA 4RDUA 3TEDA 1R49A 1ZELA 2GWRA 1OR7C 3BTIA 2ECCA 1WI9A 5JI6A 4EJUA 2QKMB 4A12A 1SFEA 2ME0A 5ED4A 5F27A 4XNFA 1O3SA 1U6GA 2CS3A 1EKEA 2KZVA 1ZRFA 3LSIA 2EZHA 2ZCWA 1RESA 4XRSG 2XPVA 3F8BA 3QOPA 4L5EA 2JPBA 1X3UA 1O4XA 2LR8A 1YS7A 3K9TA 3C18A 4XN3A 2M87A 1FYMA 3T8TA 5BNGA 1RPWA 4O6JA 5L3BA 3E5QA 5D5WB 3W6VA 3J7AY 1IRZA 3I0TA 2R0QC 4B47A 1EF4A 3KP4A 3F6VA 3OR1C 2V79A 1YW8A 2H6BA 2FA5A 2V1UA 3ABTA 2VT2A 3K70D 1GHCA 3GZ6A 4CYDA 3HOXJ 4G8XA 3G2BA 1FSEA 2BGCA 4KJZA 1JT0A 1D1BA 1YRNB 4UUVA 1YOVB 2HGCA 1IUFA 2TRTA 3WTZA 1S7EA 5L3DA 1QHGA 3I53A 1PYVA 4M73A 4YEJA 1B8IA 3KYDB 5CLSA 2P6TA 3NAUA 4B43A 2OC6A 1OCCH 1SC7A 1FOKA 5IT9K 2HVSA 2CRGA 2OUMA 1ORKA 3IRQA 1POGA 4HNUA 4KIFA 4ZTJA 4XONA 1YJWI 4CCLA 2HOSA 2MFZA 5JLWA 4CCMA 5DM6F 3X2QH 3ABMH 4XLPF 2VLAA 5HS7A 1USTA 2JK3A 5F1RA 3E0JB 3I3LA 2OTJI 2QGUA 2RDPA 1OR7A 3KX2A 5KAIC 2K40A 2QLZA 2RV8A 1LNWA 1TZLA 3OS0A 1SMTA 1UG2A 4Y4RA 1XD7A 1T8IA 3FXOA 1OMIA 2HVRA 4HX7A 3RZDJ 1S29A 3OY9A 2IT0A 4CYCA 2JZYA 2P6SA 2XGCA 5L3FA 2EV6A 3S2HJ 1YTYA 3CC7I 2E5ZA 2VBZA 1HKTA 1FP2A 1DU6A 3K0LA 1YI2I 2VASA 3DEEA 1YG2A 1YFHA 4M6XA 3WGIA 2DU9A 3BR3A 1YITI 2M4GA 2M30A 3C1DA 4RGUA 3A0HC 4S05A 4PJ0C 4C2MJ 1WJ5A 1FT9A 2W57A 3F8NA 3OYJA 4D7NA 3WTSC 2EPFA 3DPLC 3GLXA 3GO5A 2VKHA 2EJRA 3L1PA 5DD8A 4IOCF 2CUZA 3HGGA 2F4OB 1O3RA 2E1OA 2QQAA 3OIQA 3KP2A 2GA1A 2ETHA 3S2DJ 3SZPA 4I01A 2PI0A 4CDGA 3LL7A 4LG0A 3BR5A 1JKRC 1AA7A 3CO6C 3K4NA 1ITYA 2XF5A 3ZQFA 3CCSI 1MBGA 1GLNA 1GT0C 3GVAA 3IWZA 3KLNA 2PG4A 3KE2A 4HLYA 5CQEA 4BJ5C 2OAZA 1JJ6C 1RR7A 3MWMA 1GVDA 4J01A 3K1PA 1H9TA 5FLXK 4A0XA 5K1YA 1KA8A 1SFXA 5LGTA 5E18F 2QSGX 3BTLA 4AIKA 4MEYF 4D5CA 2A5YB 2HKOA 5F64A 3HUGA 1JUMA 3CJQB 3F8MA 3KEYA 1IZ1A 4U7BA 5KCMA 4CCOA 3CCEI 4XN0A 3WU1B 2JJ7A 3D1NI 3H9JA 3LSMA 3GMEA 1CF7A 1ON1A 1TL8A 4Z6YA 2YU3A 3CO7C 3AL0C 2UV1A 3LAJA 4NNJA 3I4PA 2VBXA 3AG2H 1XG1A 4M72A 4FT8A 2RC4A 4ZDLA 3CCRI 2P4WA 1MIJA 3WTTC 4CSWA 1XGNA 1VQ8I 1ETKA 2XASA 4P96A 4F52A 3IKTA 2GOXB 2ISYA 2K27A 4Y17A 3CMMA 4IHVA 1MMGA 3LSJA 3E6CC 3FX3A 1JXSA 2DMQA 4EMSA 3S1QJ 2HOTA 5AIQA 1SAUA 2DFFA 3LFUA 3Q0WA 3VB2A 3F3XA 1LKXA 3J80Z 1JHHA 2K3PA 2L7FP 3KZZA 2MC3A 4E7ZA 2MD0A 5F0HA 2Z16A 3HOSA 4O5VA 4M3GA 1AKHA 2DPUA 4NBQA 3HRUA 3TKYA 2FXAA 3OSGA 4HSTA 3OL3A 1SVLA 4DW6A 5D5UB 3CJNA 3ROUA 3IWFA 3AG3H 1T33A 1NG6A 4GRIA 3BQYA 4LK0F 3O6BB 2WB1A 1MGTA 1UELB 1LEAA 3M1CA 3CUQA 3OIPA 3CCJI 2R5YB 4FETA 2B63J 5DTDA 2E1MB 2VI6A 3K2AA 1J0RA 3BR0A 4CCNA 1MMNA 3D5LA 2Q2EB 3A03A 1EA3A 4C3HJ 3MZHA 1PP7U 3FHNA 1ONVA 2O03A 1LVKA 2PJPA 2MABA 1YYVA 3QYFA 5DCMB 5TGTA 3HIFA 3S16J 1ZLJA 1E3OC 2KQRA 3BZCA 1YE9A 3HBLA 2EIJH 2R5ZA 2E19A 2R4GA 2XGXA 2L7KA 1EH7A 4E6KG 3RPUA 4V2GA 3VOEA 4YIRX 5LBQA 2JA5J 4RMNA 2DJIA 4V19K 3T1BA 1R1UA 1V5EA 3LSTA 3JRDA 4LG0B 4Y13A 5CKTA 3HHHA 4BEHB 1IV6A 4E70A 5JVTA 1GXQA 3SEZA 3PNVA 1U0JA 4IZZA 2DQLA 4II2A 5E20A 2ELHA 2HQNA 4YFNF 3RI4A 3VYRB 2STWA 1OYWA 3JRBA 2NYXA 2LP0A 2JN6A 4UB8C 3RZOJ 2WAFA 1Y1WJ 4NDLA 3CDHA 1UHWA 1P4WA 1TT5B 2R5ZB 4ENJA 1U5TB 2XF7A 1J7KA 1KU2A 1QVTA 2H1LA 2NVTJ 2O5RA 1LPQA 3ZPLA 4I0AA 4KT6A 2RGVA 4A5NA 1IN4A 2K9LA 1MSEC 2M45A 1XGSA 4G6TB 1JGGA 5HNHA 4RB2C 5KK1A 2E2IJ 4IHYA 3R0JA 4CCJA 1UHSA 1TNTA 2VQHA 3CC4I 2VT3A 3BR2A 3A01A 3KFWX 3JRGA 4J00A 3GW2A 2HU9A 5CVJA 3TW6A 3FZVA 3E3VA 3QPHA 4QPQA 2QF7A 2GXGA 2E1CA 1TW3A 2DI3A 3E1SA 2I8DA 2OA4A 1UFMA 4M9XA 4UVBA 5DCMA 1OCTC 2MA3A 3S15J 3BROA 4KFCA 4BYYA 3S1MJ 2DQRA 3QU6A 4KISA 3I58A 2LTPA 1OFCX 2CYYA 2BHYA 3BOQA 4NQWA 2AS5F 2XRLA 2Z3YA 4HV6A 1K4TA 1ERDA 2E35A 4PGHA 2JVHA 1X1AA 1UCRA 5IY5H 2GAUA 2YX4A 3JR9A 1CQTA 3LSRA 2FU4A 1DPRA 2NNNA 3K4MA 5K5RA 4D7MA 4M6YA 1EH6A 2CH0A 4BQNA 5FJ8J 4HQMA 2CW0F 5BOXA 1QHHD 4BY7J 3V8LA 1MBHA 5HVQC 2JA8J 4P9UA 4OMZA 3P9KA 4BE2A 1K6YA 2X6YA 2BEOA 3GFMA 4DBQA 4R1HA 1MJBA 4H0EA 3F23A 1H89C 5E79C 1IGNA 2BW3B 2XSDC 2ZXIA 3CDLA 2Q0OA 1K61A 2F5VA 4EJTA 3LQQA 4CCKA 5HS8A 1E3HA 3NWTA 1E17A 3H3ZA 2OZUA 3CESA 3DTKA 2DA5A 2DYRH 4DZPA 2LDUA 4IJAA 2ZJ2A 3HHGA 2DA6A 3OYHA 3ESWB 2EV5A 1WRJA 1VQKI 4Y33A 3JSPA 3ECOA 4A3EJ 5FLVA 3GTKJ 2QKLB 2KT0A 5DV5A 3ELKA
chains in the Genus database with same CATH topology
2K9SA 1YRNA 4XICA 2O8KA 2CU7A 2ME6A 1RETA 5IYDJ 1ZQ3P 3C2BA 1WPKA 2CQXA 2DMTA 5IYBJ 3HOWJ 2MGQA 3LSPA 2CUEA 3SFIA 2WAQN 3G1OA 2YS9A 3G1LA 3H0GJ 2P81A 3JRHA 4A3CJ 5EZHA 4M3FA 5IPAA 4BY1J 3O8GA 5HODA 1FJLA 1TWAJ 2PMZN 2XPWA 3HOZJ 1BL0A 1ZK8A 4C3JJ 2LY9A 4HNVA 5J1UA 2JA6J 5F0FA 4A3MJ 1F36A 2OF7A 5M3MJ 1JJ8C 2WB1N 3Q0UA 3B6CA 3ZQGA 2VUMJ 3ZQLA 1B8IB 1TWCJ 1GUUA 3BR1A 1F43A 2DA4A 2OPTA 5EGOB 4BBSJ 5DS9A 2KDZA 1JKOC 3QPLA 1UMQA 3TP3A 1QPIA 2Y9ZA 4A3GJ 1ETQA 1TC3C 4D5FA 4RDUA 2VKEA 3TEDA 3JREA 1BW6A 4XRSA 3BTIA 1SFOJ 4A3JJ 2ECCA 3ZOBA 3PM1A 5JLXA 3A01B 2ME0A 3OSFA 5F27A 3SDGA 3GTMJ 3JRAA 3O8HA 3BQZA 2LLKA 4JX6A 2Y31A 1LE8B 1ZKGA 2L7MP 2DMUA 2EZHA 2HQ5A 2RAEA 1RESA 3PO3J 4XRSG 2XPVA 4L5EA 1O4XA 4BKXA 1ZR4A 2LR8A 2ID3A 3HOUJ 2FQ4A 5FKLA 5BNGA 1RPWA 1K83J 3BG9A 3FK6A 3DCFA 3DEWA 3W6VA 1SANA 1IRZA 3ZQHA 2R0QC 1EF4A 4JYKA 2NS8A 1ETVA 2EH3A 1X58A 2M2EA 3CCYA 3HOXJ 1JT0A 4M3BA 1P7IA 1R9TJ 1WGXA 1YRNB 4IHWA 2X6OA 5IOZA 4RBOA 1A6IA 1IUFA 2TRTA 5FKNA 3E7LA 2XPUA 5EEAA 4S0HB 1B8IA 1I50J 3A02A 9ANTA 3NAUA 5E3MA 3K7AJ 2FD5A 3F0CA 3QQAA 2CRGA 3QPSA 1ORKA 3HGYA 1POGA 1WCMJ 2EZIA 2HOSA 2Y30A 5JLWA 5GP9A 2HXOA 2JK3A 3TP0A 3M3YJ 4M6VA 4C3IJ 3BT9A 5E3LA 5E3NA 1FEXA 2E2HJ 2VKVA 2K40A 5EYRA 1D5YA 2HDDA 1APLC 5EG0A 2JMWA 1UG2A 2H8RA 2IAIA 1LFUP 3RZDJ 2GM4A 4CYCA 2XGCA 3S2HJ 2HOAA 5IP9J 2JA7J 2DJNA 5K7FA 1W0TA 1DU6A 3RQIA 1JTYA 1HDDC 1NTCA 3BR3A 1AKHB 2LKXA 1MBJA 1BA5A 3WHBA 2L9RA 1H8AC 2Y2ZA 4C2MJ 3GTOJ 5IYCJ 2CJJA 2M9HA 4D7NA 3H3VK 2IBDA 5K7ZA 1FTTA 2AO9A 3BG5A 4IHXA 2DMPA 3L1PA 1ETOA 3JRFA 3Q0VA 3PO2J 3HGGA 4MIMA 2E1OA 4FE4A 4MLOA 3S2DJ 2M0CA 5F0CA 2HXIA 4ABZA 3GTLJ 1HCRA 4QSHA 3BR5A 1FIPA 1JKRC 5J3LA 1ITYA 4AC0A 2NOGA 3ZQFA 1IC8A 1MBGA 4A3FJ 3IH2A 5IP7J 1GT0C 4FE7A 2XGDA 2LD5A 1FIAA 2IEKA 1U9OA 1JJ6C 1RR7A 1GVDA 3BTJA 2R93J 3IH3A 1U9NA 1P7JA 3BTLA 4D5CA 4X6AJ 2R7ZJ 4IEJA 1JUMA 1HOMA 1U8BA 2M8GX 4A3DJ 2E2JJ 2DN0A 5C44J 2JJ7A 2I10A 4LOCA 4B4CA 3D1NI 1OCPA 3MKLA 5EZGA 1LFBA 3M4OJ 1AHDP 4JX5A 1H88C 4BXXJ 4W97A 5M5XJ 2MSYA 4BBRJ 2X48A 2FJ1A 2W48A 1XG1A 2ECBA 1ZTRA 3LNQA 5GPCA 3LOCA 4UUTA 2DA1A 2HI3A 1JKQC 3CMYA 1DU0A 1ETKA 5C3EJ 2H1KA 2LFBA 4M3EA 5IOYA 4A93J 4GFBA 5EGOA 4IHVA 3LSJA 3HEFA 3HB9A 2DMQA 3S1QJ 2R92J 1ENHA 2Y9YA 1VFCA 2HOTA 1X2NA 3Q0WA 5C4XJ 1Z0XA 2O9LA 5M5YJ 4FTHA 1ETXA 2L7FP 5FKMA 1G2HA 5F0HA 4Y7NJ 1MNMC 4M3GA 1AKHA 3GTKJ 1MH3A 3OSGA 1ZGWA 2VPRA 4DZJA 4X1EA 2GLOA 2DA7A 4DW6A 2D5VA 1IG7A 2WV1A 3Q3SA 4MO7A 1T33A 2YUSA 1ZR2A 3S17J 3BQYA 5M5WJ 4W1UA 5C4JJ 4M3DA 4EEFG 1VF9A 1I3QJ 1JTXA 5E3OA 4DYQA 2DA3A 3MVPA 4XK4A 1ETWA 2R5YB 1GDTA 4G12A 2B63J 1BW5A 4A3KJ 4MFDA 3UKGA 5DTDA 5K7HA 1A5JA 3CQZJ 2VI6A 1Q1VA 1WH7A 3K2AA 3BR0A 1HLVA 1IJWC 1B72B 3HOYJ 1MH4A 3A03A 3FISA 2L7ZA 4C3HJ 3GTGJ 1WH5A 2GBYA 4XRMA 4A3LJ 2AHQA 3S16J 5FKOA 1LE8A 4FISA 1E3OC 5J1RA 1ETYA 1PUFB 3HBLA 2ZB9A 1PUFA 3B6AA 4AYBN 4B3AA 3GTJJ 2E19A 5F1JA 2R5ZA 1AU7A 1IDZA 5FLMJ 1JUPA 2NVYJ 1MBKA 4V2GA 1QRYA 2DA2A 2EZLA 2EBIA 2JA5J 3BTCA 4JP0A 3IH4A 1MBEA 2Y0SN 1W0UA 3JRDA 2FX0A 1IV6A 5FKKA 2ELKA 2O7OA 4QIWN 1HDPA 5F04A 2NVXJ 1RKTA 4UUSB 3JRBA 1VI0A 3G1MA 2LP0A 1IDYA 2JN6A 3JRCA 1XS9A 3RZOJ 1Y1WJ 3OOUA 1VNDA 4NDLA 4A3IJ 2R5ZB 1TWGJ 2DMNA 1QVTA 1WI3A 2NVTJ 3OIOA 3GTQJ 1XC5A 4B1RA 5IP6A 1GV5A 4V2FA 3ZQCA 1T56A 4XIDA 3I4NJ 1MSEC 1U78A 1TWFJ 1MBFA 1HF0A 1I6HJ 4A69C 1JGGA 3SJMA 2MG4A 5EDNA 2R5YA 2E2IJ 4IHYA 1UHSA 5F08A 3A01A 3BR2A 2XB0X 3JRGA 4A3BJ 1TWHJ 4DYRA 3TW7A 1QVUA 3TW6A 3GBGA 1X2MA 2ID6A 2QF7A 4UUSA 2MW8A 4DYCA 3I4MJ 2CUFA 3S1RJ 5EF6A 1FTZA 1OCTC 2TCTA 1RKWA 3HKZN 3S15J 2X9DA 5EG0B 1Z77A 1Y1VJ 3S1MJ 3S1NJ 2K9QA 2DTZA 1JKPC 2LTPA 1OFCX 3S14J 2XRLA 2HYJA 2N8GA 1OJLA 1BJZA 3IV5A 3NARA 4CYCB 2G0EA 1CQTA 3JR9A 2L0KA 2CQQA 3LSRA 5M3FJ 4D7MA 2XGEA 2COBA 3HOVJ 1JUSA 3VPRA 5FJ8J 4QTRA 5J1YA 2LVSA 4BY7J 1MBHA 1JT6A 2JA8J 4FCYA 4AUXA 2NS7A 1H89C 1IGNA 3GTPJ 2XSDC 4J19A 2QCOA 3CDLA 4I6ZA 3BR6A 1K61A 2EQRA 2JWTA 4MFEA 1MSFC 3MN2A 3RKQA 1NK2P 3HDDA 2K9NA 2LK2A 3ZQIA 2YU9J 2DA5A 1GV2A 5GPAA 3JRIA 1NK3P 4DZPA 3FK7A 2DA6A 3LSGA 3WHCA 3FIWA 3FKIJ 4Y52J 4I76A 2NVQJ 3HM5A 1B72A 3BG3A 5FLVA 4A3EJ 2EZKA 4JX4A 2M34A 2XB5A 2KT0A 1S7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9S A;  1YRN A;  4XIC A;  2O8K A;  2CU7 A;  2ME6 A;  1RET A;  5IYD J;  1ZQ3 P;  3C2B A;  1WPK A;  2CQX A;  2DMT A;  5IYB J;  3HOW J;  2MGQ A;  3LSP A;  2CUE A;  3SFI A;  2WAQ N;  3G1O A;  2YS9 A;  3G1L A;  3H0G J;  2P81 A;  3JRH A;  4A3C J;  5EZH A;  4M3F A;  5IPA A;  4BY1 J;  3O8G A;  5HOD A;  1FJL A;  1TWA J;  2PMZ N;  2XPW A;  3HOZ J;  1BL0 A;  1ZK8 A;  4C3J J;  2LY9 A;  4HNV A;  5J1U A;  2JA6 J;  5F0F A;  4A3M J;  1F36 A;  2OF7 A;  5M3M J;  1JJ8 C;  2WB1 N;  3Q0U A;  3B6C A;  3ZQG A;  2VUM J;  3ZQL A;  1B8I B;  1TWC J;  1GUU A;  3BR1 A;  1F43 A;  2DA4 A;  2OPT A;  5EGO B;  4BBS J;  5DS9 A;  2KDZ A;  1JKO C;  3QPL A;  1UMQ A;  3TP3 A;  1QPI A;  2Y9Z A;  4A3G J;  1ETQ A;  1TC3 C;  4D5F A;  4RDU A;  2VKE A;  3TED A;  3JRE A;  1BW6 A;  4XRS A;  3BTI A;  1SFO J;  4A3J J;  2ECC A;  3ZOB A;  3PM1 A;  5JLX A;  3A01 B;  2ME0 A;  3OSF A;  5F27 A;  3SDG A;  3GTM J;  3JRA A;  3O8H A;  3BQZ A;  2LLK A;  4JX6 A;  2Y31 A;  1LE8 B;  1ZKG A;  2L7M P;  2DMU A;  2EZH A;  2HQ5 A;  2RAE A;  1RES A;  3PO3 J;  4XRS G;  2XPV A;  4L5E A;  1O4X A;  4BKX A;  1ZR4 A;  2LR8 A;  2ID3 A;  3HOU J;  2FQ4 A;  5FKL A;  5BNG A;  1RPW A;  1K83 J;  3BG9 A;  3FK6 A;  3DCF A;  3DEW A;  3W6V A;  1SAN A;  1IRZ A;  3ZQH A;  2R0Q C;  1EF4 A;  4JYK A;  2NS8 A;  1ETV A;  2EH3 A;  1X58 A;  2M2E A;  3CCY A;  3HOX J;  1JT0 A;  4M3B A;  1P7I A;  1R9T J;  1WGX A;  1YRN B;  4IHW A;  2X6O A;  5IOZ A;  4RBO A;  1A6I A;  1IUF A;  2TRT A;  5FKN A;  3E7L A;  2XPU A;  5EEA A;  4S0H B;  1B8I A;  1I50 J;  3A02 A;  9ANT A;  3NAU A;  5E3M A;  3K7A J;  2FD5 A;  3F0C A;  3QQA A;  2CRG A;  3QPS A;  1ORK A;  3HGY A;  1POG A;  1WCM J;  2EZI A;  2HOS A;  2Y30 A;  5JLW A;  5GP9 A;  2HXO A;  2JK3 A;  3TP0 A;  3M3Y J;  4M6V A;  4C3I J;  3BT9 A;  5E3L A;  5E3N A;  1FEX A;  2E2H J;  2VKV A;  2K40 A;  5EYR A;  1D5Y A;  2HDD A;  1APL C;  5EG0 A;  2JMW A;  1UG2 A;  2H8R A;  2IAI A;  1LFU P;  3RZD J;  2GM4 A;  4CYC A;  2XGC A;  3S2H J;  2HOA A;  5IP9 J;  2JA7 J;  2DJN A;  5K7F A;  1W0T A;  1DU6 A;  3RQI A;  1JTY A;  1HDD C;  1NTC A;  3BR3 A;  1AKH B;  2LKX A;  1MBJ A;  1BA5 A;  3WHB A;  2L9R A;  1H8A C;  2Y2Z A;  4C2M J;  3GTO J;  5IYC J;  2CJJ A;  2M9H A;  4D7N A;  3H3V K;  2IBD A;  5K7Z A;  1FTT A;  2AO9 A;  3BG5 A;  4IHX A;  2DMP A;  3L1P A;  1ETO A;  3JRF A;  3Q0V A;  3PO2 J;  3HGG A;  4MIM A;  2E1O A;  4FE4 A;  4MLO A;  3S2D J;  2M0C A;  5F0C A;  2HXI A;  4ABZ A;  3GTL J;  1HCR A;  4QSH A;  3BR5 A;  1FIP A;  1JKR C;  5J3L A;  1ITY A;  4AC0 A;  2NOG A;  3ZQF A;  1IC8 A;  1MBG A;  4A3F J;  3IH2 A;  5IP7 J;  1GT0 C;  4FE7 A;  2XGD A;  2LD5 A;  1FIA A;  2IEK A;  1U9O A;  1JJ6 C;  1RR7 A;  1GVD A;  3BTJ A;  2R93 J;  3IH3 A;  1U9N A;  1P7J A;  3BTL A;  4D5C A;  4X6A J;  2R7Z J;  4IEJ A;  1JUM A;  1HOM A;  1U8B A;  2M8G X;  4A3D J;  2E2J J;  2DN0 A;  5C44 J;  2JJ7 A;  2I10 A;  4LOC A;  4B4C A;  3D1N I;  1OCP A;  3MKL A;  5EZG A;  1LFB A;  3M4O J;  1AHD P;  4JX5 A;  1H88 C;  4BXX J;  4W97 A;  5M5X J;  2MSY A;  4BBR J;  2X48 A;  2FJ1 A;  2W48 A;  1XG1 A;  2ECB A;  1ZTR A;  3LNQ A;  5GPC A;  3LOC A;  4UUT A;  2DA1 A;  2HI3 A;  1JKQ C;  3CMY A;  1DU0 A;  1ETK A;  5C3E J;  2H1K A;  2LFB A;  4M3E A;  5IOY A;  4A93 J;  4GFB A;  5EGO A;  4IHV A;  3LSJ A;  3HEF A;  3HB9 A;  2DMQ A;  3S1Q J;  2R92 J;  1ENH A;  2Y9Y A;  1VFC A;  2HOT A;  1X2N A;  3Q0W A;  5C4X J;  1Z0X A;  2O9L A;  5M5Y J;  4FTH A;  1ETX A;  2L7F P;  5FKM A;  1G2H A;  5F0H A;  4Y7N J;  1MNM C;  4M3G A;  1AKH A;  3GTK J;  1MH3 A;  3OSG A;  1ZGW A;  2VPR A;  4DZJ A;  4X1E A;  2GLO A;  2DA7 A;  4DW6 A;  2D5V A;  1IG7 A;  2WV1 A;  3Q3S A;  4MO7 A;  1T33 A;  2YUS A;  1ZR2 A;  3S17 J;  3BQY A;  5M5W J;  4W1U A;  5C4J J;  4M3D A;  4EEF G;  1VF9 A;  1I3Q J;  1JTX A;  5E3O A;  4DYQ A;  2DA3 A;  3MVP A;  4XK4 A;  1ETW A;  2R5Y B;  1GDT A;  4G12 A;  2B63 J;  1BW5 A;  4A3K J;  4MFD A;  3UKG A;  5DTD A;  5K7H A;  1A5J A;  3CQZ J;  2VI6 A;  1Q1V A;  1WH7 A;  3K2A A;  3BR0 A;  1HLV A;  1IJW C;  1B72 B;  3HOY J;  1MH4 A;  3A03 A;  3FIS A;  2L7Z A;  4C3H J;  3GTG J;  1WH5 A;  2GBY A;  4XRM A;  4A3L J;  2AHQ A;  3S16 J;  5FKO A;  1LE8 A;  4FIS A;  1E3O C;  5J1R A;  1ETY A;  1PUF B;  3HBL A;  2ZB9 A;  1PUF A;  3B6A A;  4AYB N;  4B3A A;  3GTJ J;  2E19 A;  5F1J A;  2R5Z A;  1AU7 A;  1IDZ A;  5FLM J;  1JUP A;  2NVY J;  1MBK A;  4V2G A;  1QRY A;  2DA2 A;  2EZL A;  2EBI A;  2JA5 J;  3BTC A;  4JP0 A;  3IH4 A;  1MBE A;  2Y0S N;  1W0U A;  3JRD A;  2FX0 A;  1IV6 A;  5FKK A;  2ELK A;  2O7O A;  4QIW N;  1HDP A;  5F04 A;  2NVX J;  1RKT A;  4UUS B;  3JRB A;  1VI0 A;  3G1M A;  2LP0 A;  1IDY A;  2JN6 A;  3JRC A;  1XS9 A;  3RZO J;  1Y1W J;  3OOU A;  1VND A;  4NDL A;  4A3I J;  2R5Z B;  1TWG J;  2DMN A;  1QVT A;  1WI3 A;  2NVT J;  3OIO A;  3GTQ J;  1XC5 A;  4B1R A;  5IP6 A;  1GV5 A;  4V2F A;  3ZQC A;  1T56 A;  4XID A;  3I4N J;  1MSE C;  1U78 A;  1TWF J;  1MBF A;  1HF0 A;  1I6H J;  4A69 C;  1JGG A;  3SJM A;  2MG4 A;  5EDN A;  2R5Y A;  2E2I J;  4IHY A;  1UHS A;  5F08 A;  3A01 A;  3BR2 A;  2XB0 X;  3JRG A;  4A3B J;  1TWH J;  4DYR A;  3TW7 A;  1QVU A;  3TW6 A;  3GBG A;  1X2M A;  2ID6 A;  2QF7 A;  4UUS A;  2MW8 A;  4DYC A;  3I4M J;  2CUF A;  3S1R J;  5EF6 A;  1FTZ A;  1OCT C;  2TCT A;  1RKW A;  3HKZ N;  3S15 J;  2X9D A;  5EG0 B;  1Z77 A;  1Y1V J;  3S1M J;  3S1N J;  2K9Q A;  2DTZ A;  1JKP C;  2LTP A;  1OFC X;  3S14 J;  2XRL A;  2HYJ A;  2N8G A;  1OJL A;  1BJZ A;  3IV5 A;  3NAR A;  4CYC B;  2G0E A;  1CQT A;  3JR9 A;  2L0K A;  2CQQ A;  3LSR A;  5M3F J;  4D7M A;  2XGE A;  2COB A;  3HOV J;  1JUS A;  3VPR A;  5FJ8 J;  4QTR A;  5J1Y A;  2LVS A;  4BY7 J;  1MBH A;  1JT6 A;  2JA8 J;  4FCY A;  4AUX A;  2NS7 A;  1H89 C;  1IGN A;  3GTP J;  2XSD C;  4J19 A;  2QCO A;  3CDL A;  4I6Z A;  3BR6 A;  1K61 A;  2EQR A;  2JWT A;  4MFE A;  1MSF C;  3MN2 A;  3RKQ A;  1NK2 P;  3HDD A;  2K9N A;  2LK2 A;  3ZQI A;  2YU9 J;  2DA5 A;  1GV2 A;  5GPA A;  3JRI A;  1NK3 P;  4DZP A;  3FK7 A;  2DA6 A;  3LSG A;  3WHC A;  3FIW A;  3FKI J;  4Y52 J;  4I76 A;  2NVQ J;  3HM5 A;  1B72 A;  3BG3 A;  5FLV A;  4A3E J;  2EZK A;  4JX4 A;  2M34 A;  2XB5 A;  2KT0 A;  1S7E A; 
#chains in the Genus database with same CATH topology
 1RUO A;  4UV8 A;  4KIB A;  3L2V A;  5FRN A;  2IS6 A;  2ME6 A;  4BQA A;  2EFQ A;  3CZ6 A;  1ZQ3 P;  2RNJ A;  5GAH J;  1QA6 A;  2CQX A;  4BAY A;  3L2U A;  2QBY B;  5D5X B;  2WAE A;  1SD7 A;  2J5P A;  1J2X A;  2CUE A;  2HR3 A;  2FMY A;  3J81 Z;  1IXS B;  2NXN B;  3C7J A;  3GCM A;  2DTR A;  4L9T A;  4KA4 A;  4GYI A;  1IRF A;  4XLN F;  2LBF B;  2VE8 A;  4YII A;  3EQL F;  4XLF A;  1OKR A;  2OJE D;  1DP7 P;  5EZH A;  2RN7 A;  1WFX A;  3O8G A;  2EIK H;  3FM3 A;  2HFH A;  5HOD A;  1Z3X A;  2PMZ N;  1BL0 A;  1ZK8 A;  3M8J A;  2F5D A;  3ZQ7 A;  3TO7 A;  4WXC A;  1R58 A;  5F0F A;  4II3 A;  3FXU A;  3P5J A;  1KYZ A;  2QYO A;  2M7B A;  2WB1 N;  3Q0U A;  3ZQG A;  4UNO A;  3CCV I;  2DK8 A;  3ZQL A;  3ISP A;  4NQW B;  1R00 A;  3BG6 A;  5FGM A;  2IP2 A;  3ABU A;  3BR1 A;  4YG2 F;  3B02 A;  2EA4 A;  2P0W A;  1I5Z A;  1Y56 A;  2ADU A;  3TGN A;  3IAS 2;  2IRF G;  4XQF A;  3MKY B;  2DOD A;  2LF8 A;  5H20 A;  1BW6 A;  2K5C A;  1SFO J;  4A3J J;  3VYS B;  1W36 D;  1L3L A;  4HAM A;  3A01 B;  1FNN A;  1Z9C A;  2F5E A;  2Y69 H;  3E5X A;  3BQZ A;  3TL4 X;  2FE3 A;  1BR1 A;  4HV5 A;  4JX6 A;  4BGD A;  3J80 K;  2ISZ A;  3BJ6 A;  2HQ5 A;  4I7H A;  4KMF A;  1E3P A;  2DO7 A;  4IRG A;  3CLQ A;  3HOU J;  4ENM A;  1BN5 A;  1G8X A;  4I09 A;  2G7H A;  3AG4 H;  5FKL A;  3PIP F;  1E0E A;  1BM9 A;  2FUG 2;  1IW7 F;  1K83 J;  2KKO A;  3CJR B;  3LQR A;  3RPQ A;  2VKD A;  1QZE A;  3F21 A;  3SQN A;  1A31 A;  4LFU A;  2KRC A;  4BAC A;  4JYK A;  2NS8 A;  2WAQ A;  4U0Y A;  2L9S A;  4L9J A;  2DCE A;  2E7W A;  2M2E A;  1WZ2 A;  1TLH B;  1LQ1 A;  1YIO A;  2AQE A;  1P7I A;  3OS1 A;  1ZGJ A;  1B6A A;  2GZW A;  5GAG J;  2RRE A;  2ZJR F;  1IRG A;  4JK1 X;  1Z1D A;  3E7L A;  2A6E F;  4IXA A;  4IKF A;  1YJN I;  3RPU D;  2HS5 A;  1D8J A;  2MLK A;  2R7O A;  2W84 A;  4IVN A;  3CCL I;  1I50 J;  3A02 A;  1WJC A;  2BXY A;  3IRR A;  9ANT A;  1SAX A;  2FD5 A;  2W00 A;  4LIV A;  1KZH A;  4P9F A;  2EIL H;  1T0F A;  3QPS A;  2MD5 A;  4B8X A;  1X1C A;  4N0B A;  2B9S A;  2Z1D A;  2W82 A;  1WJF A;  4DIQ A;  1R22 A;  3LSK A;  4G9Y A;  5GP9 A;  2K7L A;  4G7Z F;  5J47 A;  1G3S A;  2DFE A;  3Q5F A;  3KP5 A;  5BMZ A;  4CZC A;  3H5R A;  4BHP A;  2DFH A;  4N9I A;  3CDI A;  3BT9 A;  3HRS A;  4XRF A;  1Z05 A;  2VKV A;  2CO5 A;  2MH2 A;  2PJR B;  2BZT A;  2CQN A;  2K4J A;  5EG0 A;  2CFO A;  2L9N A;  3WE2 A;  2JMW A;  4A0Z A;  1R36 A;  4MNU A;  3MZY A;  3K4C A;  1W7P D;  2DK5 A;  2R7R A;  1UZC A;  3OYA A;  5FFZ A;  2GM4 A;  4I98 B;  4NC8 A;  2GIV A;  1QBJ A;  2P5K A;  4GXO A;  5D5V B;  3DQV C;  4YFX F;  1CF7 B;  2JA7 J;  3KZY A;  2JUC A;  5K7F A;  1R1T A;  1SEU A;  1JTY A;  1HDD C;  2EFP A;  2NAZ A;  2KRF A;  3MAJ A;  3MCZ A;  4KIC A;  3RJP A;  1AKH B;  5BQT A;  1BA5 A;  3MD2 A;  3WHB A;  2L9R A;  4I99 C;  1H8A C;  4EGZ A;  1T95 A;  3OYB A;  3KP6 A;  2Z2S B;  2OCC H;  5IYC J;  1VZ0 A;  3I54 A;  1N25 A;  1EJ9 A;  3H3V K;  2AO9 A;  2KLO A;  3GFJ A;  2DAO A;  2DMP A;  4LB5 A;  1NG7 A;  2XF6 A;  1R5I D;  3FWE A;  3OYN A;  3PO2 J;  2BYV E;  1I6X A;  3HOT A;  1XSX A;  2PMZ A;  3MKZ A;  2F4I A;  2HYF A;  4ZZD A;  4FE4 A;  3NWS A;  4L0Z B;  4ABZ A;  2EV0 A;  3ZMV A;  4QSH A;  3P9C A;  4P5O A;  2QUF A;  4XLH A;  4EJV A;  5J3L A;  4QPO A;  4BJ6 C;  3IH2 A;  3E6D A;  4FE7 A;  1U8R A;  6PAX A;  1P6R A;  3G71 I;  3W6J B;  2LD5 A;  1FIA A;  2HDW A;  2IGO A;  4C9Y A;  1U9O A;  3GEZ A;  3EYI A;  2A6T A;  4PZJ A;  3RDI A;  3FXL A;  1U9N A;  4PSW A;  1T38 A;  2R7F A;  1HKQ A;  4LD5 A;  4IHT A;  4RB3 C;  2M8G X;  2LRE A;  4IQJ A;  2DN0 A;  2I10 A;  1OCP A;  4XLA A;  1ODD A;  3H5A A;  3M4O J;  4UVC A;  5FRO A;  5M5X J;  2MSY A;  2FJ1 A;  4B3X A;  3TO9 A;  4F91 B;  3T8R A;  2W48 A;  3C2G A;  1ZTR A;  5EJC A;  2ZKZ A;  5DDG A;  3LNQ A;  2KIQ A;  2JUG A;  3UNG C;  1QU3 A;  3I59 B;  1JKQ C;  2WY7 Q;  4HDV A;  5C3E J;  2EFW A;  3WU0 A;  3L2C A;  5E1X A;  1FLI A;  1OCZ H;  3L00 A;  4M3E A;  1FOY A;  2HQA A;  2L3D A;  3BC8 A;  5TRD A;  3PJR A;  4IHS A;  5H6R A;  3KYL A;  1ENH A;  1XX5 A;  2Y9Y A;  1D3Y A;  1VFC A;  4WF2 A;  4FX4 A;  3N05 A;  1G59 A;  1Z0X A;  2JRT A;  1KGS A;  1PVE A;  2BY2 A;  5FKM A;  3T5X A;  1O7F A;  4M9Z A;  1FP1 D;  3PIO F;  1LDD A;  3DLL F;  2ELJ A;  3KPH A;  1WJD A;  2VPR A;  4DZJ A;  1KON A;  2DA7 A;  1T0F C;  5LGU A;  2D5V A;  2WV1 A;  4YFK F;  3L9F A;  3WTX C;  1ZR2 A;  4XOT A;  1Q1H A;  4RS8 A;  5M5W J;  3ML6 A;  1Z21 A;  2WBM A;  5C4J J;  3R60 A;  4M3D A;  2DW4 A;  3M1E A;  5E17 F;  1LEB A;  2E7X A;  3G6E I;  3BLY A;  3KYC B;  4DYQ A;  2F48 A;  2DA3 A;  1GDT A;  1ETW A;  3BCA A;  4A3K J;  4MFD A;  3B73 A;  1T2K A;  4DBR A;  1IJW C;  2HEO A;  4CHU A;  2D2W A;  4HBL A;  5TJJ A;  3FIS A;  2JT1 A;  2A61 A;  4L5I A;  3GTG J;  1OYI A;  3D5S C;  4AVZ A;  2AQF A;  3N97 A;  4NC7 A;  1WH5 A;  2DT5 A;  5FFX A;  4RB1 A;  3K70 C;  3C2H A;  3WU2 C;  2AHQ A;  1YHQ I;  2VE9 A;  4PSX A;  5FKO A;  1ZLK A;  4EAT A;  1ETY A;  5H6Q A;  1PUF B;  1UAA A;  1OCO H;  1P92 A;  1V5F A;  4WWC A;  1PUF A;  3ABK H;  3AG1 H;  5F1J A;  1HW2 A;  1X4P A;  4MTE A;  5D8K B;  3H35 A;  4K2E A;  1JUP A;  2O3F A;  4C30 A;  1QRY A;  3SHF A;  4EJO A;  5LGN A;  5FLM J;  3K1N A;  3CP2 A;  3BTC A;  5AON A;  1QPM A;  3BDD A;  1W0U A;  3BWG A;  5LFA A;  2ZBK A;  4F93 B;  2FX0 A;  2HQR A;  1WHU A;  5E8G A;  3J7Y J;  2EIN H;  3VEP A;  4QIW N;  1HDP A;  4P1W A;  3SXY A;  2QSH X;  1TQI A;  4BS9 A;  5F04 A;  4Z2Y A;  2IGN A;  4UUS B;  4M9S A;  3G1M A;  3I59 A;  4XOR A;  4A0Y A;  2M5W A;  4JBA A;  4A3I J;  2Y48 A;  3TDU C;  2H94 A;  2DMN A;  2W24 A;  2WWY A;  1WI3 A;  1DUX C;  2STT A;  1HW5 A;  1D0Y A;  4FQG A;  5KNL A;  2OQR A;  3OIO A;  2COM A;  1XC5 A;  1X19 A;  5IP6 A;  2AXL A;  2Z33 A;  3ZQC A;  3U2R A;  3WG7 H;  2IGM A;  2BY0 A;  2L5Q A;  3I4N J;  1U78 A;  3QOE A;  2NRA C;  4A2U A;  1R4N B;  4A69 C;  2LNB A;  5KHD A;  2MG4 A;  5D4R A;  1ZAR A;  4XKB A;  2VON A;  1W5C C;  1R4M B;  2EA2 A;  2CGP A;  1X4O A;  3E6M A;  4DYR A;  1BR2 A;  1QVU A;  1W1W E;  3P7N A;  5JFR A;  4UHT A;  2IW5 A;  2MW8 A;  4DYC A;  1BI1 A;  2R7Q A;  1LVA A;  2BE5 F;  3MKW B;  2XHK A;  3DF8 A;  5EF6 A;  2TCT A;  3K2Z A;  4Y15 A;  2NS0 A;  3ASO H;  1FOW A;  3WTV C;  1WWX A;  2K9Q A;  3S1N J;  3D5R C;  1R23 A;  2DTZ A;  1F1Z A;  2ZXH A;  5HDG A;  2HYJ A;  2N8G A;  3CUQ C;  3WGG A;  1BJZ A;  4LIT A;  3S3N A;  2R7T A;  2G0E A;  4AID A;  1Y8Q B;  1HST A;  2L0K A;  1JI8 A;  3U21 A;  2COB A;  3HOV J;  2UXN A;  3H0D A;  5J1Y A;  1YS6 A;  3I56 I;  1JT6 A;  3W3C A;  4AUX A;  4XKV A;  1A04 A;  3WE3 A;  4EVI A;  2KFD A;  3G73 A;  2RQP A;  3GTP J;  2R7X A;  4LB6 B;  2QCO A;  1U3E M;  1F5T A;  3DKX A;  5L3G A;  1N75 A;  4EJW A;  4HDU A;  1K79 A;  1FSH A;  4MHG A;  3CUQ B;  3DBR B;  5D4S A;  4PUS A;  3KP3 A;  4Q48 A;  2BY1 A;  2K9N A;  3HSF A;  3K4J A;  5HDK A;  1WKM A;  1ACI A;  1NK3 P;  1IXR C;  2FEZ A;  1MMD A;  4DJA A;  3F22 A;  2X4H A;  1Y0N A;  2WTE A;  3CF5 F;  4NHJ A;  2B7E A;  3H1C A;  1QZZ A;  1TQP A;  4LMY A;  1ZYR F;  1N78 A;  3HM5 A;  1XN7 A;  3CF2 A;  3TQN A;  3TMO A;  2K9S A;  2JRM A;  1YRN A;  4IPA A;  2QWW A;  2VXZ A;  4HA8 A;  4XBF A;  2R7S A;  2Y0S A;  3P9I A;  2DMT A;  4C2U A;  3CTA A;  2MGQ A;  3SZT A;  4ZH4 F;  2E34 A;  4BU2 A;  2WAQ N;  4G6D A;  3QAH A;  3G1L A;  1W7P A;  3JTG A;  2V9V A;  3CCQ I;  1Y0U A;  4QLC U;  2P81 A;  3JRH A;  4CA0 A;  1ZGA A;  4LLL A;  2IPQ X;  2DLL A;  3EET A;  1LDJ A;  5LD2 C;  3QYB A;  2GOM A;  1G4D A;  2W4S A;  4WXH A;  2BVM A;  2V7F A;  1RIO H;  2XPW A;  3HOZ J;  4HNV A;  4C3J J;  3DKW A;  5ERI A;  5J1U A;  3FXK A;  4L9V A;  2KP6 A;  4NUB A;  3M8F A;  1O7L A;  2PMU A;  2KIU A;  1DPU A;  5M3M J;  3B6C A;  3K4K A;  4EM0 B;  1HBX G;  1TWC J;  2IS2 A;  2OV7 A;  2LH9 A;  3FXJ A;  4UV9 A;  4CXF A;  3FMS A;  1U5T C;  1V5G A;  1XSV A;  5CVI A;  4FX0 A;  5DS9 A;  1JKO C;  3QPL A;  3V7C A;  4OMY A;  3DU6 A;  1AOY A;  2TDX A;  1J5Y A;  3BY6 A;  1TC3 C;  3KCC A;  1FMV A;  1NH3 A;  2VBY A;  3PSI A;  3M07 A;  1QNT A;  3Q9V A;  4XRS A;  1Y6I A;  3HXL A;  3HPG A;  3PM1 A;  2QQ9 A;  4EV0 A;  4DNC A;  3OSF A;  3SDG A;  3GTM J;  1R1V A;  1NHA A;  1LE8 B;  3DBH B;  3JW4 A;  3K4B A;  1FC3 A;  1ZKG A;  2L7M P;  3DLA A;  2E1N A;  4N9H A;  1KQ9 A;  5JVG F;  3PO3 J;  2B0L A;  3FKJ A;  2BVL A;  2EB7 A;  3V7S A;  1BBY A;  3BCB A;  2ZME A;  4CIC A;  5KAF C;  2IA2 A;  3JAM K;  3BG9 A;  3FK6 A;  2W85 A;  2FF4 A;  3KZI C;  4HX4 A;  3DCF A;  3O3K A;  1SAN A;  1BC8 C;  3F8C A;  1TP4 A;  5E1Z B;  3ZQH A;  1D5V A;  1XDS A;  3OR2 C;  5JHF A;  2EFN A;  3PUB A;  1XMA A;  1KQ8 A;  3RCO A;  2EH3 A;  1RRJ A;  1Z67 A;  5ILU A;  4LLG F;  1TBX A;  4M3B A;  3PFI A;  1SFU A;  1K78 B;  2CW8 A;  4IRI A;  1X1B A;  5IOZ A;  1C0W A;  3SEQ A;  4B09 A;  4L9N A;  5FKN A;  3RKY A;  5D8L B;  4KYW A;  2OQG A;  2XPU A;  3HL2 A;  4S0H B;  2DBB A;  5CPR B;  1B9N A;  5E3M A;  2VOO A;  1I27 A;  2QZ8 A;  2V4J C;  2PN6 A;  5K5Q A;  3MZ8 A;  3F0C A;  2KIM A;  2KDO A;  1WCM J;  1KYW A;  1KU9 A;  5GAD J;  2Y30 A;  2UZK A;  3GLL A;  1XCB A;  2GA2 A;  3O2P E;  4M6V A;  3M8E A;  4C3I J;  3G3Z A;  2X51 A;  5E3N A;  1BI3 A;  2E2H J;  4BE0 A;  1IN6 A;  1S3J A;  1D5Y A;  2PEX A;  4OIR F;  4IX7 A;  2HDC A;  1YO5 C;  4LJZ F;  4RGR A;  2FOW A;  3W2V A;  3ONQ A;  2IAI A;  2LY2 A;  3TBI A;  4RAF A;  1GXP A;  3V8J A;  3WTW C;  4PDK A;  2PBI A;  3U1K A;  1K4S A;  3OYF A;  1VQL I;  4PJL A;  5IP9 J;  3IUO A;  5E8I A;  3KEQ A;  2DJN A;  3DBL B;  5DCF A;  3RQI A;  4DGW B;  3C3W A;  2PJR A;  1NTC A;  2O8X A;  2ESN A;  3L2W A;  2LKX A;  2XAJ A;  1YX5 A;  4G7O F;  2VBW A;  4AYB A;  1WJE A;  2Y2Z A;  1L0O C;  3GWZ A;  3WTU C;  2CJJ A;  3H92 A;  4KT5 C;  3QP5 A;  2DXI A;  2XUB A;  3A4C A;  2E60 A;  2IBD A;  1FTT A;  5LLQ A;  1BJA A;  2DOA A;  2IJL A;  4IHX A;  1FYK A;  2GIZ A;  2ZXW H;  1ETO A;  3JRF A;  3Q0V A;  5ICG A;  5GTH C;  4KIT B;  4MIM A;  4NC6 A;  1YW7 A;  3W6K B;  1F9N A;  1SVO A;  2K85 A;  4MLO A;  4AWX B;  2M0C A;  5F0C A;  4BE1 A;  3GTL J;  1G3Y A;  2XRN A;  1FIP A;  4CO8 A;  4ESF A;  2GXB A;  1Z3Y A;  3LMM A;  1IC8 A;  5IP7 J;  1Y39 A;  3SDB A;  2XGD A;  3DPU A;  1RR8 C;  4D0P A;  1T6S A;  2HKX A;  2M8E A;  2XAG A;  3ERM A;  2F4M B;  2EK5 A;  2CQK A;  3ZR8 X;  1R6R A;  2R93 J;  3IH3 A;  3CUO A;  1FBS A;  5J8C A;  1P7J A;  3G4S I;  4BQO A;  4M71 A;  2R7Z J;  3NRV A;  2VJ5 A;  4OAY A;  3VWB A;  1HOM A;  1U8B A;  2F5F A;  4ZC3 A;  2E2J J;  1U2W A;  1W7P B;  2KZG A;  4B4C A;  4MEX F;  4LLN A;  3MKL A;  5EZG A;  4RAY A;  4JOM A;  4JX5 A;  4OOI A;  1H88 C;  4BXF A;  4BXX J;  5LHH A;  2Y75 A;  4BBR J;  2X48 A;  1IAW A;  3N4M A;  2IVM A;  3LWF A;  5HLI A;  2D1V A;  4E7K A;  3S2W A;  2DA1 A;  2ZJQ F;  2BW3 A;  2H1K A;  3M9A A;  5HLT A;  1VQO I;  1FPQ A;  2L02 A;  2LFB A;  4GFB A;  2ZSH B;  2XAF A;  2DDA A;  3QP6 A;  4AU7 A;  2P5V A;  3HEF A;  3HB9 A;  3K10 A;  1HC8 A;  2FQ3 A;  2DPD A;  4C2T A;  4O3M A;  2R92 J;  2XRO A;  2KRH A;  5D6F A;  3DKY A;  4Q4Z F;  1V54 H;  1X2N A;  2LRD A;  1XTA A;  2M3A A;  2XAQ A;  3AKZ A;  5C4X J;  5E1W A;  4FTH A;  1HW1 A;  1WQ2 A;  1BI2 A;  2BV6 A;  2CQ7 A;  1G2H A;  4OAZ A;  4Y7N J;  3E6B A;  1MNM C;  1MH3 A;  1KU3 A;  4YEL A;  2Q2E A;  4ZYD A;  1X1P A;  4HLX A;  2HTS A;  5B1B H;  2W7N A;  1VQ6 I;  4XLC A;  1G6N A;  4ESB A;  5LRS A;  5KVR A;  3I5U A;  1IG7 A;  1IF1 A;  4MO7 A;  5CVV A;  1XSD A;  3QU3 A;  3S17 J;  4EQQ A;  4W1U A;  1D0X A;  2BY3 A;  3OL4 A;  3OYE A;  2CV2 A;  2Z99 A;  3HG9 A;  2HPM A;  1I3Q J;  4AD9 A;  3JCU C;  4E4H A;  1SD5 A;  4DQ2 A;  5CVR A;  3W2A A;  1RZ4 A;  2IA1 A;  4BUP A;  4XK4 A;  1BW5 A;  3ASN H;  1IUY A;  4LK1 F;  3CQZ J;  2NOJ B;  1QGP A;  4NB5 A;  1HLV A;  1B72 B;  1S6L A;  2DYS H;  2MBF A;  3HOY J;  4GDF A;  3GF2 A;  4BHC A;  1HXD A;  1TW2 A;  4XRM A;  4A3L J;  2M7A A;  4FIS A;  5LEK A;  4ESJ A;  2ZB9 A;  1OCR H;  1V3F A;  2V9K A;  2X6X A;  2QBY A;  3B6A A;  2R7D A;  1AU7 A;  4UXN A;  1REP C;  1IDZ A;  1MBK A;  2NVY J;  1T98 A;  4AM3 A;  2ZJP F;  4OIQ F;  2OD5 A;  1MBE A;  1IRX A;  5AIP A;  2H8W A;  2VQG A;  2MLG A;  2YPR A;  1FY7 A;  3FBN B;  2M4K A;  4BEH A;  5FLX Z;  2YSR A;  1D8K A;  4F92 B;  2VJ4 A;  2AXT C;  2QSF X;  1RKT A;  3JTH A;  1ZRE A;  2V1D A;  1XS9 A;  3JRC A;  2H09 A;  2HYG D;  3H9G A;  4XL9 A;  4HEA 2;  3J81 K;  4RA2 A;  3JAM Z;  2KJB A;  3FXM A;  1VND A;  3OOU A;  4ITV A;  5DD4 A;  2BXZ A;  2VB6 A;  4HZF A;  1BIA A;  4ASN A;  3K69 A;  1FBQ A;  3EDP A;  4EM2 A;  1GV5 A;  2LSO A;  4V2F A;  2PLY A;  1R71 A;  4E7H A;  3RSN A;  1Z7U A;  2K02 A;  2LKP A;  3IL2 A;  1TWF J;  3K6G A;  1HF0 A;  3HUG B;  4AIH A;  3J7Z I;  1I6H J;  3PQJ A;  3ZQQ A;  3RIR A;  3SJM A;  2EWN A;  3M7G A;  2R5Y A;  3CJT B;  4HF1 A;  1MW7 A;  3ZP5 A;  5F08 A;  3SYT A;  4PFO A;  2ZXJ A;  4RM2 A;  2XB0 X;  5HLH A;  4A3B J;  3V42 A;  2K3F A;  2QEN A;  1TWH J;  3R4K A;  1DDN A;  2X85 A;  4BQQ A;  1SMY F;  1G3T A;  1X2M A;  1UG0 A;  2L4A A;  3I4M J;  5L3E A;  2PMH A;  1RKW A;  2KIF A;  3IHU A;  2QM3 A;  2X9D A;  5J8F A;  1YW9 A;  2ZNZ A;  3I64 A;  1P4A A;  3DWL E;  3L2Q A;  3T0Y A;  3S14 J;  2K9M A;  3HYI A;  1VQN I;  3IV5 A;  3FF5 A;  1HA8 A;  1AWC A;  1ZG5 A;  2CQQ A;  2F5C A;  5M3F J;  2XGE A;  2MC4 A;  4IF4 A;  4B44 A;  1BI0 A;  3VPR A;  4A5M A;  5L3C A;  2K4B A;  2XAU A;  3FHZ A;  3OYK A;  3E97 A;  4PJJ A;  3RYR A;  3KET A;  3H36 A;  2NS7 A;  1MJA A;  4KN4 X;  4ZDO A;  4L0Y B;  1OIS A;  2VIX A;  2IA0 A;  1WJA A;  2VXD A;  2CV0 A;  2HOE A;  3RQ4 A;  4J19 A;  2XSJ C;  3ZN0 A;  3OMY A;  4I6Z A;  4N4N B;  3F8F A;  1FZP B;  4HF2 A;  2C6Y A;  4Q5S F;  1Z91 A;  2ZFW A;  3ABL H;  2KMU A;  2LC2 A;  4LIU A;  1UB9 A;  1I39 A;  5DYM A;  3KIO A;  2ZO4 A;  2CMP A;  4R8H A;  1TT0 A;  2LK2 A;  1W5T A;  3VSL A;  2VJI A;  3ZQI A;  1O3T A;  4GO1 A;  1USS A;  1GVJ A;  5LRR A;  2QQB A;  1XMX A;  1KU7 A;  3LA7 A;  1FWZ A;  3LSG A;  4AIJ A;  1MNE A;  3KLO A;  4I76 A;  1B72 A;  3F9K A;  2EZK A;  3LFK A;  4JX4 A;  3CMY A;  4MQV A;  4XIC A;  4KNY A;  2O8K A;  1WVR A;  2O61 A;  1G3W A;  1VQ4 I;  1IXC A;  4XMY A;  2IGK A;  2JPC A;  1B1B A;  5IYB J;  3GZ5 A;  1K6O A;  2VJJ A;  3LSP A;  1I1S A;  2FOK A;  3SFI A;  3G1O A;  3SZG A;  1KQ0 A;  4X0G A;  5LHG A;  1PUE E;  3H0G J;  1S9H A;  4HF0 A;  4E7S A;  3S32 A;  2E36 A;  4A3C J;  3PQK A;  2MYS A;  4ZYA A;  3ZRG A;  2HZT A;  1HSJ A;  4M3F A;  3ZCO A;  4ZYE A;  1PDN C;  5IPA A;  1ZH5 A;  1IV8 A;  1FJL A;  2L01 A;  2Y0M A;  1IO2 A;  1ZRC A;  2LY9 A;  2V1X A;  3HSR A;  5GAE J;  2EFO A;  5FD5 A;  1BR4 A;  3E5U A;  1F36 A;  2WY8 Q;  2OF7 A;  3CP8 A;  1JJ8 C;  3MEX A;  2LY1 A;  5ILV A;  2CWE A;  3RKX A;  1B8I B;  1W5S A;  5FRM A;  1GUU A;  2WC2 A;  2VOD A;  4UY8 I;  2OPT A;  1OLT A;  5B3S H;  4XR6 A;  1UMQ A;  1QPI A;  1ZRD A;  2VQC A;  2FRH A;  1MJ9 A;  2L9V A;  4XM3 A;  1ETQ A;  1VQ9 I;  2VKE A;  3R61 A;  3JRE A;  3ZMZ A;  1PP8 F;  1S8N A;  4B48 A;  2V26 A;  3S93 A;  1TQM A;  2LOO A;  2XDV A;  3PFY A;  5HS9 A;  5JLX A;  3ZOB A;  5IT9 Z;  4G94 A;  3JRA A;  3O8H A;  2LLK A;  4E7L A;  2Y31 A;  5J4V A;  2DMU A;  2ZC2 A;  3U1D A;  1CGP A;  2RAE A;  2JQ7 A;  4U87 A;  1LJ9 A;  1TNS A;  1SVM A;  4BKX A;  1ZR4 A;  2ID3 A;  2FQ4 A;  2X1D A;  1FX7 A;  1MMS A;  2PQ8 A;  3MQ0 A;  2ZNY A;  4LGW A;  4YIF A;  2OTL I;  2M0M A;  2XV4 S;  3BP8 A;  3DEW A;  4D9J A;  5K5O A;  1E2X A;  3AFH A;  3CD6 I;  2DT7 B;  3WTY C;  1Y8R B;  5EEH A;  2ACJ A;  4BL0 B;  2UWM A;  2H27 A;  4HW0 A;  3ULQ B;  3PUF A;  1FYL A;  1O57 A;  1ETV A;  3GXO A;  1X58 A;  3CCY A;  5ILS A;  2BOL A;  1VQP I;  5DM7 F;  1R9T J;  1WGX A;  5DUK A;  4IHW A;  2X6O A;  3EUH C;  2IXS A;  4RBO A;  3GFI A;  2OCE A;  1A6I A;  2JSC A;  3H9Q A;  3OV8 A;  4RGS A;  5EEA A;  2YX7 A;  1T39 A;  1R5G A;  1BC7 C;  3QOD A;  4HPQ A;  3NQO A;  3LA2 A;  3TDZ C;  3K4L A;  1LDK B;  3K7A J;  3ZGK A;  4EM1 A;  4ZYG A;  4ON0 A;  5HOO A;  1MND A;  2VC0 A;  3QQA A;  5JR3 A;  1XDU A;  2HNH A;  3HGY A;  4RLF A;  3JSO A;  2DFI A;  2EZI A;  4I2O A;  5D6E A;  4WCG A;  1HQC A;  2HXO A;  5TIS C;  2XIG A;  3TP0 A;  4CZZ A;  3M3Y J;  1VQM I;  3ECH A;  4L5J A;  3V4G A;  4FAS D;  5FD6 A;  4MGR A;  5E3L A;  4IO9 F;  1FEX A;  5J6X A;  5EYR A;  2WAD A;  4RAG A;  2VC1 A;  1EV7 A;  2HDD A;  1APL C;  2E71 A;  5HDN A;  2H8R A;  5FB2 A;  3AAF A;  3Q9S A;  2LMD A;  3BZK A;  3H3U A;  3PNT A;  1LFU P;  1B4A A;  2UXX A;  4F3Q A;  1H0M A;  1WJB A;  4BNC A;  2HOA A;  3V7R A;  2JSP A;  3BPX A;  2X1E A;  3COA C;  1MD0 A;  4D1Q A;  2CSO A;  2EIM H;  3TO6 A;  4ZYH A;  1W0T A;  3VDX A;  2ESH A;  2JTV A;  3CCU I;  1K7A A;  1MBJ A;  4R79 A;  4IL6 C;  5J4Y A;  2R7U A;  1SD4 A;  2DOE A;  3GTO J;  3FXR A;  1U5T A;  1X1D A;  3OYM A;  2A05 A;  2M9H A;  4U0V A;  4ZDP A;  3BJO A;  5K7Z A;  4YRV A;  4PCQ A;  4GCV A;  2VN2 A;  4XKC A;  3BG5 A;  1O3Q A;  1M1E B;  1ZHF A;  2OZ6 A;  4H4K C;  2PX9 A;  4L18 B;  4Q47 A;  1A35 A;  2ICW G;  3LAP A;  3L2R A;  1XCV A;  4ANJ A;  1R5H A;  2HXI A;  2ZSI B;  4F7Z A;  1HCR A;  3DV8 A;  5DEQ A;  1JGS A;  1J9I A;  1D1C A;  4AC0 A;  2CV1 A;  2NOG A;  2E1M C;  2Q8K A;  1RUN A;  4A3F J;  4XSX F;  3I71 A;  5GTI C;  1EH8 A;  4BXU A;  2IEK A;  1BIB A;  5B66 C;  1S72 I;  2FML A;  2F2E A;  3ZMT A;  3BTJ A;  1FBU A;  3A1Y A;  2UUZ A;  3D0S A;  4AVP A;  4QWQ A;  3BJA A;  4X6A J;  2CUJ A;  1ZAO A;  2XVC A;  4IEJ A;  2FNP A;  1UJ8 A;  4I02 A;  3H5N A;  1S7A A;  1HKS A;  3EUK L;  1BOB A;  4A3D J;  3HSE A;  5C44 J;  2BBY A;  4LOC A;  2W25 A;  1LFB A;  1STZ A;  3F6O A;  4F55 A;  1RI7 A;  1AHD P;  1V4R A;  2LG4 A;  4OU0 A;  2F6C A;  4W97 A;  4WXD A;  3DFG A;  2LYC A;  4GGG A;  3VOD A;  1A36 A;  4HSR A;  3R6S A;  2ECB A;  2QA4 I;  3S8P A;  3DP7 A;  2G9W A;  1LB2 A;  5GPC A;  1VTN C;  2CG4 A;  1IN5 A;  2A68 F;  2JA2 A;  2RKH A;  3LOC A;  4RAZ A;  2R3S A;  3CLO A;  2HI3 A;  4UUT A;  3ZXS A;  1J59 A;  1DU0 A;  1A6Q A;  3OWT A;  5B5E C;  3DPT A;  3FMR A;  2BHZ A;  4IQ4 A;  4HOB A;  2E5N A;  5A2Q K;  5IOY A;  4A93 J;  4I0B A;  5EGO A;  4PK4 A;  4CUG A;  3OYL A;  4ENK A;  5F6F A;  5LHI A;  2ZME C;  4KDP A;  1PJR A;  3DXJ F;  2V6E A;  3HTS B;  3L09 A;  2CW7 A;  2YR2 A;  4XKW A;  5ICF A;  5CQG A;  1B9M A;  5M5Y J;  2O9L A;  1ETX A;  4BJT A;  4XOP A;  3ERE D;  4U0W A;  2O0Y A;  4WX9 A;  1S7O A;  2XAH A;  3GZN B;  2W1O A;  1ZGW A;  2GLO A;  4X1E A;  2HVQ A;  5JHU A;  5IT3 A;  3S3M A;  1DP3 A;  2WV0 A;  3Q3S A;  5EEG A;  3GFL A;  3RTR A;  3CCM I;  2QEX I;  2YUS A;  2FBK A;  1ZG1 A;  2DDB A;  2DT6 A;  1YJ9 I;  2FNA A;  2A6H F;  3FM5 A;  4EEF G;  1VF9 A;  3ZMU A;  3OYD A;  1JTX A;  3TOB A;  2GQQ A;  2R7W A;  5E3O A;  3EUH A;  3PSF A;  3MVP A;  2Z5U A;  4G12 A;  1LFP A;  3PNY A;  3UKG A;  3TOA A;  5K7H A;  1T08 B;  1A5J A;  2Q1Z B;  4JQF A;  1Q1V A;  1WH7 A;  1JHF A;  2FBI A;  4ZZL A;  4HRI A;  4P55 A;  2KPM A;  4E7J A;  5LEJ A;  1MH4 A;  2G7U A;  1RNL A;  2L7Z A;  1P4X A;  3QYE A;  2GBY A;  2FSW A;  1XMK A;  1IN7 A;  3KP7 A;  3GYH X;  3WGH A;  5BS6 A;  1LE8 A;  5J1R A;  3MFK A;  3F72 A;  1ON2 A;  4AYB N;  4B3A A;  3GTJ J;  1MMA A;  1YX3 A;  3I55 I;  3HRT A;  2IS1 A;  2EZL A;  2DA2 A;  3HRM A;  2EBI A;  4U7D A;  2DOF A;  2KHM A;  4JP0 A;  3IH4 A;  2Y0S N;  3A0B C;  3HKZ A;  1YQA A;  4PFP A;  4ZJZ A;  1FMW A;  2Z9O A;  4OIP F;  2ELK A;  5FKK A;  2O7O A;  4HQE A;  1F4K A;  5ICE A;  3QPT A;  4HX8 A;  3U9G A;  1V55 H;  4G6Q A;  2NVX J;  3HJE A;  4OIO F;  3ZMD A;  3AL0 B;  1VI0 A;  2HWV A;  1IDY A;  3V8K A;  4G7H F;  1S5L C;  4HG2 A;  5ICC A;  1YIJ I;  1SD6 A;  1TWG J;  2M1B A;  3REO A;  2P7V B;  2OBP A;  3SFZ A;  3VYU B;  1FOX A;  5HNF A;  3DU5 A;  3FBI B;  2HPI A;  2X1C A;  3VYT B;  1MDM A;  2VPL A;  4KMU X;  3CME I;  3GTQ J;  4B1R A;  4ETS A;  2ZME B;  2V1N A;  1T56 A;  2JVG A;  1Z6T A;  3NEU A;  4XLE A;  1N77 A;  2L4M A;  4N4O B;  2GXA A;  2XKO A;  2RVC A;  1DGW Y;  4XID A;  3S3O A;  1MBF A;  2CFX A;  2J5O A;  1B59 A;  1D1A A;  5EDN A;  3OYI A;  1SFK A;  3LA3 A;  4OWR B;  1LUJ B;  3IC7 A;  2A07 F;  3BG7 A;  3J7A O;  2HZD A;  4BHB A;  3TW7 A;  5DUI A;  5H2F C;  3GBG A;  4UB6 C;  2ZFU A;  2ID6 A;  3GUD A;  4S04 A;  4UUS A;  3HPH A;  1IN8 A;  4OIN F;  3OOP A;  2CUF A;  1QO0 D;  3S1R J;  1OYY A;  1VQ5 I;  1FTZ A;  2MH9 A;  3HKZ N;  5EG0 B;  3FXQ A;  1Z77 A;  3R0A A;  1Y1V J;  3GX4 X;  1UHM A;  1X3W B;  2KIS A;  1ZN2 A;  1JKP C;  3VSK A;  2KJC A;  2LF7 A;  1XGO A;  2X0L A;  3A2K A;  1OJL A;  2A3S A;  1XGM A;  3NAR A;  2H6C A;  1D0Z A;  1RC9 A;  4BH9 A;  4CYC B;  1H9G A;  2V9P A;  2RQQ A;  3IP4 B;  4A6D A;  2XKP A;  1ZG3 A;  4BDY A;  3VFZ A;  4LG3 A;  5FO5 A;  1JUS A;  4QTR A;  3HTU A;  2LVS A;  4KN7 X;  4M74 A;  4FCY A;  4ZTF A;  2D1H A;  3EUA A;  4KUM A;  3CC2 I;  1TTY A;  1I1G A;  1XB4 A;  2OU2 A;  1MZB A;  3BZ6 A;  5J40 A;  3BPV A;  1QQI A;  3BR6 A;  2NVU B;  2EQR A;  5CVU A;  3FMQ A;  4HYE A;  2PFB A;  2JWT A;  1MDM B;  2VOP A;  1MKM A;  2HTJ A;  4BDZ A;  1X3Z B;  4MFE A;  5CYV A;  2V6C A;  1MSF C;  1OQY A;  2WA0 A;  3MN2 A;  3RKQ A;  2K86 A;  3EPZ A;  4WK8 F;  1NK2 P;  3HDD A;  2YU9 J;  2FBH A;  4HNT A;  3IAM 2;  3I9V 2;  3CMA I;  1GV2 A;  5GPA A;  3JRI A;  3FK7 A;  2P7C B;  4DOZ A;  3PL8 A;  2LKS A;  1JE8 A;  3KEO A;  3WHC A;  3FIW A;  3QRF F;  3FKI J;  4Y52 J;  4RLQ A;  4PGG A;  1XPX A;  2NVQ J;  4UVA A;  3BG3 A;  1QZY A;  2M34 A;  2XB5 A;  3FDY A;  5BPI A;  4IOA F;  1VQ7 I;  1W4M A;  2D45 A;  1K78 A;  2O6G E;  2CU7 A;  1RET A;  4U88 A;  2R7V A;  5IYD J;  4FHT A;  5HLG A;  1W36 C;  2L54 A;  2A5W A;  3C2B A;  1J75 A;  3K1M A;  4ENN A;  1WPK A;  1WSU A;  4TV7 A;  3HOW J;  1Z6R A;  3DTI A;  4XSZ F;  4KIG A;  4GYG A;  1DQU A;  2VQL A;  2YS9 A;  1R7J A;  3HC7 A;  4RM3 A;  4MTD A;  3OYC A;  2LBF A;  4CGZ A;  2NNY A;  3OS2 A;  2RNG A;  1YLF A;  5B1A H;  3DEU A;  1OPC A;  4BY1 J;  4EGY A;  5CJ9 A;  2P8T A;  1TWA J;  1P2F A;  5BPD A;  2JA6 J;  3MMY B;  2XC7 A;  3WOD F;  3QWL A;  2IS4 A;  4A3M J;  4CH7 A;  2A69 F;  2I5U A;  3WG9 A;  3OYG A;  2X6W A;  3L7W A;  2VUM J;  2QVO A;  1Z7L A;  1DGR M;  4E7I A;  1F43 A;  2DA4 A;  2P5L C;  3DTE A;  2KL4 A;  3RKW A;  4A6E A;  4RGX A;  5EGO B;  4BBS J;  4PJM A;  1J09 A;  3LSH A;  4RB0 A;  4PJN A;  2KDZ A;  1P9Q C;  3ZN1 A;  2L2O A;  3TP3 A;  3W2W A;  4MQ9 F;  2QQ8 A;  2Y9Z A;  4IRH A;  3HZJ A;  1ULY A;  3UR3 C;  4A3G J;  3ZMS A;  4Y3O A;  2VL8 A;  3IKV A;  3RYP A;  4D5F A;  1I3A A;  5A2Q Z;  3EYY A;  1BOA A;  4RDU A;  3TED A;  1R49 A;  1ZEL A;  2GWR A;  1OR7 C;  3BTI A;  2ECC A;  1WI9 A;  5JI6 A;  4EJU A;  2QKM B;  4A12 A;  1SFE A;  2ME0 A;  5ED4 A;  5F27 A;  4XNF A;  1O3S A;  1U6G A;  2CS3 A;  1EKE A;  2KZV A;  1ZRF A;  3LSI A;  2EZH A;  2ZCW A;  1RES A;  4XRS G;  2XPV A;  3F8B A;  3QOP A;  4L5E A;  2JPB A;  1X3U A;  1O4X A;  2LR8 A;  1YS7 A;  3K9T A;  3C18 A;  4XN3 A;  2M87 A;  1FYM A;  3T8T A;  5BNG A;  1RPW A;  4O6J A;  5L3B A;  3E5Q A;  5D5W B;  3W6V A;  3J7A Y;  1IRZ A;  3I0T A;  2R0Q C;  4B47 A;  1EF4 A;  3KP4 A;  3F6V A;  3OR1 C;  2V79 A;  1YW8 A;  2H6B A;  2FA5 A;  2V1U A;  3ABT A;  2VT2 A;  3K70 D;  1GHC A;  3GZ6 A;  4CYD A;  3HOX J;  4G8X A;  3G2B A;  1FSE A;  2BGC A;  4KJZ A;  1JT0 A;  1D1B A;  1YRN B;  4UUV A;  1YOV B;  2HGC A;  1IUF A;  2TRT A;  3WTZ A;  1S7E A;  5L3D A;  1QHG A;  3I53 A;  1PYV A;  4M73 A;  4YEJ A;  1B8I A;  3KYD B;  5CLS A;  2P6T A;  3NAU A;  4B43 A;  2OC6 A;  1OCC H;  1SC7 A;  1FOK A;  5IT9 K;  2HVS A;  2CRG A;  2OUM A;  1ORK A;  3IRQ A;  1POG A;  4HNU A;  4KIF A;  4ZTJ A;  4XON A;  1YJW I;  4CCL A;  2HOS A;  2MFZ A;  5JLW A;  4CCM A;  5DM6 F;  3X2Q H;  3ABM H;  4XLP F;  2VLA A;  5HS7 A;  1UST A;  2JK3 A;  5F1R A;  3E0J B;  3I3L A;  2OTJ I;  2QGU A;  2RDP A;  1OR7 A;  3KX2 A;  5KAI C;  2K40 A;  2QLZ A;  2RV8 A;  1LNW A;  1TZL A;  3OS0 A;  1SMT A;  1UG2 A;  4Y4R A;  1XD7 A;  1T8I A;  3FXO A;  1OMI A;  2HVR A;  4HX7 A;  3RZD J;  1S29 A;  3OY9 A;  2IT0 A;  4CYC A;  2JZY A;  2P6S A;  2XGC A;  5L3F A;  2EV6 A;  3S2H J;  1YTY A;  3CC7 I;  2E5Z A;  2VBZ A;  1HKT A;  1FP2 A;  1DU6 A;  3K0L A;  1YI2 I;  2VAS A;  3DEE A;  1YG2 A;  1YFH A;  4M6X A;  3WGI A;  2DU9 A;  3BR3 A;  1YIT I;  2M4G A;  2M30 A;  3C1D A;  4RGU A;  3A0H C;  4S05 A;  4PJ0 C;  4C2M J;  1WJ5 A;  1FT9 A;  2W57 A;  3F8N A;  3OYJ A;  4D7N A;  3WTS C;  2EPF A;  3DPL C;  3GLX A;  3GO5 A;  2VKH A;  2EJR A;  3L1P A;  5DD8 A;  4IOC F;  2CUZ A;  3HGG A;  2F4O B;  1O3R A;  2E1O A;  2QQA A;  3OIQ A;  3KP2 A;  2GA1 A;  2ETH A;  3S2D J;  3SZP A;  4I01 A;  2PI0 A;  4CDG A;  3LL7 A;  4LG0 A;  3BR5 A;  1JKR C;  1AA7 A;  3CO6 C;  3K4N A;  1ITY A;  2XF5 A;  3ZQF A;  3CCS I;  1MBG A;  1GLN A;  1GT0 C;  3GVA A;  3IWZ A;  3KLN A;  2PG4 A;  3KE2 A;  4HLY A;  5CQE A;  4BJ5 C;  2OAZ A;  1JJ6 C;  1RR7 A;  3MWM A;  1GVD A;  4J01 A;  3K1P A;  1H9T A;  5FLX K;  4A0X A;  5K1Y A;  1KA8 A;  1SFX A;  5LGT A;  5E18 F;  2QSG X;  3BTL A;  4AIK A;  4MEY F;  4D5C A;  2A5Y B;  2HKO A;  5F64 A;  3HUG A;  1JUM A;  3CJQ B;  3F8M A;  3KEY A;  1IZ1 A;  4U7B A;  5KCM A;  4CCO A;  3CCE I;  4XN0 A;  3WU1 B;  2JJ7 A;  3D1N I;  3H9J A;  3LSM A;  3GME A;  1CF7 A;  1ON1 A;  1TL8 A;  4Z6Y A;  2YU3 A;  3CO7 C;  3AL0 C;  2UV1 A;  3LAJ A;  4NNJ A;  3I4P A;  2VBX A;  3AG2 H;  1XG1 A;  4M72 A;  4FT8 A;  2RC4 A;  4ZDL A;  3CCR I;  2P4W A;  1MIJ A;  3WTT C;  4CSW A;  1XGN A;  1VQ8 I;  1ETK A;  2XAS A;  4P96 A;  4F52 A;  3IKT A;  2GOX B;  2ISY A;  2K27 A;  4Y17 A;  3CMM A;  4IHV A;  1MMG A;  3LSJ A;  3E6C C;  3FX3 A;  1JXS A;  2DMQ A;  4EMS A;  3S1Q J;  2HOT A;  5AIQ A;  1SAU A;  2DFF A;  3LFU A;  3Q0W A;  3VB2 A;  3F3X A;  1LKX A;  3J80 Z;  1JHH A;  2K3P A;  2L7F P;  3KZZ A;  2MC3 A;  4E7Z A;  2MD0 A;  5F0H A;  2Z16 A;  3HOS A;  4O5V A;  4M3G A;  1AKH A;  2DPU A;  4NBQ A;  3HRU A;  3TKY A;  2FXA A;  3OSG A;  4HST A;  3OL3 A;  1SVL A;  4DW6 A;  5D5U B;  3CJN A;  3ROU A;  3IWF A;  3AG3 H;  1T33 A;  1NG6 A;  4GRI A;  3BQY A;  4LK0 F;  3O6B B;  2WB1 A;  1MGT A;  1UEL B;  1LEA A;  3M1C A;  3CUQ A;  3OIP A;  3CCJ I;  2R5Y B;  4FET A;  2B63 J;  5DTD A;  2E1M B;  2VI6 A;  3K2A A;  1J0R A;  3BR0 A;  4CCN A;  1MMN A;  3D5L A;  2Q2E B;  3A03 A;  1EA3 A;  4C3H J;  3MZH A;  1PP7 U;  3FHN A;  1ONV A;  2O03 A;  1LVK A;  2PJP A;  2MAB A;  1YYV A;  3QYF A;  5DCM B;  5TGT A;  3HIF A;  3S16 J;  1ZLJ A;  1E3O C;  2KQR A;  3BZC A;  1YE9 A;  3HBL A;  2EIJ H;  2R5Z A;  2E19 A;  2R4G A;  2XGX A;  2L7K A;  1EH7 A;  4E6K G;  3RPU A;  4V2G A;  3VOE A;  4YIR X;  5LBQ A;  2JA5 J;  4RMN A;  2DJI A;  4V19 K;  3T1B A;  1R1U A;  1V5E A;  3LST A;  3JRD A;  4LG0 B;  4Y13 A;  5CKT A;  3HHH A;  4BEH B;  1IV6 A;  4E70 A;  5JVT A;  1GXQ A;  3SEZ A;  3PNV A;  1U0J A;  4IZZ A;  2DQL A;  4II2 A;  5E20 A;  2ELH A;  2HQN A;  4YFN F;  3RI4 A;  3VYR B;  2STW A;  1OYW A;  3JRB A;  2NYX A;  2LP0 A;  2JN6 A;  4UB8 C;  3RZO J;  2WAF A;  1Y1W J;  4NDL A;  3CDH A;  1UHW A;  1P4W A;  1TT5 B;  2R5Z B;  4ENJ A;  1U5T B;  2XF7 A;  1J7K A;  1KU2 A;  1QVT A;  2H1L A;  2NVT J;  2O5R A;  1LPQ A;  3ZPL A;  4I0A A;  4KT6 A;  2RGV A;  4A5N A;  1IN4 A;  2K9L A;  1MSE C;  2M45 A;  1XGS A;  4G6T B;  1JGG A;  5HNH A;  4RB2 C;  5KK1 A;  2E2I J;  4IHY A;  3R0J A;  4CCJ A;  1UHS A;  1TNT A;  2VQH A;  3CC4 I;  2VT3 A;  3BR2 A;  3A01 A;  3KFW X;  3JRG A;  4J00 A;  3GW2 A;  2HU9 A;  5CVJ A;  3TW6 A;  3FZV A;  3E3V A;  3QPH A;  4QPQ A;  2QF7 A;  2GXG A;  2E1C A;  1TW3 A;  2DI3 A;  3E1S A;  2I8D A;  2OA4 A;  1UFM A;  4M9X A;  4UVB A;  5DCM A;  1OCT C;  2MA3 A;  3S15 J;  3BRO A;  4KFC A;  4BYY A;  3S1M J;  2DQR A;  3QU6 A;  4KIS A;  3I58 A;  2LTP A;  1OFC X;  2CYY A;  2BHY A;  3BOQ A;  4NQW A;  2AS5 F;  2XRL A;  2Z3Y A;  4HV6 A;  1K4T A;  1ERD A;  2E35 A;  4PGH A;  2JVH A;  1X1A A;  1UCR A;  5IY5 H;  2GAU A;  2YX4 A;  3JR9 A;  1CQT A;  3LSR A;  2FU4 A;  1DPR A;  2NNN A;  3K4M A;  5K5R A;  4D7M A;  4M6Y A;  1EH6 A;  2CH0 A;  4BQN A;  5FJ8 J;  4HQM A;  2CW0 F;  5BOX A;  1QHH D;  4BY7 J;  3V8L A;  1MBH A;  5HVQ C;  2JA8 J;  4P9U A;  4OMZ A;  3P9K A;  4BE2 A;  1K6Y A;  2X6Y A;  2BEO A;  3GFM A;  4DBQ A;  4R1H A;  1MJB A;  4H0E A;  3F23 A;  1H89 C;  5E79 C;  1IGN A;  2BW3 B;  2XSD C;  2ZXI A;  3CDL A;  2Q0O A;  1K61 A;  2F5V A;  4EJT A;  3LQQ A;  4CCK A;  5HS8 A;  1E3H A;  3NWT A;  1E17 A;  3H3Z A;  2OZU A;  3CES A;  3DTK A;  2DA5 A;  2DYR H;  4DZP A;  2LDU A;  4IJA A;  2ZJ2 A;  3HHG A;  2DA6 A;  3OYH A;  3ESW B;  2EV5 A;  1WRJ A;  1VQK I;  4Y33 A;  3JSP A;  3ECO A;  4A3E J;  5FLV A;  3GTK J;  2QKL B;  2KT0 A;  5DV5 A;  3ELK A; 
#chains in the Genus database with same CATH homology
 2K9S A;  1YRN A;  4XIC A;  2O8K A;  2CU7 A;  2ME6 A;  1RET A;  5IYD J;  1ZQ3 P;  3C2B A;  1WPK A;  2CQX A;  2DMT A;  5IYB J;  3HOW J;  2MGQ A;  3LSP A;  2CUE A;  3SFI A;  2WAQ N;  3G1O A;  2YS9 A;  3G1L A;  3H0G J;  2P81 A;  3JRH A;  4A3C J;  5EZH A;  4M3F A;  5IPA A;  4BY1 J;  3O8G A;  5HOD A;  1FJL A;  1TWA J;  2PMZ N;  2XPW A;  3HOZ J;  1BL0 A;  1ZK8 A;  4C3J J;  2LY9 A;  4HNV A;  5J1U A;  2JA6 J;  5F0F A;  4A3M J;  1F36 A;  2OF7 A;  5M3M J;  1JJ8 C;  2WB1 N;  3Q0U A;  3B6C A;  3ZQG A;  2VUM J;  3ZQL A;  1B8I B;  1TWC J;  1GUU A;  3BR1 A;  1F43 A;  2DA4 A;  2OPT A;  5EGO B;  4BBS J;  5DS9 A;  2KDZ A;  1JKO C;  3QPL A;  1UMQ A;  3TP3 A;  1QPI A;  2Y9Z A;  4A3G J;  1ETQ A;  1TC3 C;  4D5F A;  4RDU A;  2VKE A;  3TED A;  3JRE A;  1BW6 A;  4XRS A;  3BTI A;  1SFO J;  4A3J J;  2ECC A;  3ZOB A;  3PM1 A;  5JLX A;  3A01 B;  2ME0 A;  3OSF A;  5F27 A;  3SDG A;  3GTM J;  3JRA A;  3O8H A;  3BQZ A;  2LLK A;  4JX6 A;  2Y31 A;  1LE8 B;  1ZKG A;  2L7M P;  2DMU A;  2EZH A;  2HQ5 A;  2RAE A;  1RES A;  3PO3 J;  4XRS G;  2XPV A;  4L5E A;  1O4X A;  4BKX A;  1ZR4 A;  2LR8 A;  2ID3 A;  3HOU J;  2FQ4 A;  5FKL A;  5BNG A;  1RPW A;  1K83 J;  3BG9 A;  3FK6 A;  3DCF A;  3DEW A;  3W6V A;  1SAN A;  1IRZ A;  3ZQH A;  2R0Q C;  1EF4 A;  4JYK A;  2NS8 A;  1ETV A;  2EH3 A;  1X58 A;  2M2E A;  3CCY A;  3HOX J;  1JT0 A;  4M3B A;  1P7I A;  1R9T J;  1WGX A;  1YRN B;  4IHW A;  2X6O A;  5IOZ A;  4RBO A;  1A6I A;  1IUF A;  2TRT A;  5FKN A;  3E7L A;  2XPU A;  5EEA A;  4S0H B;  1B8I A;  1I50 J;  3A02 A;  9ANT A;  3NAU A;  5E3M A;  3K7A J;  2FD5 A;  3F0C A;  3QQA A;  2CRG A;  3QPS A;  1ORK A;  3HGY A;  1POG A;  1WCM J;  2EZI A;  2HOS A;  2Y30 A;  5JLW A;  5GP9 A;  2HXO A;  2JK3 A;  3TP0 A;  3M3Y J;  4M6V A;  4C3I J;  3BT9 A;  5E3L A;  5E3N A;  1FEX A;  2E2H J;  2VKV A;  2K40 A;  5EYR A;  1D5Y A;  2HDD A;  1APL C;  5EG0 A;  2JMW A;  1UG2 A;  2H8R A;  2IAI A;  1LFU P;  3RZD J;  2GM4 A;  4CYC A;  2XGC A;  3S2H J;  2HOA A;  5IP9 J;  2JA7 J;  2DJN A;  5K7F A;  1W0T A;  1DU6 A;  3RQI A;  1JTY A;  1HDD C;  1NTC A;  3BR3 A;  1AKH B;  2LKX A;  1MBJ A;  1BA5 A;  3WHB A;  2L9R A;  1H8A C;  2Y2Z A;  4C2M J;  3GTO J;  5IYC J;  2CJJ A;  2M9H A;  4D7N A;  3H3V K;  2IBD A;  5K7Z A;  1FTT A;  2AO9 A;  3BG5 A;  4IHX A;  2DMP A;  3L1P A;  1ETO A;  3JRF A;  3Q0V A;  3PO2 J;  3HGG A;  4MIM A;  2E1O A;  4FE4 A;  4MLO A;  3S2D J;  2M0C A;  5F0C A;  2HXI A;  4ABZ A;  3GTL J;  1HCR A;  4QSH A;  3BR5 A;  1FIP A;  1JKR C;  5J3L A;  1ITY A;  4AC0 A;  2NOG A;  3ZQF A;  1IC8 A;  1MBG A;  4A3F J;  3IH2 A;  5IP7 J;  1GT0 C;  4FE7 A;  2XGD A;  2LD5 A;  1FIA A;  2IEK A;  1U9O A;  1JJ6 C;  1RR7 A;  1GVD A;  3BTJ A;  2R93 J;  3IH3 A;  1U9N A;  1P7J A;  3BTL A;  4D5C A;  4X6A J;  2R7Z J;  4IEJ A;  1JUM A;  1HOM A;  1U8B A;  2M8G X;  4A3D J;  2E2J J;  2DN0 A;  5C44 J;  2JJ7 A;  2I10 A;  4LOC A;  4B4C A;  3D1N I;  1OCP A;  3MKL A;  5EZG A;  1LFB A;  3M4O J;  1AHD P;  4JX5 A;  1H88 C;  4BXX J;  4W97 A;  5M5X J;  2MSY A;  4BBR J;  2X48 A;  2FJ1 A;  2W48 A;  1XG1 A;  2ECB A;  1ZTR A;  3LNQ A;  5GPC A;  3LOC A;  4UUT A;  2DA1 A;  2HI3 A;  1JKQ C;  3CMY A;  1DU0 A;  1ETK A;  5C3E J;  2H1K A;  2LFB A;  4M3E A;  5IOY A;  4A93 J;  4GFB A;  5EGO A;  4IHV A;  3LSJ A;  3HEF A;  3HB9 A;  2DMQ A;  3S1Q J;  2R92 J;  1ENH A;  2Y9Y A;  1VFC A;  2HOT A;  1X2N A;  3Q0W A;  5C4X J;  1Z0X A;  2O9L A;  5M5Y J;  4FTH A;  1ETX A;  2L7F P;  5FKM A;  1G2H A;  5F0H A;  4Y7N J;  1MNM C;  4M3G A;  1AKH A;  3GTK J;  1MH3 A;  3OSG A;  1ZGW A;  2VPR A;  4DZJ A;  4X1E A;  2GLO A;  2DA7 A;  4DW6 A;  2D5V A;  1IG7 A;  2WV1 A;  3Q3S A;  4MO7 A;  1T33 A;  2YUS A;  1ZR2 A;  3S17 J;  3BQY A;  5M5W J;  4W1U A;  5C4J J;  4M3D A;  4EEF G;  1VF9 A;  1I3Q J;  1JTX A;  5E3O A;  4DYQ A;  2DA3 A;  3MVP A;  4XK4 A;  1ETW A;  2R5Y B;  1GDT A;  4G12 A;  2B63 J;  1BW5 A;  4A3K J;  4MFD A;  3UKG A;  5DTD A;  5K7H A;  1A5J A;  3CQZ J;  2VI6 A;  1Q1V A;  1WH7 A;  3K2A A;  3BR0 A;  1HLV A;  1IJW C;  1B72 B;  3HOY J;  1MH4 A;  3A03 A;  3FIS A;  2L7Z A;  4C3H J;  3GTG J;  1WH5 A;  2GBY A;  4XRM A;  4A3L J;  2AHQ A;  3S16 J;  5FKO A;  1LE8 A;  4FIS A;  1E3O C;  5J1R A;  1ETY A;  1PUF B;  3HBL A;  2ZB9 A;  1PUF A;  3B6A A;  4AYB N;  4B3A A;  3GTJ J;  2E19 A;  5F1J A;  2R5Z A;  1AU7 A;  1IDZ A;  5FLM J;  1JUP A;  2NVY J;  1MBK A;  4V2G A;  1QRY A;  2DA2 A;  2EZL A;  2EBI A;  2JA5 J;  3BTC A;  4JP0 A;  3IH4 A;  1MBE A;  2Y0S N;  1W0U A;  3JRD A;  2FX0 A;  1IV6 A;  5FKK A;  2ELK A;  2O7O A;  4QIW N;  1HDP A;  5F04 A;  2NVX J;  1RKT A;  4UUS B;  3JRB A;  1VI0 A;  3G1M A;  2LP0 A;  1IDY A;  2JN6 A;  3JRC A;  1XS9 A;  3RZO J;  1Y1W J;  3OOU A;  1VND A;  4NDL A;  4A3I J;  2R5Z B;  1TWG J;  2DMN A;  1QVT A;  1WI3 A;  2NVT J;  3OIO A;  3GTQ J;  1XC5 A;  4B1R A;  5IP6 A;  1GV5 A;  4V2F A;  3ZQC A;  1T56 A;  4XID A;  3I4N J;  1MSE C;  1U78 A;  1TWF J;  1MBF A;  1HF0 A;  1I6H J;  4A69 C;  1JGG A;  3SJM A;  2MG4 A;  5EDN A;  2R5Y A;  2E2I J;  4IHY A;  1UHS A;  5F08 A;  3A01 A;  3BR2 A;  2XB0 X;  3JRG A;  4A3B J;  1TWH J;  4DYR A;  3TW7 A;  1QVU A;  3TW6 A;  3GBG A;  1X2M A;  2ID6 A;  2QF7 A;  4UUS A;  2MW8 A;  4DYC A;  3I4M J;  2CUF A;  3S1R J;  5EF6 A;  1FTZ A;  1OCT C;  2TCT A;  1RKW A;  3HKZ N;  3S15 J;  2X9D A;  5EG0 B;  1Z77 A;  1Y1V J;  3S1M J;  3S1N J;  2K9Q A;  2DTZ A;  1JKP C;  2LTP A;  1OFC X;  3S14 J;  2XRL A;  2HYJ A;  2N8G A;  1OJL A;  1BJZ A;  3IV5 A;  3NAR A;  4CYC B;  2G0E A;  1CQT A;  3JR9 A;  2L0K A;  2CQQ A;  3LSR A;  5M3F J;  4D7M A;  2XGE A;  2COB A;  3HOV J;  1JUS A;  3VPR A;  5FJ8 J;  4QTR A;  5J1Y A;  2LVS A;  4BY7 J;  1MBH A;  1JT6 A;  2JA8 J;  4FCY A;  4AUX A;  2NS7 A;  1H89 C;  1IGN A;  3GTP J;  2XSD C;  4J19 A;  2QCO A;  3CDL A;  4I6Z A;  3BR6 A;  1K61 A;  2EQR A;  2JWT A;  4MFE A;  1MSF C;  3MN2 A;  3RKQ A;  1NK2 P;  3HDD A;  2K9N A;  2LK2 A;  3ZQI A;  2YU9 J;  2DA5 A;  1GV2 A;  5GPA A;  3JRI A;  1NK3 P;  4DZP A;  3FK7 A;  2DA6 A;  3LSG A;  3WHC A;  3FIW A;  3FKI J;  4Y52 J;  4I76 A;  2NVQ J;  3HM5 A;  1B72 A;  3BG3 A;  5FLV A;  4A3E J;  2EZK A;  4JX4 A;  2M34 A;  2XB5 A;  2KT0 A;  1S7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...