3GTMJ

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtmJ00
2HOTA 5M5XJ 5K7ZA 1BJZA 5C4XJ 2GBYA 4C3JJ 3HEFA 1CQTA 2JA8J 5M3FJ 1XG1A 1MBFA 1F36A 5FKLA 1ETKA 3QPLA 1POGA 3HB9A 4FISA 3JRCA 4IHXA 4W1UA 3GBGA 2N8GA 1MNMC 2CQQA 2W48A 4B1RA 3LSRA 1R9TJ 3L1PA 1U9OA 4ABZA 1BW5A 2HQ5A 5IYBJ 4XRSA 2H1KA 1ZR2A 3JRGA 2NOGA 2L7ZA 2JK3A 4A3LJ 5EG0B 2HI3A 1VFCA 2E2HJ 4QIWN 2R7ZJ 1SFOJ 2KDZA 3FIWA 2DA7A 5DTDA 3RKQA 2TCTA 2O9LA 1IC8A 1Y1VJ 3GTMJ 5FKKA 4XRSG 2OPTA 4V2GA 2LVSA 5E3NA 2K9SA 2DMPA 3FKIJ 2YUSA 1JKQC 3GTGJ 1NK3P 2FQ4A 4GFBA 1D5YA 3LSGA 3BTLA 3TW6A 1T56A 1APLC 2JWTA 1FTTA 1GDTA 1TWAJ 1XS9A 2ZB9A 1Q1VA 2OF7A 4A93J 1W0TA 3ZOBA 2XRLA 5IYDJ 3BTCA 5FKOA 2X48A 1VF9A 3BR5A 5JLXA 1HOMA 4Y7NJ 2NVYJ 1QVUA 3OSFA 4LOCA 1UHSA 4DZPA 3S2HJ 2CRGA 3BR2A 3HOVJ 4A69C 3GTLJ 3Q3SA 3BR6A 4FCYA 3RZDJ 3CQZJ 1ETYA 3PO3J 3BQYA 3Q0UA 5K7FA 3S1MJ 2NS7A 1BW6A 5GPCA 3S1RJ 2O8KA 1H8AC 2HXIA 4JX5A 2D5VA 3FK7A 3HM5A 1JKOC 1Z0XA 1RKTA 3G1OA 3HGGA 4MFEA 5GP9A 1ZTRA 3JRAA 4C2MJ 1XC5A 1RKWA 1A6IA 3FISA 4BBRJ 5J1RA 1K61A 1RESA 5M3MJ 5GPAA 4A3IJ 5M5YJ 5FLMJ 2X6OA 5BNGA 4DZJA 3RZOJ 1VNDA 5HODA 3LSJA 4B4CA 1ZQ3P 4MLOA 3PM1A 4BBSJ 4XRMA 1JT0A 3WHCA 2QCOA 2ID3A 4JP0A 5EGOB 3UKGA 4A3JJ 3HOUJ 3A03A 2R5YB 1F43A 3QQAA 3M4OJ 5EF6A 4M6VA 1WH5A 1P7JA 2B63J 4D5FA 5C4JJ 2M34A 1B72B 3S16J 4MIMA 2ID6A 1MBHA 3GTQJ 2M0CA 2Y30A 2X9DA 3MVPA 4B3AA 1BA5A 5JLWA 1SANA 3HOWJ 4RBOA 2LFBA 1QVTA 2DA4A 3O8GA 2EQRA 3M3YJ 1LE8B 3A02A 3IH4A 5F08A 1W0UA 1DU0A 1RR7A 2MG4A 3CCYA 3B6AA 4C3HJ 2LTPA 2DA3A 2LD5A 2M2EA 4D5CA 9ANTA 1ZR4A 4NDLA 2R93J 4S0HB 2VUMJ 3G1MA 5J3LA 2XGDA 2AHQA 2L0KA 3H0GJ 2L7MP 4A3GJ 2R92J 1JUSA 2VI6A 2NVQJ 2NVXJ 4BXXJ 3TP3A 3S2DJ 2CUFA 4DYQA 4AC0A 3PO2J 2L9RA 3CDLA 3DEWA 4A3KJ 2XSDC 2M9HA 1TC3C 4XICA 4IHVA 3IH2A 1JT6A 4QSHA 5IP9J 1HDPA 1IV6A 3TW7A 2XGEA 2DA6A 2MSYA 5EDNA 1I50J 1RETA 1MBGA 1ZGWA 4XIDA 1JGGA 4M3EA 1JUPA 3SDGA 4J19A 1WPKA 1OFCX 1IDYA 2LY9A 2DTZA 5EZGA 1JJ8C 1FIPA 1MBKA 4UUTA 1ZKGA 2DA5A 2E2JJ 5FKMA 3LSPA 2MGQA 5EEAA 5EZHA 4V2FA 3LNQA 3Q0VA 3JREA 3Q0WA 1JTXA 1NTCA 2Y2ZA 2R5ZB 2HOAA 2Y31A 4I6ZA 2MW8A 1JJ6C 4AYBN 4M3GA 2NS8A 2EBIA 2IAIA 4A3CJ 3NARA 3D1NI 5EGOA 2H8RA 3JRFA 1RPWA 2R5YA 1X2NA 2XPVA 1FEXA 1GVDA 4IHWA 2CU7A 1TWGJ 3HOZJ 2DMUA 2O7OA 4HNVA 1B72A 2L7FP 3JRHA 2DN0A 4FE7A 4D7MA 3IH3A 3HDDA 1T33A 3SJMA 2GM4A 3S17J 1ZK8A 1HDDC 1EF4A 3E7LA 4M3DA 1ORKA 3BT9A 4D7NA 1UG2A 4A3BJ 3DCFA 2VKVA 4IEJA 2COBA 1IG7A 1UMQA 1IGNA 1B8IB 3I4MJ 1TWFJ 1LE8A 1DU6A 1MH3A 2FJ1A 1NK2P 2DA2A 2K9NA 4L5EA 4BKXA 1ETWA 3MKLA 5F1JA 4AUXA 2HDDA 2ECBA 3HBLA 4G12A 4BY7J 3JRIA 5M5WJ 2E1OA 5F04A 1AKHB 1S7EA 2JN6A 1ETOA 3ZQIA 4EEFG 3MN2A 1A5JA 1PUFB 1IDZA 1FTZA 2WV1A 5IOYA 2CJJA 4IHYA 4JX6A 5J1UA 2XPUA 3ZQFA 3S15J 2XGCA 4A3EJ 3B6CA 3FK6A 1ETVA 2JA7J 1VI0A 1WH7A 1WCMJ 3HKZN 3NAUA 1QPIA 3IV5A 3ZQCA 2JMWA 3F0CA 2K9QA 1QRYA 3VPRA 2I10A 3OIOA 1AU7A 1GV2A 2EZLA 3LOCA 2P81A 4XK4A 5F0CA 2DJNA 4A3MJ 2LR8A 1ETQA 2TRTA 3GTKJ 3WHBA 1Y1WJ 4CYCA 4FE4A 5IPAA 2RAEA 3HOYJ 1OJLA 4UUSB 1ETXA 1U9NA 2CUEA 5E3MA 1MSFC 3K2AA 4C3IJ 3O8HA 2YU9J 1TWCJ 1I6HJ 2CQXA 3TP0A 2R5ZA 2K40A 1JKPC 2E2IJ 2JA5J 1I3QJ 3W6VA 2EZHA 2DMTA 3JR9A 2Y9YA 1HF0A 1IRZA 1FIAA 3TEDA 5E3OA 3BQZA 2ME0A 3HOXJ 5J1YA 4M3FA 4MFDA 5IP6A 2Y9ZA 5FJ8J 2AO9A 1GT0C 2HOSA 1K83J 4MO7A 1O4XA 1E3OC 2LP0A 2QF7A 1P7IA 3JRDA 2ELKA 2M8GX 4CYCB 3BG5A 5E3LA 2IEKA 5FKNA 2XB0X 2LKXA 1TWHJ 1MSEC 2IBDA 3I4NJ 2DMNA 2VKEA 1OCPA 2G0EA 1JUMA 3RQIA 4M3BA 1MBEA 1B8IA 1BL0A 4RDUA 3BG9A 3ZQHA 3C2BA 3K7AJ 4DW6A 2GLOA 3S1NJ 1IUFA 1WI3A 2KT0A 1LFBA 3JRBA 1FJLA 5F0HA 2VPRA 1HCRA 1ENHA 3BG3A 3A01A 2JA6J 5F0FA 4QTRA 1MBJA 4A3DJ 1H88C 1LFUP 5IP7J 5IYCJ 4FTHA 1HLVA 4JYKA 2Y0SN 4X1EA 2LLKA 3GTOJ 1U8BA 4Y52J 3OOUA 1AKHA 1YRNA 5FLVA 1U78A 3BR1A 3S1QJ 2EH3A 2PMZN 3H3VK 3HGYA 2YS9A 2WAQN 1PUFA 2EZIA 5DS9A 5C44J 3OSGA 2ME6A 3SFIA 5F27A 4W97A 2XPWA 1X58A 2JJ7A 1JKRC 2DMQA 3GTJJ 1X2MA 2LK2A 4I76A 1H89C 4X6AJ 5EYRA 2EZKA 3BTJA 3BR3A 2R0QC 3BR0A 3QPSA 1WGXA 2FD5A 3A01B 2HXOA 1ITYA 2ECCA 1JTYA 1MH4A 3ZQGA 3GTPJ 2DA1A 1YRNB 3G1LA 4UUSA 3ZQLA 4DYRA 1OCTC 2FX0A 3BTIA 4A3FJ 4JX4A 5IOZA 5K7HA 3CMYA 3S14J 2E19A 4BY1J 1G2HA 2WB1N 2HYJA 1IJWC 2XB5A 1AHDP 1Z77A 4DYCA 5C3EJ 2NVTJ 1GUUA 1GV5A 5EG0A
chains in the Genus database with same CATH superfamily
2R7WA 4M73A 5B3SH 5C4XJ 4UHTA 1VQ8I 2Y48A 3IC7A 4C30A 3WTUC 5HDKA 2JA8J 1QHHD 5D8LB 2Z1DA 3SDBA 3PQKA 4IXAA 4BUPA 3S3OA 1G3YA 3I59A 4ZC3A 3K2ZA 1VQ7I 4R1HA 1WFXA 3FBNB 4B8XA 1XSXA 3QYEA 2V9KA 2WTEA 5KVRA 2K27A 3V7RA 2I8DA 2N8GA 2OA4A 2VKDA 1DPUA 2CQQA 2W57A 3E97A 1V5EA 1UFMA 1DP7P 3GFLA 4B1RA 3T8RA 3IP4B 1HKTA 2KDOA 2QBYB 1J5YA 1BW5A 2L9VA 3LA7A 4XRSA 3CCUI 2NOGA 2L7ZA 4QPOA 1HSTA 1KQ9A 2BHYA 5K5QA 1N77A 3IRRA 3ESWB 3KLNA 5K1YA 5HNFA 3GCMA 3CF5F 4M6YA 2A6TA 1OKRA 4QIWN 2K5CA 3W3CA 3AFHA 4WCGA 1KU9A 1R1TA 4ZYGA 1MD0A 1O3TA 4RGXA 3QWLA 4Q4ZF 4AVZA 3K1MA 4CZZA 1DPRA 3RKQA 4H0EA 1KU2A 3FM3A 3RPUA 3RYPA 4IQ4A 1JKQC 1O3SA 3LSGA 3RYRA 4OIPF 2Q2EA 1WHUA 1UJ8A 1UB9A 3DBHB 4N9HA 5E18F 2HDCA 4XKVA 1OISA 3FMSA 2GA2A 4RS8A 1IN8A 2ZBKA 2X48A 2KQRA 2ZNZA 2ZJ2A 1VF9A 3E5QA 5JLXA 1ZRFA 1HOMA 3HZJA 4E7HA 3H9JA 2A6EF 2GIZA 4EQQA 2E71A 3OOPA 4LOCA 1UHSA 4DZPA 4IQJA 4Y17A 4FX0A 1FOYA 2CRGA 4E6KG 1R23A 3CQZJ 2JSPA 4KFCA 3V8KA 4F92B 5LBQA 1MW7A 3JCUC 2NS7A 1CF7A 2WBMA 3K4JA 2H8WA 1KA8A 4ZDLA 1E2XA 2KFDA 5L3CA 3ZCOA 1YE9A 4ENNA 4II2A 3SHFA 4JX5A 2XSJC 3CUQC 4CZCA 4HDVA 2L9SA 5FLXK 3V42A 4DIQA 2HEOA 1ZTRA 1WJAA 2EK5A 4XKWA 4XLEA 4TV7A 1DQUA 2VODA 3OYFA 4F3QA 5HLTA 3GF2A 3ERMA 2YR2A 2CS3A 2ESHA 4BBRJ 1K61A 1LVAA 1TT5B 4P96A 5D6FA 1FZPB 2BW3A 4HOBA 5M3MJ 2GWRA 5FLMJ 4BJ6C 2X6OA 4RB1A 3AKZA 3FXOA 4DZJA 2DO7A 2QA4I 1REPC 2QBYA 1MMSA 2DBBA 2W24A 3WHCA 2QCOA 1JHFA 2ID3A 3TO6A 2VBWA 2R5YB 4HBLA 4DBRA 1Y6IA 3WTVC 4D5FA 2P5KA 4LG0B 3ZR8X 4I99C 2HR3A 2A6HF 3M9AA 1HA8A 3ZMDA 5L3FA 4GYGA 4AM3A 1P4XA 4WXCA 3BCAA 1BA5A 3H0DA 4G9YA 2F5EA 4OMZA 4PGGA 4G6DA 3F21A 3LWFA 3CDHA 3D5SC 5E8GA 2JQ7A 1LE8B 3A02A 3OY9A 2EINH 3W6JB 1RR7A 3B6AA 3ZPLA 2HKXA 1EA3A 3OYHA 1G3TA 1J7KA 2WAEA 2CQNA 1RR8C 1E0EA 3OYIA 1O57A 2ZXIA 4A0YA 1TP4A 1V54H 3H0GJ 2L7MP 3J81K 4X0GA 4EJVA 3AG2H 3NWTA 2QQAA 1OR7C 2NVXJ 2NVQJ 3QYBA 4BXXJ 1HC8A 3BPXA 2QWWA 2VBXA 3S2DJ 3CLOA 1GVJA 5J6XA 2R7TA 2FNAA 3OYAA 3CO6C 4P9FA 3TOBA 2AQFA 3ZP5A 1ZG1A 3F9KA 4BQAA 4BH9A 1R5ID 2M9HA 1TC3C 4NQWA 2NVUB 4HX7A 4IHVA 4CCKA 3CO7C 1L3LA 2LMDA 5IP9J 1HDPA 1Y0UA 5FRMA 2XGEA 4HV5A 5EDNA 3LSTA 1A6QA 1XDUA 4BL0B 4ENMA 5AONA 2IS2A 1MKMA 4LB6B 6PAXA 4BE0A 2OUMA 1UG0A 4ZYDA 5BMZA 4AYBA 1PVEA 4U7BA 3TKYA 2RGVA 5EZGA 2VXZA 1MBKA 1YJ9I 4QLCU 1ZKGA 2DA5A 2OAZA 5FKMA 4BYYA 2E2JJ 3I0TA 1R7JA 5EZHA 2L01A 1R00A 1T0FC 3QP6A 4BEHA 2R5ZB 2Y2ZA 1OPCA 3PQJA 1I1SA 4I6ZA 4XM3A 2VOOA 3CJRB 3KE2A 2NS8A 3ZMZA 5D5UB 3DWLE 2ZJQF 2H09A 3NARA 3E1SA 3SEQA 3D1NI 2PEXA 2FRHA 2H8RA 3JRFA 2R5YA 4P9UA 2W1OA 1GVDA 2ZCWA 1R1UA 4KYWA 3KCCA 1BN5A 4WX9A 1BC7C 3JRHA 2DT7B 2VJJA 4Y3OA 2R7DA 5DV5A 1T33A 1QGPA 2AXTC 4E7LA 3FXMA 3VB2A 5ILUA 2Z99A 1ZK8A 4HV6A 1ORKA 4XLHA 3CF2A 4D7NA 1Y39A 3DCFA 1BR2A 4IEJA 2COBA 2O6GE 5ED4A 5KAIC 2HPMA 2QKLB 1LE8A 1DU6A 3P5JA 3C18A 3OYGA 4NNJA 5F1JA 4WK8F 5H2FC 3EETA 4EM2A 4KIFA 1KZHA 3FWEA 1W7PB 2PX9A 4RAYA 1O3RA 3A1YA 4A5MA 3AL0B 1SD4A 2XAJA 1ETOA 2GOMA 1LPQA 1S3JA 4IOAF 4DJAA 5J8FA 4LGWA 2JUCA 3G6EI 4KIBA 3RTRA 5L3DA 4HNTA 3MKYB 2F5FA 2IT0A 2XPUA 1T2KA 4ZTJA 4A3EJ 3MWMA 3MAJA 2EILH 2VN2A 2JA7J 4CA0A 1WH7A 3HSRA 2R3SA 3CJNA 5AIPA 3TO9A 2RKHA 3F0CA 1XGNA 2HGCA 4CH7A 1AU7A 1SD5A 1SVLA 2EZLA 1ZAOA 3WTZA 3J7YJ 5JHFA 2EFPA 3V8LA 2STWA 4U88A 1DGRM 2LR8A 3LL7A 1ETQA 2TRTA 2FOWA 3DV8A 1UAAA 3GTKJ 2JRTA 2GXBA 1SD6A 4FE4A 5IPAA 1IXCA 1OJLA 3PNYA 1XCVA 3H5NA 1U9NA 2CUEA 3SZPA 5E3MA 1U8RA 2M3AA 1Z9CA 3O8HA 4OAYA 2R5ZA 4JBAA 2VASA 2JA5J 3B73A 3GLXA 4ITVA 3PIOF 1HF0A 3E3VA 1IRZA 3QYFA 3TEDA 3HIFA 4DGWB 4HF0A 5J1YA 2XDVA 4MFDA 4L18B 4B48A 1U6GA 4XMYA 4LLLA 1RIOH 1KYWA 4RGSA 1GT0C 2DQLA 4MO7A 1O4XA 1ACIA 3U1KA 3ULQB 3C1DA 2BHZA 5LGTA 2M4GA 2LP0A 1K7AA 1U5TA 1OLTA 2QSGX 4CYCB 1Z21A 3K1PA 2IS6A 2IEKA 2XB0X 2KIUA 4E7JA 1MSEC 1M1EB 2WY7Q 3RPQA 3I4NJ 2DMNA 3EQLF 2F6CA 3HSEA 3LA3A 4OMYA 2FQ3A 3BCBA 2GAUA 1QNTA 4A6DA 1OCRH 3I71A 3SXYA 2MD0A 3CCVI 4HF2A 1D1BA 2XF7A 2DFHA 3ZN1A 2PG4A 2F4OB 1RUNA 1WI3A 2KT0A 4E4HA 3JRBA 3VYSB 2RVCA 2WC2A 3ISPA 3K70C 3I53A 4M9ZA 5DD4A 2E5NA 3G2BA 4QTRA 2GA1A 1H88C 5IYCJ 4FTHA 2VQGA 1MJAA 3GTOJ 1U8BA 2RN7A 1YRNA 5FLVA 4F52A 5HLHA 2PMZN 3C3WA 3ELKA 5FGMA 3H3ZA 1ZRCA 2OZUA 1QU3A 2M8EA 5DS9A 3OSGA 5F64A 2KISA 3JTHA 4W97A 2W25A 1X58A 5LGUA 3FHNA 3M8JA 4M72A 2LK2A 4RB2C 3LAJA 1P6RA 1H89C 2D1HA 2QKMB 3I64A 4HSTA 3CUOA 1TW2A 4GGGA 4XSZF 2AQEA 4IHTA 5H6RA 4FX4A 2HYGD 3BR0A 1LDDA 4Z6YA 1WGXA 2WB1A 3OS2A 2CWEA 2P7CB 1MH4A 3GTPJ 3L09A 1G6NA 2V9VA 2BZTA 1RI7A 4DYRA 3L2RA 2OTLI 2K3PA 4A3FJ 2E19A 3DPUA 1KGSA 2IPQX 2HYJA 3G71I 5CYVA 2JRMA 4BE1A 1VZ0A 3HPHA 2M87A 2E5ZA 2KLOA 2EFOA 4DYCA 5C3EJ 5JVGF 3LAPA 5E3OA 1FTTA 1BR4A 2HOTA 3VODA 5J8CA 3CC4I 1NHAA 5K7ZA 4WXDA 1XDSA 4HQEA 3BROA 4L9VA 1YW7A 2OC6A 4G7ZF 3DLAA 1R5GA 1G4DA 4A12A 1XG1A 2BEOA 3P9KA 1ETKA 3BPVA 1SFUA 1POGA 4J01A 3HB9A 4FISA 1I1GA 1R22A 2VQHA 1LEAA 4W1UA 3GBGA 4A6EA 1ZHFA 3DF8A 3KZIC 3ABKH 2DW4A 3KP2A 4Q47A 1X3ZB 5E8IA 1Z91A 1FBUA 1OCZH 3M8EA 3LSRA 5B1AH 2EB7A 2OV7A 1O7LA 4ABZA 5D4RA 1K78B 5IYBJ 2TDXA 1ZR2A 4L9TA 3JRGA 2VOPA 2XASA 1K4SA 5F1RA 2ADUA 1HQCA 1X1CA 3EDPA 3HXLA 3ZRGA 2E2HJ 4UXNA 2O8XA 2W7NA 1O3QA 1SFOJ 1I27A 5IY5H 3FIWA 2DA7A 1ZYRF 4R79A 1BI1A 1TQPA 1TQMA 4OU0A 1IC8A 1ZLJA 5KNLA 5FKKA 5AIQA 4V2GA 3L9FA 2LVSA 1EH7A 4CCMA 2ACJA 2K9SA 5D5WB 5E1ZB 4LIUA 2EV5A 4CDGA 2VLAA 1IRFA 5CJ9A 2CV2A 2P6TA 1T56A 2P4WA 3VFZA 1QA6A 2A5WA 2L54A 1GDTA 1TQIA 3T5XA 2ZB9A 3KZZA 1Q1VA 2FBKA 2LSOA 2QGUA 4YIFA 5IT9Z 1W0TA 3ZOBA 4AIJA 2XRLA 2QENA 3KX2A 4AWXB 1JE8A 2NXNB 2J5PA 5TISC 5IYDJ 3BR5A 2DFEA 4Y7NJ 3HRUA 1S7AA 3HHGA 3OSFA 1I5ZA 3BLYA 5CQEA 3RDIA 2VQCA 4MTEA 3BR2A 3IWFA 5HVQC 3CESA 1QHGA 2LF8A 3E6CC 1YS7A 2XAFA 3I3LA 2L2OA 2KZVA 1ON2A 5ICEA 3LQRA 2KRCA 3UNGC 4GRIA 3AAFA 1ETYA 1KYZA 2BGCA 1YG2A 2RDPA 3S1MJ 2BXYA 5DCFA 1BW6A 1OYYA 3SFZA 3LSIA 2PLYA 4BQNA 4MGRA 4D9JA 4D0PA 4PGHA 1H8AC 1F1ZA 5CVRA 3W2WA 1V5FA 1J0RA 5LGNA 2D5VA 4BU2A 5FROA 2FU4A 4KT6A 2MLGA 4MFEA 2DYSH 3ZQQA 3I54A 3ZXSA 3FHZA 1Z6RA 2F5DA 4ZTFA 3J7AY 1SVMA 4BDYA 2IA0A 1RKWA 3CCSI 1D8JA 3K1NA 3FF5A 2HVQA 5GPAA 3KP7A 1Z3XA 2WAFA 1UHMA 3HOSA 1DGWY 1K78A 1VNDA 4ENKA 2JPBA 4KUMA 2M30A 3LSJA 1ZQ3P 4G6QA 3PM1A 4JK1X 4ZDPA 2NS0A 4EVIA 2MA3A 3RJPA 1F43A 2EPFA 1YYVA 3M4OJ 2AXLA 1JXSA 1WH5A 1XGOA 2OQRA 1FP2A 1I39A 2H6CA 3U2RA 2YX4A 3CCQI 2QSFX 2V7FA 2RC4A 4MIMA 3ROUA 4E7ZA 4MHGA 1IN5A 3DPTA 3GTQJ 2M0CA 2Y30A 3M7GA 1Y0NA 3TO7A 4B3AA 3EUAA 5JLWA 2DODA 1SANA 3KP5A 1YIOA 1FLIA 2DJIA 2VONA 4LFUA 2VC0A 2LFBA 1YW8A 2P6SA 4LLNA 1LJ9A 2QQ8A 4A2UA 3QOEA 3OV8A 5JFRA 1T98A 2EQRA 2LY2A 3DKWA 2YU3A 2BW3B 3IH4A 3K4MA 1DU0A 2FBIA 4C3HJ 2JSCA 2LTPA 4L5JA 2DA3A 2ZSIB 2M2EA 3H9GA 5TRDA 1ZR4A 4IL6C 3NQOA 4NDLA 2IVMA 3WE3A 2R93J 3F8BA 4S0HB 2VUMJ 2BY0A 2XGDA 2CFXA 2CQKA 3GFIA 3Q9SA 2KIQA 5D5XB 4ZYAA 1JUSA 2LYCA 2VI6A 1S5LC 3QODA 3TP3A 3FZVA 2PMHA 2EFNA 1FY7A 4EJUA 1U5TC 2CUFA 5JI6A 5DCMA 5A2QZ 2L9RA 1BM9A 3DEWA 2KJBA 2M0MA 3FXLA 1N78A 3GW2A 2HS5A 3CD6I 4Y4RA 1SFEA 3EYIA 4I09A 4G8XA 3CTAA 1QPMA 3CZ6A 4XICA 1JT6A 1LUJB 4E7SA 2B9SA 4QSHA 5CVIA 5FD5A 2A3SA 1IV6A 2DA6A 2MSYA 3C2HA 3BY6A 2MFZA 1MBGA 2HYFA 2K02A 4M3EA 1Q1HA 2ZXJA 1SAUA 4KN7X 1N25A 1UHWA 1IDYA 2BY2A 3KLOA 1FIPA 4XLFA 2K9MA 2UZKA 2UXNA 2LY1A 2BV6A 4YIRX 3LNQA 3WTTC 2MBFA 3AL0C 1G3SA 4NC8A 1Y56A 3M1EA 1OCCH 2P5LC 5ILVA 2M1BA 2FBHA 1MNEA 1MIJA 5LLQA 2W4SA 2EBIA 3E6BA 5CVUA 2IAIA 2E35A 4A3CJ 1X1BA 1MGTA 2XPVA 4NQWB 2DI3A 2IP2A 4RAFA 3RCOA 1E17A 4IHWA 2X4HA 2V1UA 2DMUA 2O7OA 1F5TA 1FSEA 2ZC2A 4QPQA 1TTYA 1V55H 2DN0A 3MMYB 1W36C 1AA7A 2CH0A 4D7MA 1YI2I 3GXOA 3HDDA 4XBFA 3F8FA 2CYYA 1BI0A 1HW5A 5TGTA 4YELA 3NEUA 2O03A 3AG3H 3BT9A 1T38A 2MH9A 4XRFA 3CMAI 2D2WA 2QSHX 2VKVA 1B8IB 1DUXC 2K4JA 3MCZA 4BEHB 3J80Z 2DA2A 2K9NA 3CP2A 3WGIA 1NK2P 1UZCA 4KA4A 1USTA 1R71A 4GYIA 1SC7A 5GADJ 3DKYA 4Y33A 4C9YA 2P7VB 2RV8A 1BR1A 4M71A 4F7ZA 2DOFA 2E1MC 1BIAA 2UWMA 3GZ5A 2DOAA 4G12A 2VJ5A 3IWZA 3GUDA 2F48A 2DQRA 1STZA 3GX4X 1S7EA 4F93B 4XN0A 2F2EA 2WA0A 4EEFG 2P8TA 1QZZA 1IDZA 4BHPA 3PNVA 2LBFB 4KDPA 2WV1A 2ZMEB 3KZYA 3OS1A 4XR6A 3DTKA 1Y8RB 4GCVA 4IHYA 4JX6A 2RNGA 1LDKB 3GMEA 3QOPA 5J1UA 3LFUA 2HVRA 2Q8KA 4PJNA 3JSOA 1SAXA 3FKJA 2HKOA 5LHGA 2VE8A 1VI0A 3HKZN 3NAUA 4U87A 2KPMA 1ONVA 3KEQA 2K9QA 4PUSA 2I10A 3HUGB 3VDXA 2ISZA 4B09A 2XAQA 2HTJA 1LFPA 2VJIA 4RAGA 4IOCF 2E7WA 1ZG3A 2ZFWA 5DM6F 1Y1WJ 4UV8A 2LG4A 3RKYA 4RB3C 5BOXA 2PFBA 2Y69H 3HSFA 2V9PA 2YU9J 3ASOH 4KIGA 5E79C 1Z05A 5H6QA 1VQ9I 5LRRA 2A68F 3TP0A 2LDUA 2K40A 3F8CA 4IF4A 4XLNF 1I3QJ 5H20A 2Y9YA 4EM0B 1TW3A 5F6FA 3P9CA 4M3FA 1S9HA 2RNJA 4BE2A 2PJRB 1R4NB 2AO9A 1MJ9A 1B9MA 1K83J 5HDNA 4XONA 3F72A 1Z7UA 2UXXA 1E3OC 5FRNA 4IRIA 5HS8A 2XF6A 3SZTA 3ZMTA 3JRDA 1YJNI 4HA8A 4ZDOA 1ZG5A 1VQ6I 2BOLA 5ILSA 5FKNA 1MDMB 1TWHJ 2IBDA 2VXDA 2V1XA 2FA5A 4OINF 1OCPA 3WG9A 3KEOA 3M1CA 3RQIA 2A61A 1B8IA 3FDYA 5LFAA 1IN6A 1XCBA 4F91B 3COAC 1PUEE 3C2BA 3K7AJ 4DW6A 2GLOA 2X0LA 2KKOA 1LFBA 4GO1A 5FO5A 2CG4A 1R58A 1FJLA 1MMNA 4D1QA 4GDFA 1OQYA 2ZXHA 3ECHA 4XN3A 5F0HA 3B02A 2V26A 1HCRA 1XMAA 3C7JA 1W7PD 3K4NA 3T1BA 3E6DA 3CJTB 2M7BA 4JYKA 2Y0SN 1A36A 2ETHA 2LLKA 2EA4A 2XUBA 1FOKA 4Y52J 4I0BA 3H3UA 1U78A 3L2VA 2EH3A 1WJBA 3OL3A 2XF5A 2WAQN 4V19K 1U5TB 2L3DA 2LBFA 2ZMEA 4UUVA 3ABMH 1OYWA 3R60A 4BNCA 1J09A 2XPWA 2JVGA 4BJTA 5JVTA 5E1WA 3GTJJ 2L7KA 5IT9K 2CW7A 2L02A 3QP5A 1S8NA 2CO5A 3GZ6A 2HVSA 1D5VA 4WF2A 2B7EA 3HUGA 4DQ2A 3BR3A 1IXRC 4AIHA 1K79A 2H6BA 3K4CA 3A2KA 3DEUA 4PZJA 1FOXA 3QPSA 2PQ8A 3GEZA 1SEUA 1SMYF 5D5VB 2VKHA 1X1DA 2RQPA 1T8IA 1F4KA 1A35A 2HWVA 1YRNB 1XSVA 3ASNH 1T08B 2VJ4A 4ZZDA 5IOZA 5K7HA 4BAYA 5JHUA 1G2HA 3P9IA 2O5RA 3BJAA 2HDWA 2M4KA 2VT2A 4KN4X 1T39A 4BGDA 2KP6A 5EG0A 2DFIA 1Z3YA 2PJRA 2Z5UA 5M5XJ 1BJZA 2DT6A 2GBYA 3E0JB 3E5XA 3HEFA 1CQTA 3IAS2 3H5RA 5M3FJ 4RB0A 5FKLA 4CO8A 2A5YB 2X51A 2BYVE 4IRGA 3QPLA 1GXQA 4BS9A 1MDMA 3PNTA 3A4CA 2DT5A 3RSNA 2H94A 1D0XA 4LD5A 4PCQA 4K2EA 3VSLA 4YRVA 3OWTA 3PSFA 3L1PA 1U9OA 4LG3A 1D0YA 3OYDA 2R7XA 2HQ5A 2E1MB 3L2CA 2V1NA 3TGNA 2M5WA 4CCNA 2JK3A 2STTA 2ELHA 1S72I 2XROA 4A3LJ 2UV1A 3AG1H 5IT3A 5HNHA 3WU2C 4Z2YA 2R7ZJ 2M7AA 3CCEI 2W85A 2KDZA 1YTYA 3HG9A 4LJZF 1YX5A 3LFKA 3D5LA 4KMFA 2TCTA 2O9LA 1W5CC 4Q48A 2GXAA 1Y1VJ 1E3HA 4XRSG 1BBYA 1ZGJA 2HPIA 2OZ6A 3Q5FA 1FYMA 2PJPA 2OTJI 4WWCA 2E1CA 1JGSA 3FKIJ 4EGYA 3GTGJ 2FQ4A 4GFBA 4S05A 3BTLA 2EA2A 1APLC 5J4VA 2WADA 1XS9A 4A93J 1X3UA 3QPHA 2NNYA 1PP7U 1B1BA 3G4SI 1KQ8A 1PJRA 1WJEA 3BTCA 3DKXA 2R7QA 3H9QA 1WWXA 2FOKA 2KRFA 2IS4A 3V7SA 3LA2A 1X4OA 1IXSB 2V6EA 3I9V2 3S2HJ 3NRVA 1FBSA 3HOVJ 5J40A 3DP7A 3T8TA 2VE9A 2L4MA 2QYOA 1ZN2A 3BR6A 3Q3SA 4FCYA 1WI9A 3RZDJ 2J5OA 5DYMA 1D0ZA 1F9NA 3EYYA 1QZEA 1HKQA 2X6YA 4PJJA 5CVJA 4HF1A 5CKTA 5GTHC 3S1RJ 2CFOA 2JVHA 2ZXWH 3K0LA 4AVPA 4ZZLA 1Z6TA 1LNWA 2HXIA 4BACA 2V4JC 3HM5A 1JKOC 2DDBA 1Z0XA 4YFNF 4KISA 1RKTA 1ZH5A 3HGGA 3FMQA 5GP9A 1IN7A 1BIBA 2HZTA 2R7FA 2IW5A 1XC5A 1OYIA 1SVOA 4G94A 3CMEI 3FXKA 2HQAA 4HX8A 4O3MA 1MMGA 2R7VA 3DU5A 3FISA 1K6YA 3PUFA 4ZYHA 1B59A 2PI0A 3DU6A 3WU0A 3ZN0A 2ZSHB 1XPXA 2XHKA 4BBSJ 3LMMA 1LVKA 2EFQA 3UKGA 4JP0A 3W6KB 4NC7A 1YLFA 5EF6A 1WJFA 2X6WA 2B63J 4Q5SF 2EWNA 1MJBA 3W2VA 4XKBA 4BQOA 4IHSA 2M34A 3BG6A 1U2WA 1MBHA 4LK0F 3OYLA 3J81Z 1ZRDA 1WJCA 3MVPA 3CJQB 3GZNB 3SEZA 3IAM2 5ERIA 3KP6A 1QVTA 1AWCA 3O8GA 2XKPA 1IUYA 3LSHA 3OS0A 1W0UA 2MG4A 3CCYA 3K4KA 2ISYA 3CMMA 1TBXA 1TNSA 2JT1A 4B47A 2LD5A 9ANTA 4D5CA 2BVLA 2JUGA 3P7NA 3G1MA 5J3LA 1D1CA 1JI8A 2AHQA 4PK4A 4RAZA 3WTSC 4A3GJ 3KYLA 1IRGA 4LIVA 2ZFUA 3IKVA 3S2WA 4RM2A 1EJ9A 4UB8C 2DU9A 4EM1A 4PJLA 5HOOA 3RPUD 2GXGA 1S29A 2K3FA 2QM3A 4I01A 4MQVA 1R6RA 1FT9A 2K9LA 3PO2J 1IRXA 3CDLA 4O6JA 1BJAA 4A3KJ 2R7SA 5GAHJ 1XMXA 3VEPA 3IH2A 4I0AA 2FMLA 2V1DA 1U0JA 1YS6A 3H92A 1I50J 2DDAA 2JA2A 2KRHA 1ZGWA 4XIDA 2IRFG 2LF7A 4XL9A 2L9NA 1JUPA 2LREA 2YSRA 4J19A 1U3EM 2V79A 2KMUA 4IPAA 3CC7I 3MEXA 2LY9A 5FB2A 2DTZA 4G7OF 2KHMA 3LSPA 4GXOA 5DUKA 5EEAA 1WKMA 1ZLKA 3IUOA 1OCOH 3K70D 1FWZA 1Z1DA 1JTXA 1NTCA 2RREA 1ZELA 5KCMA 5L3GA 4MNUA 5DCMB 1JJ6C 4AYBN 4XOTA 2ZMEC 4M3GA 2I5UA 5CLSA 3ERED 2DYRH 1TNTA 3JTGA 1RPWA 1X2NA 3F6VA 1FEXA 3OYEA 1WZ2A 1TWGJ 3HOZJ 1SFXA 1P2FA 1PYVA 4HNVA 3H5AA 2L7FP 4I7HA 2FE3A 4O5VA 2KL4A 4FE7A 4ETSA 3SJMA 4PFOA 4UV9A 3S17J 3EUKL 1R4MB 4XKCA 3L2QA 3MZ8A 1EF4A 4ESBA 3E7LA 4M3DA 4B3XA 4C2TA 3PIPF 3WODF 5KAFC 3U1DA 1UG2A 4A3BJ 2ZO4A 1IG7A 1UMQA 3I4MJ 1TWFJ 4L5EA 4RGRA 2F4MB 1RNLA 2DLLA 5HDGA 4AUXA 2IS1A 2Z33A 2ECBA 1G8XA 3HBLA 1P4WA 1J59A 3BJOA 4BDZA 4BY7J 1I3AA 1FX7A 5M5WJ 3GFMA 2E36A 1VTNC 2FSWA 5F04A 3ZQIA 1SD7A 3K4BA 1X4PA 3EUHA 1P9QC 3H35A 1A5JA 1FTZA 2NYXA 3GWZA 2CJJA 4BXUA 1KQ0A 4LLGF 1J75A 2NRAC 1ULYA 3R4KA 4RA2A 4EMSA 4M6XA 3ZQFA 1SMTA 2XGCA 3S15J 3DQVC 4G6TB 3L2WA 1FSHA 4M9XA 2OD5A 3WTWC 1N75A 1ETVA 2QLZA 1WCMJ 2HNHA 4LMYA 4A0ZA 4CXFA 3K10A 5FFXA 4ENJA 2ZKZA 4NUBA 1QRYA 2BY1A 4OIRF 2NNNA 3OIOA 1GV2A 1SFKA 3BP8A 3LOCA 4KT5C 1TL8A 5F0CA 2DJNA 2G7HA 1QBJA 3BJ6A 3OIPA 3WHBA 3L2UA 1FOWA 3RIRA 4OIOF 2VC1A 2RAEA 3J7AO 3WGHA 4HLXA 4UUSB 3HRMA 2FF4A 3K2AA 4EJWA 4UB6C 4II3A 4C3IJ 3QRFF 4HEA2 2D45A 2DAOA 3WTXC 1CGPA 1TWCJ 4P1WA 1JKPC 4HSRA 2E2IJ 1EH6A 4AIKA 1E3PA 2EZHA 2DMTA 3FX3A 1WJ5A 2K86A 1QZYA 5DD8A 3DEEA 3BQZA 2XIGA 2ME0A 3HOXJ 1L0OC 5KK1A 4HAMA 1A31A 2Y9ZA 3M8FA 4MQ9F 4KICA 2W84A 1MMDA 1YITI 2OU2A 2K85A 4LB5A 4OAZA 2L4AA 2PMUA 2VIXA 3PFYA 1R1VA 2B0LA 4ZH4F 2FXAA 4E70A 2LC2A 3FXQA 2ELKA 2M8GX 3BG5A 5E3LA 1YW9A 1LB2A 4P5OA 4CCOA 1RUOA 2VKEA 3BOQA 3WG7H 3U21A 4J00A 4HG2A 4M3BA 1MBEA 1S6LA 2X6XA 2OCEA 1IUFA 4EGZA 2A07F 1X19A 1ODDA 3F8MA 2X1EA 3ONQA 2PMZA 4MEXF 1VQNI 1FC3A 4EV0A 1ENHA 3BG3A 3A01A 1VQOI 1WJDA 3LQQA 3HRSA 1MBJA 3ZMVA 4HRIA 2JA6J 1LFUP 1HLVA 1HW1A 2HQRA 3K4LA 3OYJA 3OOUA 3O3KA 4EJTA 4U7DA 2YS9A 1MZBA 3LSMA 3TDUC 4L5IA 1TLHB 3HTUA 4XORA 5C44J 2ME6A 2OBPA 3SFIA 4NC6A 1MNDA 2IGNA 4U0YA 4FETA 1JKRC 2DMQA 4JQFA 3QU6A 5L3BA 1B9NA 1X2MA 3OR2C 3ZGKA 1IAWA 3DFGA 2XAHA 3DTEA 1VQMI 4CYDA 4PSXA 1DDNA 4CICA 3BTJA 1EH8A 2R0QC 1RZ4A 4L0ZB 2JTVA 3KFWX 4KJZA 1ITYA 1JTYA 3ZQGA 3CCLI 3VWBA 1XX5A 3FXRA 3PUBA 3OYBA 1BOBA 3G1LA 4UUSA 3ZQLA 3TL4X 2FX0A 4JX4A 3A0BC 4Y13A 3F3XA 4YEJA 5GAEJ 2WB1N 4B44A 5J47A 5CQGA 4HLYA 1AHDP 1Z77A 3HOTA 2YPRA 1LQ1A 2HOEA 3TQNA 4LITA 2W00A 2CUZA 2NOJB 1GV5A 4KMUX 2KIFA 3RKWA 2QUFA 5E1XA 3DXJF 4G7HF 3QAHA 1ZARA 1VQKI 4C3JJ 3WU1B 1BI3A 5K5OA 4HQMA 5JR3A 2DXIA 2BBYA 1MBFA 1F36A 3KIOA 1W4MA 1Y8QB 4PFPA 3KPHA 3JRCA 4IHXA 4I2OA 3K9TA 2F5CA 1G59A 2CMPA 3MKZA 1PDNC 1MNMC 4IO9F 2MH2A 1VQ5I 2W48A 4XLAA 4RLQA 1R9TJ 1K4TA 2D1VA 3C2GA 3KP3A 5CVVA 2H1KA 5LHIA 1R5HA 3SZGA 3VOEA 3FM5A 3R0AA 4EATA 1KU3A 3OYCA 5EG0B 2HI3A 3HYIA 4IKFA 3KYCB 4L0YB 1VFCA 4XQFA 1YO5C 3F6OA 1LKXA 2P0WA 4M9SA 3SQNA 4XNFA 2CGPA 4S04A 1T95A 5B5EC 4BHBA 5DTDA 1BC8C 4YG2F 1OMIA 2E7XA 3GTMJ 4UVAA 3GLLA 3IKTA 2OPTA 3K6GA 4CGZA 3ML6A 2COMA 5E3NA 2DPDA 3F8NA 1QQIA 2DMPA 4JOMA 4HDUA 2YUSA 4HPQA 1NK3P 1IN4A 2LKPA 1D5YA 3TW6A 2O61A 1D1AA 2JWTA 4C2UA 1O7FA 3GFJA 1TWAJ 2OF7A 3MZYA 4WXHA 3H36A 2Z16A 3JAMZ 2ZJRF 1YOVB 4FQGA 5FD6A 5FKOA 1FYKA 3E6MA 4E7KA 3L7WA 2NVYJ 1QVUA 2MC4A 3QU3A 1T6SA 2MYSA 3V7CA 3QPTA 2P5VA 1IW7F 2EIMH 4A69C 3GTLJ 1FPQA 1AOYA 3OIQA 2VT3A 4H4KC 3BZCA 5LD2C 2XAUA 3PO3J 1RRJA 3CC2I 4MEYF 3BQYA 3MQ0A 2HTSA 3Q0UA 2JPCA 5K7FA 3NWSA 1DP3A 3ZMUA 4ZYEA 3CCMI 2IGMA 5GPCA 2O8KA 3TBIA 2HQNA 2CSOA 4RGUA 3U9GA 2EV6A 2H1LA 1W36D 3WGGA 4LG0A 2CV1A 3CCRI 3ECOA 3L00A 3FK7A 4UY8I 3F22A 3G1OA 3DBLB 3KP4A 1QO0D 3LSKA 3T0YA 2OJED 3JRAA 1R49A 3UR3C 4C2MJ 3S3NA 3W2AA 4CHUA 4A0XA 3TMOA 1A6IA 5J1RA 3CCJI 2K4BA 1RESA 2L5QA 4PJ0C 4LK1F 4HNUA 4A3IJ 5M5YJ 2Z3YA 5BNGA 4ESFA 3EUHC 5D6EA 3RZOJ 3WE2A 5HODA 4PDKA 4B4CA 4MLOA 2KIMA 4ASNA 4XRMA 1JT0A 4A3JJ 5EGOB 3HOUJ 3A03A 1W5SA 2PN6A 1H9TA 3QQAA 3RI4A 3I56I 3R6SA 4M6VA 1P7JA 2G9WA 1R36A 3BC8A 3I55I 5C4JJ 2DCEA 3OL4A 2BXZA 1B72B 3S16J 1V3FA 3R0JA 2DOEA 2ID6A 3RKXA 2R7UA 1GLNA 3DLLF 2X9DA 5DM7F 2F5VA 1K6OA 4KNYA 3HOWJ 4RBOA 1GHCA 4N4OB 2KJCA 4AU7A 2V6CA 3BDDA 2DA4A 2LRDA 1TZLA 3M3YJ 2LNBA 3CUQB 5F08A 5CPRB 4E7IA 5HS7A 2O3FA 1FP1D 2WWYA 2DPUA 3I58A 2BY3A 4EJOA 1RC9A 2XKOA 5ICFA 3S32A 1FMVA 2O0YA 2L0KA 3E5UA 1V5GA 3REOA 3G3ZA 3MKWB 4B43A 2X1CA 3HHHA 3VYTB 3K69A 2R92J 3PL8A 2IJLA 4ZJZA 1IO2A 2H27A 4UVBA 5HS9A 2ELJA 4OOIA 4DNCA 1XB4A 5DDGA 2QVOA 4DYQA 3R61A 4AC0A 3WTYC 2FMYA 1KONA 2PBIA 4PJMA 3ZQ7A 2XSDC 3OYNA 3PJRA 4DBQA 3KEYA 5E20A 3S8PA 3TW7A 3ABLH 1GXPA 4NB5A 2IXSA 2IA1A 2MC3A 4MTDA 2FNPA 1X1PA 3FXJA 1RETA 3N4MA 4HX4A 1JGGA 3HC7A 2FUG2 3OYKA 3SDGA 4UVCA 5LRSA 1HKSA 1WPKA 1OFCX 2K7LA 1JJ8C 1PP8F 5GTIC 4UNOA 5FLXZ 2QZ8A 4UUTA 5B66C 2LOOA 5A2QK 5ICCA 1YJWI 2MGQA 2IGKA 2XC7A 4V2FA 4ESJA 3Q0VA 3JREA 3Q0WA 1XMKA 2HU9A 4I98B 1JHHA 2HOAA 2Y31A 3Q9VA 2WV0A 3MZHA 1H9GA 2MW8A 4ANJA 4CUGA 4FHTA 4N0BA 4P55A 1YHQI 5EGOA 4DOZA 2X1DA 1NG7A 3VYUB 4RMNA 1W7PA 2CW0F 5DEQA 1Z67A 2CU7A 4XOPA 5GAGJ 3KYDB 3GVAA 5L3EA 5LEKA 2IA2A 1B72A 1H0MA 3FMRA 1D3YA 1S7OA 4FT8A 2M45A 5KHDA 3IH3A 4CCJA 4ON0A 2GM4A 2A69F 3HTSB 2JZYA 3F23A 1HDDC 1YQAA 2CUJA 2E60A 3S3MA 3GO5A 2GIVA 2AS5F 4F55A 1IGNA 3H1CA 1MH3A 2FJ1A 3CUQA 3EPZA 4BKXA 1ETWA 2R7OA 3MKLA 4RLFA 4KITB 4L9JA 3MFKA 2HZDA 3J7ZI 2HDDA 3HPGA 2LKSA 2KZGA 2C6YA 4NHJA 1I6XA 1C0WA 2GZWA 5ICGA 3JRIA 3HL2A 2E1OA 1Z7LA 3S93A 3IRQA 1AKHB 3N05A 4YFKF 2JN6A 1B6AA 3DPLC 1W1WE 1EKEA 3PSIA 4L9NA 2EFWA 3HKZA 3MN2A 2XRNA 4HZFA 1PUFB 1UCRA 1XSDA 4AD9A 1FYLA 5IOYA 3V8JA 3D5RC 3J80K 4HYEA 2EJRA 2VB6A 3MD2A 4N9IA 3X2QH 3B6CA 5BQTA 5LHHA 1FBQA 3FK6A 3GYHX 1QPIA 2BVMA 3RQ4A 3IV5A 3ZQCA 2JMWA 2E34A 2QQ9A 3VPRA 4YFXF 3FBIB 1VQPI 2VPLA 3KETA 3JW4A 2P81A 3PFIA 4XK4A 5FFZA 4A3MJ 2ZNYA 3V4GA 1XD7A 5HLIA 1VQLI 4BHCA 4CYCA 1XGMA 3ZMSA 2DK8A 2ZJPF 2A05A 5J4YA 3HOYJ 2XAGA 1HSJA 3HJEA 1ERDA 1ETXA 5B1BH 1MSFC 3FXUA 2LH9A 3O2PE 1ON1A 3TDZC 4M74A 1I6HJ 2CQXA 2DTRA 2MABA 3W6VA 5EJCA 3JR9A 2Z2SB 1ZGAA 1FIAA 3OMYA 1KU7A 2QQBA 1YFHA 5EEGA 5EEHA 4RM3A 1LDJA 1IZ1A 1B4AA 2Z9OA 3BWGA 2HFHA 4R8HA 2XGXA 5TJJA 5D8KB 5IP6A 3OYMA 2XV4S 5FJ8J 1X3WB 4N4NB 2HOSA 3TOAA 4BJ5C 1MMAA 1V4RA 1OR7A 2E1NA 3G73A 2EIKH 2QEXI 4U0VA 2OCCH 2QF7A 2G7UA 3I59B 1P7IA 2OQGA 2EIJH 5HLGA 1J2XA 3ABUA 2LKXA 2Y75A 1XN7A 2R4GA 2BE5F 2NAZA 2G0EA 1JUMA 2Y0MA 4CCLA 1J9IA 2GQQA 2XVCA 1UELB 1BL0A 4OWRB 4RDUA 3BG9A 2Q0OA 2Y0SA 3ZQHA 4PSWA 5BS6A 2R7RA 5BPIA 3S1NJ 1YIJI 4NBQA 1WRJA 1HBXG 3AG4H 2WAQA 1NG6A 2VPRA 2IGOA 4HW0A 3D0SA 3IHUA 4QWQA 5F0FA 1VQ4I 4A3DJ 4YIIA 1YX3A 3M07A 5IP7J 1ZREA 2ESNA 1HXDA 3CLQA 4BQQA 2FEZA 2CW8A 4X1EA 2YX7A 1AKHA 3O6BB 1P92A 3BR1A 1XGSA 5BPDA 1T0FA 3S1QJ 1XTAA 4XLPF 1WSUA 3HGYA 4CSWA 3H3VK 1P4AA 2VL8A 2CV0A 4A5NA 3I5UA 1PUFA 1BOAA 4IX7A 1EV7A 1TT0A 2EV0A 2EZIA 4XLCA 3HRTA 5F27A 3DTIA 3JSPA 2JJ7A 4XSXF 4BXFA 3IL2A 1NH3A 2VBZA 4AIDA 4IZZA 3JAMK 4I76A 3A0HC 1LEBA 2X85A 4X6AJ 2W82A 2CQ7A 3DBRB 2Q2EB 5EYRA 4U0WA 3SYTA 2EZKA 2UUZA 3VYRB 4FASD 3BZKA 1FMWA 2DK5A 2F4IA 1FNNA 2MLKA 1G3WA 2DFFA 4IVNA 2RQQA 1HW2A 3CDIA 3A01B 2FD5A 2HXOA 2WY8Q 4I02A 5K5RA 5E17F 2ECCA 4IJAA 3BG7A 2DA1A 1X1AA 4IRHA 3ABTA 3CP8A 3VSKA 1BI2A 1OCTC 3N97A 5LEJA 3BTIA 3CMYA 2VBYA 3S14J 1WVRA 4BY1J 3BZ6A 4Y15A 5D4SA 1USSA 5DUIA 1A04A 3I4PA 1IJWC 2XB5A 2MD5A 1WQ2A 1D8KA 3OR1C 1IF1A 2Q1ZB 2ICWG 1IV8A 1W5TA 2VQLA 4OIQF 2GOXB 1CF7B 1GUUA 2NVTJ
chains in the Genus database with same CATH topology
2HOTA 5M5XJ 5K7ZA 1BJZA 5C4XJ 2GBYA 4C3JJ 3HEFA 1CQTA 2JA8J 5M3FJ 1XG1A 1MBFA 1F36A 5FKLA 1ETKA 3QPLA 1POGA 3HB9A 4FISA 3JRCA 4IHXA 4W1UA 3GBGA 2N8GA 1MNMC 2CQQA 2W48A 4B1RA 3LSRA 1R9TJ 3L1PA 1U9OA 4ABZA 1BW5A 2HQ5A 5IYBJ 4XRSA 2H1KA 1ZR2A 3JRGA 2NOGA 2L7ZA 2JK3A 4A3LJ 5EG0B 2HI3A 1VFCA 2E2HJ 4QIWN 2R7ZJ 1SFOJ 2KDZA 3FIWA 2DA7A 5DTDA 3RKQA 2TCTA 2O9LA 1IC8A 1Y1VJ 3GTMJ 5FKKA 4XRSG 2OPTA 4V2GA 2LVSA 5E3NA 2K9SA 2DMPA 3FKIJ 2YUSA 1JKQC 3GTGJ 1NK3P 2FQ4A 4GFBA 1D5YA 3LSGA 3BTLA 3TW6A 1T56A 1APLC 2JWTA 1FTTA 1GDTA 1TWAJ 1XS9A 2ZB9A 1Q1VA 2OF7A 4A93J 1W0TA 3ZOBA 2XRLA 5IYDJ 3BTCA 5FKOA 2X48A 1VF9A 3BR5A 5JLXA 1HOMA 4Y7NJ 2NVYJ 1QVUA 3OSFA 4LOCA 1UHSA 4DZPA 3S2HJ 2CRGA 3BR2A 3HOVJ 4A69C 3GTLJ 3Q3SA 3BR6A 4FCYA 3RZDJ 3CQZJ 1ETYA 3PO3J 3BQYA 3Q0UA 5K7FA 3S1MJ 2NS7A 1BW6A 5GPCA 3S1RJ 2O8KA 1H8AC 2HXIA 4JX5A 2D5VA 3FK7A 3HM5A 1JKOC 1Z0XA 1RKTA 3G1OA 3HGGA 4MFEA 5GP9A 1ZTRA 3JRAA 4C2MJ 1XC5A 1RKWA 1A6IA 3FISA 4BBRJ 5J1RA 1K61A 1RESA 5M3MJ 5GPAA 4A3IJ 5M5YJ 5FLMJ 2X6OA 5BNGA 4DZJA 3RZOJ 1VNDA 5HODA 3LSJA 4B4CA 1ZQ3P 4MLOA 3PM1A 4BBSJ 4XRMA 1JT0A 3WHCA 2QCOA 2ID3A 4JP0A 5EGOB 3UKGA 4A3JJ 3HOUJ 3A03A 2R5YB 1F43A 3QQAA 3M4OJ 5EF6A 4M6VA 1WH5A 1P7JA 2B63J 4D5FA 5C4JJ 2M34A 1B72B 3S16J 4MIMA 2ID6A 1MBHA 3GTQJ 2M0CA 2Y30A 2X9DA 3MVPA 4B3AA 1BA5A 5JLWA 1SANA 3HOWJ 4RBOA 2LFBA 1QVTA 2DA4A 3O8GA 2EQRA 3M3YJ 1LE8B 3A02A 3IH4A 5F08A 1W0UA 1DU0A 1RR7A 2MG4A 3CCYA 3B6AA 4C3HJ 2LTPA 2DA3A 2LD5A 2M2EA 4D5CA 9ANTA 1ZR4A 4NDLA 2R93J 4S0HB 2VUMJ 3G1MA 5J3LA 2XGDA 2AHQA 2L0KA 3H0GJ 2L7MP 4A3GJ 2R92J 1JUSA 2VI6A 2NVQJ 2NVXJ 4BXXJ 3TP3A 3S2DJ 2CUFA 4DYQA 4AC0A 3PO2J 2L9RA 3CDLA 3DEWA 4A3KJ 2XSDC 2M9HA 1TC3C 4XICA 4IHVA 3IH2A 1JT6A 4QSHA 5IP9J 1HDPA 1IV6A 3TW7A 2XGEA 2DA6A 2MSYA 5EDNA 1I50J 1RETA 1MBGA 1ZGWA 4XIDA 1JGGA 4M3EA 1JUPA 3SDGA 4J19A 1WPKA 1OFCX 1IDYA 2LY9A 2DTZA 5EZGA 1JJ8C 1FIPA 1MBKA 4UUTA 1ZKGA 2DA5A 2E2JJ 5FKMA 3LSPA 2MGQA 5EEAA 5EZHA 4V2FA 3LNQA 3Q0VA 3JREA 3Q0WA 1JTXA 1NTCA 2Y2ZA 2R5ZB 2HOAA 2Y31A 4I6ZA 2MW8A 1JJ6C 4AYBN 4M3GA 2NS8A 2EBIA 2IAIA 4A3CJ 3NARA 3D1NI 5EGOA 2H8RA 3JRFA 1RPWA 2R5YA 1X2NA 2XPVA 1FEXA 1GVDA 4IHWA 2CU7A 1TWGJ 3HOZJ 2DMUA 2O7OA 4HNVA 1B72A 2L7FP 3JRHA 2DN0A 4FE7A 4D7MA 3IH3A 3HDDA 1T33A 3SJMA 2GM4A 3S17J 1ZK8A 1HDDC 1EF4A 3E7LA 4M3DA 1ORKA 3BT9A 4D7NA 1UG2A 4A3BJ 3DCFA 2VKVA 4IEJA 2COBA 1IG7A 1UMQA 1IGNA 1B8IB 3I4MJ 1TWFJ 1LE8A 1DU6A 1MH3A 2FJ1A 1NK2P 2DA2A 2K9NA 4L5EA 4BKXA 1ETWA 3MKLA 5F1JA 4AUXA 2HDDA 2ECBA 3HBLA 4G12A 4BY7J 3JRIA 5M5WJ 2E1OA 5F04A 1AKHB 1S7EA 2JN6A 1ETOA 3ZQIA 4EEFG 3MN2A 1A5JA 1PUFB 1IDZA 1FTZA 2WV1A 5IOYA 2CJJA 4IHYA 4JX6A 5J1UA 2XPUA 3ZQFA 3S15J 2XGCA 4A3EJ 3B6CA 3FK6A 1ETVA 2JA7J 1VI0A 1WH7A 1WCMJ 3HKZN 3NAUA 1QPIA 3IV5A 3ZQCA 2JMWA 3F0CA 2K9QA 1QRYA 3VPRA 2I10A 3OIOA 1AU7A 1GV2A 2EZLA 3LOCA 2P81A 4XK4A 5F0CA 2DJNA 4A3MJ 2LR8A 1ETQA 2TRTA 3GTKJ 3WHBA 1Y1WJ 4CYCA 4FE4A 5IPAA 2RAEA 3HOYJ 1OJLA 4UUSB 1ETXA 1U9NA 2CUEA 5E3MA 1MSFC 3K2AA 4C3IJ 3O8HA 2YU9J 1TWCJ 1I6HJ 2CQXA 3TP0A 2R5ZA 2K40A 1JKPC 2E2IJ 2JA5J 1I3QJ 3W6VA 2EZHA 2DMTA 3JR9A 2Y9YA 1HF0A 1IRZA 1FIAA 3TEDA 5E3OA 3BQZA 2ME0A 3HOXJ 5J1YA 4M3FA 4MFDA 5IP6A 2Y9ZA 5FJ8J 2AO9A 1GT0C 2HOSA 1K83J 4MO7A 1O4XA 1E3OC 2LP0A 2QF7A 1P7IA 3JRDA 2ELKA 2M8GX 4CYCB 3BG5A 5E3LA 2IEKA 5FKNA 2XB0X 2LKXA 1TWHJ 1MSEC 2IBDA 3I4NJ 2DMNA 2VKEA 1OCPA 2G0EA 1JUMA 3RQIA 4M3BA 1MBEA 1B8IA 1BL0A 4RDUA 3BG9A 3ZQHA 3C2BA 3K7AJ 4DW6A 2GLOA 3S1NJ 1IUFA 1WI3A 2KT0A 1LFBA 3JRBA 1FJLA 5F0HA 2VPRA 1HCRA 1ENHA 3BG3A 3A01A 2JA6J 5F0FA 4QTRA 1MBJA 4A3DJ 1H88C 1LFUP 5IP7J 5IYCJ 4FTHA 1HLVA 4JYKA 2Y0SN 4X1EA 2LLKA 3GTOJ 1U8BA 4Y52J 3OOUA 1AKHA 1YRNA 5FLVA 1U78A 3BR1A 3S1QJ 2EH3A 2PMZN 3H3VK 3HGYA 2YS9A 2WAQN 1PUFA 2EZIA 5DS9A 5C44J 3OSGA 2ME6A 3SFIA 5F27A 4W97A 2XPWA 1X58A 2JJ7A 1JKRC 2DMQA 3GTJJ 1X2MA 2LK2A 4I76A 1H89C 4X6AJ 5EYRA 2EZKA 3BTJA 3BR3A 2R0QC 3BR0A 3QPSA 1WGXA 2FD5A 3A01B 2HXOA 1ITYA 2ECCA 1JTYA 1MH4A 3ZQGA 3GTPJ 2DA1A 1YRNB 3G1LA 4UUSA 3ZQLA 4DYRA 1OCTC 2FX0A 3BTIA 4A3FJ 4JX4A 5IOZA 5K7HA 3CMYA 3S14J 2E19A 4BY1J 1G2HA 2WB1N 2HYJA 1IJWC 2XB5A 1AHDP 1Z77A 4DYCA 5C3EJ 2NVTJ 1GUUA 1GV5A 5EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOT A;  5M5X J;  5K7Z A;  1BJZ A;  5C4X J;  2GBY A;  4C3J J;  3HEF A;  1CQT A;  2JA8 J;  5M3F J;  1XG1 A;  1MBF A;  1F36 A;  5FKL A;  1ETK A;  3QPL A;  1POG A;  3HB9 A;  4FIS A;  3JRC A;  4IHX A;  4W1U A;  3GBG A;  2N8G A;  1MNM C;  2CQQ A;  2W48 A;  4B1R A;  3LSR A;  1R9T J;  3L1P A;  1U9O A;  4ABZ A;  1BW5 A;  2HQ5 A;  5IYB J;  4XRS A;  2H1K A;  1ZR2 A;  3JRG A;  2NOG A;  2L7Z A;  2JK3 A;  4A3L J;  5EG0 B;  2HI3 A;  1VFC A;  2E2H J;  4QIW N;  2R7Z J;  1SFO J;  2KDZ A;  3FIW A;  2DA7 A;  5DTD A;  3RKQ A;  2TCT A;  2O9L A;  1IC8 A;  1Y1V J;  3GTM J;  5FKK A;  4XRS G;  2OPT A;  4V2G A;  2LVS A;  5E3N A;  2K9S A;  2DMP A;  3FKI J;  2YUS A;  1JKQ C;  3GTG J;  1NK3 P;  2FQ4 A;  4GFB A;  1D5Y A;  3LSG A;  3BTL A;  3TW6 A;  1T56 A;  1APL C;  2JWT A;  1FTT A;  1GDT A;  1TWA J;  1XS9 A;  2ZB9 A;  1Q1V A;  2OF7 A;  4A93 J;  1W0T A;  3ZOB A;  2XRL A;  5IYD J;  3BTC A;  5FKO A;  2X48 A;  1VF9 A;  3BR5 A;  5JLX A;  1HOM A;  4Y7N J;  2NVY J;  1QVU A;  3OSF A;  4LOC A;  1UHS A;  4DZP A;  3S2H J;  2CRG A;  3BR2 A;  3HOV J;  4A69 C;  3GTL J;  3Q3S A;  3BR6 A;  4FCY A;  3RZD J;  3CQZ J;  1ETY A;  3PO3 J;  3BQY A;  3Q0U A;  5K7F A;  3S1M J;  2NS7 A;  1BW6 A;  5GPC A;  3S1R J;  2O8K A;  1H8A C;  2HXI A;  4JX5 A;  2D5V A;  3FK7 A;  3HM5 A;  1JKO C;  1Z0X A;  1RKT A;  3G1O A;  3HGG A;  4MFE A;  5GP9 A;  1ZTR A;  3JRA A;  4C2M J;  1XC5 A;  1RKW A;  1A6I A;  3FIS A;  4BBR J;  5J1R A;  1K61 A;  1RES A;  5M3M J;  5GPA A;  4A3I J;  5M5Y J;  5FLM J;  2X6O A;  5BNG A;  4DZJ A;  3RZO J;  1VND A;  5HOD A;  3LSJ A;  4B4C A;  1ZQ3 P;  4MLO A;  3PM1 A;  4BBS J;  4XRM A;  1JT0 A;  3WHC A;  2QCO A;  2ID3 A;  4JP0 A;  5EGO B;  3UKG A;  4A3J J;  3HOU J;  3A03 A;  2R5Y B;  1F43 A;  3QQA A;  3M4O J;  5EF6 A;  4M6V A;  1WH5 A;  1P7J A;  2B63 J;  4D5F A;  5C4J J;  2M34 A;  1B72 B;  3S16 J;  4MIM A;  2ID6 A;  1MBH A;  3GTQ J;  2M0C A;  2Y30 A;  2X9D A;  3MVP A;  4B3A A;  1BA5 A;  5JLW A;  1SAN A;  3HOW J;  4RBO A;  2LFB A;  1QVT A;  2DA4 A;  3O8G A;  2EQR A;  3M3Y J;  1LE8 B;  3A02 A;  3IH4 A;  5F08 A;  1W0U A;  1DU0 A;  1RR7 A;  2MG4 A;  3CCY A;  3B6A A;  4C3H J;  2LTP A;  2DA3 A;  2LD5 A;  2M2E A;  4D5C A;  9ANT A;  1ZR4 A;  4NDL A;  2R93 J;  4S0H B;  2VUM J;  3G1M A;  5J3L A;  2XGD A;  2AHQ A;  2L0K A;  3H0G J;  2L7M P;  4A3G J;  2R92 J;  1JUS A;  2VI6 A;  2NVQ J;  2NVX J;  4BXX J;  3TP3 A;  3S2D J;  2CUF A;  4DYQ A;  4AC0 A;  3PO2 J;  2L9R A;  3CDL A;  3DEW A;  4A3K J;  2XSD C;  2M9H A;  1TC3 C;  4XIC A;  4IHV A;  3IH2 A;  1JT6 A;  4QSH A;  5IP9 J;  1HDP A;  1IV6 A;  3TW7 A;  2XGE A;  2DA6 A;  2MSY A;  5EDN A;  1I50 J;  1RET A;  1MBG A;  1ZGW A;  4XID A;  1JGG A;  4M3E A;  1JUP A;  3SDG A;  4J19 A;  1WPK A;  1OFC X;  1IDY A;  2LY9 A;  2DTZ A;  5EZG A;  1JJ8 C;  1FIP A;  1MBK A;  4UUT A;  1ZKG A;  2DA5 A;  2E2J J;  5FKM A;  3LSP A;  2MGQ A;  5EEA A;  5EZH A;  4V2F A;  3LNQ A;  3Q0V A;  3JRE A;  3Q0W A;  1JTX A;  1NTC A;  2Y2Z A;  2R5Z B;  2HOA A;  2Y31 A;  4I6Z A;  2MW8 A;  1JJ6 C;  4AYB N;  4M3G A;  2NS8 A;  2EBI A;  2IAI A;  4A3C J;  3NAR A;  3D1N I;  5EGO A;  2H8R A;  3JRF A;  1RPW A;  2R5Y A;  1X2N A;  2XPV A;  1FEX A;  1GVD A;  4IHW A;  2CU7 A;  1TWG J;  3HOZ J;  2DMU A;  2O7O A;  4HNV A;  1B72 A;  2L7F P;  3JRH A;  2DN0 A;  4FE7 A;  4D7M A;  3IH3 A;  3HDD A;  1T33 A;  3SJM A;  2GM4 A;  3S17 J;  1ZK8 A;  1HDD C;  1EF4 A;  3E7L A;  4M3D A;  1ORK A;  3BT9 A;  4D7N A;  1UG2 A;  4A3B J;  3DCF A;  2VKV A;  4IEJ A;  2COB A;  1IG7 A;  1UMQ A;  1IGN A;  1B8I B;  3I4M J;  1TWF J;  1LE8 A;  1DU6 A;  1MH3 A;  2FJ1 A;  1NK2 P;  2DA2 A;  2K9N A;  4L5E A;  4BKX A;  1ETW A;  3MKL A;  5F1J A;  4AUX A;  2HDD A;  2ECB A;  3HBL A;  4G12 A;  4BY7 J;  3JRI A;  5M5W J;  2E1O A;  5F04 A;  1AKH B;  1S7E A;  2JN6 A;  1ETO A;  3ZQI A;  4EEF G;  3MN2 A;  1A5J A;  1PUF B;  1IDZ A;  1FTZ A;  2WV1 A;  5IOY A;  2CJJ A;  4IHY A;  4JX6 A;  5J1U A;  2XPU A;  3ZQF A;  3S15 J;  2XGC A;  4A3E J;  3B6C A;  3FK6 A;  1ETV A;  2JA7 J;  1VI0 A;  1WH7 A;  1WCM J;  3HKZ N;  3NAU A;  1QPI A;  3IV5 A;  3ZQC A;  2JMW A;  3F0C A;  2K9Q A;  1QRY A;  3VPR A;  2I10 A;  3OIO A;  1AU7 A;  1GV2 A;  2EZL A;  3LOC A;  2P81 A;  4XK4 A;  5F0C A;  2DJN A;  4A3M J;  2LR8 A;  1ETQ A;  2TRT A;  3GTK J;  3WHB A;  1Y1W J;  4CYC A;  4FE4 A;  5IPA A;  2RAE A;  3HOY J;  1OJL A;  4UUS B;  1ETX A;  1U9N A;  2CUE A;  5E3M A;  1MSF C;  3K2A A;  4C3I J;  3O8H A;  2YU9 J;  1TWC J;  1I6H J;  2CQX A;  3TP0 A;  2R5Z A;  2K40 A;  1JKP C;  2E2I J;  2JA5 J;  1I3Q J;  3W6V A;  2EZH A;  2DMT A;  3JR9 A;  2Y9Y A;  1HF0 A;  1IRZ A;  1FIA A;  3TED A;  5E3O A;  3BQZ A;  2ME0 A;  3HOX J;  5J1Y A;  4M3F A;  4MFD A;  5IP6 A;  2Y9Z A;  5FJ8 J;  2AO9 A;  1GT0 C;  2HOS A;  1K83 J;  4MO7 A;  1O4X A;  1E3O C;  2LP0 A;  2QF7 A;  1P7I A;  3JRD A;  2ELK A;  2M8G X;  4CYC B;  3BG5 A;  5E3L A;  2IEK A;  5FKN A;  2XB0 X;  2LKX A;  1TWH J;  1MSE C;  2IBD A;  3I4N J;  2DMN A;  2VKE A;  1OCP A;  2G0E A;  1JUM A;  3RQI A;  4M3B A;  1MBE A;  1B8I A;  1BL0 A;  4RDU A;  3BG9 A;  3ZQH A;  3C2B A;  3K7A J;  4DW6 A;  2GLO A;  3S1N J;  1IUF A;  1WI3 A;  2KT0 A;  1LFB A;  3JRB A;  1FJL A;  5F0H A;  2VPR A;  1HCR A;  1ENH A;  3BG3 A;  3A01 A;  2JA6 J;  5F0F A;  4QTR A;  1MBJ A;  4A3D J;  1H88 C;  1LFU P;  5IP7 J;  5IYC J;  4FTH A;  1HLV A;  4JYK A;  2Y0S N;  4X1E A;  2LLK A;  3GTO J;  1U8B A;  4Y52 J;  3OOU A;  1AKH A;  1YRN A;  5FLV A;  1U78 A;  3BR1 A;  3S1Q J;  2EH3 A;  2PMZ N;  3H3V K;  3HGY A;  2YS9 A;  2WAQ N;  1PUF A;  2EZI A;  5DS9 A;  5C44 J;  3OSG A;  2ME6 A;  3SFI A;  5F27 A;  4W97 A;  2XPW A;  1X58 A;  2JJ7 A;  1JKR C;  2DMQ A;  3GTJ J;  1X2M A;  2LK2 A;  4I76 A;  1H89 C;  4X6A J;  5EYR A;  2EZK A;  3BTJ A;  3BR3 A;  2R0Q C;  3BR0 A;  3QPS A;  1WGX A;  2FD5 A;  3A01 B;  2HXO A;  1ITY A;  2ECC A;  1JTY A;  1MH4 A;  3ZQG A;  3GTP J;  2DA1 A;  1YRN B;  3G1L A;  4UUS A;  3ZQL A;  4DYR A;  1OCT C;  2FX0 A;  3BTI A;  4A3F J;  4JX4 A;  5IOZ A;  5K7H A;  3CMY A;  3S14 J;  2E19 A;  4BY1 J;  1G2H A;  2WB1 N;  2HYJ A;  1IJW C;  2XB5 A;  1AHD P;  1Z77 A;  4DYC A;  5C3E J;  2NVT J;  1GUU A;  1GV5 A;  5EG0 A; 
#chains in the Genus database with same CATH topology
 2R7W A;  4M73 A;  5B3S H;  5C4X J;  4UHT A;  1VQ8 I;  2Y48 A;  3IC7 A;  4C30 A;  3WTU C;  5HDK A;  2JA8 J;  1QHH D;  5D8L B;  2Z1D A;  3SDB A;  3PQK A;  4IXA A;  4BUP A;  3S3O A;  1G3Y A;  3I59 A;  4ZC3 A;  3K2Z A;  1VQ7 I;  4R1H A;  1WFX A;  3FBN B;  4B8X A;  1XSX A;  3QYE A;  2V9K A;  2WTE A;  5KVR A;  2K27 A;  3V7R A;  2I8D A;  2N8G A;  2OA4 A;  2VKD A;  1DPU A;  2CQQ A;  2W57 A;  3E97 A;  1V5E A;  1UFM A;  1DP7 P;  3GFL A;  4B1R A;  3T8R A;  3IP4 B;  1HKT A;  2KDO A;  2QBY B;  1J5Y A;  1BW5 A;  2L9V A;  3LA7 A;  4XRS A;  3CCU I;  2NOG A;  2L7Z A;  4QPO A;  1HST A;  1KQ9 A;  2BHY A;  5K5Q A;  1N77 A;  3IRR A;  3ESW B;  3KLN A;  5K1Y A;  5HNF A;  3GCM A;  3CF5 F;  4M6Y A;  2A6T A;  1OKR A;  4QIW N;  2K5C A;  3W3C A;  3AFH A;  4WCG A;  1KU9 A;  1R1T A;  4ZYG A;  1MD0 A;  1O3T A;  4RGX A;  3QWL A;  4Q4Z F;  4AVZ A;  3K1M A;  4CZZ A;  1DPR A;  3RKQ A;  4H0E A;  1KU2 A;  3FM3 A;  3RPU A;  3RYP A;  4IQ4 A;  1JKQ C;  1O3S A;  3LSG A;  3RYR A;  4OIP F;  2Q2E A;  1WHU A;  1UJ8 A;  1UB9 A;  3DBH B;  4N9H A;  5E18 F;  2HDC A;  4XKV A;  1OIS A;  3FMS A;  2GA2 A;  4RS8 A;  1IN8 A;  2ZBK A;  2X48 A;  2KQR A;  2ZNZ A;  2ZJ2 A;  1VF9 A;  3E5Q A;  5JLX A;  1ZRF A;  1HOM A;  3HZJ A;  4E7H A;  3H9J A;  2A6E F;  2GIZ A;  4EQQ A;  2E71 A;  3OOP A;  4LOC A;  1UHS A;  4DZP A;  4IQJ A;  4Y17 A;  4FX0 A;  1FOY A;  2CRG A;  4E6K G;  1R23 A;  3CQZ J;  2JSP A;  4KFC A;  3V8K A;  4F92 B;  5LBQ A;  1MW7 A;  3JCU C;  2NS7 A;  1CF7 A;  2WBM A;  3K4J A;  2H8W A;  1KA8 A;  4ZDL A;  1E2X A;  2KFD A;  5L3C A;  3ZCO A;  1YE9 A;  4ENN A;  4II2 A;  3SHF A;  4JX5 A;  2XSJ C;  3CUQ C;  4CZC A;  4HDV A;  2L9S A;  5FLX K;  3V42 A;  4DIQ A;  2HEO A;  1ZTR A;  1WJA A;  2EK5 A;  4XKW A;  4XLE A;  4TV7 A;  1DQU A;  2VOD A;  3OYF A;  4F3Q A;  5HLT A;  3GF2 A;  3ERM A;  2YR2 A;  2CS3 A;  2ESH A;  4BBR J;  1K61 A;  1LVA A;  1TT5 B;  4P96 A;  5D6F A;  1FZP B;  2BW3 A;  4HOB A;  5M3M J;  2GWR A;  5FLM J;  4BJ6 C;  2X6O A;  4RB1 A;  3AKZ A;  3FXO A;  4DZJ A;  2DO7 A;  2QA4 I;  1REP C;  2QBY A;  1MMS A;  2DBB A;  2W24 A;  3WHC A;  2QCO A;  1JHF A;  2ID3 A;  3TO6 A;  2VBW A;  2R5Y B;  4HBL A;  4DBR A;  1Y6I A;  3WTV C;  4D5F A;  2P5K A;  4LG0 B;  3ZR8 X;  4I99 C;  2HR3 A;  2A6H F;  3M9A A;  1HA8 A;  3ZMD A;  5L3F A;  4GYG A;  4AM3 A;  1P4X A;  4WXC A;  3BCA A;  1BA5 A;  3H0D A;  4G9Y A;  2F5E A;  4OMZ A;  4PGG A;  4G6D A;  3F21 A;  3LWF A;  3CDH A;  3D5S C;  5E8G A;  2JQ7 A;  1LE8 B;  3A02 A;  3OY9 A;  2EIN H;  3W6J B;  1RR7 A;  3B6A A;  3ZPL A;  2HKX A;  1EA3 A;  3OYH A;  1G3T A;  1J7K A;  2WAE A;  2CQN A;  1RR8 C;  1E0E A;  3OYI A;  1O57 A;  2ZXI A;  4A0Y A;  1TP4 A;  1V54 H;  3H0G J;  2L7M P;  3J81 K;  4X0G A;  4EJV A;  3AG2 H;  3NWT A;  2QQA A;  1OR7 C;  2NVX J;  2NVQ J;  3QYB A;  4BXX J;  1HC8 A;  3BPX A;  2QWW A;  2VBX A;  3S2D J;  3CLO A;  1GVJ A;  5J6X A;  2R7T A;  2FNA A;  3OYA A;  3CO6 C;  4P9F A;  3TOB A;  2AQF A;  3ZP5 A;  1ZG1 A;  3F9K A;  4BQA A;  4BH9 A;  1R5I D;  2M9H A;  1TC3 C;  4NQW A;  2NVU B;  4HX7 A;  4IHV A;  4CCK A;  3CO7 C;  1L3L A;  2LMD A;  5IP9 J;  1HDP A;  1Y0U A;  5FRM A;  2XGE A;  4HV5 A;  5EDN A;  3LST A;  1A6Q A;  1XDU A;  4BL0 B;  4ENM A;  5AON A;  2IS2 A;  1MKM A;  4LB6 B;  6PAX A;  4BE0 A;  2OUM A;  1UG0 A;  4ZYD A;  5BMZ A;  4AYB A;  1PVE A;  4U7B A;  3TKY A;  2RGV A;  5EZG A;  2VXZ A;  1MBK A;  1YJ9 I;  4QLC U;  1ZKG A;  2DA5 A;  2OAZ A;  5FKM A;  4BYY A;  2E2J J;  3I0T A;  1R7J A;  5EZH A;  2L01 A;  1R00 A;  1T0F C;  3QP6 A;  4BEH A;  2R5Z B;  2Y2Z A;  1OPC A;  3PQJ A;  1I1S A;  4I6Z A;  4XM3 A;  2VOO A;  3CJR B;  3KE2 A;  2NS8 A;  3ZMZ A;  5D5U B;  3DWL E;  2ZJQ F;  2H09 A;  3NAR A;  3E1S A;  3SEQ A;  3D1N I;  2PEX A;  2FRH A;  2H8R A;  3JRF A;  2R5Y A;  4P9U A;  2W1O A;  1GVD A;  2ZCW A;  1R1U A;  4KYW A;  3KCC A;  1BN5 A;  4WX9 A;  1BC7 C;  3JRH A;  2DT7 B;  2VJJ A;  4Y3O A;  2R7D A;  5DV5 A;  1T33 A;  1QGP A;  2AXT C;  4E7L A;  3FXM A;  3VB2 A;  5ILU A;  2Z99 A;  1ZK8 A;  4HV6 A;  1ORK A;  4XLH A;  3CF2 A;  4D7N A;  1Y39 A;  3DCF A;  1BR2 A;  4IEJ A;  2COB A;  2O6G E;  5ED4 A;  5KAI C;  2HPM A;  2QKL B;  1LE8 A;  1DU6 A;  3P5J A;  3C18 A;  3OYG A;  4NNJ A;  5F1J A;  4WK8 F;  5H2F C;  3EET A;  4EM2 A;  4KIF A;  1KZH A;  3FWE A;  1W7P B;  2PX9 A;  4RAY A;  1O3R A;  3A1Y A;  4A5M A;  3AL0 B;  1SD4 A;  2XAJ A;  1ETO A;  2GOM A;  1LPQ A;  1S3J A;  4IOA F;  4DJA A;  5J8F A;  4LGW A;  2JUC A;  3G6E I;  4KIB A;  3RTR A;  5L3D A;  4HNT A;  3MKY B;  2F5F A;  2IT0 A;  2XPU A;  1T2K A;  4ZTJ A;  4A3E J;  3MWM A;  3MAJ A;  2EIL H;  2VN2 A;  2JA7 J;  4CA0 A;  1WH7 A;  3HSR A;  2R3S A;  3CJN A;  5AIP A;  3TO9 A;  2RKH A;  3F0C A;  1XGN A;  2HGC A;  4CH7 A;  1AU7 A;  1SD5 A;  1SVL A;  2EZL A;  1ZAO A;  3WTZ A;  3J7Y J;  5JHF A;  2EFP A;  3V8L A;  2STW A;  4U88 A;  1DGR M;  2LR8 A;  3LL7 A;  1ETQ A;  2TRT A;  2FOW A;  3DV8 A;  1UAA A;  3GTK J;  2JRT A;  2GXB A;  1SD6 A;  4FE4 A;  5IPA A;  1IXC A;  1OJL A;  3PNY A;  1XCV A;  3H5N A;  1U9N A;  2CUE A;  3SZP A;  5E3M A;  1U8R A;  2M3A A;  1Z9C A;  3O8H A;  4OAY A;  2R5Z A;  4JBA A;  2VAS A;  2JA5 J;  3B73 A;  3GLX A;  4ITV A;  3PIO F;  1HF0 A;  3E3V A;  1IRZ A;  3QYF A;  3TED A;  3HIF A;  4DGW B;  4HF0 A;  5J1Y A;  2XDV A;  4MFD A;  4L18 B;  4B48 A;  1U6G A;  4XMY A;  4LLL A;  1RIO H;  1KYW A;  4RGS A;  1GT0 C;  2DQL A;  4MO7 A;  1O4X A;  1ACI A;  3U1K A;  3ULQ B;  3C1D A;  2BHZ A;  5LGT A;  2M4G A;  2LP0 A;  1K7A A;  1U5T A;  1OLT A;  2QSG X;  4CYC B;  1Z21 A;  3K1P A;  2IS6 A;  2IEK A;  2XB0 X;  2KIU A;  4E7J A;  1MSE C;  1M1E B;  2WY7 Q;  3RPQ A;  3I4N J;  2DMN A;  3EQL F;  2F6C A;  3HSE A;  3LA3 A;  4OMY A;  2FQ3 A;  3BCB A;  2GAU A;  1QNT A;  4A6D A;  1OCR H;  3I71 A;  3SXY A;  2MD0 A;  3CCV I;  4HF2 A;  1D1B A;  2XF7 A;  2DFH A;  3ZN1 A;  2PG4 A;  2F4O B;  1RUN A;  1WI3 A;  2KT0 A;  4E4H A;  3JRB A;  3VYS B;  2RVC A;  2WC2 A;  3ISP A;  3K70 C;  3I53 A;  4M9Z A;  5DD4 A;  2E5N A;  3G2B A;  4QTR A;  2GA1 A;  1H88 C;  5IYC J;  4FTH A;  2VQG A;  1MJA A;  3GTO J;  1U8B A;  2RN7 A;  1YRN A;  5FLV A;  4F52 A;  5HLH A;  2PMZ N;  3C3W A;  3ELK A;  5FGM A;  3H3Z A;  1ZRC A;  2OZU A;  1QU3 A;  2M8E A;  5DS9 A;  3OSG A;  5F64 A;  2KIS A;  3JTH A;  4W97 A;  2W25 A;  1X58 A;  5LGU A;  3FHN A;  3M8J A;  4M72 A;  2LK2 A;  4RB2 C;  3LAJ A;  1P6R A;  1H89 C;  2D1H A;  2QKM B;  3I64 A;  4HST A;  3CUO A;  1TW2 A;  4GGG A;  4XSZ F;  2AQE A;  4IHT A;  5H6R A;  4FX4 A;  2HYG D;  3BR0 A;  1LDD A;  4Z6Y A;  1WGX A;  2WB1 A;  3OS2 A;  2CWE A;  2P7C B;  1MH4 A;  3GTP J;  3L09 A;  1G6N A;  2V9V A;  2BZT A;  1RI7 A;  4DYR A;  3L2R A;  2OTL I;  2K3P A;  4A3F J;  2E19 A;  3DPU A;  1KGS A;  2IPQ X;  2HYJ A;  3G71 I;  5CYV A;  2JRM A;  4BE1 A;  1VZ0 A;  3HPH A;  2M87 A;  2E5Z A;  2KLO A;  2EFO A;  4DYC A;  5C3E J;  5JVG F;  3LAP A;  5E3O A;  1FTT A;  1BR4 A;  2HOT A;  3VOD A;  5J8C A;  3CC4 I;  1NHA A;  5K7Z A;  4WXD A;  1XDS A;  4HQE A;  3BRO A;  4L9V A;  1YW7 A;  2OC6 A;  4G7Z F;  3DLA A;  1R5G A;  1G4D A;  4A12 A;  1XG1 A;  2BEO A;  3P9K A;  1ETK A;  3BPV A;  1SFU A;  1POG A;  4J01 A;  3HB9 A;  4FIS A;  1I1G A;  1R22 A;  2VQH A;  1LEA A;  4W1U A;  3GBG A;  4A6E A;  1ZHF A;  3DF8 A;  3KZI C;  3ABK H;  2DW4 A;  3KP2 A;  4Q47 A;  1X3Z B;  5E8I A;  1Z91 A;  1FBU A;  1OCZ H;  3M8E A;  3LSR A;  5B1A H;  2EB7 A;  2OV7 A;  1O7L A;  4ABZ A;  5D4R A;  1K78 B;  5IYB J;  2TDX A;  1ZR2 A;  4L9T A;  3JRG A;  2VOP A;  2XAS A;  1K4S A;  5F1R A;  2ADU A;  1HQC A;  1X1C A;  3EDP A;  3HXL A;  3ZRG A;  2E2H J;  4UXN A;  2O8X A;  2W7N A;  1O3Q A;  1SFO J;  1I27 A;  5IY5 H;  3FIW A;  2DA7 A;  1ZYR F;  4R79 A;  1BI1 A;  1TQP A;  1TQM A;  4OU0 A;  1IC8 A;  1ZLJ A;  5KNL A;  5FKK A;  5AIQ A;  4V2G A;  3L9F A;  2LVS A;  1EH7 A;  4CCM A;  2ACJ A;  2K9S A;  5D5W B;  5E1Z B;  4LIU A;  2EV5 A;  4CDG A;  2VLA A;  1IRF A;  5CJ9 A;  2CV2 A;  2P6T A;  1T56 A;  2P4W A;  3VFZ A;  1QA6 A;  2A5W A;  2L54 A;  1GDT A;  1TQI A;  3T5X A;  2ZB9 A;  3KZZ A;  1Q1V A;  2FBK A;  2LSO A;  2QGU A;  4YIF A;  5IT9 Z;  1W0T A;  3ZOB A;  4AIJ A;  2XRL A;  2QEN A;  3KX2 A;  4AWX B;  1JE8 A;  2NXN B;  2J5P A;  5TIS C;  5IYD J;  3BR5 A;  2DFE A;  4Y7N J;  3HRU A;  1S7A A;  3HHG A;  3OSF A;  1I5Z A;  3BLY A;  5CQE A;  3RDI A;  2VQC A;  4MTE A;  3BR2 A;  3IWF A;  5HVQ C;  3CES A;  1QHG A;  2LF8 A;  3E6C C;  1YS7 A;  2XAF A;  3I3L A;  2L2O A;  2KZV A;  1ON2 A;  5ICE A;  3LQR A;  2KRC A;  3UNG C;  4GRI A;  3AAF A;  1ETY A;  1KYZ A;  2BGC A;  1YG2 A;  2RDP A;  3S1M J;  2BXY A;  5DCF A;  1BW6 A;  1OYY A;  3SFZ A;  3LSI A;  2PLY A;  4BQN A;  4MGR A;  4D9J A;  4D0P A;  4PGH A;  1H8A C;  1F1Z A;  5CVR A;  3W2W A;  1V5F A;  1J0R A;  5LGN A;  2D5V A;  4BU2 A;  5FRO A;  2FU4 A;  4KT6 A;  2MLG A;  4MFE A;  2DYS H;  3ZQQ A;  3I54 A;  3ZXS A;  3FHZ A;  1Z6R A;  2F5D A;  4ZTF A;  3J7A Y;  1SVM A;  4BDY A;  2IA0 A;  1RKW A;  3CCS I;  1D8J A;  3K1N A;  3FF5 A;  2HVQ A;  5GPA A;  3KP7 A;  1Z3X A;  2WAF A;  1UHM A;  3HOS A;  1DGW Y;  1K78 A;  1VND A;  4ENK A;  2JPB A;  4KUM A;  2M30 A;  3LSJ A;  1ZQ3 P;  4G6Q A;  3PM1 A;  4JK1 X;  4ZDP A;  2NS0 A;  4EVI A;  2MA3 A;  3RJP A;  1F43 A;  2EPF A;  1YYV A;  3M4O J;  2AXL A;  1JXS A;  1WH5 A;  1XGO A;  2OQR A;  1FP2 A;  1I39 A;  2H6C A;  3U2R A;  2YX4 A;  3CCQ I;  2QSF X;  2V7F A;  2RC4 A;  4MIM A;  3ROU A;  4E7Z A;  4MHG A;  1IN5 A;  3DPT A;  3GTQ J;  2M0C A;  2Y30 A;  3M7G A;  1Y0N A;  3TO7 A;  4B3A A;  3EUA A;  5JLW A;  2DOD A;  1SAN A;  3KP5 A;  1YIO A;  1FLI A;  2DJI A;  2VON A;  4LFU A;  2VC0 A;  2LFB A;  1YW8 A;  2P6S A;  4LLN A;  1LJ9 A;  2QQ8 A;  4A2U A;  3QOE A;  3OV8 A;  5JFR A;  1T98 A;  2EQR A;  2LY2 A;  3DKW A;  2YU3 A;  2BW3 B;  3IH4 A;  3K4M A;  1DU0 A;  2FBI A;  4C3H J;  2JSC A;  2LTP A;  4L5J A;  2DA3 A;  2ZSI B;  2M2E A;  3H9G A;  5TRD A;  1ZR4 A;  4IL6 C;  3NQO A;  4NDL A;  2IVM A;  3WE3 A;  2R93 J;  3F8B A;  4S0H B;  2VUM J;  2BY0 A;  2XGD A;  2CFX A;  2CQK A;  3GFI A;  3Q9S A;  2KIQ A;  5D5X B;  4ZYA A;  1JUS A;  2LYC A;  2VI6 A;  1S5L C;  3QOD A;  3TP3 A;  3FZV A;  2PMH A;  2EFN A;  1FY7 A;  4EJU A;  1U5T C;  2CUF A;  5JI6 A;  5DCM A;  5A2Q Z;  2L9R A;  1BM9 A;  3DEW A;  2KJB A;  2M0M A;  3FXL A;  1N78 A;  3GW2 A;  2HS5 A;  3CD6 I;  4Y4R A;  1SFE A;  3EYI A;  4I09 A;  4G8X A;  3CTA A;  1QPM A;  3CZ6 A;  4XIC A;  1JT6 A;  1LUJ B;  4E7S A;  2B9S A;  4QSH A;  5CVI A;  5FD5 A;  2A3S A;  1IV6 A;  2DA6 A;  2MSY A;  3C2H A;  3BY6 A;  2MFZ A;  1MBG A;  2HYF A;  2K02 A;  4M3E A;  1Q1H A;  2ZXJ A;  1SAU A;  4KN7 X;  1N25 A;  1UHW A;  1IDY A;  2BY2 A;  3KLO A;  1FIP A;  4XLF A;  2K9M A;  2UZK A;  2UXN A;  2LY1 A;  2BV6 A;  4YIR X;  3LNQ A;  3WTT C;  2MBF A;  3AL0 C;  1G3S A;  4NC8 A;  1Y56 A;  3M1E A;  1OCC H;  2P5L C;  5ILV A;  2M1B A;  2FBH A;  1MNE A;  1MIJ A;  5LLQ A;  2W4S A;  2EBI A;  3E6B A;  5CVU A;  2IAI A;  2E35 A;  4A3C J;  1X1B A;  1MGT A;  2XPV A;  4NQW B;  2DI3 A;  2IP2 A;  4RAF A;  3RCO A;  1E17 A;  4IHW A;  2X4H A;  2V1U A;  2DMU A;  2O7O A;  1F5T A;  1FSE A;  2ZC2 A;  4QPQ A;  1TTY A;  1V55 H;  2DN0 A;  3MMY B;  1W36 C;  1AA7 A;  2CH0 A;  4D7M A;  1YI2 I;  3GXO A;  3HDD A;  4XBF A;  3F8F A;  2CYY A;  1BI0 A;  1HW5 A;  5TGT A;  4YEL A;  3NEU A;  2O03 A;  3AG3 H;  3BT9 A;  1T38 A;  2MH9 A;  4XRF A;  3CMA I;  2D2W A;  2QSH X;  2VKV A;  1B8I B;  1DUX C;  2K4J A;  3MCZ A;  4BEH B;  3J80 Z;  2DA2 A;  2K9N A;  3CP2 A;  3WGI A;  1NK2 P;  1UZC A;  4KA4 A;  1UST A;  1R71 A;  4GYI A;  1SC7 A;  5GAD J;  3DKY A;  4Y33 A;  4C9Y A;  2P7V B;  2RV8 A;  1BR1 A;  4M71 A;  4F7Z A;  2DOF A;  2E1M C;  1BIA A;  2UWM A;  3GZ5 A;  2DOA A;  4G12 A;  2VJ5 A;  3IWZ A;  3GUD A;  2F48 A;  2DQR A;  1STZ A;  3GX4 X;  1S7E A;  4F93 B;  4XN0 A;  2F2E A;  2WA0 A;  4EEF G;  2P8T A;  1QZZ A;  1IDZ A;  4BHP A;  3PNV A;  2LBF B;  4KDP A;  2WV1 A;  2ZME B;  3KZY A;  3OS1 A;  4XR6 A;  3DTK A;  1Y8R B;  4GCV A;  4IHY A;  4JX6 A;  2RNG A;  1LDK B;  3GME A;  3QOP A;  5J1U A;  3LFU A;  2HVR A;  2Q8K A;  4PJN A;  3JSO A;  1SAX A;  3FKJ A;  2HKO A;  5LHG A;  2VE8 A;  1VI0 A;  3HKZ N;  3NAU A;  4U87 A;  2KPM A;  1ONV A;  3KEQ A;  2K9Q A;  4PUS A;  2I10 A;  3HUG B;  3VDX A;  2ISZ A;  4B09 A;  2XAQ A;  2HTJ A;  1LFP A;  2VJI A;  4RAG A;  4IOC F;  2E7W A;  1ZG3 A;  2ZFW A;  5DM6 F;  1Y1W J;  4UV8 A;  2LG4 A;  3RKY A;  4RB3 C;  5BOX A;  2PFB A;  2Y69 H;  3HSF A;  2V9P A;  2YU9 J;  3ASO H;  4KIG A;  5E79 C;  1Z05 A;  5H6Q A;  1VQ9 I;  5LRR A;  2A68 F;  3TP0 A;  2LDU A;  2K40 A;  3F8C A;  4IF4 A;  4XLN F;  1I3Q J;  5H20 A;  2Y9Y A;  4EM0 B;  1TW3 A;  5F6F A;  3P9C A;  4M3F A;  1S9H A;  2RNJ A;  4BE2 A;  2PJR B;  1R4N B;  2AO9 A;  1MJ9 A;  1B9M A;  1K83 J;  5HDN A;  4XON A;  3F72 A;  1Z7U A;  2UXX A;  1E3O C;  5FRN A;  4IRI A;  5HS8 A;  2XF6 A;  3SZT A;  3ZMT A;  3JRD A;  1YJN I;  4HA8 A;  4ZDO A;  1ZG5 A;  1VQ6 I;  2BOL A;  5ILS A;  5FKN A;  1MDM B;  1TWH J;  2IBD A;  2VXD A;  2V1X A;  2FA5 A;  4OIN F;  1OCP A;  3WG9 A;  3KEO A;  3M1C A;  3RQI A;  2A61 A;  1B8I A;  3FDY A;  5LFA A;  1IN6 A;  1XCB A;  4F91 B;  3COA C;  1PUE E;  3C2B A;  3K7A J;  4DW6 A;  2GLO A;  2X0L A;  2KKO A;  1LFB A;  4GO1 A;  5FO5 A;  2CG4 A;  1R58 A;  1FJL A;  1MMN A;  4D1Q A;  4GDF A;  1OQY A;  2ZXH A;  3ECH A;  4XN3 A;  5F0H A;  3B02 A;  2V26 A;  1HCR A;  1XMA A;  3C7J A;  1W7P D;  3K4N A;  3T1B A;  3E6D A;  3CJT B;  2M7B A;  4JYK A;  2Y0S N;  1A36 A;  2ETH A;  2LLK A;  2EA4 A;  2XUB A;  1FOK A;  4Y52 J;  4I0B A;  3H3U A;  1U78 A;  3L2V A;  2EH3 A;  1WJB A;  3OL3 A;  2XF5 A;  2WAQ N;  4V19 K;  1U5T B;  2L3D A;  2LBF A;  2ZME A;  4UUV A;  3ABM H;  1OYW A;  3R60 A;  4BNC A;  1J09 A;  2XPW A;  2JVG A;  4BJT A;  5JVT A;  5E1W A;  3GTJ J;  2L7K A;  5IT9 K;  2CW7 A;  2L02 A;  3QP5 A;  1S8N A;  2CO5 A;  3GZ6 A;  2HVS A;  1D5V A;  4WF2 A;  2B7E A;  3HUG A;  4DQ2 A;  3BR3 A;  1IXR C;  4AIH A;  1K79 A;  2H6B A;  3K4C A;  3A2K A;  3DEU A;  4PZJ A;  1FOX A;  3QPS A;  2PQ8 A;  3GEZ A;  1SEU A;  1SMY F;  5D5V B;  2VKH A;  1X1D A;  2RQP A;  1T8I A;  1F4K A;  1A35 A;  2HWV A;  1YRN B;  1XSV A;  3ASN H;  1T08 B;  2VJ4 A;  4ZZD A;  5IOZ A;  5K7H A;  4BAY A;  5JHU A;  1G2H A;  3P9I A;  2O5R A;  3BJA A;  2HDW A;  2M4K A;  2VT2 A;  4KN4 X;  1T39 A;  4BGD A;  2KP6 A;  5EG0 A;  2DFI A;  1Z3Y A;  2PJR A;  2Z5U A;  5M5X J;  1BJZ A;  2DT6 A;  2GBY A;  3E0J B;  3E5X A;  3HEF A;  1CQT A;  3IAS 2;  3H5R A;  5M3F J;  4RB0 A;  5FKL A;  4CO8 A;  2A5Y B;  2X51 A;  2BYV E;  4IRG A;  3QPL A;  1GXQ A;  4BS9 A;  1MDM A;  3PNT A;  3A4C A;  2DT5 A;  3RSN A;  2H94 A;  1D0X A;  4LD5 A;  4PCQ A;  4K2E A;  3VSL A;  4YRV A;  3OWT A;  3PSF A;  3L1P A;  1U9O A;  4LG3 A;  1D0Y A;  3OYD A;  2R7X A;  2HQ5 A;  2E1M B;  3L2C A;  2V1N A;  3TGN A;  2M5W A;  4CCN A;  2JK3 A;  2STT A;  2ELH A;  1S72 I;  2XRO A;  4A3L J;  2UV1 A;  3AG1 H;  5IT3 A;  5HNH A;  3WU2 C;  4Z2Y A;  2R7Z J;  2M7A A;  3CCE I;  2W85 A;  2KDZ A;  1YTY A;  3HG9 A;  4LJZ F;  1YX5 A;  3LFK A;  3D5L A;  4KMF A;  2TCT A;  2O9L A;  1W5C C;  4Q48 A;  2GXA A;  1Y1V J;  1E3H A;  4XRS G;  1BBY A;  1ZGJ A;  2HPI A;  2OZ6 A;  3Q5F A;  1FYM A;  2PJP A;  2OTJ I;  4WWC A;  2E1C A;  1JGS A;  3FKI J;  4EGY A;  3GTG J;  2FQ4 A;  4GFB A;  4S05 A;  3BTL A;  2EA2 A;  1APL C;  5J4V A;  2WAD A;  1XS9 A;  4A93 J;  1X3U A;  3QPH A;  2NNY A;  1PP7 U;  1B1B A;  3G4S I;  1KQ8 A;  1PJR A;  1WJE A;  3BTC A;  3DKX A;  2R7Q A;  3H9Q A;  1WWX A;  2FOK A;  2KRF A;  2IS4 A;  3V7S A;  3LA2 A;  1X4O A;  1IXS B;  2V6E A;  3I9V 2;  3S2H J;  3NRV A;  1FBS A;  3HOV J;  5J40 A;  3DP7 A;  3T8T A;  2VE9 A;  2L4M A;  2QYO A;  1ZN2 A;  3BR6 A;  3Q3S A;  4FCY A;  1WI9 A;  3RZD J;  2J5O A;  5DYM A;  1D0Z A;  1F9N A;  3EYY A;  1QZE A;  1HKQ A;  2X6Y A;  4PJJ A;  5CVJ A;  4HF1 A;  5CKT A;  5GTH C;  3S1R J;  2CFO A;  2JVH A;  2ZXW H;  3K0L A;  4AVP A;  4ZZL A;  1Z6T A;  1LNW A;  2HXI A;  4BAC A;  2V4J C;  3HM5 A;  1JKO C;  2DDB A;  1Z0X A;  4YFN F;  4KIS A;  1RKT A;  1ZH5 A;  3HGG A;  3FMQ A;  5GP9 A;  1IN7 A;  1BIB A;  2HZT A;  2R7F A;  2IW5 A;  1XC5 A;  1OYI A;  1SVO A;  4G94 A;  3CME I;  3FXK A;  2HQA A;  4HX8 A;  4O3M A;  1MMG A;  2R7V A;  3DU5 A;  3FIS A;  1K6Y A;  3PUF A;  4ZYH A;  1B59 A;  2PI0 A;  3DU6 A;  3WU0 A;  3ZN0 A;  2ZSH B;  1XPX A;  2XHK A;  4BBS J;  3LMM A;  1LVK A;  2EFQ A;  3UKG A;  4JP0 A;  3W6K B;  4NC7 A;  1YLF A;  5EF6 A;  1WJF A;  2X6W A;  2B63 J;  4Q5S F;  2EWN A;  1MJB A;  3W2V A;  4XKB A;  4BQO A;  4IHS A;  2M34 A;  3BG6 A;  1U2W A;  1MBH A;  4LK0 F;  3OYL A;  3J81 Z;  1ZRD A;  1WJC A;  3MVP A;  3CJQ B;  3GZN B;  3SEZ A;  3IAM 2;  5ERI A;  3KP6 A;  1QVT A;  1AWC A;  3O8G A;  2XKP A;  1IUY A;  3LSH A;  3OS0 A;  1W0U A;  2MG4 A;  3CCY A;  3K4K A;  2ISY A;  3CMM A;  1TBX A;  1TNS A;  2JT1 A;  4B47 A;  2LD5 A;  9ANT A;  4D5C A;  2BVL A;  2JUG A;  3P7N A;  3G1M A;  5J3L A;  1D1C A;  1JI8 A;  2AHQ A;  4PK4 A;  4RAZ A;  3WTS C;  4A3G J;  3KYL A;  1IRG A;  4LIV A;  2ZFU A;  3IKV A;  3S2W A;  4RM2 A;  1EJ9 A;  4UB8 C;  2DU9 A;  4EM1 A;  4PJL A;  5HOO A;  3RPU D;  2GXG A;  1S29 A;  2K3F A;  2QM3 A;  4I01 A;  4MQV A;  1R6R A;  1FT9 A;  2K9L A;  3PO2 J;  1IRX A;  3CDL A;  4O6J A;  1BJA A;  4A3K J;  2R7S A;  5GAH J;  1XMX A;  3VEP A;  3IH2 A;  4I0A A;  2FML A;  2V1D A;  1U0J A;  1YS6 A;  3H92 A;  1I50 J;  2DDA A;  2JA2 A;  2KRH A;  1ZGW A;  4XID A;  2IRF G;  2LF7 A;  4XL9 A;  2L9N A;  1JUP A;  2LRE A;  2YSR A;  4J19 A;  1U3E M;  2V79 A;  2KMU A;  4IPA A;  3CC7 I;  3MEX A;  2LY9 A;  5FB2 A;  2DTZ A;  4G7O F;  2KHM A;  3LSP A;  4GXO A;  5DUK A;  5EEA A;  1WKM A;  1ZLK A;  3IUO A;  1OCO H;  3K70 D;  1FWZ A;  1Z1D A;  1JTX A;  1NTC A;  2RRE A;  1ZEL A;  5KCM A;  5L3G A;  4MNU A;  5DCM B;  1JJ6 C;  4AYB N;  4XOT A;  2ZME C;  4M3G A;  2I5U A;  5CLS A;  3ERE D;  2DYR H;  1TNT A;  3JTG A;  1RPW A;  1X2N A;  3F6V A;  1FEX A;  3OYE A;  1WZ2 A;  1TWG J;  3HOZ J;  1SFX A;  1P2F A;  1PYV A;  4HNV A;  3H5A A;  2L7F P;  4I7H A;  2FE3 A;  4O5V A;  2KL4 A;  4FE7 A;  4ETS A;  3SJM A;  4PFO A;  4UV9 A;  3S17 J;  3EUK L;  1R4M B;  4XKC A;  3L2Q A;  3MZ8 A;  1EF4 A;  4ESB A;  3E7L A;  4M3D A;  4B3X A;  4C2T A;  3PIP F;  3WOD F;  5KAF C;  3U1D A;  1UG2 A;  4A3B J;  2ZO4 A;  1IG7 A;  1UMQ A;  3I4M J;  1TWF J;  4L5E A;  4RGR A;  2F4M B;  1RNL A;  2DLL A;  5HDG A;  4AUX A;  2IS1 A;  2Z33 A;  2ECB A;  1G8X A;  3HBL A;  1P4W A;  1J59 A;  3BJO A;  4BDZ A;  4BY7 J;  1I3A A;  1FX7 A;  5M5W J;  3GFM A;  2E36 A;  1VTN C;  2FSW A;  5F04 A;  3ZQI A;  1SD7 A;  3K4B A;  1X4P A;  3EUH A;  1P9Q C;  3H35 A;  1A5J A;  1FTZ A;  2NYX A;  3GWZ A;  2CJJ A;  4BXU A;  1KQ0 A;  4LLG F;  1J75 A;  2NRA C;  1ULY A;  3R4K A;  4RA2 A;  4EMS A;  4M6X A;  3ZQF A;  1SMT A;  2XGC A;  3S15 J;  3DQV C;  4G6T B;  3L2W A;  1FSH A;  4M9X A;  2OD5 A;  3WTW C;  1N75 A;  1ETV A;  2QLZ A;  1WCM J;  2HNH A;  4LMY A;  4A0Z A;  4CXF A;  3K10 A;  5FFX A;  4ENJ A;  2ZKZ A;  4NUB A;  1QRY A;  2BY1 A;  4OIR F;  2NNN A;  3OIO A;  1GV2 A;  1SFK A;  3BP8 A;  3LOC A;  4KT5 C;  1TL8 A;  5F0C A;  2DJN A;  2G7H A;  1QBJ A;  3BJ6 A;  3OIP A;  3WHB A;  3L2U A;  1FOW A;  3RIR A;  4OIO F;  2VC1 A;  2RAE A;  3J7A O;  3WGH A;  4HLX A;  4UUS B;  3HRM A;  2FF4 A;  3K2A A;  4EJW A;  4UB6 C;  4II3 A;  4C3I J;  3QRF F;  4HEA 2;  2D45 A;  2DAO A;  3WTX C;  1CGP A;  1TWC J;  4P1W A;  1JKP C;  4HSR A;  2E2I J;  1EH6 A;  4AIK A;  1E3P A;  2EZH A;  2DMT A;  3FX3 A;  1WJ5 A;  2K86 A;  1QZY A;  5DD8 A;  3DEE A;  3BQZ A;  2XIG A;  2ME0 A;  3HOX J;  1L0O C;  5KK1 A;  4HAM A;  1A31 A;  2Y9Z A;  3M8F A;  4MQ9 F;  4KIC A;  2W84 A;  1MMD A;  1YIT I;  2OU2 A;  2K85 A;  4LB5 A;  4OAZ A;  2L4A A;  2PMU A;  2VIX A;  3PFY A;  1R1V A;  2B0L A;  4ZH4 F;  2FXA A;  4E70 A;  2LC2 A;  3FXQ A;  2ELK A;  2M8G X;  3BG5 A;  5E3L A;  1YW9 A;  1LB2 A;  4P5O A;  4CCO A;  1RUO A;  2VKE A;  3BOQ A;  3WG7 H;  3U21 A;  4J00 A;  4HG2 A;  4M3B A;  1MBE A;  1S6L A;  2X6X A;  2OCE A;  1IUF A;  4EGZ A;  2A07 F;  1X19 A;  1ODD A;  3F8M A;  2X1E A;  3ONQ A;  2PMZ A;  4MEX F;  1VQN I;  1FC3 A;  4EV0 A;  1ENH A;  3BG3 A;  3A01 A;  1VQO I;  1WJD A;  3LQQ A;  3HRS A;  1MBJ A;  3ZMV A;  4HRI A;  2JA6 J;  1LFU P;  1HLV A;  1HW1 A;  2HQR A;  3K4L A;  3OYJ A;  3OOU A;  3O3K A;  4EJT A;  4U7D A;  2YS9 A;  1MZB A;  3LSM A;  3TDU C;  4L5I A;  1TLH B;  3HTU A;  4XOR A;  5C44 J;  2ME6 A;  2OBP A;  3SFI A;  4NC6 A;  1MND A;  2IGN A;  4U0Y A;  4FET A;  1JKR C;  2DMQ A;  4JQF A;  3QU6 A;  5L3B A;  1B9N A;  1X2M A;  3OR2 C;  3ZGK A;  1IAW A;  3DFG A;  2XAH A;  3DTE A;  1VQM I;  4CYD A;  4PSX A;  1DDN A;  4CIC A;  3BTJ A;  1EH8 A;  2R0Q C;  1RZ4 A;  4L0Z B;  2JTV A;  3KFW X;  4KJZ A;  1ITY A;  1JTY A;  3ZQG A;  3CCL I;  3VWB A;  1XX5 A;  3FXR A;  3PUB A;  3OYB A;  1BOB A;  3G1L A;  4UUS A;  3ZQL A;  3TL4 X;  2FX0 A;  4JX4 A;  3A0B C;  4Y13 A;  3F3X A;  4YEJ A;  5GAE J;  2WB1 N;  4B44 A;  5J47 A;  5CQG A;  4HLY A;  1AHD P;  1Z77 A;  3HOT A;  2YPR A;  1LQ1 A;  2HOE A;  3TQN A;  4LIT A;  2W00 A;  2CUZ A;  2NOJ B;  1GV5 A;  4KMU X;  2KIF A;  3RKW A;  2QUF A;  5E1X A;  3DXJ F;  4G7H F;  3QAH A;  1ZAR A;  1VQK I;  4C3J J;  3WU1 B;  1BI3 A;  5K5O A;  4HQM A;  5JR3 A;  2DXI A;  2BBY A;  1MBF A;  1F36 A;  3KIO A;  1W4M A;  1Y8Q B;  4PFP A;  3KPH A;  3JRC A;  4IHX A;  4I2O A;  3K9T A;  2F5C A;  1G59 A;  2CMP A;  3MKZ A;  1PDN C;  1MNM C;  4IO9 F;  2MH2 A;  1VQ5 I;  2W48 A;  4XLA A;  4RLQ A;  1R9T J;  1K4T A;  2D1V A;  3C2G A;  3KP3 A;  5CVV A;  2H1K A;  5LHI A;  1R5H A;  3SZG A;  3VOE A;  3FM5 A;  3R0A A;  4EAT A;  1KU3 A;  3OYC A;  5EG0 B;  2HI3 A;  3HYI A;  4IKF A;  3KYC B;  4L0Y B;  1VFC A;  4XQF A;  1YO5 C;  3F6O A;  1LKX A;  2P0W A;  4M9S A;  3SQN A;  4XNF A;  2CGP A;  4S04 A;  1T95 A;  5B5E C;  4BHB A;  5DTD A;  1BC8 C;  4YG2 F;  1OMI A;  2E7X A;  3GTM J;  4UVA A;  3GLL A;  3IKT A;  2OPT A;  3K6G A;  4CGZ A;  3ML6 A;  2COM A;  5E3N A;  2DPD A;  3F8N A;  1QQI A;  2DMP A;  4JOM A;  4HDU A;  2YUS A;  4HPQ A;  1NK3 P;  1IN4 A;  2LKP A;  1D5Y A;  3TW6 A;  2O61 A;  1D1A A;  2JWT A;  4C2U A;  1O7F A;  3GFJ A;  1TWA J;  2OF7 A;  3MZY A;  4WXH A;  3H36 A;  2Z16 A;  3JAM Z;  2ZJR F;  1YOV B;  4FQG A;  5FD6 A;  5FKO A;  1FYK A;  3E6M A;  4E7K A;  3L7W A;  2NVY J;  1QVU A;  2MC4 A;  3QU3 A;  1T6S A;  2MYS A;  3V7C A;  3QPT A;  2P5V A;  1IW7 F;  2EIM H;  4A69 C;  3GTL J;  1FPQ A;  1AOY A;  3OIQ A;  2VT3 A;  4H4K C;  3BZC A;  5LD2 C;  2XAU A;  3PO3 J;  1RRJ A;  3CC2 I;  4MEY F;  3BQY A;  3MQ0 A;  2HTS A;  3Q0U A;  2JPC A;  5K7F A;  3NWS A;  1DP3 A;  3ZMU A;  4ZYE A;  3CCM I;  2IGM A;  5GPC A;  2O8K A;  3TBI A;  2HQN A;  2CSO A;  4RGU A;  3U9G A;  2EV6 A;  2H1L A;  1W36 D;  3WGG A;  4LG0 A;  2CV1 A;  3CCR I;  3ECO A;  3L00 A;  3FK7 A;  4UY8 I;  3F22 A;  3G1O A;  3DBL B;  3KP4 A;  1QO0 D;  3LSK A;  3T0Y A;  2OJE D;  3JRA A;  1R49 A;  3UR3 C;  4C2M J;  3S3N A;  3W2A A;  4CHU A;  4A0X A;  3TMO A;  1A6I A;  5J1R A;  3CCJ I;  2K4B A;  1RES A;  2L5Q A;  4PJ0 C;  4LK1 F;  4HNU A;  4A3I J;  5M5Y J;  2Z3Y A;  5BNG A;  4ESF A;  3EUH C;  5D6E A;  3RZO J;  3WE2 A;  5HOD A;  4PDK A;  4B4C A;  4MLO A;  2KIM A;  4ASN A;  4XRM A;  1JT0 A;  4A3J J;  5EGO B;  3HOU J;  3A03 A;  1W5S A;  2PN6 A;  1H9T A;  3QQA A;  3RI4 A;  3I56 I;  3R6S A;  4M6V A;  1P7J A;  2G9W A;  1R36 A;  3BC8 A;  3I55 I;  5C4J J;  2DCE A;  3OL4 A;  2BXZ A;  1B72 B;  3S16 J;  1V3F A;  3R0J A;  2DOE A;  2ID6 A;  3RKX A;  2R7U A;  1GLN A;  3DLL F;  2X9D A;  5DM7 F;  2F5V A;  1K6O A;  4KNY A;  3HOW J;  4RBO A;  1GHC A;  4N4O B;  2KJC A;  4AU7 A;  2V6C A;  3BDD A;  2DA4 A;  2LRD A;  1TZL A;  3M3Y J;  2LNB A;  3CUQ B;  5F08 A;  5CPR B;  4E7I A;  5HS7 A;  2O3F A;  1FP1 D;  2WWY A;  2DPU A;  3I58 A;  2BY3 A;  4EJO A;  1RC9 A;  2XKO A;  5ICF A;  3S32 A;  1FMV A;  2O0Y A;  2L0K A;  3E5U A;  1V5G A;  3REO A;  3G3Z A;  3MKW B;  4B43 A;  2X1C A;  3HHH A;  3VYT B;  3K69 A;  2R92 J;  3PL8 A;  2IJL A;  4ZJZ A;  1IO2 A;  2H27 A;  4UVB A;  5HS9 A;  2ELJ A;  4OOI A;  4DNC A;  1XB4 A;  5DDG A;  2QVO A;  4DYQ A;  3R61 A;  4AC0 A;  3WTY C;  2FMY A;  1KON A;  2PBI A;  4PJM A;  3ZQ7 A;  2XSD C;  3OYN A;  3PJR A;  4DBQ A;  3KEY A;  5E20 A;  3S8P A;  3TW7 A;  3ABL H;  1GXP A;  4NB5 A;  2IXS A;  2IA1 A;  2MC3 A;  4MTD A;  2FNP A;  1X1P A;  3FXJ A;  1RET A;  3N4M A;  4HX4 A;  1JGG A;  3HC7 A;  2FUG 2;  3OYK A;  3SDG A;  4UVC A;  5LRS A;  1HKS A;  1WPK A;  1OFC X;  2K7L A;  1JJ8 C;  1PP8 F;  5GTI C;  4UNO A;  5FLX Z;  2QZ8 A;  4UUT A;  5B66 C;  2LOO A;  5A2Q K;  5ICC A;  1YJW I;  2MGQ A;  2IGK A;  2XC7 A;  4V2F A;  4ESJ A;  3Q0V A;  3JRE A;  3Q0W A;  1XMK A;  2HU9 A;  4I98 B;  1JHH A;  2HOA A;  2Y31 A;  3Q9V A;  2WV0 A;  3MZH A;  1H9G A;  2MW8 A;  4ANJ A;  4CUG A;  4FHT A;  4N0B A;  4P55 A;  1YHQ I;  5EGO A;  4DOZ A;  2X1D A;  1NG7 A;  3VYU B;  4RMN A;  1W7P A;  2CW0 F;  5DEQ A;  1Z67 A;  2CU7 A;  4XOP A;  5GAG J;  3KYD B;  3GVA A;  5L3E A;  5LEK A;  2IA2 A;  1B72 A;  1H0M A;  3FMR A;  1D3Y A;  1S7O A;  4FT8 A;  2M45 A;  5KHD A;  3IH3 A;  4CCJ A;  4ON0 A;  2GM4 A;  2A69 F;  3HTS B;  2JZY A;  3F23 A;  1HDD C;  1YQA A;  2CUJ A;  2E60 A;  3S3M A;  3GO5 A;  2GIV A;  2AS5 F;  4F55 A;  1IGN A;  3H1C A;  1MH3 A;  2FJ1 A;  3CUQ A;  3EPZ A;  4BKX A;  1ETW A;  2R7O A;  3MKL A;  4RLF A;  4KIT B;  4L9J A;  3MFK A;  2HZD A;  3J7Z I;  2HDD A;  3HPG A;  2LKS A;  2KZG A;  2C6Y A;  4NHJ A;  1I6X A;  1C0W A;  2GZW A;  5ICG A;  3JRI A;  3HL2 A;  2E1O A;  1Z7L A;  3S93 A;  3IRQ A;  1AKH B;  3N05 A;  4YFK F;  2JN6 A;  1B6A A;  3DPL C;  1W1W E;  1EKE A;  3PSI A;  4L9N A;  2EFW A;  3HKZ A;  3MN2 A;  2XRN A;  4HZF A;  1PUF B;  1UCR A;  1XSD A;  4AD9 A;  1FYL A;  5IOY A;  3V8J A;  3D5R C;  3J80 K;  4HYE A;  2EJR A;  2VB6 A;  3MD2 A;  4N9I A;  3X2Q H;  3B6C A;  5BQT A;  5LHH A;  1FBQ A;  3FK6 A;  3GYH X;  1QPI A;  2BVM A;  3RQ4 A;  3IV5 A;  3ZQC A;  2JMW A;  2E34 A;  2QQ9 A;  3VPR A;  4YFX F;  3FBI B;  1VQP I;  2VPL A;  3KET A;  3JW4 A;  2P81 A;  3PFI A;  4XK4 A;  5FFZ A;  4A3M J;  2ZNY A;  3V4G A;  1XD7 A;  5HLI A;  1VQL I;  4BHC A;  4CYC A;  1XGM A;  3ZMS A;  2DK8 A;  2ZJP F;  2A05 A;  5J4Y A;  3HOY J;  2XAG A;  1HSJ A;  3HJE A;  1ERD A;  1ETX A;  5B1B H;  1MSF C;  3FXU A;  2LH9 A;  3O2P E;  1ON1 A;  3TDZ C;  4M74 A;  1I6H J;  2CQX A;  2DTR A;  2MAB A;  3W6V A;  5EJC A;  3JR9 A;  2Z2S B;  1ZGA A;  1FIA A;  3OMY A;  1KU7 A;  2QQB A;  1YFH A;  5EEG A;  5EEH A;  4RM3 A;  1LDJ A;  1IZ1 A;  1B4A A;  2Z9O A;  3BWG A;  2HFH A;  4R8H A;  2XGX A;  5TJJ A;  5D8K B;  5IP6 A;  3OYM A;  2XV4 S;  5FJ8 J;  1X3W B;  4N4N B;  2HOS A;  3TOA A;  4BJ5 C;  1MMA A;  1V4R A;  1OR7 A;  2E1N A;  3G73 A;  2EIK H;  2QEX I;  4U0V A;  2OCC H;  2QF7 A;  2G7U A;  3I59 B;  1P7I A;  2OQG A;  2EIJ H;  5HLG A;  1J2X A;  3ABU A;  2LKX A;  2Y75 A;  1XN7 A;  2R4G A;  2BE5 F;  2NAZ A;  2G0E A;  1JUM A;  2Y0M A;  4CCL A;  1J9I A;  2GQQ A;  2XVC A;  1UEL B;  1BL0 A;  4OWR B;  4RDU A;  3BG9 A;  2Q0O A;  2Y0S A;  3ZQH A;  4PSW A;  5BS6 A;  2R7R A;  5BPI A;  3S1N J;  1YIJ I;  4NBQ A;  1WRJ A;  1HBX G;  3AG4 H;  2WAQ A;  1NG6 A;  2VPR A;  2IGO A;  4HW0 A;  3D0S A;  3IHU A;  4QWQ A;  5F0F A;  1VQ4 I;  4A3D J;  4YII A;  1YX3 A;  3M07 A;  5IP7 J;  1ZRE A;  2ESN A;  1HXD A;  3CLQ A;  4BQQ A;  2FEZ A;  2CW8 A;  4X1E A;  2YX7 A;  1AKH A;  3O6B B;  1P92 A;  3BR1 A;  1XGS A;  5BPD A;  1T0F A;  3S1Q J;  1XTA A;  4XLP F;  1WSU A;  3HGY A;  4CSW A;  3H3V K;  1P4A A;  2VL8 A;  2CV0 A;  4A5N A;  3I5U A;  1PUF A;  1BOA A;  4IX7 A;  1EV7 A;  1TT0 A;  2EV0 A;  2EZI A;  4XLC A;  3HRT A;  5F27 A;  3DTI A;  3JSP A;  2JJ7 A;  4XSX F;  4BXF A;  3IL2 A;  1NH3 A;  2VBZ A;  4AID A;  4IZZ A;  3JAM K;  4I76 A;  3A0H C;  1LEB A;  2X85 A;  4X6A J;  2W82 A;  2CQ7 A;  3DBR B;  2Q2E B;  5EYR A;  4U0W A;  3SYT A;  2EZK A;  2UUZ A;  3VYR B;  4FAS D;  3BZK A;  1FMW A;  2DK5 A;  2F4I A;  1FNN A;  2MLK A;  1G3W A;  2DFF A;  4IVN A;  2RQQ A;  1HW2 A;  3CDI A;  3A01 B;  2FD5 A;  2HXO A;  2WY8 Q;  4I02 A;  5K5R A;  5E17 F;  2ECC A;  4IJA A;  3BG7 A;  2DA1 A;  1X1A A;  4IRH A;  3ABT A;  3CP8 A;  3VSK A;  1BI2 A;  1OCT C;  3N97 A;  5LEJ A;  3BTI A;  3CMY A;  2VBY A;  3S14 J;  1WVR A;  4BY1 J;  3BZ6 A;  4Y15 A;  5D4S A;  1USS A;  5DUI A;  1A04 A;  3I4P A;  1IJW C;  2XB5 A;  2MD5 A;  1WQ2 A;  1D8K A;  3OR1 C;  1IF1 A;  2Q1Z B;  2ICW G;  1IV8 A;  1W5T A;  2VQL A;  4OIQ F;  2GOX B;  1CF7 B;  1GUU A;  2NVT J; 
#chains in the Genus database with same CATH homology
 2HOT A;  5M5X J;  5K7Z A;  1BJZ A;  5C4X J;  2GBY A;  4C3J J;  3HEF A;  1CQT A;  2JA8 J;  5M3F J;  1XG1 A;  1MBF A;  1F36 A;  5FKL A;  1ETK A;  3QPL A;  1POG A;  3HB9 A;  4FIS A;  3JRC A;  4IHX A;  4W1U A;  3GBG A;  2N8G A;  1MNM C;  2CQQ A;  2W48 A;  4B1R A;  3LSR A;  1R9T J;  3L1P A;  1U9O A;  4ABZ A;  1BW5 A;  2HQ5 A;  5IYB J;  4XRS A;  2H1K A;  1ZR2 A;  3JRG A;  2NOG A;  2L7Z A;  2JK3 A;  4A3L J;  5EG0 B;  2HI3 A;  1VFC A;  2E2H J;  4QIW N;  2R7Z J;  1SFO J;  2KDZ A;  3FIW A;  2DA7 A;  5DTD A;  3RKQ A;  2TCT A;  2O9L A;  1IC8 A;  1Y1V J;  3GTM J;  5FKK A;  4XRS G;  2OPT A;  4V2G A;  2LVS A;  5E3N A;  2K9S A;  2DMP A;  3FKI J;  2YUS A;  1JKQ C;  3GTG J;  1NK3 P;  2FQ4 A;  4GFB A;  1D5Y A;  3LSG A;  3BTL A;  3TW6 A;  1T56 A;  1APL C;  2JWT A;  1FTT A;  1GDT A;  1TWA J;  1XS9 A;  2ZB9 A;  1Q1V A;  2OF7 A;  4A93 J;  1W0T A;  3ZOB A;  2XRL A;  5IYD J;  3BTC A;  5FKO A;  2X48 A;  1VF9 A;  3BR5 A;  5JLX A;  1HOM A;  4Y7N J;  2NVY J;  1QVU A;  3OSF A;  4LOC A;  1UHS A;  4DZP A;  3S2H J;  2CRG A;  3BR2 A;  3HOV J;  4A69 C;  3GTL J;  3Q3S A;  3BR6 A;  4FCY A;  3RZD J;  3CQZ J;  1ETY A;  3PO3 J;  3BQY A;  3Q0U A;  5K7F A;  3S1M J;  2NS7 A;  1BW6 A;  5GPC A;  3S1R J;  2O8K A;  1H8A C;  2HXI A;  4JX5 A;  2D5V A;  3FK7 A;  3HM5 A;  1JKO C;  1Z0X A;  1RKT A;  3G1O A;  3HGG A;  4MFE A;  5GP9 A;  1ZTR A;  3JRA A;  4C2M J;  1XC5 A;  1RKW A;  1A6I A;  3FIS A;  4BBR J;  5J1R A;  1K61 A;  1RES A;  5M3M J;  5GPA A;  4A3I J;  5M5Y J;  5FLM J;  2X6O A;  5BNG A;  4DZJ A;  3RZO J;  1VND A;  5HOD A;  3LSJ A;  4B4C A;  1ZQ3 P;  4MLO A;  3PM1 A;  4BBS J;  4XRM A;  1JT0 A;  3WHC A;  2QCO A;  2ID3 A;  4JP0 A;  5EGO B;  3UKG A;  4A3J J;  3HOU J;  3A03 A;  2R5Y B;  1F43 A;  3QQA A;  3M4O J;  5EF6 A;  4M6V A;  1WH5 A;  1P7J A;  2B63 J;  4D5F A;  5C4J J;  2M34 A;  1B72 B;  3S16 J;  4MIM A;  2ID6 A;  1MBH A;  3GTQ J;  2M0C A;  2Y30 A;  2X9D A;  3MVP A;  4B3A A;  1BA5 A;  5JLW A;  1SAN A;  3HOW J;  4RBO A;  2LFB A;  1QVT A;  2DA4 A;  3O8G A;  2EQR A;  3M3Y J;  1LE8 B;  3A02 A;  3IH4 A;  5F08 A;  1W0U A;  1DU0 A;  1RR7 A;  2MG4 A;  3CCY A;  3B6A A;  4C3H J;  2LTP A;  2DA3 A;  2LD5 A;  2M2E A;  4D5C A;  9ANT A;  1ZR4 A;  4NDL A;  2R93 J;  4S0H B;  2VUM J;  3G1M A;  5J3L A;  2XGD A;  2AHQ A;  2L0K A;  3H0G J;  2L7M P;  4A3G J;  2R92 J;  1JUS A;  2VI6 A;  2NVQ J;  2NVX J;  4BXX J;  3TP3 A;  3S2D J;  2CUF A;  4DYQ A;  4AC0 A;  3PO2 J;  2L9R A;  3CDL A;  3DEW A;  4A3K J;  2XSD C;  2M9H A;  1TC3 C;  4XIC A;  4IHV A;  3IH2 A;  1JT6 A;  4QSH A;  5IP9 J;  1HDP A;  1IV6 A;  3TW7 A;  2XGE A;  2DA6 A;  2MSY A;  5EDN A;  1I50 J;  1RET A;  1MBG A;  1ZGW A;  4XID A;  1JGG A;  4M3E A;  1JUP A;  3SDG A;  4J19 A;  1WPK A;  1OFC X;  1IDY A;  2LY9 A;  2DTZ A;  5EZG A;  1JJ8 C;  1FIP A;  1MBK A;  4UUT A;  1ZKG A;  2DA5 A;  2E2J J;  5FKM A;  3LSP A;  2MGQ A;  5EEA A;  5EZH A;  4V2F A;  3LNQ A;  3Q0V A;  3JRE A;  3Q0W A;  1JTX A;  1NTC A;  2Y2Z A;  2R5Z B;  2HOA A;  2Y31 A;  4I6Z A;  2MW8 A;  1JJ6 C;  4AYB N;  4M3G A;  2NS8 A;  2EBI A;  2IAI A;  4A3C J;  3NAR A;  3D1N I;  5EGO A;  2H8R A;  3JRF A;  1RPW A;  2R5Y A;  1X2N A;  2XPV A;  1FEX A;  1GVD A;  4IHW A;  2CU7 A;  1TWG J;  3HOZ J;  2DMU A;  2O7O A;  4HNV A;  1B72 A;  2L7F P;  3JRH A;  2DN0 A;  4FE7 A;  4D7M A;  3IH3 A;  3HDD A;  1T33 A;  3SJM A;  2GM4 A;  3S17 J;  1ZK8 A;  1HDD C;  1EF4 A;  3E7L A;  4M3D A;  1ORK A;  3BT9 A;  4D7N A;  1UG2 A;  4A3B J;  3DCF A;  2VKV A;  4IEJ A;  2COB A;  1IG7 A;  1UMQ A;  1IGN A;  1B8I B;  3I4M J;  1TWF J;  1LE8 A;  1DU6 A;  1MH3 A;  2FJ1 A;  1NK2 P;  2DA2 A;  2K9N A;  4L5E A;  4BKX A;  1ETW A;  3MKL A;  5F1J A;  4AUX A;  2HDD A;  2ECB A;  3HBL A;  4G12 A;  4BY7 J;  3JRI A;  5M5W J;  2E1O A;  5F04 A;  1AKH B;  1S7E A;  2JN6 A;  1ETO A;  3ZQI A;  4EEF G;  3MN2 A;  1A5J A;  1PUF B;  1IDZ A;  1FTZ A;  2WV1 A;  5IOY A;  2CJJ A;  4IHY A;  4JX6 A;  5J1U A;  2XPU A;  3ZQF A;  3S15 J;  2XGC A;  4A3E J;  3B6C A;  3FK6 A;  1ETV A;  2JA7 J;  1VI0 A;  1WH7 A;  1WCM J;  3HKZ N;  3NAU A;  1QPI A;  3IV5 A;  3ZQC A;  2JMW A;  3F0C A;  2K9Q A;  1QRY A;  3VPR A;  2I10 A;  3OIO A;  1AU7 A;  1GV2 A;  2EZL A;  3LOC A;  2P81 A;  4XK4 A;  5F0C A;  2DJN A;  4A3M J;  2LR8 A;  1ETQ A;  2TRT A;  3GTK J;  3WHB A;  1Y1W J;  4CYC A;  4FE4 A;  5IPA A;  2RAE A;  3HOY J;  1OJL A;  4UUS B;  1ETX A;  1U9N A;  2CUE A;  5E3M A;  1MSF C;  3K2A A;  4C3I J;  3O8H A;  2YU9 J;  1TWC J;  1I6H J;  2CQX A;  3TP0 A;  2R5Z A;  2K40 A;  1JKP C;  2E2I J;  2JA5 J;  1I3Q J;  3W6V A;  2EZH A;  2DMT A;  3JR9 A;  2Y9Y A;  1HF0 A;  1IRZ A;  1FIA A;  3TED A;  5E3O A;  3BQZ A;  2ME0 A;  3HOX J;  5J1Y A;  4M3F A;  4MFD A;  5IP6 A;  2Y9Z A;  5FJ8 J;  2AO9 A;  1GT0 C;  2HOS A;  1K83 J;  4MO7 A;  1O4X A;  1E3O C;  2LP0 A;  2QF7 A;  1P7I A;  3JRD A;  2ELK A;  2M8G X;  4CYC B;  3BG5 A;  5E3L A;  2IEK A;  5FKN A;  2XB0 X;  2LKX A;  1TWH J;  1MSE C;  2IBD A;  3I4N J;  2DMN A;  2VKE A;  1OCP A;  2G0E A;  1JUM A;  3RQI A;  4M3B A;  1MBE A;  1B8I A;  1BL0 A;  4RDU A;  3BG9 A;  3ZQH A;  3C2B A;  3K7A J;  4DW6 A;  2GLO A;  3S1N J;  1IUF A;  1WI3 A;  2KT0 A;  1LFB A;  3JRB A;  1FJL A;  5F0H A;  2VPR A;  1HCR A;  1ENH A;  3BG3 A;  3A01 A;  2JA6 J;  5F0F A;  4QTR A;  1MBJ A;  4A3D J;  1H88 C;  1LFU P;  5IP7 J;  5IYC J;  4FTH A;  1HLV A;  4JYK A;  2Y0S N;  4X1E A;  2LLK A;  3GTO J;  1U8B A;  4Y52 J;  3OOU A;  1AKH A;  1YRN A;  5FLV A;  1U78 A;  3BR1 A;  3S1Q J;  2EH3 A;  2PMZ N;  3H3V K;  3HGY A;  2YS9 A;  2WAQ N;  1PUF A;  2EZI A;  5DS9 A;  5C44 J;  3OSG A;  2ME6 A;  3SFI A;  5F27 A;  4W97 A;  2XPW A;  1X58 A;  2JJ7 A;  1JKR C;  2DMQ A;  3GTJ J;  1X2M A;  2LK2 A;  4I76 A;  1H89 C;  4X6A J;  5EYR A;  2EZK A;  3BTJ A;  3BR3 A;  2R0Q C;  3BR0 A;  3QPS A;  1WGX A;  2FD5 A;  3A01 B;  2HXO A;  1ITY A;  2ECC A;  1JTY A;  1MH4 A;  3ZQG A;  3GTP J;  2DA1 A;  1YRN B;  3G1L A;  4UUS A;  3ZQL A;  4DYR A;  1OCT C;  2FX0 A;  3BTI A;  4A3F J;  4JX4 A;  5IOZ A;  5K7H A;  3CMY A;  3S14 J;  2E19 A;  4BY1 J;  1G2H A;  2WB1 N;  2HYJ A;  1IJW C;  2XB5 A;  1AHD P;  1Z77 A;  4DYC A;  5C3E J;  2NVT J;  1GUU A;  1GV5 A;  5EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...