3GTMJ

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtmJ00
1DU6A 3QPSA 2GLOA 2Y9YA 1GV2A 5F1JA 1ZK8A 3Q3SA 3OSGA 1MBKA 1LFUP 3S16J 1P7IA 2HOAA 4A3IJ 2HOTA 2JA8J 3S2DJ 3HB9A 5K7ZA 3PM1A 3K2AA 5J1YA 4FCYA 1ETQA 5FKLA 2M0CA 3JRDA 4XIDA 2DA2A 1JT0A 3GTLJ 5C3EJ 1NK2P 3GBGA 5E3NA 2DMUA 5F08A 4AYBN 3JRGA 1U78A 4A3DJ 1JKQC 1B72A 2XGDA 2WAQN 2VKEA 1B8IB 2LP0A 3HGGA 1AHDP 2L7MP 2XGEA 2EQRA 2Y0SN 1WI3A 1IG7A 5FKOA 1OCTC 3D1NI 4I6ZA 2AO9A 1O4XA 3M3YJ 1QRYA 3I4NJ 4BBRJ 2R7ZJ 3SDGA 3ZQFA 4GFBA 2K9QA 2IEKA 2XPWA 3BR6A 1TWAJ 5M5WJ 5F0HA 5EG0B 1X58A 1FIAA 3E7LA 3GTQJ 2R5YA 1VFCA 5DTDA 1OFCX 2ZB9A 4BKXA 2OPTA 3QPLA 1OJLA 2CRGA 2MSYA 1BW5A 2DMTA 2TCTA 4M3FA 2JN6A 3JREA 4MLOA 1MNMC 4RBOA 3BTLA 5EG0A 4JYKA 5IP7J 1G2HA 5EYRA 3OIOA 1D5YA 5J1RA 1MBJA 2EBIA 5IYCJ 3M4OJ 3A01A 2KDZA 1HDDC 5HODA 3JRCA 4FISA 1IDZA 3LOCA 4J19A 3BR1A 2JA7J 3BG5A 2EZKA 2R5YB 3G1OA 4NDLA 2NVXJ 1MH3A 3BQYA 1I3QJ 1AU7A 3NAUA 2Y31A 5FLMJ 2AHQA 2HI3A 1PUFB 2M2EA 4C2MJ 1ZGWA 2JA6J 5K7HA 1NTCA 5EEAA 3FIWA 4XRSA 3WHBA 3HOVJ 2O8KA 2CJJA 3RQIA 3GTOJ 2XPVA 1K83J 3QQAA 3O8GA 4FE4A 1SFOJ 2HDDA 1BW6A 3WHCA 2DA7A 3JRAA 2FJ1A 4MIMA 1RETA 2YUSA 1H89C 2JMWA 2XB0X 2VPRA 2IBDA 4CYCB 3HKZN 1ETKA 3FK7A 3OSFA 1T56A 1WCMJ 1F43A 5IP9J 2H1KA 3ZOBA 2B63J 3IH2A 5F0FA 1TWCJ 1IDYA 4W97A 4IHYA 3GTGJ 5IOYA 2L0KA 2DA3A 2XB5A 5M3MJ 1Z0XA 3RKQA 2DN0A 2NS8A 3HBLA 1VI0A 2M34A 1I50J 3O8HA 1ZTRA 4M3EA 1MBFA 3SFIA 2O7OA 2LR8A 1UMQA 1GUUA 5EZHA 1JJ6C 4JX6A 4DZJA 2LVSA 1IGNA 1X2NA 3TEDA 3GTKJ 1QVUA 2VKVA 4M3DA 2X48A 4DYRA 3MVPA 1DU0A 2LKXA 4LOCA 2CUFA 2COBA 3IH4A 1UG2A 1FTTA 1CQTA 5M3FJ 2E1OA 4UUSA 5IPAA 1ETVA 3F0CA 3BR3A 2QF7A 5FKKA 2NVTJ 3HEFA 2CUEA 3LSGA 1S7EA 1JTXA 3BTCA 2WV1A 5IYBJ 1JKOC 4MFDA 4A3CJ 5DS9A 3TW6A 3Q0WA 4X1EA 3W6VA 3RZOJ 2D5VA 1VF9A 1A6IA 5EF6A 2LTPA 2M8GX 3G1MA 5GP9A 5F0CA 3CMYA 1ITYA 1H8AC 3I4MJ 4A69C 1ORKA 4DYCA 1GT0C 1UHSA 2NS7A 2E2IJ 5FKNA 3ZQLA 1IUFA 1E3OC 2DA1A 3GTJJ 1RKWA 1IRZA 3BQZA 2VUMJ 3HOUJ 2FD5A 2HYJA 1X2MA 4XRSG 2LD5A 3HOWJ 2Y9ZA 1MBHA 2NVYJ 5IOZA 4IHWA 1P7JA 2XGCA 2FQ4A 1I6HJ 1ETYA 1AKHB 1WPKA 3BTIA 4A3FJ 4BXXJ 2HXIA 1TC3C 4A3JJ 1GV5A 3BR2A 4AUXA 3HOXJ 2ELKA 2XSDC 1R9TJ 2WB1N 1JTYA 1HF0A 2JJ7A 4M3GA 4Y7NJ 2MW8A 1WH5A 2NOGA 4A93J 2I10A 5JLWA 3HOZJ 1NK3P 3H3VK 3A02A 4W1UA 1XS9A 1JGGA 3HDDA 2GM4A 3L1PA 5J3LA 9ANTA 4C3JJ 4RDUA 1LE8B 5F27A 1ZKGA 1RKTA 3JRHA 4MO7A 4D7NA 2R5ZB 1IJWC 2DMPA 5GPCA 3JRFA 2KT0A 3TW7A 4HNVA 2CQQA 5M5XJ 1JKRC 3BG9A 2X6OA 3SJMA 5IYDJ 4A3KJ 1JUPA 1GVDA 4XK4A 1EF4A 4D7MA 1FJLA 2MGQA 1Y1VJ 1B72B 3DCFA 3S1QJ 1HOMA 2E2HJ 1Y1WJ 3TP3A 3S15J 3GTPJ 2FX0A 4IHVA 1MBGA 1JT6A 1XC5A 3FK6A 5IP6A 5C4JJ 3S1RJ 1IV6A 2XPUA 2HXOA 5M5YJ 3HGYA 1ENHA 1XG1A 2DA6A 5FJ8J 2O9LA 2HOSA 5E3LA 4XICA 1QPIA 2L9RA 1FEXA 3LSRA 1B8IA 2HQ5A 3LNQA 2LFBA 2K9SA 1IC8A 2PMZN 3BG3A 1APLC 3ZQIA 4XRMA 3G1LA 3CCYA 3H0GJ 1FTZA 1TWHJ 1LE8A 3HOYJ 2L7FP 2W48A 4ABZA 4BY1J 2DMQA 3ZQCA 1HLVA 2ECBA 2CQXA 3ZQHA 1FIPA 2EH3A 2R0QC 1ETWA 1Z77A 4JX5A 2JA5J 1F36A 1JUSA 5EGOB 1K61A 1AKHA 1JJ8C 1MBEA 3DEWA 3IH3A 2VI6A 2YS9A 4Y52J 1U8BA 2N8GA 1U9NA 2DA4A 5F04A 2X9DA 5EZGA 2ME6A 1JKPC 4B4CA 4V2GA 1Q1VA 4QTRA 5FLVA 1LFBA 2DJNA 1HDPA 1ZR4A 2OF7A 4A3BJ 4MFEA 4BY7J 3Q0UA 5K7FA 3S1MJ 5C44J 1VNDA 3S1NJ 2JWTA 3S2HJ 1YRNA 2Y30A 1ETXA 3PO2J 4D5FA 2NVQJ 4C3HJ 1H88C 3ZQGA 2E2JJ 1TWFJ 2DMNA 3BTJA 4UUTA 3CQZJ 5EDNA 4G12A 1TWGJ 1ETOA 2R5ZA 1ZR2A 3GTMJ 2YU9J 5FKMA 4A3LJ 3A03A 3TP0A 4M3BA 1W0UA 3VPRA 4B1RA 2LK2A 3JR9A 3MN2A 1WGXA 1T33A 2P81A 4JP0A 1JUMA 3S14J 2IAIA 2G0EA 4QIWN 4JX4A 4CYCA 1BA5A 5C4XJ 2EZIA 2R93J 1U9OA 2XRLA 3Q0VA 2DA5A 4UUSB 3BT9A 1HCRA 2M9HA 3NARA 4C3IJ 2EZLA 2RAEA 1MSEC 1SANA 4DZPA 3RZDJ 2ID6A 4L5EA 5JLXA 2MG4A 5BNGA 2JK3A 3S17J 2EZHA 4FE7A 1BJZA 3FKIJ 4I76A 3B6CA 5J1UA 2TRTA 2Y2ZA 3K7AJ 4DW6A 2H8RA 1MH4A 1ZQ3P 2L7ZA 3B6AA 4FTHA 2LLKA 2R92J 3LSJA 3UKGA 3PO3J 1RR7A 1RESA 4A3MJ 1POGA 4QSHA 1BL0A 5GPAA 2K40A 3JRIA 2GBYA 4D5CA 1WH7A 4IEJA 2K9NA 1GDTA 4IHXA 2CU7A 3LSPA 1QVTA 3C2BA 3CDLA 3MKLA 1PUFA 3JRBA 1W0TA 1A5JA 2DTZA 4B3AA 3FISA 1MSFC 3OOUA 3BR5A 2ID3A 4M6VA 3HM5A 2E19A 1YRNB 4V2FA 5E3MA 4BBSJ 2ECCA 5EGOA 3IV5A 4EEFG 2LY9A 4DYQA 4A3GJ 3A01B 3BR0A 1OCPA 4S0HB 4X6AJ 4A3EJ 4AC0A 2ME0A 1RPWA 2QCOA 5E3OA
chains in the Genus database with same CATH superfamily
1KU3A 3NEUA 2Y9YA 2ZJ2A 4A5MA 2M0MA 2KZVA 4YFXF 3OSGA 1FBQA 3S16J 1P7IA 4RB2C 2HOTA 2OA4A 2JA8J 3HB9A 1OLTA 4LGWA 3VDXA 3FKJA 1ETQA 1S7OA 5FKLA 4IHSA 1TT5B 3FXRA 2HNHA 3LAPA 1FOYA 1JT0A 1ZLJA 1LDKB 4EJWA 1UJ8A 3H9JA 2DMUA 4Y15A 3CLQA 4AYBN 3JRGA 1LB2A 3IWFA 4ESFA 1B72A 3BPVA 2WAQN 4F3QA 1FT9A 2FEZA 1B8IB 1WJAA 1N77A 4P96A 2M4GA 1IN5A 1ONVA 4IXAA 2BW3B 3KZZA 4BUPA 4ESJA 3PSIA 4PZJA 4RS8A 5FKOA 1OCTC 3D1NI 3RIRA 1B4AA 2V9KA 1PYVA 2BYVE 1MJAA 3CF2A 5E8GA 4LLNA 1JI8A 3ZQFA 1KYZA 2FXAA 1Z6TA 1A6QA 2KRFA 2KLOA 3QPHA 1Z91A 4XKBA 1HBXG 1TQMA 3HPGA 2CQKA 2VQLA 5K5RA 1X58A 3FXOA 4BHPA 3OYJA 4RA2A 1XSDA 2R7VA 4LITA 4CCLA 4KA4A 4FASD 2OPTA 3OMYA 4M73A 4UB6C 3WG9A 4L0YB 2TCTA 4XL9A 2CH0A 3H0DA 2Z33A 1STZA 2HR3A 4J01A 2RNJA 1MNMC 2AQEA 1G4DA 4BNCA 3BTLA 3HHGA 5EG0A 4JYKA 2E1CA 1FC3A 2X6XA 5IYCJ 4EGYA 1UHWA 3A01A 3A2KA 5HODA 3JRCA 4NHJA 4U0VA 3QP6A 1VQNI 2QSGX 2BGCA 3A4CA 3R61A 2ESHA 2F48A 1IDZA 4Z2YA 4J19A 4EJOA 2QGUA 2EZKA 3ASNH 3T8TA 3OYFA 1WJ5A 2Q0OA 3G1OA 3BQYA 1AU7A 3NAUA 1O3SA 1HC8A 1MD0A 2RNGA 5D6FA 4WF2A 4ZC3A 4YFKF 2W7NA 1Z9CA 3BY6A 3E0JB 5K7HA 3ZMTA 1YLFA 5GTIC 4R1HA 2CJJA 2X85A 4FX4A 1IRXA 1D0ZA 2CW7A 2GWRA 4HZFA 5IT3A 2E60A 1P4XA 4XKVA 2PJPA 2M87A 3KLOA 4IF4A 2KFDA 1BW6A 3OR1C 3WHCA 2DA7A 2STWA 3DP7A 2FJ1A 2DI3A 1YJ9I 1VZ0A 3IAS2 1H89C 2KL4A 4AIHA 3EETA 1ETKA 3H5NA 4G94A 3HPHA 2Y69H 3OSFA 1MMDA 1F43A 1X1CA 5IP9J 3BWGA 3DPLC 5F0FA 5BS6A 3T1BA 1TWCJ 3F8MA 5FRNA 3G3ZA 1IF1A 4NQWB 2CV1A 1DPUA 2OQRA 5IOYA 2L0KA 1KQ9A 2DA3A 2IXSA 2XB5A 1Z0XA 3HBLA 3QOEA 1VI0A 2AQFA 3GYHX 3HTUA 1MMGA 1QNTA 1R1TA 3K10A 3OWTA 4ZDPA 2M34A 1VQMI 3O8HA 2RN7A 4R79A 3CUQA 3GUDA 2O7OA 1VQ5I 3RKWA 3UR3C 1JJ6C 2DQLA 2CFXA 1YI2I 2LVSA 4ZZDA 3TEDA 2X51A 4PJNA 5FFZA 1FBSA 3M8FA 2VC1A 4BACA 2JRTA 2O0YA 3ZQ7A 4PJMA 3H92A 2CUFA 3TDZC 4UUVA 2DCEA 1T8IA 3WTSC 3L2VA 1SFUA 1ETVA 4HG2A 4IOCF 3FXJA 5HNFA 2VE9A 2QF7A 2NVTJ 1MMNA 1IRGA 1S7EA 1JTXA 4CZZA 2XAJA 3OS1A 4IZZA 1JKOC 3LSHA 1Q1HA 2BZTA 2JVHA 3OY9A 1OCOH 2OZUA 4RM3A 2W57A 4X1EA 2R7XA 4KIGA 3RZOJ 2D5VA 4UV8A 2MH9A 5KNLA 1FP1D 3RKYA 4I7HA 2KIFA 1KQ8A 3KLNA 1NHAA 2V4JC 3I56I 3GFIA 3RDIA 2DPDA 1UHSA 2IA1A 2NS7A 1I1SA 3U1DA 3QU3A 4ETSA 3HUGB 4RGSA 3GTJJ 3NWTA 1BOAA 3BQZA 2EIMH 3JTGA 2FD5A 3LWFA 1X2MA 2OCCH 2O8XA 4JBAA 4XLPF 2LD5A 3HOWJ 5K5OA 2GZWA 5LRRA 2VC0A 2W84A 2UXNA 3FWEA 5ICGA 2E36A 3WTZA 3K9TA 5AIPA 1AKHB 5GADJ 1X3WB 4BXXJ 4IKFA 5CVVA 4ZTFA 2L9VA 1YFHA 3HOXJ 1XGSA 3MEXA 4EJUA 1VQ8I 2QQBA 1TT0A 2CV0A 2JT1A 1G6NA 4XLCA 4IQ4A 2DFHA 4A0ZA 3A0BC 4CXFA 4Z6YA 1B1BA 4DBQA 4LB6B 5LGTA 2F2EA 1ON2A 2RC4A 1F4KA 3H3VK 3JSOA 2KRHA 5CQGA 2XROA 3ABUA 2GM4A 1S6LA 4LG0A 9ANTA 2IPQX 4JQFA 3MZHA 5FD6A 2XVCA 3H3ZA 1VQLI 5HDKA 2J5OA 2L4MA 1T38A 4HA8A 5EJCA 3TW7A 3FZVA 5JR3A 4Y33A 4ESBA 1GVJA 3ABMH 2EV5A 4BYYA 4ZZLA 3ABLH 4DBRA 5HS7A 4NC8A 3F22A 5IYDJ 4M6YA 4A3KJ 2EPFA 5H20A 1GVDA 4XK4A 4CCNA 4OAYA 2MGQA 2VKHA 1TW2A 2OV7A 1B72B 3M8JA 5ICFA 3CCLI 3TP3A 3P7NA 3GTPJ 3CCMI 4F7ZA 1XC5A 2BY0A 3L00A 2FBIA 3OYNA 5M5YJ 3CF5F 4HF0A 2F5DA 2C6YA 2H94A 3HGYA 3PL8A 4B8XA 1XG1A 4Q5SF 2O9LA 3V8LA 3E5XA 2E5NA 1BJAA 3I71A 2OZ6A 2L9RA 1HSTA 3LSRA 1AWCA 3OYMA 4AIJA 2LFBA 3S3MA 2GXAA 3DF8A 5D6EA 5IT9Z 2OTJI 3AKZA 3ZCOA 1IC8A 3CESA 3BG3A 3GMEA 1HW5A 2UXXA 3G1LA 1UHMA 2P5KA 1FTZA 2BXZA 2L7FP 2W48A 4BY1J 4CHUA 2Z99A 3T0YA 2CQXA 3ZQHA 1LEAA 1XDSA 5LHHA 5TGTA 2ZMEC 5JVGF 2R0QC 4EM1A 1Z77A 2JA5J 1JUSA 3H5AA 3RTRA 2JQ7A 1AKHA 3J81K 1IXSB 1F1ZA 1SVOA 4HNTA 3P9IA 3F3XA 2ZXHA 4PGHA 2ME6A 5B3SH 3CP2A 3SEZA 3IL2A 5LRSA 2KKOA 2L7KA 1VQ9I 2ZSIB 1HDPA 2OF7A 2P4WA 2H09A 4BY7J 1P4AA 5C44J 4BXFA 3HRMA 2VOPA 1EH7A 1VNDA 5ILUA 5DM7F 1TW3A 3FX3A 3S2HJ 2L2OA 2CSOA 5HLHA 1J59A 1B6AA 5FLXZ 3K4KA 2CYYA 1W36D 2WY7Q 3I53A 2GA1A 1U6GA 4RGXA 4B44A 3MZ8A 3RPQA 3ZQGA 2J5PA 2GAUA 3QU6A 2E2JJ 1H9GA 3CQZJ 5BOXA 3IAM2 3BJOA 1Y8RB 2R5ZA 1BIAA 2NAZA 3GTMJ 2EIKH 3HSFA 3OS0A 1W5TA 5FKMA 4D9JA 1MKMA 4M3BA 4CICA 1ZAOA 3K4BA 3M8EA 3ZXSA 4Y4RA 2ZNZA 4XBFA 1K6OA 3ELKA 1JUMA 4CA0A 2IGKA 2G0EA 5CKTA 4IPAA 1S8NA 4JX4A 2EV6A 2EZIA 4DJAA 4ENJA 2MBFA 2NOJB 2IT0A 4CCMA 3Q0VA 3FXMA 1HCRA 2M9HA 3QP5A 1HXDA 3AFHA 1S9HA 1W4MA 2RAEA 4B3XA 2HTSA 3TOAA 4DZPA 4L5EA 4OMZA 1FPQA 4KJZA 4LJZF 2WV0A 2W4SA 5CVUA 2HQAA 2JK3A 3DPUA 3PNVA 2EZHA 3EYIA 4G9YA 2TRTA 4NC6A 2H8WA 4DW6A 3RKXA 3CCSI 2H8RA 1U0JA 1MH4A 1PP7U 1OR7A 4BEHB 2F5FA 3N05A 4S05A 3KP5A 5B1AH 2LLKA 2Q2EB 3BLYA 3UKGA 5FD5A 1REPC 1BBYA 3WTXC 1RR7A 3CDHA 1OMIA 3JAMZ 2K4BA 4L9VA 3MKZA 2XF7A 1BL0A 3CP8A 5GPAA 3DEUA 3HHHA 3HSEA 3M07A 2JSPA 4IHTA 2K9NA 2CU7A 3LSPA 2R7TA 1XGNA 2F5CA 2LC2A 1FMVA 2ZXIA 5J8FA 3L2RA 2NRAC 1PUFA 3JRBA 1WJDA 2WY8Q 2DTZA 3FXLA 4GGGA 1KA8A 1VQKI 3HM5A 2EJRA 5E1XA 5EEHA 5E3MA 4EEFG 1YJWI 1USTA 4HYEA 2K4JA 3GFMA 2QBYB 4S0HB 4AVZA 5GAGJ 4PJ0C 4UNOA 1XGMA 4LK1F 2ELHA 1YW9A 5H6QA 1RPWA 2W85A 4XLEA 2QCOA 2L54A 2LSOA 1DU6A 3QPSA 2GLOA 5F1JA 1GV2A 3LMMA 1HKQA 1VQ4I 3Q3SA 1MBKA 1F9NA 3W2VA 1H9TA 2LDUA 2HOAA 4A3IJ 4IRGA 1QPMA 3Q5FA 3IWZA 3P9KA 2VBWA 3K2AA 5FO5A 4FCYA 2DW4A 2M0CA 2DA2A 3AG2H 4NUBA 3KYCB 5E1WA 3WU1B 3CZ6A 3E6DA 3EUHA 4KYWA 3GTLJ 3GBGA 4XLAA 2WAFA 4C2UA 2XAQA 2XF6A 1Y8QB 1U78A 2JZYA 5J4YA 4A3DJ 3DPTA 1JKQC 2A68F 2VKEA 3VEPA 3P5JA 2FBHA 2LP0A 4WXCA 3V8KA 2KISA 3DTIA 2H6BA 4P1WA 2BY2A 2A6EF 2EQRA 2XGEA 3FBIB 3CDIA 4DQ2A 1ERDA 2ZJPF 2CS3A 1ZREA 3DLAA 4BQQA 4CCOA 2QA4I 1IG7A 2VXDA 4F52A 1K6YA 3A1YA 1I39A 2GOXB 1OYYA 3VFZA 1IN6A 4BBRJ 1P2FA 4GFBA 1KQ0A 2H6CA 3ERED 2XPWA 3BG6A 1G3TA 3BR6A 2EINH 2EV0A 4QLCU 1G8XA 1TWAJ 1FX7A 5F0HA 4WX9A 4B09A 2R5YA 2I5UA 4YFNF 5E79C 2ZB9A 2PMUA 1WVRA 1ZHFA 1ZG5A 1BW5A 5E20A 2DMTA 4OOIA 1HQCA 5JHUA 4M3FA 3TL4X 2WAEA 3OYKA 2WWYA 5TRDA 1OKRA 5B5EC 4RBOA 3GZ5A 1ZG1A 3IKTA 4G6DA 2XSJC 2ZFUA 5J1RA 2EBIA 2M8EA 2XC7A 1T2KA 3ZMUA 2CG4A 4GO1A 4M74A 5DCMB 2KDZA 1HDDC 1XCVA 3KFWX 4LIVA 3K1NA 2EFNA 2XAFA 2G7HA 2ACJA 1I5ZA 3KETA 4MHGA 2DOEA 5J40A 3OYGA 2EB7A 2RV8A 2R5YB 1AOYA 4RB1A 1LUJB 4V19K 5FB2A 2HI3A 3BZ6A 1ZGWA 2JA6J 1FYMA 3S3OA 5EEAA 3FIWA 2QYOA 2VJIA 2FRHA 3WHBA 3HOVJ 3DFGA 1ZRCA 1OR7C 3M1CA 2MC4A 3GO5A 4ZH4F 3O8GA 2LOOA 2EFQA 3L2WA 1K79A 5DD8A 4UVBA 4KUMA 1GXQA 2GIZA 2IP2A 4MIMA 1X1PA 5D5XB 2JMWA 2IBDA 4MQ9F 4CYCB 3CCQI 2ZSHB 2O6GE 1SAUA 1WCMJ 2STTA 3K70D 1TZLA 4QPQA 2P8TA 3W6JB 2B63J 3FMSA 2LH9A 4N0BA 3ECHA 4W97A 3FXUA 4IHYA 2E7WA 1Z7LA 2Q1ZB 1A04A 1MIJA 3CCJI 1J9IA 1FOXA 3IP4B 2LYCA 3C3WA 5M3MJ 3RKQA 1FYLA 3J7AO 2DN0A 2NS8A 3VSKA 1YS7A 3AG4H 3H3UA 1YQAA 2HYFA 1MBFA 3QYFA 3DKXA 2LR8A 2HPIA 3GZNB 1SFXA 2FNAA 3PUFA 4JX6A 2MLKA 1X2NA 2VXZA 5L3EA 5LD2C 2WTEA 1KU9A 5CJ9A 4DYRA 1DU0A 2LKXA 4L5IA 4WWCA 1FOWA 2VBXA 3L7WA 3K2ZA 3IH4A 4BJ6C 3HJEA 2HVSA 1WZ2A 4I0AA 1LEBA 2PI0A 3F0CA 2V1DA 3BR3A 3G73A 3ULQB 5FKKA 1FLIA 3HEFA 2CUEA 2MFZA 3SZGA 5IYBJ 3L9FA 3KX2A 2JPCA 4MFDA 2MYSA 1D3YA 2ETHA 4NQWA 2CWEA 3KIOA 1A6IA 1YS6A 2FBKA 3L2QA 3G1MA 5GP9A 3CMYA 1DUXC 1ITYA 1GT0C 4BJ5C 4U0WA 2KZGA 2LNBA 2HDCA 4UHTA 5HLTA 3PFIA 1SD4A 3C7JA 1RKWA 3HOUJ 5HDGA 4YEJA 1YG2A 2Y9ZA 5ICCA 3I3LA 4ON0A 3D5SC 2NVYJ 5IOZA 1P7JA 2XGCA 4IHWA 1S3JA 3JCUC 1N78A 4A3FJ 2HXIA 1B9MA 1GV5A 4Y13A 3LSKA 2COMA 1RIOH 1PUEE 4RAZA 3WG7H 5JVTA 1ON1A 2KMUA 4AUXA 3GEZA 4G7HF 1RR8C 3CUOA 2JJ7A 4M3GA 2YR2A 3H36A 1WH5A 2ISZA 3I55I 4HX8A 4A93J 4PDKA 4E7HA 1NK3P 3GCMA 3A02A 1GXPA 1XS9A 5DCMA 1G3YA 3I0TA 1UAAA 2K5CA 1QO0D 1YX5A 5J3LA 3L1PA 4C3JJ 2K86A 3DBHB 1T39A 2L5QA 4E7JA 1T95A 4RLFA 3JRHA 4RAFA 4D7NA 2QENA 2R5ZB 2E1MB 2DMPA 1E2XA 3UNGC 4A5NA 1MNEA 2F5VA 5GPCA 3JRFA 2AXLA 1K7AA 2QKMB 3F6OA 4LLGF 1X1BA 3K4CA 4KIFA 4Q4ZF 4UXNA 3BG9A 3GFLA 2AXTC 2X6OA 3DTKA 4Q47A 5CVJA 3SJMA 1ZRFA 2OBPA 4RMNA 3BPXA 3OYLA 1RNLA 1BI2A 4H4KC 4FHTA 4K2EA 1Y1WJ 5LHIA 1USSA 1JT6A 5C4JJ 1FOKA 3QOPA 2HXOA 3OYHA 2EFPA 1YO5C 1ENHA 5FJ8J 2DAOA 3ZMZA 5E18F 2R7WA 4XICA 2HKOA 2UZKA 3CJQB 4BQAA 1LPQA 1N25A 2QUFA 4EQQA 1B8IA 2HQ5A 3LNQA 1V55H 4X0GA 2EFOA 3VYTB 2PMZN 1VQ6I 1XTAA 1APLC 1MMSA 2V1NA 3CCYA 1Z67A 2KIMA 1GLNA 1WWXA 3H0GJ 1TWHJ 5BQTA 3HOYJ 3C2GA 1IV8A 2L9SA 3ZQCA 3CJNA 3S93A 1HLVA 2ECBA 1SD7A 5DEQA 1IAWA 2HEOA 5HS9A 3NQOA 5DM6F 1ETWA 4JX5A 2B0LA 2QSHX 1K61A 3SZTA 1U9NA 1GHCA 1WFXA 2DA4A 5F04A 2A6HF 4N9IA 4V2GA 4ZYDA 5DCFA 1KONA 2YPRA 5FLVA 1ZR4A 3PSFA 1XMAA 3ZRGA 4G6TB 4BXUA 1RC9A 2RGVA 1U2WA 1V4RA 4OIOF 1V5GA 1U8RA 2VQGA 3V4GA 1NG6A 3CMAI 4XONA 3TO6A 2ZJQF 4BHBA 3TDUC 4G6QA 4BGDA 1TTYA 4B43A 2NVQJ 2V9PA 4C3HJ 5ICEA 2K9LA 1MNDA 2DBBA 2IS2A 1H88C 1X3UA 4F55A 2OCEA 1FZPB 3BDDA 2DMNA 1E3PA 2WA0A 2BV6A 4OMYA 4UUTA 2XUBA 2BY1A 2RKHA 4RAYA 1QA6A 3PIOF 4QPOA 4RGRA 5AIQA 1ZR2A 1DDNA 2HU9A 2GIVA 3HYIA 4PJJA 4L9JA 4A3LJ 3R0AA 2K9MA 1IW7F 2YX7A 2X6WA 2BHZA 3JR9A 5KK1A 2VN2A 2DFFA 3J80Z 3S8PA 5L3FA 2W24A 4LLLA 2M7BA 3HSRA 4ZTJA 1YOVB 2DJIA 2NXNB 4QIWN 3N4MA 3KZYA 3QPTA 5J6XA 4CYCA 4YIIA 3J80K 1BA5A 4HW0A 4CZCA 4F91B 2ESNA 2MH2A 3CMEI 2WC2A 2R93J 4AD9A 4M6XA 1U9OA 1F5TA 3LSMA 3BT9A 4EM0B 1VQ7I 2E1MC 3N97A 4ZDOA 3MWMA 3V8JA 4I0BA 4M72A 4C3IJ 1NG7A 2P0WA 2P7VB 1ZLKA 1IXRC 1DGRM 5J4VA 3HKZA 1XX5A 5ED4A 3HTSB 5D4RA 5JLXA 2MG4A 2A5YB 4L9NA 3S17J 1HA8A 4PUSA 4U7DA 3LA3A 3GWZA 3GVAA 2XGXA 1R49A 2A69F 3FKIJ 4XLNF 5J1UA 2Y2ZA 4EMSA 5KVRA 2JPBA 3K7AJ 4OWRB 1OYIA 3K69A 3WU0A 4M9SA 3EQLF 2L9NA 1BM9A 2XIGA 2L7ZA 2IGNA 4FTHA 1B9NA 1FSEA 1D8KA 2Q8KA 3PO3J 2LF8A 1VQPI 3S32A 4HF2A 5FLXK 4EGZA 1TL8A 1RESA 4A3MJ 1POGA 4LG3A 5HS8A 4S04A 1S72I 3BG7A 1V5FA 3OOPA 2VB6A 3PNYA 1TQPA 1UZCA 2HKXA 4IEJA 4ASNA 4U7BA 1SD6A 2KRCA 1GDTA 4I02A 3BCBA 2IRFG 2QWWA 3EUAA 4AU7A 1A5JA 1V3FA 4IVNA 1HKSA 2QSFX 2EA2A 1I3AA 1Z7UA 1W1WE 3KEQA 1RZ4A 4M6VA 4WCGA 4WXDA 1G3WA 2JA2A 5L3CA 2KP6A 1YRNB 2R7QA 4BBSJ 3J81Z 2A3SA 3RPUA 2D45A 3WE2A 2LY9A 2ZXWH 4HSTA 2ZBKA 3KZIC 5IY5H 2VASA 1A36A 4I01A 3RCOA 1LJ9A 1R1VA 4MGRA 2D1HA 1O3QA 1ZYRF 1ODDA 2DFEA 4MTEA 2HZDA 4XNFA 1IN7A 2H27A 4AM3A 2MC3A 3LFUA 1ZK8A 3LSIA 5J47A 3BP8A 1LVAA 3M9AA 5K7ZA 2O61A 4A0YA 3KP3A 3KYLA 4XIDA 3S3NA 1QZZA 5C3EJ 3VYSB 2GA2A 5E3NA 2LREA 4M9XA 2ELJA 5F08A 2M5WA 3G2BA 3U9GA 1OCRH 2VKDA 3FHZA 4ZYEA 3HOSA 3K0LA 1WQ2A 2XGDA 1V54H 3M1EA 4OAZA 1BN5A 3HGGA 1C0WA 1AHDP 4BH9A 1RUOA 5E1ZB 2RVCA 1O7LA 2FMYA 1Z6RA 1D8JA 2E35A 2Y0SN 1WI3A 4YIFA 4XSZF 2VJ5A 3RSNA 4BE1A 2IW5A 4I6ZA 3TQNA 1XSXA 2BW3A 4U87A 2AO9A 3I4NJ 1QRYA 5DUIA 3SDGA 2HQNA 2IEKA 3HL2A 1FYKA 2MD0A 1HKTA 5LGUA 5AONA 2V79A 4M71A 5M5WJ 1KU7A 4N4NB 3E7LA 4LG0B 5LEJA 4D1QA 1NH3A 2BEOA 1MDMA 4RB0A 1OFCX 2DK8A 2R7FA 3QPLA 2EWNA 3LSTA 2CRGA 2MSYA 2WAQA 1Y0NA 4E70A 2QQAA 2Z2SB 4YG2F 2LMDA 1XGOA 3EUKL 4MEYF 2WADA 4E7KA 3F21A 4MLOA 5LEKA 4E6KG 1PP8F 4XMYA 2VODA 5FFXA 1G2HA 2XAUA 3TO7A 1O3RA 1D5YA 4KMFA 1MBJA 5JHFA 1IRFA 1XB4A 3CC7I 3CCEI 3AL0B 4FISA 3OYCA 2PX9A 2HWVA 3DWLE 2FQ3A 3ONQA 1L3LA 1P4WA 3DBLB 3GW2A 4KICA 3LOCA 4OIQF 2LY2A 3JW4A 2JA7J 1UG0A 2PEXA 3EUHC 1D1AA 2GOMA 3W2WA 4NDLA 4C9YA 1MH3A 1I3QJ 2IGMA 2AHQA 2R7DA 1R5GA 4HQEA 2R7UA 3DV8A 4TV7A 3HC7A 4GCVA 2XAHA 3HIFA 3F8BA 4PGGA 2PMZA 3MMYB 1K83J 3BCAA 3KP6A 1WJEA 1OYWA 5B1BH 2HFHA 3JRAA 4L18B 4EATA 2BHYA 2EFWA 1RETA 3TO9A 2GQQA 4B48A 3WODF 2JUCA 3KYDB 3WTUC 3G4SI 3FK7A 2ZCWA 4JK1X 1IZ1A 3KP4A 3ZOBA 2DT5A 4PK4A 3PNTA 3ERMA 3VWBA 2O5RA 3GF2A 4I2OA 5TISC 1YITI 3R0JA 3GTGJ 3K4LA 4IJAA 3JSPA 2QEXI 3CUQB 4CDGA 3D0SA 2W25A 1YYVA 5LHGA 4WK8F 4L5JA 1BI0A 3NWSA 4LK0F 1G59A 4M3EA 1ZTRA 5LGNA 1DPRA 5CVIA 1YIOA 1UMQA 3SQNA 3F6VA 2CW0F 1W5CC 1SFKA 3CO6C 2PMHA 2JRMA 2ZNYA 3GTKJ 1QVUA 4AIDA 2X48A 3O6BB 3HOTA 3MVPA 3TKYA 4U0YA 1ZGAA 2COBA 2FE3A 1UG2A 1FTTA 4FETA 1CQTA 4O6JA 2R7OA 2E1OA 2FF4A 4ENNA 1R23A 3HG9A 5D5WB 3MFKA 4UB8C 1BI1A 3QODA 3TGNA 3BTCA 1SC7A 2WV1A 3I4PA 4C2TA 3L2UA 1YE9A 3Q0WA 3SHFA 4BDZA 2PJRB 3DKWA 1IO2A 1D1BA 5EF6A 4XN3A 3LA7A 2LTPA 2M8GX 2OQGA 3MD2A 5F0CA 3SDBA 4KMUX 4A69C 3TOBA 2V6EA 1L0OC 2E2IJ 3RQ4A 2FU4A 2M4KA 1XPXA 4J00A 5HVQC 5FKNA 3ZQLA 3IHUA 1J09A 3H9GA 3MQ0A 1E3OC 1YW7A 4EV0A 4ZDLA 3ROUA 1BC7C 1BR1A 4Y17A 2P6SA 4ITVA 2FQ4A 1ZGJA 1ETYA 3CD6I 1WPKA 1TC3C 2FOKA 2DFIA 4MQVA 2A6TA 3E3VA 2QQ8A 2RREA 4IX7A 2ELKA 2XSDC 1R9TJ 2WB1N 2D2WA 4XR6A 4Y7NJ 2MW8A 4R8HA 3V7RA 4HLYA 5BPIA 1TLHB 5KHDA 5JLWA 2F4IA 4RLQA 3RI4A 3DLLF 4ZYAA 2JTVA 2CQ7A 3K4NA 2FNPA 5BMZA 4G8XA 1RRJA 3K6GA 2K7LA 3ECOA 6PAXA 3S2WA 4RM2A 1FWZA 1LE8B 1ZKGA 5DV5A 5ERIA 2PQ8A 4C30A 4KFCA 3HRTA 5B66C 4P5OA 2XKOA 2HYGD 1UB9A 2VT3A 4MO7A 1LQ1A 1HW2A 1BOBA 2PN6A 1A35A 2XASA 2KT0A 1K78A 2AS5F 4LIUA 2LKSA 3ML6A 1QZEA 5CLSA 2CV2A 3E5UA 1P92A 1JKRC 1XD7A 2W00A 1IUYA 3W3CA 1U5TC 5GAEJ 5K1YA 1N75A 1JUPA 3PIPF 1EF4A 4D7MA 1FJLA 3RYPA 1X1DA 2M3AA 3HRSA 1HOMA 3DCFA 5L3DA 3I5UA 2E2HJ 3S15J 2ZFWA 2FX0A 1MBGA 3FK6A 3SEQA 5IP6A 1LDJA 1VTNC 2XPUA 2CUJA 3DEEA 2DA6A 4CUGA 2HOSA 5E3LA 1QPIA 5GTHC 1Y6IA 2ZXJA 1Y56A 5KAFC 2MD5A 2QQ9A 2V1UA 2K9SA 5L3GA 5D5VB 2Z16A 2GXBA 4PJLA 3OV8A 4H0EA 1W5SA 3ZQIA 4EJVA 1BR4A 1SD5A 1I27A 3OL3A 1LNWA 2LF7A 2Z5UA 4OU0A 1TNTA 2DO7A 1RUNA 3ZPLA 1OCZH 4XM3A 1FIPA 3AAFA 1T0FC 3CO7C 2OC6A 1PJRA 4AIKA 5EGOB 1YJNI 1MBEA 3DEWA 3IH3A 2VI6A 2YS9A 4Y52J 1Z21A 2K27A 2N8GA 3FXQA 4ZJZA 3H5RA 3COAC 1Z3YA 3FXKA 5EZGA 3OYAA 4QTRA 3MKWB 3W2AA 1LFBA 2HOEA 2DJNA 3NRVA 2NNNA 4A3BJ 4MFEA 3O2PE 2QBYA 4N9HA 1FY7A 2NVUB 5K7FA 5D5UB 4FX0A 3S1MJ 1JE8A 4I98B 5DD4A 3DQVC 2JSCA 3R60A 4XORA 3S1NJ 3ABTA 1QHGA 1D0XA 1TBXA 2L01A 1ETXA 2Y30A 3K4MA 4NNJA 3PO2J 4D5FA 5KCMA 1ZELA 5J8CA 1PDNC 3WTVC 3AL0C 3L2CA 2ADUA 3BTJA 2DQRA 3QWLA 4BU2A 5EDNA 4G12A 2KHMA 1R71A 3FMRA 4GRIA 2DOFA 4KT6A 3SYTA 3QRFF 2YU9J 2RQQA 1BR2A 1LKXA 3A03A 1W0UA 1R5ID 2LBFB 1WRJA 4L0ZB 1AA7A 2X1EA 4E7ZA 4FQGA 1R1UA 2CW8A 4UVAA 2P81A 1DP7P 4UVCA 2IAIA 3E5QA 2HVQA 1LDDA 2UV1A 3ZP5A 1BC8C 2VBZA 2V26A 2DA5A 4ANJA 4UUSB 1TQIA 5DUKA 2P7CB 2L3DA 1U5TA 3NARA 3RPUD 2FUG2 1A31A 2BE5F 2Y0SA 2M7AA 2ISYA 3AG1H 1MSEC 1SANA 4M9ZA 3SXYA 3RZDJ 2R3SA 2ID6A 1XDUA 2JVGA 5BNGA 2DTRA 1IXCA 2LBFA 1XMXA 4OIRF 4FE7A 4PSXA 4A6EA 1BJZA 2UWMA 2HDWA 3BZKA 4YIRX 2MLGA 3B6CA 1V5EA 4RAGA 1QHHD 3FM3A 3I64A 3ISPA 3KEOA 3PQJA 1W36C 3VB2A 1R36A 5H2FC 2XKPA 3CUQC 3E97A 3LSJA 4BE2A 1KZHA 1WKMA 3SZPA 3G6EI 4CH7A 2DODA 3BROA 4XLFA 4QSHA 2IS4A 3JRIA 3U2RA 3RYRA 3C2HA 2GBYA 4D5CA 4P9UA 2VBYA 1W7PA 2FMLA 4IHXA 1YW8A 3KP2A 3ZMSA 3C2BA 3CDLA 3MKLA 4BS9A 4BAYA 2V1XA 3JAMK 4HLXA 3OYBA 1I6XA 5JFRA 1W0TA 4UY8I 3O3KA 4B3AA 4OIPF 2A05A 3FISA 3OOUA 2ID3A 1ZRDA 1R22A 4V2FA 1QBJA 5IT9K 1DP3A 5EGOA 2DLLA 3IV5A 3E6BA 3IRRA 2JUGA 4A3GJ 4DYQA 2X0LA 3A01B 2X1CA 4XKCA 2KIQA 3BR0A 1SVLA 1E3HA 3B02A 5CQEA 4A6DA 4X6AJ 2X4HA 4XOPA 2UUZA 2VL8A 4DIQA 1T6SA 2ME0A 4B47A 3J7ZI 2B9SA 1MJBA 4II2A 4Y3OA 2K85A 2BY3A 1SMYF 4XQFA 2VQCA 2ZC2A 2DDAA 1LFUP 3KPHA 4HPQA 2DXIA 3PQKA 4PSWA 4BL0B 2QM3A 5EEGA 3S2DJ 2F6CA 3PM1A 5J1YA 1UFMA 3E1SA 3JRDA 4HV5A 3F72A 4QWQA 5JI6A 3ZR8X 2V9VA 5K5QA 1NK2P 1LVKA 5LLQA 2F4MB 3GLXA 3H35A 1SEUA 2VLAA 4O3MA 4KDPA 2E7XA 2A5WA 3EPZA 3I59A 2IS6A 4HX7A 1R5HA 4LB5A 2L7MP 2XV4S 3HZJA 1MDMB 4BQNA 1SAXA 4P9FA 2D1VA 4IO9F 1CF7A 3CJRB 5F64A 1O4XA 3M3YJ 4OINF 2R7ZJ 3ZMVA 4ENMA 2K9QA 5E8IA 1WJBA 3FF5A 2DK5A 4PCQA 2BOLA 5EG0B 3WGGA 1FIAA 3GTQJ 1VFCA 4CSWA 1O57A 1ZARA 5DTDA 3OYDA 1CF7B 4BKXA 1T98A 1OJLA 2RDPA 1HSJA 3I59B 1XCBA 2OD5A 2BXYA 2FA5A 1DGWY 2JN6A 1J5YA 3JREA 2F5EA 4HAMA 1FP2A 4HDVA 1YIJI 4HF1A 2EILH 1T08B 3OIQA 5IP7J 4HOBA 5EYRA 3K4JA 3OIOA 4LMYA 1X4PA 2IA0A 1EKEA 2VIXA 5D8LB 3IKVA 2R7RA 2QVOA 3M4OJ 4P55A 1XN7A 1P6RA 2OAZA 1OISA 2VQHA 1W7PD 2VT2A 1R58A 1MW7A 3BR1A 2M1BA 3BG5A 4O5VA 2XRNA 4HRIA 3CC4I 1OCCH 2NS0A 2NVXJ 1QGPA 2IJLA 3B73A 1D5VA 5DYMA 2Y31A 3D5LA 5FLMJ 1PUFB 3KEYA 3V42A 2M2EA 4JOMA 4C2MJ 1EJ9A 3F23A 2NNYA 1NTCA 4XN0A 2V7FA 2A07F 1YHQI 5DDGA 4XRSA 4RB3C 2O8KA 4AWXB 3RQIA 3VYUB 3GTOJ 2XPVA 2P6TA 2HPMA 4I99C 3QQAA 2PJRA 1QQIA 2V6CA 4FE4A 1SFOJ 2XF5A 2HDDA 5CVRA 2LG4A 2PFBA 1KGSA 1EA3A 4CCJA 5LFAA 3V7CA 4AVPA 2YUSA 2ZMEA 2VOOA 2XB0X 3BZCA 2VPRA 2WB1A 3ZGKA 3HKZN 2X6YA 1T56A 2CGPA 3PJRA 1UELB 3VOEA 2H1KA 4YELA 5BPDA 3F8NA 2YSRA 3IH2A 3ASOH 3WTYC 1IDYA 1R6RA 2E71A 2Z9OA 1SFEA 2K02A 4HX4A 4HBLA 2I8DA 4BEHA 2XAGA 4XLHA 2OUMA 4LD5A 1J7KA 2BBYA 1I50J 1E17A 3C18A 3SFIA 5TJJA 3PUBA 4MEXF 1EH6A 1GUUA 5EZHA 1MGTA 4EVIA 2HVRA 2DPUA 4DZJA 1IGNA 1Y39A 4L9TA 1U3EM 4XRFA 3F9KA 2VKVA 4M3DA 4KISA 3U1KA 2E34A 1B59A 3LL7A 4BQOA 2Y0MA 4LOCA 3IUOA 3T8RA 5M3FJ 3ABKH 4UUSA 5IPAA 3GFJA 2CUZA 4PFPA 3FHNA 3TMOA 1BI3A 2KQRA 1JGSA 3ZN1A 3E6MA 3LSGA 5H6RA 1J75A 1XSVA 3BJ6A 3R4KA 3FMQA 2ZMEB 2L02A 5CPRB 3REOA 4KIBA 2DDBA 4A3CJ 5DS9A 3TW6A 2H1LA 1FMWA 1ACIA 2ZJRF 3EYYA 3W6VA 4KNYA 1VF9A 4WXHA 4A0XA 3LQQA 3HRUA 5F6FA 1H8AC 4RGUA 4CGZA 3I4MJ 1H0MA 2Z3YA 1ORKA 3GXOA 1G3SA 4KN7X 4DYCA 2ZKZA 4HDUA 3WGHA 3GZ6A 2DYSH 2VONA 5FRMA 2HTJA 4YRVA 2DOAA 1IUFA 3G71I 3DU5A 4BJTA 2LKPA 2DA1A 2OTLI 1IRZA 2VUMJ 3E6CC 1SVMA 2HYJA 2Y48A 5ILSA 4XRSG 2HQRA 4A2UA 1O3TA 4IL6C 1MBHA 3KCCA 1JHFA 3WU2C 1I6HJ 2DYRH 4XSXF 1OPCA 3KE2A 3BTIA 5A2QK 5D8KB 3HXLA 3JTHA 2M30A 2RQPA 4DGWB 4A3JJ 5LBQA 2VPLA 2CFOA 3A0HC 2PLYA 4KT5C 1I1GA 3BR2A 1ZN2A 3GX4X 2PBIA 5FROA 2VJ4A 2A61A 2G9WA 1JTYA 1HF0A 1R4MB 3ZQQA 3Q9SA 3X2QH 2NOGA 5HOOA 2WBMA 2I10A 1KYWA 2YX4A 4A12A 3HOZJ 2R7SA 3F8FA 3WE3A 1TNSA 1Z1DA 2K3FA 3K70C 3OYIA 1MJ9A 3F8CA 4W1UA 1X4OA 2EA4A 3FM5A 4NBQA 1HW1A 1JGGA 3HDDA 1D1CA 1CGPA 3CCRI 2HZTA 1IN8A 2MA3A 4F93B 4RDUA 1X3ZB 2QLZA 4CYDA 1ZH5A 2XDVA 2DU9A 5F27A 1RKTA 2KPMA 2OU2A 2QKLB 1IJWC 1D0YA 1ULYA 3OS2A 1M1EB 4NB5A 4XKWA 4HNVA 3M7GA 3QAHA 1LFPA 2CQQA 2PG4A 3LQRA 2IA2A 5M5XJ 1WJFA 2P5LC 3CLOA 5HLIA 3CJTB 3W6KB 1K78B 3R6SA 5E17F 2DT6A 3FBNB 1J2XA 1QZYA 1TP4A 1Y1VJ 3I58A 4HSRA 4BE0A 3S1QJ 2R4GA 4CO8A 3K1MA 1XMKA 2XHKA 4IHVA 3VODA 3S1RJ 1IV6A 3J7AY 3IC7A 4Q48A 1FNNA 1KU2A 1PVEA 4BDYA 4II3A 1R00A 1Z05A 3SFZA 1FEXA 2IGOA 3P9CA 1JHHA 2W1OA 2IS1A 1Y0UA 4XRMA 4MNUA 3MAJA 4NC7A 4E4HA 4UV9A 1LE8A 4ABZA 1DQUA 3CTAA 2DMQA 2KJCA 1MMAA 2EH3A 3K1PA 1F36A 2CQNA 1JJ8C 3BC8A 4U88A 1U8BA 1X1AA 3CMMA 4HNUA 2X9DA 1WI9A 1JKPC 4B4CA 2OJED 1Q1VA 2GXGA 3LA2A 3KP7A 4CCKA 2BVLA 3H9QA 4XOTA 3L09A 3J7YJ 2O03A 2VJJA 3DU6A 3Q0UA 1W7PB 2W82A 3Q9VA 4N4OB 1IN4A 2JWTA 3CCUI 1YRNA 2ZO4A 4HQMA 4IRIA 2NYXA 3OYEA 3DBRB 3D5RC 4ENKA 1S7AA 2EK5A 2HGCA 4GYGA 3QYBA 3WTTC 1TWFJ 1WSUA 4E7IA 4D0PA 1E0EA 1O7FA 3I9V2 4KITB 5A2QZ 1TWGJ 1ETOA 5HNHA 4LFUA 2KDOA 3VYRB 2L4AA 2LY1A 5CYVA 2Z1DA 2ICWG 4AYBA 3TP0A 5KAIC 3V7SA 3WTWC 4E7LA 1P9QC 3VPRA 3DKYA 4B1RA 2TDXA 2LK2A 3VSLA 1Z3XA 2Q2EA 4KN4X 5HDNA 3MN2A 1WGXA 1K4TA 1T33A 3ESWB 5ILVA 1RI7A 4PFOA 4DNCA 4JP0A 3WGIA 3MKYB 3S14J 4ZYHA 2YU3A 3MCZA 1MZBA 2FOWA 5C4XJ 3LFKA 2IVMA 5GAHJ 4F92B 3DTEA 2XRLA 1T0FA 3HUGA 2F4OB 4IRHA 2KIUA 4IQJA 2CMPA 4BHCA 3GLLA 2EZLA 1ZG3A 2K3PA 5FGMA 2G7UA 3FDYA 1WHUA 3CC2I 1X19A 3LAJA 3BOQA 1U5TB 2EIJH 2E1NA 4EM2A 3OR2C 3DXJF 1R4NB 3EDPA 2LRDA 1FBUA 3C1DA 3T5XA 1JXSA 4I76A 2P5VA 3OL4A 4I09A 1VQOI 2VE8A 3I54A 2M45A 1ZQ3P 3TBIA 5F1RA 2CO5A 2QZ8A 4HEA2 3B6AA 2O3FA 1YX3A 4G7ZF 3PFYA 2KJBA 4GDFA 1S5LC 2X1DA 2R92J 2MABA 5HLGA 4DOZA 2BVMA 1J0RA 4EJTA 4HV6A 2K40A 1WH7A 4G7OF 4MTDA 1QVTA 2E5ZA 1QU3A 3IRQA 5L3BA 1EH8A 1FSHA 1R7JA 3RJPA 3ZMDA 4GYIA 2Y75A 1MSFC 3MZYA 3BR5A 1K4SA 2HS5A 4GXOA 1OQYA 2E19A 3ZN0A 1S29A 2ECCA 1WJCA 3BJAA 3CCVI 4IOAF 3H1CA 3OIPA 2FSWA 1BIBA 4FT8A 1YTYA 3AG3H 2B7EA 1EV7A 1OCPA 1UCRA 1SMTA 3U21A 3QYEA 4A3EJ 2DT7B 4AC0A 4E7SA 4ZYGA 5D4SA 5E3OA
chains in the Genus database with same CATH topology
1DU6A 3QPSA 2GLOA 2Y9YA 1GV2A 5F1JA 1ZK8A 3Q3SA 3OSGA 1MBKA 1LFUP 3S16J 1P7IA 2HOAA 4A3IJ 2HOTA 2JA8J 3S2DJ 3HB9A 5K7ZA 3PM1A 3K2AA 5J1YA 4FCYA 1ETQA 5FKLA 2M0CA 3JRDA 4XIDA 2DA2A 1JT0A 3GTLJ 5C3EJ 1NK2P 3GBGA 5E3NA 2DMUA 5F08A 4AYBN 3JRGA 1U78A 4A3DJ 1JKQC 1B72A 2XGDA 2WAQN 2VKEA 1B8IB 2LP0A 3HGGA 1AHDP 2L7MP 2XGEA 2EQRA 2Y0SN 1WI3A 1IG7A 5FKOA 1OCTC 3D1NI 4I6ZA 2AO9A 1O4XA 3M3YJ 1QRYA 3I4NJ 4BBRJ 2R7ZJ 3SDGA 3ZQFA 4GFBA 2K9QA 2IEKA 2XPWA 3BR6A 1TWAJ 5M5WJ 5F0HA 5EG0B 1X58A 1FIAA 3E7LA 3GTQJ 2R5YA 1VFCA 5DTDA 1OFCX 2ZB9A 4BKXA 2OPTA 3QPLA 1OJLA 2CRGA 2MSYA 1BW5A 2DMTA 2TCTA 4M3FA 2JN6A 3JREA 4MLOA 1MNMC 4RBOA 3BTLA 5EG0A 4JYKA 5IP7J 1G2HA 5EYRA 3OIOA 1D5YA 5J1RA 1MBJA 2EBIA 5IYCJ 3M4OJ 3A01A 2KDZA 1HDDC 5HODA 3JRCA 4FISA 1IDZA 3LOCA 4J19A 3BR1A 2JA7J 3BG5A 2EZKA 2R5YB 3G1OA 4NDLA 2NVXJ 1MH3A 3BQYA 1I3QJ 1AU7A 3NAUA 2Y31A 5FLMJ 2AHQA 2HI3A 1PUFB 2M2EA 4C2MJ 1ZGWA 2JA6J 5K7HA 1NTCA 5EEAA 3FIWA 4XRSA 3WHBA 3HOVJ 2O8KA 2CJJA 3RQIA 3GTOJ 2XPVA 1K83J 3QQAA 3O8GA 4FE4A 1SFOJ 2HDDA 1BW6A 3WHCA 2DA7A 3JRAA 2FJ1A 4MIMA 1RETA 2YUSA 1H89C 2JMWA 2XB0X 2VPRA 2IBDA 4CYCB 3HKZN 1ETKA 3FK7A 3OSFA 1T56A 1WCMJ 1F43A 5IP9J 2H1KA 3ZOBA 2B63J 3IH2A 5F0FA 1TWCJ 1IDYA 4W97A 4IHYA 3GTGJ 5IOYA 2L0KA 2DA3A 2XB5A 5M3MJ 1Z0XA 3RKQA 2DN0A 2NS8A 3HBLA 1VI0A 2M34A 1I50J 3O8HA 1ZTRA 4M3EA 1MBFA 3SFIA 2O7OA 2LR8A 1UMQA 1GUUA 5EZHA 1JJ6C 4JX6A 4DZJA 2LVSA 1IGNA 1X2NA 3TEDA 3GTKJ 1QVUA 2VKVA 4M3DA 2X48A 4DYRA 3MVPA 1DU0A 2LKXA 4LOCA 2CUFA 2COBA 3IH4A 1UG2A 1FTTA 1CQTA 5M3FJ 2E1OA 4UUSA 5IPAA 1ETVA 3F0CA 3BR3A 2QF7A 5FKKA 2NVTJ 3HEFA 2CUEA 3LSGA 1S7EA 1JTXA 3BTCA 2WV1A 5IYBJ 1JKOC 4MFDA 4A3CJ 5DS9A 3TW6A 3Q0WA 4X1EA 3W6VA 3RZOJ 2D5VA 1VF9A 1A6IA 5EF6A 2LTPA 2M8GX 3G1MA 5GP9A 5F0CA 3CMYA 1ITYA 1H8AC 3I4MJ 4A69C 1ORKA 4DYCA 1GT0C 1UHSA 2NS7A 2E2IJ 5FKNA 3ZQLA 1IUFA 1E3OC 2DA1A 3GTJJ 1RKWA 1IRZA 3BQZA 2VUMJ 3HOUJ 2FD5A 2HYJA 1X2MA 4XRSG 2LD5A 3HOWJ 2Y9ZA 1MBHA 2NVYJ 5IOZA 4IHWA 1P7JA 2XGCA 2FQ4A 1I6HJ 1ETYA 1AKHB 1WPKA 3BTIA 4A3FJ 4BXXJ 2HXIA 1TC3C 4A3JJ 1GV5A 3BR2A 4AUXA 3HOXJ 2ELKA 2XSDC 1R9TJ 2WB1N 1JTYA 1HF0A 2JJ7A 4M3GA 4Y7NJ 2MW8A 1WH5A 2NOGA 4A93J 2I10A 5JLWA 3HOZJ 1NK3P 3H3VK 3A02A 4W1UA 1XS9A 1JGGA 3HDDA 2GM4A 3L1PA 5J3LA 9ANTA 4C3JJ 4RDUA 1LE8B 5F27A 1ZKGA 1RKTA 3JRHA 4MO7A 4D7NA 2R5ZB 1IJWC 2DMPA 5GPCA 3JRFA 2KT0A 3TW7A 4HNVA 2CQQA 5M5XJ 1JKRC 3BG9A 2X6OA 3SJMA 5IYDJ 4A3KJ 1JUPA 1GVDA 4XK4A 1EF4A 4D7MA 1FJLA 2MGQA 1Y1VJ 1B72B 3DCFA 3S1QJ 1HOMA 2E2HJ 1Y1WJ 3TP3A 3S15J 3GTPJ 2FX0A 4IHVA 1MBGA 1JT6A 1XC5A 3FK6A 5IP6A 5C4JJ 3S1RJ 1IV6A 2XPUA 2HXOA 5M5YJ 3HGYA 1ENHA 1XG1A 2DA6A 5FJ8J 2O9LA 2HOSA 5E3LA 4XICA 1QPIA 2L9RA 1FEXA 3LSRA 1B8IA 2HQ5A 3LNQA 2LFBA 2K9SA 1IC8A 2PMZN 3BG3A 1APLC 3ZQIA 4XRMA 3G1LA 3CCYA 3H0GJ 1FTZA 1TWHJ 1LE8A 3HOYJ 2L7FP 2W48A 4ABZA 4BY1J 2DMQA 3ZQCA 1HLVA 2ECBA 2CQXA 3ZQHA 1FIPA 2EH3A 2R0QC 1ETWA 1Z77A 4JX5A 2JA5J 1F36A 1JUSA 5EGOB 1K61A 1AKHA 1JJ8C 1MBEA 3DEWA 3IH3A 2VI6A 2YS9A 4Y52J 1U8BA 2N8GA 1U9NA 2DA4A 5F04A 2X9DA 5EZGA 2ME6A 1JKPC 4B4CA 4V2GA 1Q1VA 4QTRA 5FLVA 1LFBA 2DJNA 1HDPA 1ZR4A 2OF7A 4A3BJ 4MFEA 4BY7J 3Q0UA 5K7FA 3S1MJ 5C44J 1VNDA 3S1NJ 2JWTA 3S2HJ 1YRNA 2Y30A 1ETXA 3PO2J 4D5FA 2NVQJ 4C3HJ 1H88C 3ZQGA 2E2JJ 1TWFJ 2DMNA 3BTJA 4UUTA 3CQZJ 5EDNA 4G12A 1TWGJ 1ETOA 2R5ZA 1ZR2A 3GTMJ 2YU9J 5FKMA 4A3LJ 3A03A 3TP0A 4M3BA 1W0UA 3VPRA 4B1RA 2LK2A 3JR9A 3MN2A 1WGXA 1T33A 2P81A 4JP0A 1JUMA 3S14J 2IAIA 2G0EA 4QIWN 4JX4A 4CYCA 1BA5A 5C4XJ 2EZIA 2R93J 1U9OA 2XRLA 3Q0VA 2DA5A 4UUSB 3BT9A 1HCRA 2M9HA 3NARA 4C3IJ 2EZLA 2RAEA 1MSEC 1SANA 4DZPA 3RZDJ 2ID6A 4L5EA 5JLXA 2MG4A 5BNGA 2JK3A 3S17J 2EZHA 4FE7A 1BJZA 3FKIJ 4I76A 3B6CA 5J1UA 2TRTA 2Y2ZA 3K7AJ 4DW6A 2H8RA 1MH4A 1ZQ3P 2L7ZA 3B6AA 4FTHA 2LLKA 2R92J 3LSJA 3UKGA 3PO3J 1RR7A 1RESA 4A3MJ 1POGA 4QSHA 1BL0A 5GPAA 2K40A 3JRIA 2GBYA 4D5CA 1WH7A 4IEJA 2K9NA 1GDTA 4IHXA 2CU7A 3LSPA 1QVTA 3C2BA 3CDLA 3MKLA 1PUFA 3JRBA 1W0TA 1A5JA 2DTZA 4B3AA 3FISA 1MSFC 3OOUA 3BR5A 2ID3A 4M6VA 3HM5A 2E19A 1YRNB 4V2FA 5E3MA 4BBSJ 2ECCA 5EGOA 3IV5A 4EEFG 2LY9A 4DYQA 4A3GJ 3A01B 3BR0A 1OCPA 4S0HB 4X6AJ 4A3EJ 4AC0A 2ME0A 1RPWA 2QCOA 5E3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU6 A;  3QPS A;  2GLO A;  2Y9Y A;  1GV2 A;  5F1J A;  1ZK8 A;  3Q3S A;  3OSG A;  1MBK A;  1LFU P;  3S16 J;  1P7I A;  2HOA A;  4A3I J;  2HOT A;  2JA8 J;  3S2D J;  3HB9 A;  5K7Z A;  3PM1 A;  3K2A A;  5J1Y A;  4FCY A;  1ETQ A;  5FKL A;  2M0C A;  3JRD A;  4XID A;  2DA2 A;  1JT0 A;  3GTL J;  5C3E J;  1NK2 P;  3GBG A;  5E3N A;  2DMU A;  5F08 A;  4AYB N;  3JRG A;  1U78 A;  4A3D J;  1JKQ C;  1B72 A;  2XGD A;  2WAQ N;  2VKE A;  1B8I B;  2LP0 A;  3HGG A;  1AHD P;  2L7M P;  2XGE A;  2EQR A;  2Y0S N;  1WI3 A;  1IG7 A;  5FKO A;  1OCT C;  3D1N I;  4I6Z A;  2AO9 A;  1O4X A;  3M3Y J;  1QRY A;  3I4N J;  4BBR J;  2R7Z J;  3SDG A;  3ZQF A;  4GFB A;  2K9Q A;  2IEK A;  2XPW A;  3BR6 A;  1TWA J;  5M5W J;  5F0H A;  5EG0 B;  1X58 A;  1FIA A;  3E7L A;  3GTQ J;  2R5Y A;  1VFC A;  5DTD A;  1OFC X;  2ZB9 A;  4BKX A;  2OPT A;  3QPL A;  1OJL A;  2CRG A;  2MSY A;  1BW5 A;  2DMT A;  2TCT A;  4M3F A;  2JN6 A;  3JRE A;  4MLO A;  1MNM C;  4RBO A;  3BTL A;  5EG0 A;  4JYK A;  5IP7 J;  1G2H A;  5EYR A;  3OIO A;  1D5Y A;  5J1R A;  1MBJ A;  2EBI A;  5IYC J;  3M4O J;  3A01 A;  2KDZ A;  1HDD C;  5HOD A;  3JRC A;  4FIS A;  1IDZ A;  3LOC A;  4J19 A;  3BR1 A;  2JA7 J;  3BG5 A;  2EZK A;  2R5Y B;  3G1O A;  4NDL A;  2NVX J;  1MH3 A;  3BQY A;  1I3Q J;  1AU7 A;  3NAU A;  2Y31 A;  5FLM J;  2AHQ A;  2HI3 A;  1PUF B;  2M2E A;  4C2M J;  1ZGW A;  2JA6 J;  5K7H A;  1NTC A;  5EEA A;  3FIW A;  4XRS A;  3WHB A;  3HOV J;  2O8K A;  2CJJ A;  3RQI A;  3GTO J;  2XPV A;  1K83 J;  3QQA A;  3O8G A;  4FE4 A;  1SFO J;  2HDD A;  1BW6 A;  3WHC A;  2DA7 A;  3JRA A;  2FJ1 A;  4MIM A;  1RET A;  2YUS A;  1H89 C;  2JMW A;  2XB0 X;  2VPR A;  2IBD A;  4CYC B;  3HKZ N;  1ETK A;  3FK7 A;  3OSF A;  1T56 A;  1WCM J;  1F43 A;  5IP9 J;  2H1K A;  3ZOB A;  2B63 J;  3IH2 A;  5F0F A;  1TWC J;  1IDY A;  4W97 A;  4IHY A;  3GTG J;  5IOY A;  2L0K A;  2DA3 A;  2XB5 A;  5M3M J;  1Z0X A;  3RKQ A;  2DN0 A;  2NS8 A;  3HBL A;  1VI0 A;  2M34 A;  1I50 J;  3O8H A;  1ZTR A;  4M3E A;  1MBF A;  3SFI A;  2O7O A;  2LR8 A;  1UMQ A;  1GUU A;  5EZH A;  1JJ6 C;  4JX6 A;  4DZJ A;  2LVS A;  1IGN A;  1X2N A;  3TED A;  3GTK J;  1QVU A;  2VKV A;  4M3D A;  2X48 A;  4DYR A;  3MVP A;  1DU0 A;  2LKX A;  4LOC A;  2CUF A;  2COB A;  3IH4 A;  1UG2 A;  1FTT A;  1CQT A;  5M3F J;  2E1O A;  4UUS A;  5IPA A;  1ETV A;  3F0C A;  3BR3 A;  2QF7 A;  5FKK A;  2NVT J;  3HEF A;  2CUE A;  3LSG A;  1S7E A;  1JTX A;  3BTC A;  2WV1 A;  5IYB J;  1JKO C;  4MFD A;  4A3C J;  5DS9 A;  3TW6 A;  3Q0W A;  4X1E A;  3W6V A;  3RZO J;  2D5V A;  1VF9 A;  1A6I A;  5EF6 A;  2LTP A;  2M8G X;  3G1M A;  5GP9 A;  5F0C A;  3CMY A;  1ITY A;  1H8A C;  3I4M J;  4A69 C;  1ORK A;  4DYC A;  1GT0 C;  1UHS A;  2NS7 A;  2E2I J;  5FKN A;  3ZQL A;  1IUF A;  1E3O C;  2DA1 A;  3GTJ J;  1RKW A;  1IRZ A;  3BQZ A;  2VUM J;  3HOU J;  2FD5 A;  2HYJ A;  1X2M A;  4XRS G;  2LD5 A;  3HOW J;  2Y9Z A;  1MBH A;  2NVY J;  5IOZ A;  4IHW A;  1P7J A;  2XGC A;  2FQ4 A;  1I6H J;  1ETY A;  1AKH B;  1WPK A;  3BTI A;  4A3F J;  4BXX J;  2HXI A;  1TC3 C;  4A3J J;  1GV5 A;  3BR2 A;  4AUX A;  3HOX J;  2ELK A;  2XSD C;  1R9T J;  2WB1 N;  1JTY A;  1HF0 A;  2JJ7 A;  4M3G A;  4Y7N J;  2MW8 A;  1WH5 A;  2NOG A;  4A93 J;  2I10 A;  5JLW A;  3HOZ J;  1NK3 P;  3H3V K;  3A02 A;  4W1U A;  1XS9 A;  1JGG A;  3HDD A;  2GM4 A;  3L1P A;  5J3L A;  9ANT A;  4C3J J;  4RDU A;  1LE8 B;  5F27 A;  1ZKG A;  1RKT A;  3JRH A;  4MO7 A;  4D7N A;  2R5Z B;  1IJW C;  2DMP A;  5GPC A;  3JRF A;  2KT0 A;  3TW7 A;  4HNV A;  2CQQ A;  5M5X J;  1JKR C;  3BG9 A;  2X6O A;  3SJM A;  5IYD J;  4A3K J;  1JUP A;  1GVD A;  4XK4 A;  1EF4 A;  4D7M A;  1FJL A;  2MGQ A;  1Y1V J;  1B72 B;  3DCF A;  3S1Q J;  1HOM A;  2E2H J;  1Y1W J;  3TP3 A;  3S15 J;  3GTP J;  2FX0 A;  4IHV A;  1MBG A;  1JT6 A;  1XC5 A;  3FK6 A;  5IP6 A;  5C4J J;  3S1R J;  1IV6 A;  2XPU A;  2HXO A;  5M5Y J;  3HGY A;  1ENH A;  1XG1 A;  2DA6 A;  5FJ8 J;  2O9L A;  2HOS A;  5E3L A;  4XIC A;  1QPI A;  2L9R A;  1FEX A;  3LSR A;  1B8I A;  2HQ5 A;  3LNQ A;  2LFB A;  2K9S A;  1IC8 A;  2PMZ N;  3BG3 A;  1APL C;  3ZQI A;  4XRM A;  3G1L A;  3CCY A;  3H0G J;  1FTZ A;  1TWH J;  1LE8 A;  3HOY J;  2L7F P;  2W48 A;  4ABZ A;  4BY1 J;  2DMQ A;  3ZQC A;  1HLV A;  2ECB A;  2CQX A;  3ZQH A;  1FIP A;  2EH3 A;  2R0Q C;  1ETW A;  1Z77 A;  4JX5 A;  2JA5 J;  1F36 A;  1JUS A;  5EGO B;  1K61 A;  1AKH A;  1JJ8 C;  1MBE A;  3DEW A;  3IH3 A;  2VI6 A;  2YS9 A;  4Y52 J;  1U8B A;  2N8G A;  1U9N A;  2DA4 A;  5F04 A;  2X9D A;  5EZG A;  2ME6 A;  1JKP C;  4B4C A;  4V2G A;  1Q1V A;  4QTR A;  5FLV A;  1LFB A;  2DJN A;  1HDP A;  1ZR4 A;  2OF7 A;  4A3B J;  4MFE A;  4BY7 J;  3Q0U A;  5K7F A;  3S1M J;  5C44 J;  1VND A;  3S1N J;  2JWT A;  3S2H J;  1YRN A;  2Y30 A;  1ETX A;  3PO2 J;  4D5F A;  2NVQ J;  4C3H J;  1H88 C;  3ZQG A;  2E2J J;  1TWF J;  2DMN A;  3BTJ A;  4UUT A;  3CQZ J;  5EDN A;  4G12 A;  1TWG J;  1ETO A;  2R5Z A;  1ZR2 A;  3GTM J;  2YU9 J;  5FKM A;  4A3L J;  3A03 A;  3TP0 A;  4M3B A;  1W0U A;  3VPR A;  4B1R A;  2LK2 A;  3JR9 A;  3MN2 A;  1WGX A;  1T33 A;  2P81 A;  4JP0 A;  1JUM A;  3S14 J;  2IAI A;  2G0E A;  4QIW N;  4JX4 A;  4CYC A;  1BA5 A;  5C4X J;  2EZI A;  2R93 J;  1U9O A;  2XRL A;  3Q0V A;  2DA5 A;  4UUS B;  3BT9 A;  1HCR A;  2M9H A;  3NAR A;  4C3I J;  2EZL A;  2RAE A;  1MSE C;  1SAN A;  4DZP A;  3RZD J;  2ID6 A;  4L5E A;  5JLX A;  2MG4 A;  5BNG A;  2JK3 A;  3S17 J;  2EZH A;  4FE7 A;  1BJZ A;  3FKI J;  4I76 A;  3B6C A;  5J1U A;  2TRT A;  2Y2Z A;  3K7A J;  4DW6 A;  2H8R A;  1MH4 A;  1ZQ3 P;  2L7Z A;  3B6A A;  4FTH A;  2LLK A;  2R92 J;  3LSJ A;  3UKG A;  3PO3 J;  1RR7 A;  1RES A;  4A3M J;  1POG A;  4QSH A;  1BL0 A;  5GPA A;  2K40 A;  3JRI A;  2GBY A;  4D5C A;  1WH7 A;  4IEJ A;  2K9N A;  1GDT A;  4IHX A;  2CU7 A;  3LSP A;  1QVT A;  3C2B A;  3CDL A;  3MKL A;  1PUF A;  3JRB A;  1W0T A;  1A5J A;  2DTZ A;  4B3A A;  3FIS A;  1MSF C;  3OOU A;  3BR5 A;  2ID3 A;  4M6V A;  3HM5 A;  2E19 A;  1YRN B;  4V2F A;  5E3M A;  4BBS J;  2ECC A;  5EGO A;  3IV5 A;  4EEF G;  2LY9 A;  4DYQ A;  4A3G J;  3A01 B;  3BR0 A;  1OCP A;  4S0H B;  4X6A J;  4A3E J;  4AC0 A;  2ME0 A;  1RPW A;  2QCO A;  5E3O A; 
#chains in the Genus database with same CATH topology
 1KU3 A;  3NEU A;  2Y9Y A;  2ZJ2 A;  4A5M A;  2M0M A;  2KZV A;  4YFX F;  3OSG A;  1FBQ A;  3S16 J;  1P7I A;  4RB2 C;  2HOT A;  2OA4 A;  2JA8 J;  3HB9 A;  1OLT A;  4LGW A;  3VDX A;  3FKJ A;  1ETQ A;  1S7O A;  5FKL A;  4IHS A;  1TT5 B;  3FXR A;  2HNH A;  3LAP A;  1FOY A;  1JT0 A;  1ZLJ A;  1LDK B;  4EJW A;  1UJ8 A;  3H9J A;  2DMU A;  4Y15 A;  3CLQ A;  4AYB N;  3JRG A;  1LB2 A;  3IWF A;  4ESF A;  1B72 A;  3BPV A;  2WAQ N;  4F3Q A;  1FT9 A;  2FEZ A;  1B8I B;  1WJA A;  1N77 A;  4P96 A;  2M4G A;  1IN5 A;  1ONV A;  4IXA A;  2BW3 B;  3KZZ A;  4BUP A;  4ESJ A;  3PSI A;  4PZJ A;  4RS8 A;  5FKO A;  1OCT C;  3D1N I;  3RIR A;  1B4A A;  2V9K A;  1PYV A;  2BYV E;  1MJA A;  3CF2 A;  5E8G A;  4LLN A;  1JI8 A;  3ZQF A;  1KYZ A;  2FXA A;  1Z6T A;  1A6Q A;  2KRF A;  2KLO A;  3QPH A;  1Z91 A;  4XKB A;  1HBX G;  1TQM A;  3HPG A;  2CQK A;  2VQL A;  5K5R A;  1X58 A;  3FXO A;  4BHP A;  3OYJ A;  4RA2 A;  1XSD A;  2R7V A;  4LIT A;  4CCL A;  4KA4 A;  4FAS D;  2OPT A;  3OMY A;  4M73 A;  4UB6 C;  3WG9 A;  4L0Y B;  2TCT A;  4XL9 A;  2CH0 A;  3H0D A;  2Z33 A;  1STZ A;  2HR3 A;  4J01 A;  2RNJ A;  1MNM C;  2AQE A;  1G4D A;  4BNC A;  3BTL A;  3HHG A;  5EG0 A;  4JYK A;  2E1C A;  1FC3 A;  2X6X A;  5IYC J;  4EGY A;  1UHW A;  3A01 A;  3A2K A;  5HOD A;  3JRC A;  4NHJ A;  4U0V A;  3QP6 A;  1VQN I;  2QSG X;  2BGC A;  3A4C A;  3R61 A;  2ESH A;  2F48 A;  1IDZ A;  4Z2Y A;  4J19 A;  4EJO A;  2QGU A;  2EZK A;  3ASN H;  3T8T A;  3OYF A;  1WJ5 A;  2Q0O A;  3G1O A;  3BQY A;  1AU7 A;  3NAU A;  1O3S A;  1HC8 A;  1MD0 A;  2RNG A;  5D6F A;  4WF2 A;  4ZC3 A;  4YFK F;  2W7N A;  1Z9C A;  3BY6 A;  3E0J B;  5K7H A;  3ZMT A;  1YLF A;  5GTI C;  4R1H A;  2CJJ A;  2X85 A;  4FX4 A;  1IRX A;  1D0Z A;  2CW7 A;  2GWR A;  4HZF A;  5IT3 A;  2E60 A;  1P4X A;  4XKV A;  2PJP A;  2M87 A;  3KLO A;  4IF4 A;  2KFD A;  1BW6 A;  3OR1 C;  3WHC A;  2DA7 A;  2STW A;  3DP7 A;  2FJ1 A;  2DI3 A;  1YJ9 I;  1VZ0 A;  3IAS 2;  1H89 C;  2KL4 A;  4AIH A;  3EET A;  1ETK A;  3H5N A;  4G94 A;  3HPH A;  2Y69 H;  3OSF A;  1MMD A;  1F43 A;  1X1C A;  5IP9 J;  3BWG A;  3DPL C;  5F0F A;  5BS6 A;  3T1B A;  1TWC J;  3F8M A;  5FRN A;  3G3Z A;  1IF1 A;  4NQW B;  2CV1 A;  1DPU A;  2OQR A;  5IOY A;  2L0K A;  1KQ9 A;  2DA3 A;  2IXS A;  2XB5 A;  1Z0X A;  3HBL A;  3QOE A;  1VI0 A;  2AQF A;  3GYH X;  3HTU A;  1MMG A;  1QNT A;  1R1T A;  3K10 A;  3OWT A;  4ZDP A;  2M34 A;  1VQM I;  3O8H A;  2RN7 A;  4R79 A;  3CUQ A;  3GUD A;  2O7O A;  1VQ5 I;  3RKW A;  3UR3 C;  1JJ6 C;  2DQL A;  2CFX A;  1YI2 I;  2LVS A;  4ZZD A;  3TED A;  2X51 A;  4PJN A;  5FFZ A;  1FBS A;  3M8F A;  2VC1 A;  4BAC A;  2JRT A;  2O0Y A;  3ZQ7 A;  4PJM A;  3H92 A;  2CUF A;  3TDZ C;  4UUV A;  2DCE A;  1T8I A;  3WTS C;  3L2V A;  1SFU A;  1ETV A;  4HG2 A;  4IOC F;  3FXJ A;  5HNF A;  2VE9 A;  2QF7 A;  2NVT J;  1MMN A;  1IRG A;  1S7E A;  1JTX A;  4CZZ A;  2XAJ A;  3OS1 A;  4IZZ A;  1JKO C;  3LSH A;  1Q1H A;  2BZT A;  2JVH A;  3OY9 A;  1OCO H;  2OZU A;  4RM3 A;  2W57 A;  4X1E A;  2R7X A;  4KIG A;  3RZO J;  2D5V A;  4UV8 A;  2MH9 A;  5KNL A;  1FP1 D;  3RKY A;  4I7H A;  2KIF A;  1KQ8 A;  3KLN A;  1NHA A;  2V4J C;  3I56 I;  3GFI A;  3RDI A;  2DPD A;  1UHS A;  2IA1 A;  2NS7 A;  1I1S A;  3U1D A;  3QU3 A;  4ETS A;  3HUG B;  4RGS A;  3GTJ J;  3NWT A;  1BOA A;  3BQZ A;  2EIM H;  3JTG A;  2FD5 A;  3LWF A;  1X2M A;  2OCC H;  2O8X A;  4JBA A;  4XLP F;  2LD5 A;  3HOW J;  5K5O A;  2GZW A;  5LRR A;  2VC0 A;  2W84 A;  2UXN A;  3FWE A;  5ICG A;  2E36 A;  3WTZ A;  3K9T A;  5AIP A;  1AKH B;  5GAD J;  1X3W B;  4BXX J;  4IKF A;  5CVV A;  4ZTF A;  2L9V A;  1YFH A;  3HOX J;  1XGS A;  3MEX A;  4EJU A;  1VQ8 I;  2QQB A;  1TT0 A;  2CV0 A;  2JT1 A;  1G6N A;  4XLC A;  4IQ4 A;  2DFH A;  4A0Z A;  3A0B C;  4CXF A;  4Z6Y A;  1B1B A;  4DBQ A;  4LB6 B;  5LGT A;  2F2E A;  1ON2 A;  2RC4 A;  1F4K A;  3H3V K;  3JSO A;  2KRH A;  5CQG A;  2XRO A;  3ABU A;  2GM4 A;  1S6L A;  4LG0 A;  9ANT A;  2IPQ X;  4JQF A;  3MZH A;  5FD6 A;  2XVC A;  3H3Z A;  1VQL I;  5HDK A;  2J5O A;  2L4M A;  1T38 A;  4HA8 A;  5EJC A;  3TW7 A;  3FZV A;  5JR3 A;  4Y33 A;  4ESB A;  1GVJ A;  3ABM H;  2EV5 A;  4BYY A;  4ZZL A;  3ABL H;  4DBR A;  5HS7 A;  4NC8 A;  3F22 A;  5IYD J;  4M6Y A;  4A3K J;  2EPF A;  5H20 A;  1GVD A;  4XK4 A;  4CCN A;  4OAY A;  2MGQ A;  2VKH A;  1TW2 A;  2OV7 A;  1B72 B;  3M8J A;  5ICF A;  3CCL I;  3TP3 A;  3P7N A;  3GTP J;  3CCM I;  4F7Z A;  1XC5 A;  2BY0 A;  3L00 A;  2FBI A;  3OYN A;  5M5Y J;  3CF5 F;  4HF0 A;  2F5D A;  2C6Y A;  2H94 A;  3HGY A;  3PL8 A;  4B8X A;  1XG1 A;  4Q5S F;  2O9L A;  3V8L A;  3E5X A;  2E5N A;  1BJA A;  3I71 A;  2OZ6 A;  2L9R A;  1HST A;  3LSR A;  1AWC A;  3OYM A;  4AIJ A;  2LFB A;  3S3M A;  2GXA A;  3DF8 A;  5D6E A;  5IT9 Z;  2OTJ I;  3AKZ A;  3ZCO A;  1IC8 A;  3CES A;  3BG3 A;  3GME A;  1HW5 A;  2UXX A;  3G1L A;  1UHM A;  2P5K A;  1FTZ A;  2BXZ A;  2L7F P;  2W48 A;  4BY1 J;  4CHU A;  2Z99 A;  3T0Y A;  2CQX A;  3ZQH A;  1LEA A;  1XDS A;  5LHH A;  5TGT A;  2ZME C;  5JVG F;  2R0Q C;  4EM1 A;  1Z77 A;  2JA5 J;  1JUS A;  3H5A A;  3RTR A;  2JQ7 A;  1AKH A;  3J81 K;  1IXS B;  1F1Z A;  1SVO A;  4HNT A;  3P9I A;  3F3X A;  2ZXH A;  4PGH A;  2ME6 A;  5B3S H;  3CP2 A;  3SEZ A;  3IL2 A;  5LRS A;  2KKO A;  2L7K A;  1VQ9 I;  2ZSI B;  1HDP A;  2OF7 A;  2P4W A;  2H09 A;  4BY7 J;  1P4A A;  5C44 J;  4BXF A;  3HRM A;  2VOP A;  1EH7 A;  1VND A;  5ILU A;  5DM7 F;  1TW3 A;  3FX3 A;  3S2H J;  2L2O A;  2CSO A;  5HLH A;  1J59 A;  1B6A A;  5FLX Z;  3K4K A;  2CYY A;  1W36 D;  2WY7 Q;  3I53 A;  2GA1 A;  1U6G A;  4RGX A;  4B44 A;  3MZ8 A;  3RPQ A;  3ZQG A;  2J5P A;  2GAU A;  3QU6 A;  2E2J J;  1H9G A;  3CQZ J;  5BOX A;  3IAM 2;  3BJO A;  1Y8R B;  2R5Z A;  1BIA A;  2NAZ A;  3GTM J;  2EIK H;  3HSF A;  3OS0 A;  1W5T A;  5FKM A;  4D9J A;  1MKM A;  4M3B A;  4CIC A;  1ZAO A;  3K4B A;  3M8E A;  3ZXS A;  4Y4R A;  2ZNZ A;  4XBF A;  1K6O A;  3ELK A;  1JUM A;  4CA0 A;  2IGK A;  2G0E A;  5CKT A;  4IPA A;  1S8N A;  4JX4 A;  2EV6 A;  2EZI A;  4DJA A;  4ENJ A;  2MBF A;  2NOJ B;  2IT0 A;  4CCM A;  3Q0V A;  3FXM A;  1HCR A;  2M9H A;  3QP5 A;  1HXD A;  3AFH A;  1S9H A;  1W4M A;  2RAE A;  4B3X A;  2HTS A;  3TOA A;  4DZP A;  4L5E A;  4OMZ A;  1FPQ A;  4KJZ A;  4LJZ F;  2WV0 A;  2W4S A;  5CVU A;  2HQA A;  2JK3 A;  3DPU A;  3PNV A;  2EZH A;  3EYI A;  4G9Y A;  2TRT A;  4NC6 A;  2H8W A;  4DW6 A;  3RKX A;  3CCS I;  2H8R A;  1U0J A;  1MH4 A;  1PP7 U;  1OR7 A;  4BEH B;  2F5F A;  3N05 A;  4S05 A;  3KP5 A;  5B1A H;  2LLK A;  2Q2E B;  3BLY A;  3UKG A;  5FD5 A;  1REP C;  1BBY A;  3WTX C;  1RR7 A;  3CDH A;  1OMI A;  3JAM Z;  2K4B A;  4L9V A;  3MKZ A;  2XF7 A;  1BL0 A;  3CP8 A;  5GPA A;  3DEU A;  3HHH A;  3HSE A;  3M07 A;  2JSP A;  4IHT A;  2K9N A;  2CU7 A;  3LSP A;  2R7T A;  1XGN A;  2F5C A;  2LC2 A;  1FMV A;  2ZXI A;  5J8F A;  3L2R A;  2NRA C;  1PUF A;  3JRB A;  1WJD A;  2WY8 Q;  2DTZ A;  3FXL A;  4GGG A;  1KA8 A;  1VQK I;  3HM5 A;  2EJR A;  5E1X A;  5EEH A;  5E3M A;  4EEF G;  1YJW I;  1UST A;  4HYE A;  2K4J A;  3GFM A;  2QBY B;  4S0H B;  4AVZ A;  5GAG J;  4PJ0 C;  4UNO A;  1XGM A;  4LK1 F;  2ELH A;  1YW9 A;  5H6Q A;  1RPW A;  2W85 A;  4XLE A;  2QCO A;  2L54 A;  2LSO A;  1DU6 A;  3QPS A;  2GLO A;  5F1J A;  1GV2 A;  3LMM A;  1HKQ A;  1VQ4 I;  3Q3S A;  1MBK A;  1F9N A;  3W2V A;  1H9T A;  2LDU A;  2HOA A;  4A3I J;  4IRG A;  1QPM A;  3Q5F A;  3IWZ A;  3P9K A;  2VBW A;  3K2A A;  5FO5 A;  4FCY A;  2DW4 A;  2M0C A;  2DA2 A;  3AG2 H;  4NUB A;  3KYC B;  5E1W A;  3WU1 B;  3CZ6 A;  3E6D A;  3EUH A;  4KYW A;  3GTL J;  3GBG A;  4XLA A;  2WAF A;  4C2U A;  2XAQ A;  2XF6 A;  1Y8Q B;  1U78 A;  2JZY A;  5J4Y A;  4A3D J;  3DPT A;  1JKQ C;  2A68 F;  2VKE A;  3VEP A;  3P5J A;  2FBH A;  2LP0 A;  4WXC A;  3V8K A;  2KIS A;  3DTI A;  2H6B A;  4P1W A;  2BY2 A;  2A6E F;  2EQR A;  2XGE A;  3FBI B;  3CDI A;  4DQ2 A;  1ERD A;  2ZJP F;  2CS3 A;  1ZRE A;  3DLA A;  4BQQ A;  4CCO A;  2QA4 I;  1IG7 A;  2VXD A;  4F52 A;  1K6Y A;  3A1Y A;  1I39 A;  2GOX B;  1OYY A;  3VFZ A;  1IN6 A;  4BBR J;  1P2F A;  4GFB A;  1KQ0 A;  2H6C A;  3ERE D;  2XPW A;  3BG6 A;  1G3T A;  3BR6 A;  2EIN H;  2EV0 A;  4QLC U;  1G8X A;  1TWA J;  1FX7 A;  5F0H A;  4WX9 A;  4B09 A;  2R5Y A;  2I5U A;  4YFN F;  5E79 C;  2ZB9 A;  2PMU A;  1WVR A;  1ZHF A;  1ZG5 A;  1BW5 A;  5E20 A;  2DMT A;  4OOI A;  1HQC A;  5JHU A;  4M3F A;  3TL4 X;  2WAE A;  3OYK A;  2WWY A;  5TRD A;  1OKR A;  5B5E C;  4RBO A;  3GZ5 A;  1ZG1 A;  3IKT A;  4G6D A;  2XSJ C;  2ZFU A;  5J1R A;  2EBI A;  2M8E A;  2XC7 A;  1T2K A;  3ZMU A;  2CG4 A;  4GO1 A;  4M74 A;  5DCM B;  2KDZ A;  1HDD C;  1XCV A;  3KFW X;  4LIV A;  3K1N A;  2EFN A;  2XAF A;  2G7H A;  2ACJ A;  1I5Z A;  3KET A;  4MHG A;  2DOE A;  5J40 A;  3OYG A;  2EB7 A;  2RV8 A;  2R5Y B;  1AOY A;  4RB1 A;  1LUJ B;  4V19 K;  5FB2 A;  2HI3 A;  3BZ6 A;  1ZGW A;  2JA6 J;  1FYM A;  3S3O A;  5EEA A;  3FIW A;  2QYO A;  2VJI A;  2FRH A;  3WHB A;  3HOV J;  3DFG A;  1ZRC A;  1OR7 C;  3M1C A;  2MC4 A;  3GO5 A;  4ZH4 F;  3O8G A;  2LOO A;  2EFQ A;  3L2W A;  1K79 A;  5DD8 A;  4UVB A;  4KUM A;  1GXQ A;  2GIZ A;  2IP2 A;  4MIM A;  1X1P A;  5D5X B;  2JMW A;  2IBD A;  4MQ9 F;  4CYC B;  3CCQ I;  2ZSH B;  2O6G E;  1SAU A;  1WCM J;  2STT A;  3K70 D;  1TZL A;  4QPQ A;  2P8T A;  3W6J B;  2B63 J;  3FMS A;  2LH9 A;  4N0B A;  3ECH A;  4W97 A;  3FXU A;  4IHY A;  2E7W A;  1Z7L A;  2Q1Z B;  1A04 A;  1MIJ A;  3CCJ I;  1J9I A;  1FOX A;  3IP4 B;  2LYC A;  3C3W A;  5M3M J;  3RKQ A;  1FYL A;  3J7A O;  2DN0 A;  2NS8 A;  3VSK A;  1YS7 A;  3AG4 H;  3H3U A;  1YQA A;  2HYF A;  1MBF A;  3QYF A;  3DKX A;  2LR8 A;  2HPI A;  3GZN B;  1SFX A;  2FNA A;  3PUF A;  4JX6 A;  2MLK A;  1X2N A;  2VXZ A;  5L3E A;  5LD2 C;  2WTE A;  1KU9 A;  5CJ9 A;  4DYR A;  1DU0 A;  2LKX A;  4L5I A;  4WWC A;  1FOW A;  2VBX A;  3L7W A;  3K2Z A;  3IH4 A;  4BJ6 C;  3HJE A;  2HVS A;  1WZ2 A;  4I0A A;  1LEB A;  2PI0 A;  3F0C A;  2V1D A;  3BR3 A;  3G73 A;  3ULQ B;  5FKK A;  1FLI A;  3HEF A;  2CUE A;  2MFZ A;  3SZG A;  5IYB J;  3L9F A;  3KX2 A;  2JPC A;  4MFD A;  2MYS A;  1D3Y A;  2ETH A;  4NQW A;  2CWE A;  3KIO A;  1A6I A;  1YS6 A;  2FBK A;  3L2Q A;  3G1M A;  5GP9 A;  3CMY A;  1DUX C;  1ITY A;  1GT0 C;  4BJ5 C;  4U0W A;  2KZG A;  2LNB A;  2HDC A;  4UHT A;  5HLT A;  3PFI A;  1SD4 A;  3C7J A;  1RKW A;  3HOU J;  5HDG A;  4YEJ A;  1YG2 A;  2Y9Z A;  5ICC A;  3I3L A;  4ON0 A;  3D5S C;  2NVY J;  5IOZ A;  1P7J A;  2XGC A;  4IHW A;  1S3J A;  3JCU C;  1N78 A;  4A3F J;  2HXI A;  1B9M A;  1GV5 A;  4Y13 A;  3LSK A;  2COM A;  1RIO H;  1PUE E;  4RAZ A;  3WG7 H;  5JVT A;  1ON1 A;  2KMU A;  4AUX A;  3GEZ A;  4G7H F;  1RR8 C;  3CUO A;  2JJ7 A;  4M3G A;  2YR2 A;  3H36 A;  1WH5 A;  2ISZ A;  3I55 I;  4HX8 A;  4A93 J;  4PDK A;  4E7H A;  1NK3 P;  3GCM A;  3A02 A;  1GXP A;  1XS9 A;  5DCM A;  1G3Y A;  3I0T A;  1UAA A;  2K5C A;  1QO0 D;  1YX5 A;  5J3L A;  3L1P A;  4C3J J;  2K86 A;  3DBH B;  1T39 A;  2L5Q A;  4E7J A;  1T95 A;  4RLF A;  3JRH A;  4RAF A;  4D7N A;  2QEN A;  2R5Z B;  2E1M B;  2DMP A;  1E2X A;  3UNG C;  4A5N A;  1MNE A;  2F5V A;  5GPC A;  3JRF A;  2AXL A;  1K7A A;  2QKM B;  3F6O A;  4LLG F;  1X1B A;  3K4C A;  4KIF A;  4Q4Z F;  4UXN A;  3BG9 A;  3GFL A;  2AXT C;  2X6O A;  3DTK A;  4Q47 A;  5CVJ A;  3SJM A;  1ZRF A;  2OBP A;  4RMN A;  3BPX A;  3OYL A;  1RNL A;  1BI2 A;  4H4K C;  4FHT A;  4K2E A;  1Y1W J;  5LHI A;  1USS A;  1JT6 A;  5C4J J;  1FOK A;  3QOP A;  2HXO A;  3OYH A;  2EFP A;  1YO5 C;  1ENH A;  5FJ8 J;  2DAO A;  3ZMZ A;  5E18 F;  2R7W A;  4XIC A;  2HKO A;  2UZK A;  3CJQ B;  4BQA A;  1LPQ A;  1N25 A;  2QUF A;  4EQQ A;  1B8I A;  2HQ5 A;  3LNQ A;  1V55 H;  4X0G A;  2EFO A;  3VYT B;  2PMZ N;  1VQ6 I;  1XTA A;  1APL C;  1MMS A;  2V1N A;  3CCY A;  1Z67 A;  2KIM A;  1GLN A;  1WWX A;  3H0G J;  1TWH J;  5BQT A;  3HOY J;  3C2G A;  1IV8 A;  2L9S A;  3ZQC A;  3CJN A;  3S93 A;  1HLV A;  2ECB A;  1SD7 A;  5DEQ A;  1IAW A;  2HEO A;  5HS9 A;  3NQO A;  5DM6 F;  1ETW A;  4JX5 A;  2B0L A;  2QSH X;  1K61 A;  3SZT A;  1U9N A;  1GHC A;  1WFX A;  2DA4 A;  5F04 A;  2A6H F;  4N9I A;  4V2G A;  4ZYD A;  5DCF A;  1KON A;  2YPR A;  5FLV A;  1ZR4 A;  3PSF A;  1XMA A;  3ZRG A;  4G6T B;  4BXU A;  1RC9 A;  2RGV A;  1U2W A;  1V4R A;  4OIO F;  1V5G A;  1U8R A;  2VQG A;  3V4G A;  1NG6 A;  3CMA I;  4XON A;  3TO6 A;  2ZJQ F;  4BHB A;  3TDU C;  4G6Q A;  4BGD A;  1TTY A;  4B43 A;  2NVQ J;  2V9P A;  4C3H J;  5ICE A;  2K9L A;  1MND A;  2DBB A;  2IS2 A;  1H88 C;  1X3U A;  4F55 A;  2OCE A;  1FZP B;  3BDD A;  2DMN A;  1E3P A;  2WA0 A;  2BV6 A;  4OMY A;  4UUT A;  2XUB A;  2BY1 A;  2RKH A;  4RAY A;  1QA6 A;  3PIO F;  4QPO A;  4RGR A;  5AIQ A;  1ZR2 A;  1DDN A;  2HU9 A;  2GIV A;  3HYI A;  4PJJ A;  4L9J A;  4A3L J;  3R0A A;  2K9M A;  1IW7 F;  2YX7 A;  2X6W A;  2BHZ A;  3JR9 A;  5KK1 A;  2VN2 A;  2DFF A;  3J80 Z;  3S8P A;  5L3F A;  2W24 A;  4LLL A;  2M7B A;  3HSR A;  4ZTJ A;  1YOV B;  2DJI A;  2NXN B;  4QIW N;  3N4M A;  3KZY A;  3QPT A;  5J6X A;  4CYC A;  4YII A;  3J80 K;  1BA5 A;  4HW0 A;  4CZC A;  4F91 B;  2ESN A;  2MH2 A;  3CME I;  2WC2 A;  2R93 J;  4AD9 A;  4M6X A;  1U9O A;  1F5T A;  3LSM A;  3BT9 A;  4EM0 B;  1VQ7 I;  2E1M C;  3N97 A;  4ZDO A;  3MWM A;  3V8J A;  4I0B A;  4M72 A;  4C3I J;  1NG7 A;  2P0W A;  2P7V B;  1ZLK A;  1IXR C;  1DGR M;  5J4V A;  3HKZ A;  1XX5 A;  5ED4 A;  3HTS B;  5D4R A;  5JLX A;  2MG4 A;  2A5Y B;  4L9N A;  3S17 J;  1HA8 A;  4PUS A;  4U7D A;  3LA3 A;  3GWZ A;  3GVA A;  2XGX A;  1R49 A;  2A69 F;  3FKI J;  4XLN F;  5J1U A;  2Y2Z A;  4EMS A;  5KVR A;  2JPB A;  3K7A J;  4OWR B;  1OYI A;  3K69 A;  3WU0 A;  4M9S A;  3EQL F;  2L9N A;  1BM9 A;  2XIG A;  2L7Z A;  2IGN A;  4FTH A;  1B9N A;  1FSE A;  1D8K A;  2Q8K A;  3PO3 J;  2LF8 A;  1VQP I;  3S32 A;  4HF2 A;  5FLX K;  4EGZ A;  1TL8 A;  1RES A;  4A3M J;  1POG A;  4LG3 A;  5HS8 A;  4S04 A;  1S72 I;  3BG7 A;  1V5F A;  3OOP A;  2VB6 A;  3PNY A;  1TQP A;  1UZC A;  2HKX A;  4IEJ A;  4ASN A;  4U7B A;  1SD6 A;  2KRC A;  1GDT A;  4I02 A;  3BCB A;  2IRF G;  2QWW A;  3EUA A;  4AU7 A;  1A5J A;  1V3F A;  4IVN A;  1HKS A;  2QSF X;  2EA2 A;  1I3A A;  1Z7U A;  1W1W E;  3KEQ A;  1RZ4 A;  4M6V A;  4WCG A;  4WXD A;  1G3W A;  2JA2 A;  5L3C A;  2KP6 A;  1YRN B;  2R7Q A;  4BBS J;  3J81 Z;  2A3S A;  3RPU A;  2D45 A;  3WE2 A;  2LY9 A;  2ZXW H;  4HST A;  2ZBK A;  3KZI C;  5IY5 H;  2VAS A;  1A36 A;  4I01 A;  3RCO A;  1LJ9 A;  1R1V A;  4MGR A;  2D1H A;  1O3Q A;  1ZYR F;  1ODD A;  2DFE A;  4MTE A;  2HZD A;  4XNF A;  1IN7 A;  2H27 A;  4AM3 A;  2MC3 A;  3LFU A;  1ZK8 A;  3LSI A;  5J47 A;  3BP8 A;  1LVA A;  3M9A A;  5K7Z A;  2O61 A;  4A0Y A;  3KP3 A;  3KYL A;  4XID A;  3S3N A;  1QZZ A;  5C3E J;  3VYS B;  2GA2 A;  5E3N A;  2LRE A;  4M9X A;  2ELJ A;  5F08 A;  2M5W A;  3G2B A;  3U9G A;  1OCR H;  2VKD A;  3FHZ A;  4ZYE A;  3HOS A;  3K0L A;  1WQ2 A;  2XGD A;  1V54 H;  3M1E A;  4OAZ A;  1BN5 A;  3HGG A;  1C0W A;  1AHD P;  4BH9 A;  1RUO A;  5E1Z B;  2RVC A;  1O7L A;  2FMY A;  1Z6R A;  1D8J A;  2E35 A;  2Y0S N;  1WI3 A;  4YIF A;  4XSZ F;  2VJ5 A;  3RSN A;  4BE1 A;  2IW5 A;  4I6Z A;  3TQN A;  1XSX A;  2BW3 A;  4U87 A;  2AO9 A;  3I4N J;  1QRY A;  5DUI A;  3SDG A;  2HQN A;  2IEK A;  3HL2 A;  1FYK A;  2MD0 A;  1HKT A;  5LGU A;  5AON A;  2V79 A;  4M71 A;  5M5W J;  1KU7 A;  4N4N B;  3E7L A;  4LG0 B;  5LEJ A;  4D1Q A;  1NH3 A;  2BEO A;  1MDM A;  4RB0 A;  1OFC X;  2DK8 A;  2R7F A;  3QPL A;  2EWN A;  3LST A;  2CRG A;  2MSY A;  2WAQ A;  1Y0N A;  4E70 A;  2QQA A;  2Z2S B;  4YG2 F;  2LMD A;  1XGO A;  3EUK L;  4MEY F;  2WAD A;  4E7K A;  3F21 A;  4MLO A;  5LEK A;  4E6K G;  1PP8 F;  4XMY A;  2VOD A;  5FFX A;  1G2H A;  2XAU A;  3TO7 A;  1O3R A;  1D5Y A;  4KMF A;  1MBJ A;  5JHF A;  1IRF A;  1XB4 A;  3CC7 I;  3CCE I;  3AL0 B;  4FIS A;  3OYC A;  2PX9 A;  2HWV A;  3DWL E;  2FQ3 A;  3ONQ A;  1L3L A;  1P4W A;  3DBL B;  3GW2 A;  4KIC A;  3LOC A;  4OIQ F;  2LY2 A;  3JW4 A;  2JA7 J;  1UG0 A;  2PEX A;  3EUH C;  1D1A A;  2GOM A;  3W2W A;  4NDL A;  4C9Y A;  1MH3 A;  1I3Q J;  2IGM A;  2AHQ A;  2R7D A;  1R5G A;  4HQE A;  2R7U A;  3DV8 A;  4TV7 A;  3HC7 A;  4GCV A;  2XAH A;  3HIF A;  3F8B A;  4PGG A;  2PMZ A;  3MMY B;  1K83 J;  3BCA A;  3KP6 A;  1WJE A;  1OYW A;  5B1B H;  2HFH A;  3JRA A;  4L18 B;  4EAT A;  2BHY A;  2EFW A;  1RET A;  3TO9 A;  2GQQ A;  4B48 A;  3WOD F;  2JUC A;  3KYD B;  3WTU C;  3G4S I;  3FK7 A;  2ZCW A;  4JK1 X;  1IZ1 A;  3KP4 A;  3ZOB A;  2DT5 A;  4PK4 A;  3PNT A;  3ERM A;  3VWB A;  2O5R A;  3GF2 A;  4I2O A;  5TIS C;  1YIT I;  3R0J A;  3GTG J;  3K4L A;  4IJA A;  3JSP A;  2QEX I;  3CUQ B;  4CDG A;  3D0S A;  2W25 A;  1YYV A;  5LHG A;  4WK8 F;  4L5J A;  1BI0 A;  3NWS A;  4LK0 F;  1G59 A;  4M3E A;  1ZTR A;  5LGN A;  1DPR A;  5CVI A;  1YIO A;  1UMQ A;  3SQN A;  3F6V A;  2CW0 F;  1W5C C;  1SFK A;  3CO6 C;  2PMH A;  2JRM A;  2ZNY A;  3GTK J;  1QVU A;  4AID A;  2X48 A;  3O6B B;  3HOT A;  3MVP A;  3TKY A;  4U0Y A;  1ZGA A;  2COB A;  2FE3 A;  1UG2 A;  1FTT A;  4FET A;  1CQT A;  4O6J A;  2R7O A;  2E1O A;  2FF4 A;  4ENN A;  1R23 A;  3HG9 A;  5D5W B;  3MFK A;  4UB8 C;  1BI1 A;  3QOD A;  3TGN A;  3BTC A;  1SC7 A;  2WV1 A;  3I4P A;  4C2T A;  3L2U A;  1YE9 A;  3Q0W A;  3SHF A;  4BDZ A;  2PJR B;  3DKW A;  1IO2 A;  1D1B A;  5EF6 A;  4XN3 A;  3LA7 A;  2LTP A;  2M8G X;  2OQG A;  3MD2 A;  5F0C A;  3SDB A;  4KMU X;  4A69 C;  3TOB A;  2V6E A;  1L0O C;  2E2I J;  3RQ4 A;  2FU4 A;  2M4K A;  1XPX A;  4J00 A;  5HVQ C;  5FKN A;  3ZQL A;  3IHU A;  1J09 A;  3H9G A;  3MQ0 A;  1E3O C;  1YW7 A;  4EV0 A;  4ZDL A;  3ROU A;  1BC7 C;  1BR1 A;  4Y17 A;  2P6S A;  4ITV A;  2FQ4 A;  1ZGJ A;  1ETY A;  3CD6 I;  1WPK A;  1TC3 C;  2FOK A;  2DFI A;  4MQV A;  2A6T A;  3E3V A;  2QQ8 A;  2RRE A;  4IX7 A;  2ELK A;  2XSD C;  1R9T J;  2WB1 N;  2D2W A;  4XR6 A;  4Y7N J;  2MW8 A;  4R8H A;  3V7R A;  4HLY A;  5BPI A;  1TLH B;  5KHD A;  5JLW A;  2F4I A;  4RLQ A;  3RI4 A;  3DLL F;  4ZYA A;  2JTV A;  2CQ7 A;  3K4N A;  2FNP A;  5BMZ A;  4G8X A;  1RRJ A;  3K6G A;  2K7L A;  3ECO A;  6PAX A;  3S2W A;  4RM2 A;  1FWZ A;  1LE8 B;  1ZKG A;  5DV5 A;  5ERI A;  2PQ8 A;  4C30 A;  4KFC A;  3HRT A;  5B66 C;  4P5O A;  2XKO A;  2HYG D;  1UB9 A;  2VT3 A;  4MO7 A;  1LQ1 A;  1HW2 A;  1BOB A;  2PN6 A;  1A35 A;  2XAS A;  2KT0 A;  1K78 A;  2AS5 F;  4LIU A;  2LKS A;  3ML6 A;  1QZE A;  5CLS A;  2CV2 A;  3E5U A;  1P92 A;  1JKR C;  1XD7 A;  2W00 A;  1IUY A;  3W3C A;  1U5T C;  5GAE J;  5K1Y A;  1N75 A;  1JUP A;  3PIP F;  1EF4 A;  4D7M A;  1FJL A;  3RYP A;  1X1D A;  2M3A A;  3HRS A;  1HOM A;  3DCF A;  5L3D A;  3I5U A;  2E2H J;  3S15 J;  2ZFW A;  2FX0 A;  1MBG A;  3FK6 A;  3SEQ A;  5IP6 A;  1LDJ A;  1VTN C;  2XPU A;  2CUJ A;  3DEE A;  2DA6 A;  4CUG A;  2HOS A;  5E3L A;  1QPI A;  5GTH C;  1Y6I A;  2ZXJ A;  1Y56 A;  5KAF C;  2MD5 A;  2QQ9 A;  2V1U A;  2K9S A;  5L3G A;  5D5V B;  2Z16 A;  2GXB A;  4PJL A;  3OV8 A;  4H0E A;  1W5S A;  3ZQI A;  4EJV A;  1BR4 A;  1SD5 A;  1I27 A;  3OL3 A;  1LNW A;  2LF7 A;  2Z5U A;  4OU0 A;  1TNT A;  2DO7 A;  1RUN A;  3ZPL A;  1OCZ H;  4XM3 A;  1FIP A;  3AAF A;  1T0F C;  3CO7 C;  2OC6 A;  1PJR A;  4AIK A;  5EGO B;  1YJN I;  1MBE A;  3DEW A;  3IH3 A;  2VI6 A;  2YS9 A;  4Y52 J;  1Z21 A;  2K27 A;  2N8G A;  3FXQ A;  4ZJZ A;  3H5R A;  3COA C;  1Z3Y A;  3FXK A;  5EZG A;  3OYA A;  4QTR A;  3MKW B;  3W2A A;  1LFB A;  2HOE A;  2DJN A;  3NRV A;  2NNN A;  4A3B J;  4MFE A;  3O2P E;  2QBY A;  4N9H A;  1FY7 A;  2NVU B;  5K7F A;  5D5U B;  4FX0 A;  3S1M J;  1JE8 A;  4I98 B;  5DD4 A;  3DQV C;  2JSC A;  3R60 A;  4XOR A;  3S1N J;  3ABT A;  1QHG A;  1D0X A;  1TBX A;  2L01 A;  1ETX A;  2Y30 A;  3K4M A;  4NNJ A;  3PO2 J;  4D5F A;  5KCM A;  1ZEL A;  5J8C A;  1PDN C;  3WTV C;  3AL0 C;  3L2C A;  2ADU A;  3BTJ A;  2DQR A;  3QWL A;  4BU2 A;  5EDN A;  4G12 A;  2KHM A;  1R71 A;  3FMR A;  4GRI A;  2DOF A;  4KT6 A;  3SYT A;  3QRF F;  2YU9 J;  2RQQ A;  1BR2 A;  1LKX A;  3A03 A;  1W0U A;  1R5I D;  2LBF B;  1WRJ A;  4L0Z B;  1AA7 A;  2X1E A;  4E7Z A;  4FQG A;  1R1U A;  2CW8 A;  4UVA A;  2P81 A;  1DP7 P;  4UVC A;  2IAI A;  3E5Q A;  2HVQ A;  1LDD A;  2UV1 A;  3ZP5 A;  1BC8 C;  2VBZ A;  2V26 A;  2DA5 A;  4ANJ A;  4UUS B;  1TQI A;  5DUK A;  2P7C B;  2L3D A;  1U5T A;  3NAR A;  3RPU D;  2FUG 2;  1A31 A;  2BE5 F;  2Y0S A;  2M7A A;  2ISY A;  3AG1 H;  1MSE C;  1SAN A;  4M9Z A;  3SXY A;  3RZD J;  2R3S A;  2ID6 A;  1XDU A;  2JVG A;  5BNG A;  2DTR A;  1IXC A;  2LBF A;  1XMX A;  4OIR F;  4FE7 A;  4PSX A;  4A6E A;  1BJZ A;  2UWM A;  2HDW A;  3BZK A;  4YIR X;  2MLG A;  3B6C A;  1V5E A;  4RAG A;  1QHH D;  3FM3 A;  3I64 A;  3ISP A;  3KEO A;  3PQJ A;  1W36 C;  3VB2 A;  1R36 A;  5H2F C;  2XKP A;  3CUQ C;  3E97 A;  3LSJ A;  4BE2 A;  1KZH A;  1WKM A;  3SZP A;  3G6E I;  4CH7 A;  2DOD A;  3BRO A;  4XLF A;  4QSH A;  2IS4 A;  3JRI A;  3U2R A;  3RYR A;  3C2H A;  2GBY A;  4D5C A;  4P9U A;  2VBY A;  1W7P A;  2FML A;  4IHX A;  1YW8 A;  3KP2 A;  3ZMS A;  3C2B A;  3CDL A;  3MKL A;  4BS9 A;  4BAY A;  2V1X A;  3JAM K;  4HLX A;  3OYB A;  1I6X A;  5JFR A;  1W0T A;  4UY8 I;  3O3K A;  4B3A A;  4OIP F;  2A05 A;  3FIS A;  3OOU A;  2ID3 A;  1ZRD A;  1R22 A;  4V2F A;  1QBJ A;  5IT9 K;  1DP3 A;  5EGO A;  2DLL A;  3IV5 A;  3E6B A;  3IRR A;  2JUG A;  4A3G J;  4DYQ A;  2X0L A;  3A01 B;  2X1C A;  4XKC A;  2KIQ A;  3BR0 A;  1SVL A;  1E3H A;  3B02 A;  5CQE A;  4A6D A;  4X6A J;  2X4H A;  4XOP A;  2UUZ A;  2VL8 A;  4DIQ A;  1T6S A;  2ME0 A;  4B47 A;  3J7Z I;  2B9S A;  1MJB A;  4II2 A;  4Y3O A;  2K85 A;  2BY3 A;  1SMY F;  4XQF A;  2VQC A;  2ZC2 A;  2DDA A;  1LFU P;  3KPH A;  4HPQ A;  2DXI A;  3PQK A;  4PSW A;  4BL0 B;  2QM3 A;  5EEG A;  3S2D J;  2F6C A;  3PM1 A;  5J1Y A;  1UFM A;  3E1S A;  3JRD A;  4HV5 A;  3F72 A;  4QWQ A;  5JI6 A;  3ZR8 X;  2V9V A;  5K5Q A;  1NK2 P;  1LVK A;  5LLQ A;  2F4M B;  3GLX A;  3H35 A;  1SEU A;  2VLA A;  4O3M A;  4KDP A;  2E7X A;  2A5W A;  3EPZ A;  3I59 A;  2IS6 A;  4HX7 A;  1R5H A;  4LB5 A;  2L7M P;  2XV4 S;  3HZJ A;  1MDM B;  4BQN A;  1SAX A;  4P9F A;  2D1V A;  4IO9 F;  1CF7 A;  3CJR B;  5F64 A;  1O4X A;  3M3Y J;  4OIN F;  2R7Z J;  3ZMV A;  4ENM A;  2K9Q A;  5E8I A;  1WJB A;  3FF5 A;  2DK5 A;  4PCQ A;  2BOL A;  5EG0 B;  3WGG A;  1FIA A;  3GTQ J;  1VFC A;  4CSW A;  1O57 A;  1ZAR A;  5DTD A;  3OYD A;  1CF7 B;  4BKX A;  1T98 A;  1OJL A;  2RDP A;  1HSJ A;  3I59 B;  1XCB A;  2OD5 A;  2BXY A;  2FA5 A;  1DGW Y;  2JN6 A;  1J5Y A;  3JRE A;  2F5E A;  4HAM A;  1FP2 A;  4HDV A;  1YIJ I;  4HF1 A;  2EIL H;  1T08 B;  3OIQ A;  5IP7 J;  4HOB A;  5EYR A;  3K4J A;  3OIO A;  4LMY A;  1X4P A;  2IA0 A;  1EKE A;  2VIX A;  5D8L B;  3IKV A;  2R7R A;  2QVO A;  3M4O J;  4P55 A;  1XN7 A;  1P6R A;  2OAZ A;  1OIS A;  2VQH A;  1W7P D;  2VT2 A;  1R58 A;  1MW7 A;  3BR1 A;  2M1B A;  3BG5 A;  4O5V A;  2XRN A;  4HRI A;  3CC4 I;  1OCC H;  2NS0 A;  2NVX J;  1QGP A;  2IJL A;  3B73 A;  1D5V A;  5DYM A;  2Y31 A;  3D5L A;  5FLM J;  1PUF B;  3KEY A;  3V42 A;  2M2E A;  4JOM A;  4C2M J;  1EJ9 A;  3F23 A;  2NNY A;  1NTC A;  4XN0 A;  2V7F A;  2A07 F;  1YHQ I;  5DDG A;  4XRS A;  4RB3 C;  2O8K A;  4AWX B;  3RQI A;  3VYU B;  3GTO J;  2XPV A;  2P6T A;  2HPM A;  4I99 C;  3QQA A;  2PJR A;  1QQI A;  2V6C A;  4FE4 A;  1SFO J;  2XF5 A;  2HDD A;  5CVR A;  2LG4 A;  2PFB A;  1KGS A;  1EA3 A;  4CCJ A;  5LFA A;  3V7C A;  4AVP A;  2YUS A;  2ZME A;  2VOO A;  2XB0 X;  3BZC A;  2VPR A;  2WB1 A;  3ZGK A;  3HKZ N;  2X6Y A;  1T56 A;  2CGP A;  3PJR A;  1UEL B;  3VOE A;  2H1K A;  4YEL A;  5BPD A;  3F8N A;  2YSR A;  3IH2 A;  3ASO H;  3WTY C;  1IDY A;  1R6R A;  2E71 A;  2Z9O A;  1SFE A;  2K02 A;  4HX4 A;  4HBL A;  2I8D A;  4BEH A;  2XAG A;  4XLH A;  2OUM A;  4LD5 A;  1J7K A;  2BBY A;  1I50 J;  1E17 A;  3C18 A;  3SFI A;  5TJJ A;  3PUB A;  4MEX F;  1EH6 A;  1GUU A;  5EZH A;  1MGT A;  4EVI A;  2HVR A;  2DPU A;  4DZJ A;  1IGN A;  1Y39 A;  4L9T A;  1U3E M;  4XRF A;  3F9K A;  2VKV A;  4M3D A;  4KIS A;  3U1K A;  2E34 A;  1B59 A;  3LL7 A;  4BQO A;  2Y0M A;  4LOC A;  3IUO A;  3T8R A;  5M3F J;  3ABK H;  4UUS A;  5IPA A;  3GFJ A;  2CUZ A;  4PFP A;  3FHN A;  3TMO A;  1BI3 A;  2KQR A;  1JGS A;  3ZN1 A;  3E6M A;  3LSG A;  5H6R A;  1J75 A;  1XSV A;  3BJ6 A;  3R4K A;  3FMQ A;  2ZME B;  2L02 A;  5CPR B;  3REO A;  4KIB A;  2DDB A;  4A3C J;  5DS9 A;  3TW6 A;  2H1L A;  1FMW A;  1ACI A;  2ZJR F;  3EYY A;  3W6V A;  4KNY A;  1VF9 A;  4WXH A;  4A0X A;  3LQQ A;  3HRU A;  5F6F A;  1H8A C;  4RGU A;  4CGZ A;  3I4M J;  1H0M A;  2Z3Y A;  1ORK A;  3GXO A;  1G3S A;  4KN7 X;  4DYC A;  2ZKZ A;  4HDU A;  3WGH A;  3GZ6 A;  2DYS H;  2VON A;  5FRM A;  2HTJ A;  4YRV A;  2DOA A;  1IUF A;  3G71 I;  3DU5 A;  4BJT A;  2LKP A;  2DA1 A;  2OTL I;  1IRZ A;  2VUM J;  3E6C C;  1SVM A;  2HYJ A;  2Y48 A;  5ILS A;  4XRS G;  2HQR A;  4A2U A;  1O3T A;  4IL6 C;  1MBH A;  3KCC A;  1JHF A;  3WU2 C;  1I6H J;  2DYR H;  4XSX F;  1OPC A;  3KE2 A;  3BTI A;  5A2Q K;  5D8K B;  3HXL A;  3JTH A;  2M30 A;  2RQP A;  4DGW B;  4A3J J;  5LBQ A;  2VPL A;  2CFO A;  3A0H C;  2PLY A;  4KT5 C;  1I1G A;  3BR2 A;  1ZN2 A;  3GX4 X;  2PBI A;  5FRO A;  2VJ4 A;  2A61 A;  2G9W A;  1JTY A;  1HF0 A;  1R4M B;  3ZQQ A;  3Q9S A;  3X2Q H;  2NOG A;  5HOO A;  2WBM A;  2I10 A;  1KYW A;  2YX4 A;  4A12 A;  3HOZ J;  2R7S A;  3F8F A;  3WE3 A;  1TNS A;  1Z1D A;  2K3F A;  3K70 C;  3OYI A;  1MJ9 A;  3F8C A;  4W1U A;  1X4O A;  2EA4 A;  3FM5 A;  4NBQ A;  1HW1 A;  1JGG A;  3HDD A;  1D1C A;  1CGP A;  3CCR I;  2HZT A;  1IN8 A;  2MA3 A;  4F93 B;  4RDU A;  1X3Z B;  2QLZ A;  4CYD A;  1ZH5 A;  2XDV A;  2DU9 A;  5F27 A;  1RKT A;  2KPM A;  2OU2 A;  2QKL B;  1IJW C;  1D0Y A;  1ULY A;  3OS2 A;  1M1E B;  4NB5 A;  4XKW A;  4HNV A;  3M7G A;  3QAH A;  1LFP A;  2CQQ A;  2PG4 A;  3LQR A;  2IA2 A;  5M5X J;  1WJF A;  2P5L C;  3CLO A;  5HLI A;  3CJT B;  3W6K B;  1K78 B;  3R6S A;  5E17 F;  2DT6 A;  3FBN B;  1J2X A;  1QZY A;  1TP4 A;  1Y1V J;  3I58 A;  4HSR A;  4BE0 A;  3S1Q J;  2R4G A;  4CO8 A;  3K1M A;  1XMK A;  2XHK A;  4IHV A;  3VOD A;  3S1R J;  1IV6 A;  3J7A Y;  3IC7 A;  4Q48 A;  1FNN A;  1KU2 A;  1PVE A;  4BDY A;  4II3 A;  1R00 A;  1Z05 A;  3SFZ A;  1FEX A;  2IGO A;  3P9C A;  1JHH A;  2W1O A;  2IS1 A;  1Y0U A;  4XRM A;  4MNU A;  3MAJ A;  4NC7 A;  4E4H A;  4UV9 A;  1LE8 A;  4ABZ A;  1DQU A;  3CTA A;  2DMQ A;  2KJC A;  1MMA A;  2EH3 A;  3K1P A;  1F36 A;  2CQN A;  1JJ8 C;  3BC8 A;  4U88 A;  1U8B A;  1X1A A;  3CMM A;  4HNU A;  2X9D A;  1WI9 A;  1JKP C;  4B4C A;  2OJE D;  1Q1V A;  2GXG A;  3LA2 A;  3KP7 A;  4CCK A;  2BVL A;  3H9Q A;  4XOT A;  3L09 A;  3J7Y J;  2O03 A;  2VJJ A;  3DU6 A;  3Q0U A;  1W7P B;  2W82 A;  3Q9V A;  4N4O B;  1IN4 A;  2JWT A;  3CCU I;  1YRN A;  2ZO4 A;  4HQM A;  4IRI A;  2NYX A;  3OYE A;  3DBR B;  3D5R C;  4ENK A;  1S7A A;  2EK5 A;  2HGC A;  4GYG A;  3QYB A;  3WTT C;  1TWF J;  1WSU A;  4E7I A;  4D0P A;  1E0E A;  1O7F A;  3I9V 2;  4KIT B;  5A2Q Z;  1TWG J;  1ETO A;  5HNH A;  4LFU A;  2KDO A;  3VYR B;  2L4A A;  2LY1 A;  5CYV A;  2Z1D A;  2ICW G;  4AYB A;  3TP0 A;  5KAI C;  3V7S A;  3WTW C;  4E7L A;  1P9Q C;  3VPR A;  3DKY A;  4B1R A;  2TDX A;  2LK2 A;  3VSL A;  1Z3X A;  2Q2E A;  4KN4 X;  5HDN A;  3MN2 A;  1WGX A;  1K4T A;  1T33 A;  3ESW B;  5ILV A;  1RI7 A;  4PFO A;  4DNC A;  4JP0 A;  3WGI A;  3MKY B;  3S14 J;  4ZYH A;  2YU3 A;  3MCZ A;  1MZB A;  2FOW A;  5C4X J;  3LFK A;  2IVM A;  5GAH J;  4F92 B;  3DTE A;  2XRL A;  1T0F A;  3HUG A;  2F4O B;  4IRH A;  2KIU A;  4IQJ A;  2CMP A;  4BHC A;  3GLL A;  2EZL A;  1ZG3 A;  2K3P A;  5FGM A;  2G7U A;  3FDY A;  1WHU A;  3CC2 I;  1X19 A;  3LAJ A;  3BOQ A;  1U5T B;  2EIJ H;  2E1N A;  4EM2 A;  3OR2 C;  3DXJ F;  1R4N B;  3EDP A;  2LRD A;  1FBU A;  3C1D A;  3T5X A;  1JXS A;  4I76 A;  2P5V A;  3OL4 A;  4I09 A;  1VQO I;  2VE8 A;  3I54 A;  2M45 A;  1ZQ3 P;  3TBI A;  5F1R A;  2CO5 A;  2QZ8 A;  4HEA 2;  3B6A A;  2O3F A;  1YX3 A;  4G7Z F;  3PFY A;  2KJB A;  4GDF A;  1S5L C;  2X1D A;  2R92 J;  2MAB A;  5HLG A;  4DOZ A;  2BVM A;  1J0R A;  4EJT A;  4HV6 A;  2K40 A;  1WH7 A;  4G7O F;  4MTD A;  1QVT A;  2E5Z A;  1QU3 A;  3IRQ A;  5L3B A;  1EH8 A;  1FSH A;  1R7J A;  3RJP A;  3ZMD A;  4GYI A;  2Y75 A;  1MSF C;  3MZY A;  3BR5 A;  1K4S A;  2HS5 A;  4GXO A;  1OQY A;  2E19 A;  3ZN0 A;  1S29 A;  2ECC A;  1WJC A;  3BJA A;  3CCV I;  4IOA F;  3H1C A;  3OIP A;  2FSW A;  1BIB A;  4FT8 A;  1YTY A;  3AG3 H;  2B7E A;  1EV7 A;  1OCP A;  1UCR A;  1SMT A;  3U21 A;  3QYE A;  4A3E J;  2DT7 B;  4AC0 A;  4E7S A;  4ZYG A;  5D4S A;  5E3O A; 
#chains in the Genus database with same CATH homology
 1DU6 A;  3QPS A;  2GLO A;  2Y9Y A;  1GV2 A;  5F1J A;  1ZK8 A;  3Q3S A;  3OSG A;  1MBK A;  1LFU P;  3S16 J;  1P7I A;  2HOA A;  4A3I J;  2HOT A;  2JA8 J;  3S2D J;  3HB9 A;  5K7Z A;  3PM1 A;  3K2A A;  5J1Y A;  4FCY A;  1ETQ A;  5FKL A;  2M0C A;  3JRD A;  4XID A;  2DA2 A;  1JT0 A;  3GTL J;  5C3E J;  1NK2 P;  3GBG A;  5E3N A;  2DMU A;  5F08 A;  4AYB N;  3JRG A;  1U78 A;  4A3D J;  1JKQ C;  1B72 A;  2XGD A;  2WAQ N;  2VKE A;  1B8I B;  2LP0 A;  3HGG A;  1AHD P;  2L7M P;  2XGE A;  2EQR A;  2Y0S N;  1WI3 A;  1IG7 A;  5FKO A;  1OCT C;  3D1N I;  4I6Z A;  2AO9 A;  1O4X A;  3M3Y J;  1QRY A;  3I4N J;  4BBR J;  2R7Z J;  3SDG A;  3ZQF A;  4GFB A;  2K9Q A;  2IEK A;  2XPW A;  3BR6 A;  1TWA J;  5M5W J;  5F0H A;  5EG0 B;  1X58 A;  1FIA A;  3E7L A;  3GTQ J;  2R5Y A;  1VFC A;  5DTD A;  1OFC X;  2ZB9 A;  4BKX A;  2OPT A;  3QPL A;  1OJL A;  2CRG A;  2MSY A;  1BW5 A;  2DMT A;  2TCT A;  4M3F A;  2JN6 A;  3JRE A;  4MLO A;  1MNM C;  4RBO A;  3BTL A;  5EG0 A;  4JYK A;  5IP7 J;  1G2H A;  5EYR A;  3OIO A;  1D5Y A;  5J1R A;  1MBJ A;  2EBI A;  5IYC J;  3M4O J;  3A01 A;  2KDZ A;  1HDD C;  5HOD A;  3JRC A;  4FIS A;  1IDZ A;  3LOC A;  4J19 A;  3BR1 A;  2JA7 J;  3BG5 A;  2EZK A;  2R5Y B;  3G1O A;  4NDL A;  2NVX J;  1MH3 A;  3BQY A;  1I3Q J;  1AU7 A;  3NAU A;  2Y31 A;  5FLM J;  2AHQ A;  2HI3 A;  1PUF B;  2M2E A;  4C2M J;  1ZGW A;  2JA6 J;  5K7H A;  1NTC A;  5EEA A;  3FIW A;  4XRS A;  3WHB A;  3HOV J;  2O8K A;  2CJJ A;  3RQI A;  3GTO J;  2XPV A;  1K83 J;  3QQA A;  3O8G A;  4FE4 A;  1SFO J;  2HDD A;  1BW6 A;  3WHC A;  2DA7 A;  3JRA A;  2FJ1 A;  4MIM A;  1RET A;  2YUS A;  1H89 C;  2JMW A;  2XB0 X;  2VPR A;  2IBD A;  4CYC B;  3HKZ N;  1ETK A;  3FK7 A;  3OSF A;  1T56 A;  1WCM J;  1F43 A;  5IP9 J;  2H1K A;  3ZOB A;  2B63 J;  3IH2 A;  5F0F A;  1TWC J;  1IDY A;  4W97 A;  4IHY A;  3GTG J;  5IOY A;  2L0K A;  2DA3 A;  2XB5 A;  5M3M J;  1Z0X A;  3RKQ A;  2DN0 A;  2NS8 A;  3HBL A;  1VI0 A;  2M34 A;  1I50 J;  3O8H A;  1ZTR A;  4M3E A;  1MBF A;  3SFI A;  2O7O A;  2LR8 A;  1UMQ A;  1GUU A;  5EZH A;  1JJ6 C;  4JX6 A;  4DZJ A;  2LVS A;  1IGN A;  1X2N A;  3TED A;  3GTK J;  1QVU A;  2VKV A;  4M3D A;  2X48 A;  4DYR A;  3MVP A;  1DU0 A;  2LKX A;  4LOC A;  2CUF A;  2COB A;  3IH4 A;  1UG2 A;  1FTT A;  1CQT A;  5M3F J;  2E1O A;  4UUS A;  5IPA A;  1ETV A;  3F0C A;  3BR3 A;  2QF7 A;  5FKK A;  2NVT J;  3HEF A;  2CUE A;  3LSG A;  1S7E A;  1JTX A;  3BTC A;  2WV1 A;  5IYB J;  1JKO C;  4MFD A;  4A3C J;  5DS9 A;  3TW6 A;  3Q0W A;  4X1E A;  3W6V A;  3RZO J;  2D5V A;  1VF9 A;  1A6I A;  5EF6 A;  2LTP A;  2M8G X;  3G1M A;  5GP9 A;  5F0C A;  3CMY A;  1ITY A;  1H8A C;  3I4M J;  4A69 C;  1ORK A;  4DYC A;  1GT0 C;  1UHS A;  2NS7 A;  2E2I J;  5FKN A;  3ZQL A;  1IUF A;  1E3O C;  2DA1 A;  3GTJ J;  1RKW A;  1IRZ A;  3BQZ A;  2VUM J;  3HOU J;  2FD5 A;  2HYJ A;  1X2M A;  4XRS G;  2LD5 A;  3HOW J;  2Y9Z A;  1MBH A;  2NVY J;  5IOZ A;  4IHW A;  1P7J A;  2XGC A;  2FQ4 A;  1I6H J;  1ETY A;  1AKH B;  1WPK A;  3BTI A;  4A3F J;  4BXX J;  2HXI A;  1TC3 C;  4A3J J;  1GV5 A;  3BR2 A;  4AUX A;  3HOX J;  2ELK A;  2XSD C;  1R9T J;  2WB1 N;  1JTY A;  1HF0 A;  2JJ7 A;  4M3G A;  4Y7N J;  2MW8 A;  1WH5 A;  2NOG A;  4A93 J;  2I10 A;  5JLW A;  3HOZ J;  1NK3 P;  3H3V K;  3A02 A;  4W1U A;  1XS9 A;  1JGG A;  3HDD A;  2GM4 A;  3L1P A;  5J3L A;  9ANT A;  4C3J J;  4RDU A;  1LE8 B;  5F27 A;  1ZKG A;  1RKT A;  3JRH A;  4MO7 A;  4D7N A;  2R5Z B;  1IJW C;  2DMP A;  5GPC A;  3JRF A;  2KT0 A;  3TW7 A;  4HNV A;  2CQQ A;  5M5X J;  1JKR C;  3BG9 A;  2X6O A;  3SJM A;  5IYD J;  4A3K J;  1JUP A;  1GVD A;  4XK4 A;  1EF4 A;  4D7M A;  1FJL A;  2MGQ A;  1Y1V J;  1B72 B;  3DCF A;  3S1Q J;  1HOM A;  2E2H J;  1Y1W J;  3TP3 A;  3S15 J;  3GTP J;  2FX0 A;  4IHV A;  1MBG A;  1JT6 A;  1XC5 A;  3FK6 A;  5IP6 A;  5C4J J;  3S1R J;  1IV6 A;  2XPU A;  2HXO A;  5M5Y J;  3HGY A;  1ENH A;  1XG1 A;  2DA6 A;  5FJ8 J;  2O9L A;  2HOS A;  5E3L A;  4XIC A;  1QPI A;  2L9R A;  1FEX A;  3LSR A;  1B8I A;  2HQ5 A;  3LNQ A;  2LFB A;  2K9S A;  1IC8 A;  2PMZ N;  3BG3 A;  1APL C;  3ZQI A;  4XRM A;  3G1L A;  3CCY A;  3H0G J;  1FTZ A;  1TWH J;  1LE8 A;  3HOY J;  2L7F P;  2W48 A;  4ABZ A;  4BY1 J;  2DMQ A;  3ZQC A;  1HLV A;  2ECB A;  2CQX A;  3ZQH A;  1FIP A;  2EH3 A;  2R0Q C;  1ETW A;  1Z77 A;  4JX5 A;  2JA5 J;  1F36 A;  1JUS A;  5EGO B;  1K61 A;  1AKH A;  1JJ8 C;  1MBE A;  3DEW A;  3IH3 A;  2VI6 A;  2YS9 A;  4Y52 J;  1U8B A;  2N8G A;  1U9N A;  2DA4 A;  5F04 A;  2X9D A;  5EZG A;  2ME6 A;  1JKP C;  4B4C A;  4V2G A;  1Q1V A;  4QTR A;  5FLV A;  1LFB A;  2DJN A;  1HDP A;  1ZR4 A;  2OF7 A;  4A3B J;  4MFE A;  4BY7 J;  3Q0U A;  5K7F A;  3S1M J;  5C44 J;  1VND A;  3S1N J;  2JWT A;  3S2H J;  1YRN A;  2Y30 A;  1ETX A;  3PO2 J;  4D5F A;  2NVQ J;  4C3H J;  1H88 C;  3ZQG A;  2E2J J;  1TWF J;  2DMN A;  3BTJ A;  4UUT A;  3CQZ J;  5EDN A;  4G12 A;  1TWG J;  1ETO A;  2R5Z A;  1ZR2 A;  3GTM J;  2YU9 J;  5FKM A;  4A3L J;  3A03 A;  3TP0 A;  4M3B A;  1W0U A;  3VPR A;  4B1R A;  2LK2 A;  3JR9 A;  3MN2 A;  1WGX A;  1T33 A;  2P81 A;  4JP0 A;  1JUM A;  3S14 J;  2IAI A;  2G0E A;  4QIW N;  4JX4 A;  4CYC A;  1BA5 A;  5C4X J;  2EZI A;  2R93 J;  1U9O A;  2XRL A;  3Q0V A;  2DA5 A;  4UUS B;  3BT9 A;  1HCR A;  2M9H A;  3NAR A;  4C3I J;  2EZL A;  2RAE A;  1MSE C;  1SAN A;  4DZP A;  3RZD J;  2ID6 A;  4L5E A;  5JLX A;  2MG4 A;  5BNG A;  2JK3 A;  3S17 J;  2EZH A;  4FE7 A;  1BJZ A;  3FKI J;  4I76 A;  3B6C A;  5J1U A;  2TRT A;  2Y2Z A;  3K7A J;  4DW6 A;  2H8R A;  1MH4 A;  1ZQ3 P;  2L7Z A;  3B6A A;  4FTH A;  2LLK A;  2R92 J;  3LSJ A;  3UKG A;  3PO3 J;  1RR7 A;  1RES A;  4A3M J;  1POG A;  4QSH A;  1BL0 A;  5GPA A;  2K40 A;  3JRI A;  2GBY A;  4D5C A;  1WH7 A;  4IEJ A;  2K9N A;  1GDT A;  4IHX A;  2CU7 A;  3LSP A;  1QVT A;  3C2B A;  3CDL A;  3MKL A;  1PUF A;  3JRB A;  1W0T A;  1A5J A;  2DTZ A;  4B3A A;  3FIS A;  1MSF C;  3OOU A;  3BR5 A;  2ID3 A;  4M6V A;  3HM5 A;  2E19 A;  1YRN B;  4V2F A;  5E3M A;  4BBS J;  2ECC A;  5EGO A;  3IV5 A;  4EEF G;  2LY9 A;  4DYQ A;  4A3G J;  3A01 B;  3BR0 A;  1OCP A;  4S0H B;  4X6A J;  4A3E J;  4AC0 A;  2ME0 A;  1RPW A;  2QCO A;  5E3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...