3GTOK

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtoK00
3M4OK 4YFXA 4A3EC 3HKZL 2R7ZC 3S1RC 3HOXC 2NVYK 1BDFA 5FLMC 4AYBD 2VUMC 3PO3C 4XLPA 3I4MC 4C2MK 3HOZK 4QJVA 4ZH4A 3S2HC 4XLNA 3S1MK 3HOUC 3GTKC 2WB1L 1WCMK 5C4JC 2E2IC 3GTMC 3GTLC 4OINA 3WODA 1XPPA 3S1NC 5FJ8K 2A69A 4A3JK 4AYBL 4Q4ZA 4BY7C 3HOYC 4LJZA 2YU9C 3GTPC 2E2HK 1TWCK 2PA8D 1HQMA 1I50K 1SFOK 3S1RK 1TWGK 2B63K 3S15C 3FKIK 5M3MK 3GTJC 2O5JA 2JA8C 1YNNA 2R92K 3H3VL 3PO3K 3GTGC 2WAQD 1ZYRA 3H0GK 3M4OC 3S2HK 4KMUA 4BXXC 4OIOA 5FLMK 3GTMK 3GTKK 2JA7K 2NVYC 4MEYA 4Q5SA 4C3IK 2JA6K 3GTQK 2A6HA 1I3QK 1TWHC 4BBSC 5C3EC 2Y0SL 3GTPK 3DXJA 2JA5C 2E2JC 4BY1K 3S17C 3EQLA 1TWGC 2PMZL 2B63C 4KN7A 2E2IK 3PO2C 3GTJK 4A3IK 3S2DK 4XSZA 1IW7A 1K83C 4A93C 4OIPA 2YU9K 1SMYA 3H0GC 3H3VD 4BY7K 1I50C 4A3FC 3GTOC 2NVXK 4A3LC 2PA8L 3FKIC 3HOXK 4Y52C 1I6HK 3RZOK 2NVTC 3K7AK 4Y7NC 4KN4A 5IYCK 1Y1WC 4A3CC 3S16C 5C3EK 4BXXK 3HOUK 2WB1D 3CQZK 1I6VA 4MEXA 3PO2K 4X6AC 3S14K 4A3IC 2JA6C 3S2DC 1I3QC 1TWHK 4G7OA 4XSXA 3GTQC 4BBSK 1TWAK 2NVQC 2JA5K 5C44K 3HOYK 1TWCC 2NVXC 4A3MC 3HKZD 2R93C 3I4NC 4A3GK 3HOVC 4QIWL 1TWFC 2A68A 4JK1A 5IP9K 5TMCA 2JA8K 1Y1WK 2NVTK 1K83K 2R92C 4C3JK 3GTGK 3HOWC 4QIWD 4A3CK 2BE5A 4A3LK 1YNJA 2O5IA 1I6HC 4Y52K 4QJVB 3RZDC 5IYDC 3K7AC 4Y7NK 5IP7C 3RZOC 4BBRK 4G7HA 3S16K 2R93K 1R9TC 4G7ZA 5C4XC 4A3BC 3S1QC 4A3DC 4X6AK 1WCMC 5TMFA 5C4JK 2E2JK 4BY1C 3S14C 3HOVK 5M5XK 4YFNA 5M5YK 4A3KC 3M3YC 1TWAC 2NVQK 3HOWK 5C44C 4A3EK 1Y1VK 4A3MK 4LLGA 4A3FK 2PMZD 3GTOK 5IYBC 5D4DA 2Y0SD 5M3FK 2VUMK 5IYCC 2CW0A 4A3BK 2PPBA 2R7ZK 4YG2A 4LK0A 2JA7C 4A3DK 3CQZC 4OIQA 3RZDK 5IYDK 3S1NK 4LK1A 4BBRC 5IP7K 2WAQL 4NOIA 3I4MK 5C4XK 1R9TK 3S1QK 3S1MC 3S17K 1SFOC 1Y1VC 2E2HC 3HOZC 1TWFK 3S15K 5M5WK 4MQ9A 4C3HK 4YFKA 5IYBK 4A3KK 4OIRA 3GTLK 3I4NK 3M3YK 4GZYA 4A3GC 5IP9C 4A93K 4A3JC 2A6EA
chains in the Genus database with same CATH superfamily
4C3JC 3ERED 4YFXA 2Y3PA 4A3EC 3BUEA 3HOXC 2NVYK 2VUMC 3I4MC 4C2MK 4ZH4A 3AH5A 4KMDA 3GTKC 1WCMK 3GTMC 1K83A 1XPPA 1O28A 3S1NC 1VH2A 3HOYC 4LJZA 1HQMA 2B63K 2V6UA 3FKIK 5M3MK 4KB4A 2JA8C 1XZPA 3GTGC 4KMHA 3S2HK 3M4OC 4BXXC 2XCRB 5FLMK 3GTMK 3GTKK 1PJ7A 1JQWA 5EGEA 2GSNA 4P5BA 4Q5SA 4C3IK 2GAGC 2NVXA 3GTPK 3GDZA 5JFEA 4AH6A 2E2JC 3GTPA 3EQLA 1ZVUA 2PMZL 2B63C 4KN7A 3GTJK 1B4BA 1IW7A 1K83C 4A93C 2YU9K 1VLOA 4XCHA 3BP3A 3QX3A 3GIRA 3GTGA 2ZFZA 5EGHA 2VUMA 3A8KA 2NVTC 3K7AK 4A3CC 3IPJA 4BXXK 1O2BA 1WOSA 1DCPA 1I6VA 3CQZK 1X31C 3S14K 4A3IC 1J6XA 3FOFA 4PAAA 3HOYK 1TWCC 4A3MC 2P8TA 3CQZA 1TWFC 2A68A 2JA8K 1Y1WK 3HOWC 3GTGK 4KM9A 3RZDC 5IYDC 3K7AC 3RZOC 1TWCA 3OEPA 1R9TC 4G7ZA 4A3BC 4P5AA 3S1QC 4LQYA 4X6AK 1EFWA 5M5XK 4YFNA 4A3KC 2GAHC 1USOA 1SFOA 4A3EK 1XZPB 4GTFA 5IYBC 1O26A 2Y0SD 3ADAC 1GE9A 2R7ZA 4A3DK 4YG2A 2P5MA 4KDDA 4BBRC 1WCMA 1XZQA 2FQTA 3S1MC 4WILA 4RMFA 4C3HK 3I4NK 3HOZC 3L4KA 1EQRA 3HKZL 1R9TA 2XCQA 3SZZA 5FLMC 3GTJA 3TTGA 4KM8A 3A8JA 3PO3C 4XLPA 4QJVA 4XLNA 3S1MK 2RH6A 2WB1L 3N0BA 3NUHA 4OINA 3WODA 1WSRA 1L0WA 5FJ8K 1ZXOA 3FOEA 4A3JK 4KASA 1EK8A 2YU9C 1O2FB 1XXBA 2E2HK 2PA8D 3TFHA 1I50K 1TWGK 1USMA 1INNA 5IOTA 1PJ6A 1YNNA 2R92K 3H3VL 4C2MC 2WAQD 1ZYRA 3H0GK 3FHZA 1B4AA 1IS1A 4MEYA 4GTAA 4G0VA 1I3QK 1TWHC 5C3EC 2Y0SL 4BY1K 1TWGC 2E2IK 4KB2A 2KWAA 1SMYA 3H3VD 1I50C 1BGWA 1C0AA 4A3FC 2V6TA 2PA8L 3HOXK 1J98A 3AD8C 2FQOA 4KN4A 5C3EK 1VJEA 4X6AC 1EI6A 3G4AA 3GEEA 1I3QC 1TWHK 4G7OA 3GTQC 3TFJA 2NVQC 2JA5K 5C44K 3VA7A 3HKZD 4A3GK 1JVIA 3HOVC 2NVTK 2ZUEA 4A3CK 1EH1A 5IORA 3A8IA 4A3LK 4BLBA 4LR2A 1I6HC 1WQHA 4BBRK 2V6SA 3FKIA 1UV7A 3GTOA 3N3YA 5CJ9A 1F93A 5C4JK 3LAPA 2E2JK 1TWAA 3HOVK 5M5YK 2JA7A 2NVQK 3HOWK 4LLGA 2PMZD 1DCHA 5D4DA 1IQ0A 1O29A 4GTBA 2NVYA 2CW0A 4A3BK 2R7ZK 2JA7C 3CQZC 4OIQA 3S1NK 4GFQA 5IP7K 3AD7C 4NOIA 2RGRA 1RU0A 3S17K 3GEIA 2E2HC 1IBAA 5IYBK 3M3YK 1TWFK 2ZUFA 2A6EA 4G7HA 4GTDA 3M4OK 1J6WA 1Y1WA 2R7ZC 4PABA 3S1RC 2R93A 4AYBD 4WJ3M 1ZBSA 3HOUC 3GTQA 2E2IC 3CAGA 5E68A 1O24A 2A69A 4FM9A 4G0WA 1AB4A 3S1RK 4P9SA 2JA6A 3PO3K 1XXCA 1ZQ1C 4KATA 4KMUA 5IOSA 1TWFA 2A6HA 2XCOA 4GTLA 3DXJA 2JA5C 1TWHA 3PO2C 3S2DK 3GTKA 3GTMA 4XSZA 1WQFA 1JOEA 3H0GC 1VRQC 4BY7K 1BJTA 3GTOC 2NVXK 4A3LC 1J6VA 1I6HK 3LPXA 3S0XA 3RZOK 1V5VA 3HOUK 3PO2K 4WJ4A 3T00A 2JA6C 3Q3QA 1TWAK 4GTEA 2NVXC 2R93C 5IP9K 4JK1A 5IOQA 2R92C 4KAWX 1K83K 2BE5A 3AQPA 1YNJA 4Y52K 4QJVB 5IP7C 5C4XC 1O2AA 1WCMC 1IL2A 3H0GA 4BY1C 1XZQB 4BLAA 3M3YC 1TWAC 1TWGA 4A3FK 1YCLA 3RZDK 3MMLB 4LK1A 2WAQL 3I4MK 5C4XK 3LAJA 1R9TK 2CFAA 4GTCA 3GTLK 2R93K 4A3GC 1VGXA 1WQGA 1F9NA 4DDQA 1PJ5A 1BDFA 3AQOA 2D6FC 3S2HC 1WOOA 1I50A 3SZYA 5C4JC 3GTLC 2R92A 4G0UA 3AD9C 4AYBL 4Q4ZA 4BY7C 2E2HA 1IE0A 4GT9A 3GTPC 1TWCK 1SFOK 3S15C 3GTJC 1HI9A 2O5JA 1O25A 5TJ3A 4FZBA 3T02A 4KC6A 4OIOA 2JA7K 2NVYC 2JA6K 3GTQK 4BBSC 3OPFA 1WSVA 3S17C 4A3IK 3TFIA 2E2IA 4LOWA 1WORA 4KARA 4OIPA 2PHCB 4BKWA 3G4CA 5L46A 2W7VA 3N0CA 1DCOA 3FKIC 4Y52C 4Y7NC 1Y1WC 5IYCK 3S16C 3GSIA 2YU9A 2WB1D 4MEXA 1XXAA 1BS2A 3BP8C 3S2DC 4C3IC 2EBBA 4BBSK 4XSXA 2JA5A 1ISEA 2CFAB 4M1XA 2GSUA 3I4NC 1F7UA 4QIWL 3HOZK 5TMCA 4C3JK 4QIWD 5JVOA 1KQ4A 3GEHA 3V4GA 1WIHA 3JSTA 2O5IA 4KMAA 5HL8A 4Y7NK 5CHPA 3S16K 1Y1VA 1YX2A 4O2DA 3HXAA 4A3DC 5TMFA 1I3QA 3S14C 2JH3A 4ILDA 3GTLA 2B63A 4J3NA 5C44C 1Y1VK 4A3MK 3GTOK 4C3HC 5M3FK 2VUMK 4C45A 5IYCC 1G51A 3T01A 1DD5A 4LK0A 2GSOA 5IYDK 1O27A 1WOPA 3S1QK 1SFOC 1Y1VC 1F7VA 3OREA 3L4JA 3S15K 5M5WK 4MQ9A 4YFKA 4A3KK 4OIRA 4GZYA 5IP9C 4A93K 4A3JC 2PPBA
chains in the Genus database with same CATH topology
3M4OK 4YFXA 4A3EC 3HKZL 2R7ZC 3S1RC 3HOXC 2NVYK 1BDFA 5FLMC 4AYBD 2VUMC 3PO3C 4XLPA 3I4MC 4C2MK 3HOZK 4QJVA 4ZH4A 3S2HC 4XLNA 3S1MK 3HOUC 3GTKC 2WB1L 1WCMK 5C4JC 2E2IC 3GTMC 3GTLC 4OINA 3WODA 1XPPA 3S1NC 5FJ8K 2A69A 4A3JK 4AYBL 4Q4ZA 4BY7C 3HOYC 4LJZA 2YU9C 3GTPC 2E2HK 1TWCK 2PA8D 1HQMA 1I50K 1SFOK 3S1RK 1TWGK 2B63K 3S15C 3FKIK 5M3MK 3GTJC 2O5JA 2JA8C 1YNNA 2R92K 3H3VL 3PO3K 3GTGC 2WAQD 1ZYRA 3H0GK 3M4OC 3S2HK 4KMUA 4BXXC 4OIOA 5FLMK 3GTMK 3GTKK 2JA7K 2NVYC 4MEYA 4Q5SA 4C3IK 2JA6K 3GTQK 2A6HA 1I3QK 1TWHC 4BBSC 5C3EC 2Y0SL 3GTPK 3DXJA 2JA5C 2E2JC 4BY1K 3S17C 3EQLA 1TWGC 2PMZL 2B63C 4KN7A 2E2IK 3PO2C 3GTJK 4A3IK 3S2DK 4XSZA 1IW7A 1K83C 4A93C 4OIPA 2YU9K 1SMYA 3H0GC 3H3VD 4BY7K 1I50C 4A3FC 3GTOC 2NVXK 4A3LC 2PA8L 3FKIC 3HOXK 4Y52C 1I6HK 3RZOK 2NVTC 3K7AK 4Y7NC 4KN4A 5IYCK 1Y1WC 4A3CC 3S16C 5C3EK 4BXXK 3HOUK 2WB1D 3CQZK 1I6VA 4MEXA 3PO2K 4X6AC 3S14K 4A3IC 2JA6C 3S2DC 1I3QC 1TWHK 4G7OA 4XSXA 3GTQC 4BBSK 1TWAK 2NVQC 2JA5K 5C44K 3HOYK 1TWCC 2NVXC 4A3MC 3HKZD 2R93C 3I4NC 4A3GK 3HOVC 4QIWL 1TWFC 2A68A 4JK1A 5IP9K 5TMCA 2JA8K 1Y1WK 2NVTK 1K83K 2R92C 4C3JK 3GTGK 3HOWC 4QIWD 4A3CK 2BE5A 4A3LK 1YNJA 2O5IA 1I6HC 4Y52K 4QJVB 3RZDC 5IYDC 3K7AC 4Y7NK 5IP7C 3RZOC 4BBRK 4G7HA 3S16K 2R93K 1R9TC 4G7ZA 5C4XC 4A3BC 3S1QC 4A3DC 4X6AK 1WCMC 5TMFA 5C4JK 2E2JK 4BY1C 3S14C 3HOVK 5M5XK 4YFNA 5M5YK 4A3KC 3M3YC 1TWAC 2NVQK 3HOWK 5C44C 4A3EK 1Y1VK 4A3MK 4LLGA 4A3FK 2PMZD 3GTOK 5IYBC 5D4DA 2Y0SD 5M3FK 2VUMK 5IYCC 2CW0A 4A3BK 2PPBA 2R7ZK 4YG2A 4LK0A 2JA7C 4A3DK 3CQZC 4OIQA 3RZDK 5IYDK 3S1NK 4LK1A 4BBRC 5IP7K 2WAQL 4NOIA 3I4MK 5C4XK 1R9TK 3S1QK 3S1MC 3S17K 1SFOC 1Y1VC 2E2HC 3HOZC 1TWFK 3S15K 5M5WK 4MQ9A 4C3HK 4YFKA 5IYBK 4A3KK 4OIRA 3GTLK 3I4NK 3M3YK 4GZYA 4A3GC 5IP9C 4A93K 4A3JC 2A6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O K;  4YFX A;  4A3E C;  3HKZ L;  2R7Z C;  3S1R C;  3HOX C;  2NVY K;  1BDF A;  5FLM C;  4AYB D;  2VUM C;  3PO3 C;  4XLP A;  3I4M C;  4C2M K;  3HOZ K;  4QJV A;  4ZH4 A;  3S2H C;  4XLN A;  3S1M K;  3HOU C;  3GTK C;  2WB1 L;  1WCM K;  5C4J C;  2E2I C;  3GTM C;  3GTL C;  4OIN A;  3WOD A;  1XPP A;  3S1N C;  5FJ8 K;  2A69 A;  4A3J K;  4AYB L;  4Q4Z A;  4BY7 C;  3HOY C;  4LJZ A;  2YU9 C;  3GTP C;  2E2H K;  1TWC K;  2PA8 D;  1HQM A;  1I50 K;  1SFO K;  3S1R K;  1TWG K;  2B63 K;  3S15 C;  3FKI K;  5M3M K;  3GTJ C;  2O5J A;  2JA8 C;  1YNN A;  2R92 K;  3H3V L;  3PO3 K;  3GTG C;  2WAQ D;  1ZYR A;  3H0G K;  3M4O C;  3S2H K;  4KMU A;  4BXX C;  4OIO A;  5FLM K;  3GTM K;  3GTK K;  2JA7 K;  2NVY C;  4MEY A;  4Q5S A;  4C3I K;  2JA6 K;  3GTQ K;  2A6H A;  1I3Q K;  1TWH C;  4BBS C;  5C3E C;  2Y0S L;  3GTP K;  3DXJ A;  2JA5 C;  2E2J C;  4BY1 K;  3S17 C;  3EQL A;  1TWG C;  2PMZ L;  2B63 C;  4KN7 A;  2E2I K;  3PO2 C;  3GTJ K;  4A3I K;  3S2D K;  4XSZ A;  1IW7 A;  1K83 C;  4A93 C;  4OIP A;  2YU9 K;  1SMY A;  3H0G C;  3H3V D;  4BY7 K;  1I50 C;  4A3F C;  3GTO C;  2NVX K;  4A3L C;  2PA8 L;  3FKI C;  3HOX K;  4Y52 C;  1I6H K;  3RZO K;  2NVT C;  3K7A K;  4Y7N C;  4KN4 A;  5IYC K;  1Y1W C;  4A3C C;  3S16 C;  5C3E K;  4BXX K;  3HOU K;  2WB1 D;  3CQZ K;  1I6V A;  4MEX A;  3PO2 K;  4X6A C;  3S14 K;  4A3I C;  2JA6 C;  3S2D C;  1I3Q C;  1TWH K;  4G7O A;  4XSX A;  3GTQ C;  4BBS K;  1TWA K;  2NVQ C;  2JA5 K;  5C44 K;  3HOY K;  1TWC C;  2NVX C;  4A3M C;  3HKZ D;  2R93 C;  3I4N C;  4A3G K;  3HOV C;  4QIW L;  1TWF C;  2A68 A;  4JK1 A;  5IP9 K;  5TMC A;  2JA8 K;  1Y1W K;  2NVT K;  1K83 K;  2R92 C;  4C3J K;  3GTG K;  3HOW C;  4QIW D;  4A3C K;  2BE5 A;  4A3L K;  1YNJ A;  2O5I A;  1I6H C;  4Y52 K;  4QJV B;  3RZD C;  5IYD C;  3K7A C;  4Y7N K;  5IP7 C;  3RZO C;  4BBR K;  4G7H A;  3S16 K;  2R93 K;  1R9T C;  4G7Z A;  5C4X C;  4A3B C;  3S1Q C;  4A3D C;  4X6A K;  1WCM C;  5TMF A;  5C4J K;  2E2J K;  4BY1 C;  3S14 C;  3HOV K;  5M5X K;  4YFN A;  5M5Y K;  4A3K C;  3M3Y C;  1TWA C;  2NVQ K;  3HOW K;  5C44 C;  4A3E K;  1Y1V K;  4A3M K;  4LLG A;  4A3F K;  2PMZ D;  3GTO K;  5IYB C;  5D4D A;  2Y0S D;  5M3F K;  2VUM K;  5IYC C;  2CW0 A;  4A3B K;  2PPB A;  2R7Z K;  4YG2 A;  4LK0 A;  2JA7 C;  4A3D K;  3CQZ C;  4OIQ A;  3RZD K;  5IYD K;  3S1N K;  4LK1 A;  4BBR C;  5IP7 K;  2WAQ L;  4NOI A;  3I4M K;  5C4X K;  1R9T K;  3S1Q K;  3S1M C;  3S17 K;  1SFO C;  1Y1V C;  2E2H C;  3HOZ C;  1TWF K;  3S15 K;  5M5W K;  4MQ9 A;  4C3H K;  4YFK A;  5IYB K;  4A3K K;  4OIR A;  3GTL K;  3I4N K;  3M3Y K;  4GZY A;  4A3G C;  5IP9 C;  4A93 K;  4A3J C;  2A6E A; 
#chains in the Genus database with same CATH topology
 4C3J C;  3ERE D;  4YFX A;  2Y3P A;  4A3E C;  3BUE A;  3HOX C;  2NVY K;  2VUM C;  3I4M C;  4C2M K;  4ZH4 A;  3AH5 A;  4KMD A;  3GTK C;  1WCM K;  3GTM C;  1K83 A;  1XPP A;  1O28 A;  3S1N C;  1VH2 A;  3HOY C;  4LJZ A;  1HQM A;  2B63 K;  2V6U A;  3FKI K;  5M3M K;  4KB4 A;  2JA8 C;  1XZP A;  3GTG C;  4KMH A;  3S2H K;  3M4O C;  4BXX C;  2XCR B;  5FLM K;  3GTM K;  3GTK K;  1PJ7 A;  1JQW A;  5EGE A;  2GSN A;  4P5B A;  4Q5S A;  4C3I K;  2GAG C;  2NVX A;  3GTP K;  3GDZ A;  5JFE A;  4AH6 A;  2E2J C;  3GTP A;  3EQL A;  1ZVU A;  2PMZ L;  2B63 C;  4KN7 A;  3GTJ K;  1B4B A;  1IW7 A;  1K83 C;  4A93 C;  2YU9 K;  1VLO A;  4XCH A;  3BP3 A;  3QX3 A;  3GIR A;  3GTG A;  2ZFZ A;  5EGH A;  2VUM A;  3A8K A;  2NVT C;  3K7A K;  4A3C C;  3IPJ A;  4BXX K;  1O2B A;  1WOS A;  1DCP A;  1I6V A;  3CQZ K;  1X31 C;  3S14 K;  4A3I C;  1J6X A;  3FOF A;  4PAA A;  3HOY K;  1TWC C;  4A3M C;  2P8T A;  3CQZ A;  1TWF C;  2A68 A;  2JA8 K;  1Y1W K;  3HOW C;  3GTG K;  4KM9 A;  3RZD C;  5IYD C;  3K7A C;  3RZO C;  1TWC A;  3OEP A;  1R9T C;  4G7Z A;  4A3B C;  4P5A A;  3S1Q C;  4LQY A;  4X6A K;  1EFW A;  5M5X K;  4YFN A;  4A3K C;  2GAH C;  1USO A;  1SFO A;  4A3E K;  1XZP B;  4GTF A;  5IYB C;  1O26 A;  2Y0S D;  3ADA C;  1GE9 A;  2R7Z A;  4A3D K;  4YG2 A;  2P5M A;  4KDD A;  4BBR C;  1WCM A;  1XZQ A;  2FQT A;  3S1M C;  4WIL A;  4RMF A;  4C3H K;  3I4N K;  3HOZ C;  3L4K A;  1EQR A;  3HKZ L;  1R9T A;  2XCQ A;  3SZZ A;  5FLM C;  3GTJ A;  3TTG A;  4KM8 A;  3A8J A;  3PO3 C;  4XLP A;  4QJV A;  4XLN A;  3S1M K;  2RH6 A;  2WB1 L;  3N0B A;  3NUH A;  4OIN A;  3WOD A;  1WSR A;  1L0W A;  5FJ8 K;  1ZXO A;  3FOE A;  4A3J K;  4KAS A;  1EK8 A;  2YU9 C;  1O2F B;  1XXB A;  2E2H K;  2PA8 D;  3TFH A;  1I50 K;  1TWG K;  1USM A;  1INN A;  5IOT A;  1PJ6 A;  1YNN A;  2R92 K;  3H3V L;  4C2M C;  2WAQ D;  1ZYR A;  3H0G K;  3FHZ A;  1B4A A;  1IS1 A;  4MEY A;  4GTA A;  4G0V A;  1I3Q K;  1TWH C;  5C3E C;  2Y0S L;  4BY1 K;  1TWG C;  2E2I K;  4KB2 A;  2KWA A;  1SMY A;  3H3V D;  1I50 C;  1BGW A;  1C0A A;  4A3F C;  2V6T A;  2PA8 L;  3HOX K;  1J98 A;  3AD8 C;  2FQO A;  4KN4 A;  5C3E K;  1VJE A;  4X6A C;  1EI6 A;  3G4A A;  3GEE A;  1I3Q C;  1TWH K;  4G7O A;  3GTQ C;  3TFJ A;  2NVQ C;  2JA5 K;  5C44 K;  3VA7 A;  3HKZ D;  4A3G K;  1JVI A;  3HOV C;  2NVT K;  2ZUE A;  4A3C K;  1EH1 A;  5IOR A;  3A8I A;  4A3L K;  4BLB A;  4LR2 A;  1I6H C;  1WQH A;  4BBR K;  2V6S A;  3FKI A;  1UV7 A;  3GTO A;  3N3Y A;  5CJ9 A;  1F93 A;  5C4J K;  3LAP A;  2E2J K;  1TWA A;  3HOV K;  5M5Y K;  2JA7 A;  2NVQ K;  3HOW K;  4LLG A;  2PMZ D;  1DCH A;  5D4D A;  1IQ0 A;  1O29 A;  4GTB A;  2NVY A;  2CW0 A;  4A3B K;  2R7Z K;  2JA7 C;  3CQZ C;  4OIQ A;  3S1N K;  4GFQ A;  5IP7 K;  3AD7 C;  4NOI A;  2RGR A;  1RU0 A;  3S17 K;  3GEI A;  2E2H C;  1IBA A;  5IYB K;  3M3Y K;  1TWF K;  2ZUF A;  2A6E A;  4G7H A;  4GTD A;  3M4O K;  1J6W A;  1Y1W A;  2R7Z C;  4PAB A;  3S1R C;  2R93 A;  4AYB D;  4WJ3 M;  1ZBS A;  3HOU C;  3GTQ A;  2E2I C;  3CAG A;  5E68 A;  1O24 A;  2A69 A;  4FM9 A;  4G0W A;  1AB4 A;  3S1R K;  4P9S A;  2JA6 A;  3PO3 K;  1XXC A;  1ZQ1 C;  4KAT A;  4KMU A;  5IOS A;  1TWF A;  2A6H A;  2XCO A;  4GTL A;  3DXJ A;  2JA5 C;  1TWH A;  3PO2 C;  3S2D K;  3GTK A;  3GTM A;  4XSZ A;  1WQF A;  1JOE A;  3H0G C;  1VRQ C;  4BY7 K;  1BJT A;  3GTO C;  2NVX K;  4A3L C;  1J6V A;  1I6H K;  3LPX A;  3S0X A;  3RZO K;  1V5V A;  3HOU K;  3PO2 K;  4WJ4 A;  3T00 A;  2JA6 C;  3Q3Q A;  1TWA K;  4GTE A;  2NVX C;  2R93 C;  5IP9 K;  4JK1 A;  5IOQ A;  2R92 C;  4KAW X;  1K83 K;  2BE5 A;  3AQP A;  1YNJ A;  4Y52 K;  4QJV B;  5IP7 C;  5C4X C;  1O2A A;  1WCM C;  1IL2 A;  3H0G A;  4BY1 C;  1XZQ B;  4BLA A;  3M3Y C;  1TWA C;  1TWG A;  4A3F K;  1YCL A;  3RZD K;  3MML B;  4LK1 A;  2WAQ L;  3I4M K;  5C4X K;  3LAJ A;  1R9T K;  2CFA A;  4GTC A;  3GTL K;  2R93 K;  4A3G C;  1VGX A;  1WQG A;  1F9N A;  4DDQ A;  1PJ5 A;  1BDF A;  3AQO A;  2D6F C;  3S2H C;  1WOO A;  1I50 A;  3SZY A;  5C4J C;  3GTL C;  2R92 A;  4G0U A;  3AD9 C;  4AYB L;  4Q4Z A;  4BY7 C;  2E2H A;  1IE0 A;  4GT9 A;  3GTP C;  1TWC K;  1SFO K;  3S15 C;  3GTJ C;  1HI9 A;  2O5J A;  1O25 A;  5TJ3 A;  4FZB A;  3T02 A;  4KC6 A;  4OIO A;  2JA7 K;  2NVY C;  2JA6 K;  3GTQ K;  4BBS C;  3OPF A;  1WSV A;  3S17 C;  4A3I K;  3TFI A;  2E2I A;  4LOW A;  1WOR A;  4KAR A;  4OIP A;  2PHC B;  4BKW A;  3G4C A;  5L46 A;  2W7V A;  3N0C A;  1DCO A;  3FKI C;  4Y52 C;  4Y7N C;  1Y1W C;  5IYC K;  3S16 C;  3GSI A;  2YU9 A;  2WB1 D;  4MEX A;  1XXA A;  1BS2 A;  3BP8 C;  3S2D C;  4C3I C;  2EBB A;  4BBS K;  4XSX A;  2JA5 A;  1ISE A;  2CFA B;  4M1X A;  2GSU A;  3I4N C;  1F7U A;  4QIW L;  3HOZ K;  5TMC A;  4C3J K;  4QIW D;  5JVO A;  1KQ4 A;  3GEH A;  3V4G A;  1WIH A;  3JST A;  2O5I A;  4KMA A;  5HL8 A;  4Y7N K;  5CHP A;  3S16 K;  1Y1V A;  1YX2 A;  4O2D A;  3HXA A;  4A3D C;  5TMF A;  1I3Q A;  3S14 C;  2JH3 A;  4ILD A;  3GTL A;  2B63 A;  4J3N A;  5C44 C;  1Y1V K;  4A3M K;  3GTO K;  4C3H C;  5M3F K;  2VUM K;  4C45 A;  5IYC C;  1G51 A;  3T01 A;  1DD5 A;  4LK0 A;  2GSO A;  5IYD K;  1O27 A;  1WOP A;  3S1Q K;  1SFO C;  1Y1V C;  1F7V A;  3ORE A;  3L4J A;  3S15 K;  5M5W K;  4MQ9 A;  4YFK A;  4A3K K;  4OIR A;  4GZY A;  5IP9 C;  4A93 K;  4A3J C;  2PPB A; 
#chains in the Genus database with same CATH homology
 3M4O K;  4YFX A;  4A3E C;  3HKZ L;  2R7Z C;  3S1R C;  3HOX C;  2NVY K;  1BDF A;  5FLM C;  4AYB D;  2VUM C;  3PO3 C;  4XLP A;  3I4M C;  4C2M K;  3HOZ K;  4QJV A;  4ZH4 A;  3S2H C;  4XLN A;  3S1M K;  3HOU C;  3GTK C;  2WB1 L;  1WCM K;  5C4J C;  2E2I C;  3GTM C;  3GTL C;  4OIN A;  3WOD A;  1XPP A;  3S1N C;  5FJ8 K;  2A69 A;  4A3J K;  4AYB L;  4Q4Z A;  4BY7 C;  3HOY C;  4LJZ A;  2YU9 C;  3GTP C;  2E2H K;  1TWC K;  2PA8 D;  1HQM A;  1I50 K;  1SFO K;  3S1R K;  1TWG K;  2B63 K;  3S15 C;  3FKI K;  5M3M K;  3GTJ C;  2O5J A;  2JA8 C;  1YNN A;  2R92 K;  3H3V L;  3PO3 K;  3GTG C;  2WAQ D;  1ZYR A;  3H0G K;  3M4O C;  3S2H K;  4KMU A;  4BXX C;  4OIO A;  5FLM K;  3GTM K;  3GTK K;  2JA7 K;  2NVY C;  4MEY A;  4Q5S A;  4C3I K;  2JA6 K;  3GTQ K;  2A6H A;  1I3Q K;  1TWH C;  4BBS C;  5C3E C;  2Y0S L;  3GTP K;  3DXJ A;  2JA5 C;  2E2J C;  4BY1 K;  3S17 C;  3EQL A;  1TWG C;  2PMZ L;  2B63 C;  4KN7 A;  2E2I K;  3PO2 C;  3GTJ K;  4A3I K;  3S2D K;  4XSZ A;  1IW7 A;  1K83 C;  4A93 C;  4OIP A;  2YU9 K;  1SMY A;  3H0G C;  3H3V D;  4BY7 K;  1I50 C;  4A3F C;  3GTO C;  2NVX K;  4A3L C;  2PA8 L;  3FKI C;  3HOX K;  4Y52 C;  1I6H K;  3RZO K;  2NVT C;  3K7A K;  4Y7N C;  4KN4 A;  5IYC K;  1Y1W C;  4A3C C;  3S16 C;  5C3E K;  4BXX K;  3HOU K;  2WB1 D;  3CQZ K;  1I6V A;  4MEX A;  3PO2 K;  4X6A C;  3S14 K;  4A3I C;  2JA6 C;  3S2D C;  1I3Q C;  1TWH K;  4G7O A;  4XSX A;  3GTQ C;  4BBS K;  1TWA K;  2NVQ C;  2JA5 K;  5C44 K;  3HOY K;  1TWC C;  2NVX C;  4A3M C;  3HKZ D;  2R93 C;  3I4N C;  4A3G K;  3HOV C;  4QIW L;  1TWF C;  2A68 A;  4JK1 A;  5IP9 K;  5TMC A;  2JA8 K;  1Y1W K;  2NVT K;  1K83 K;  2R92 C;  4C3J K;  3GTG K;  3HOW C;  4QIW D;  4A3C K;  2BE5 A;  4A3L K;  1YNJ A;  2O5I A;  1I6H C;  4Y52 K;  4QJV B;  3RZD C;  5IYD C;  3K7A C;  4Y7N K;  5IP7 C;  3RZO C;  4BBR K;  4G7H A;  3S16 K;  2R93 K;  1R9T C;  4G7Z A;  5C4X C;  4A3B C;  3S1Q C;  4A3D C;  4X6A K;  1WCM C;  5TMF A;  5C4J K;  2E2J K;  4BY1 C;  3S14 C;  3HOV K;  5M5X K;  4YFN A;  5M5Y K;  4A3K C;  3M3Y C;  1TWA C;  2NVQ K;  3HOW K;  5C44 C;  4A3E K;  1Y1V K;  4A3M K;  4LLG A;  4A3F K;  2PMZ D;  3GTO K;  5IYB C;  5D4D A;  2Y0S D;  5M3F K;  2VUM K;  5IYC C;  2CW0 A;  4A3B K;  2PPB A;  2R7Z K;  4YG2 A;  4LK0 A;  2JA7 C;  4A3D K;  3CQZ C;  4OIQ A;  3RZD K;  5IYD K;  3S1N K;  4LK1 A;  4BBR C;  5IP7 K;  2WAQ L;  4NOI A;  3I4M K;  5C4X K;  1R9T K;  3S1Q K;  3S1M C;  3S17 K;  1SFO C;  1Y1V C;  2E2H C;  3HOZ C;  1TWF K;  3S15 K;  5M5W K;  4MQ9 A;  4C3H K;  4YFK A;  5IYB K;  4A3K K;  4OIR A;  3GTL K;  3I4N K;  3M3Y K;  4GZY A;  4A3G C;  5IP9 C;  4A93 K;  4A3J C;  2A6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...