3GTOK

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtoK00
3S2HK 4A3LC 2NVXC 3HOWK 2R93K 2JA5K 2WAQD 4C3IK 3M3YK 3PO2K 3HOZC 3WODA 3PO3C 4A3DK 1YNJA 2WB1L 3HKZL 5C4JK 3H3VL 1TWGC 2Y0SD 5C3EC 4NOIA 5IYBC 2E2IK 2NVTK 3S17C 3S2DK 2YU9K 4XLPA 1BDFA 5M3MK 4LK1A 4BY7K 3GTKC 4A3LK 2NVXK 4BBSC 4XSXA 3PO3K 2NVQC 3HOZK 3RZOC 4JK1A 2JA7C 3HOVC 2VUMC 3HKZD 1I50K 2A6HA 4KN7A 5C3EK 3H3VD 5IYBK 3S17K 5M5XK 1SFOC 2E2HC 4G7OA 4QIWL 3GTMC 3GTKK 1K83C 4BBSK 2E2IC 5IP7C 5M5YK 2NVQK 3RZOK 3S1QC 1IW7A 2JA7K 3HOVK 2VUMK 4OIQA 1I6VA 4A3EC 4OIOA 1TWFC 4AYBL 5TMCA 3GTPC 4GZYA 4A3GK 2A6EA 1SFOK 2E2HK 1TWAC 3HOXC 2JA6C 3GTMK 1I50C 4QIWD 1K83K 3S1NC 5IP7K 3CQZC 2BE5A 4A3KK 3S1QK 2E2JC 3S1MK 3FKIC 4C3HK 4C3JK 3GTPK 2A68A 4A3EK 1TWFK 4AYBD 2PPBA 1TWCC 2R92C 2B63K 5D4DA 4OIRA 1ZYRA 1TWAK 3HOXK 2JA6K 2WB1D 3H0GC 4BXXC 5IP9C 4A3GC 3S1NK 4MEXA 3CQZK 4A3BC 4YFXA 2E2JK 3FKIK 3GTJC 3M4OC 4LJZA 1WCMK 4Y52C 1I6HC 2R92K 4BBRC 3GTOC 1TWCK 4C2MK 4YFNA 5IYCC 4A3KC 3I4MC 3S14C 2O5JA 3S1MC 1TWHC 4G7HA 2PMZL 3H0GK 4BXXK 5IP9K 4QJVA 4A3JC 2B63C 4MQ9A 4A3BK 3S15C 2PA8L 1HQMA 4G7ZA 1Y1VC 3GTJK 3M4OK 1YNNA 3RZDC 3I4NC 1I6HK 4Y52K 2JA8C 2CW0A 4BBRK 3GTOK 3I4MK 1I3QK 4BY1C 4LK0A 5IYCK 3S14K 1TWHK 3HOYC 2PMZD 4Q5SA 4A3IC 1WCMC 2WAQL 1XPPA 4MEYA 4A3JK 5C44C 4A3FC 4KN4A 3S15K 4A3MC 4QJVB 1Y1VK 2A69A 4A93C 3K7AK 3RZDK 3I4NK 3S1RK 2JA8K 2O5IA 3S16C 1Y1WC 4BY1K 4YG2A 4A3CC 4Q4ZA 3HOYK 4XLNA 4A3IK 3HOUC 1I3QC 5C44K 5TMFA 5IYDC 4ZH4A 5FLMC 5M3FK 4A3FK 3GTQC 4A3MK 4X6AC 3GTGC 4LLGA 4A93K 2R7ZC 4OINA 3DXJA 1R9TC 3S16K 1Y1WK 4A3CK 4Y7NK 3GTLC 3K7AC 1SMYA 2NVYC 3S1RC 4KMUA 3HOUK 5C4XC 5IYDK 3GTQK 4YFKA 5FLMK 3S2HC 4X6AK 3GTGK 3HOWC 1TWGK 5M5WK 2R93C 2JA5C 3M3YC 4A3DC 2R7ZK 3PO2C 1R9TK 5FJ8K 3GTLK 5C4JC 2PA8D 2Y0SL 4BY7C 2NVTC 3S2DC 2NVYK 3EQLA 4OIPA 2YU9C 5C4XK 4Y7NC 4XSZA
chains in the Genus database with same CATH superfamily
3GDZA 4GFQA 4RMFA 1EFWA 2WAQD 1WOPA 3M3YK 1KQ4A 1YNJA 2WB1L 3HKZL 2R92A 4GTLA 4ILDA 2NVTK 3S17C 1J6VA 3S2DK 2VUMA 3A8KA 1SFOA 1DD5A 4JK1A 3GTOA 2A6HA 1O2FB 4G7OA 4G0VA 4QIWL 3GTMC 3GTKK 4BBSK 5IP7C 2JA6A 3SZZA 3FHZA 1IW7A 2JA7K 3HOVK 1DCOA 3CQZA 4AYBL 1TWFC 4GZYA 4KAWX 2A6EA 1L0WA 1WCMA 1IQ0A 3HOXC 1DCHA 2E2HK 1TWCA 1K83K 3BP3A 2BE5A 3H0GA 3S1MK 4C3JK 1INNA 1J6WA 5IOQA 2R92C 4P5BA 4C2MC 3GTJA 5D4DA 2B63K 1ZYRA 1I3QA 5IP9C 3ERED 4A3GC 3M4OC 2GSNA 1XZPA 3GTLA 3GTOC 1Y1VA 5TJ3A 4A3BK 3BP8C 1O2AA 3RZDC 1AB4A 2JA8C 4BBRK 4LK0A 5IYCK 3N0BA 1PJ6A 2PMZD 3A8JA 4Q5SA 1WCMC 2D6FC 4A3JK 5C44C 2ZUEA 3SZYA 4QJVB 3K7AK 1RU0A 1O24A 1Y1WC 4KARA 2FQOA 4LR2A 4KM8A 2EBBA 3BUEA 2V6UA 1I3QC 4A3FK 5TMFA 4ZH4A 4LLGA 4J3NA 1R9TC 2R93A 3GTLC 1USMA 4GTDA 3S1RC 4KMUA 3HOUK 5C4XC 5FLMK 2E2IA 4X6AK 3GTGK 3TFJA 2JA5C 4A3DC 3AD8C 1EK8A 2PA8D 2NVYK 4PAAA 2RH6A 4Y7NC 3S2HK 4A3LC 1O27A 3PO3C 3WODA 1F7UA 3H3VL 2Y0SD 4BY7K 4WILA 4LQYA 3TFIA 1WOSA 2YU9K 1BDFA 3CAGA 2NVXK 4XSXA 2PHCB 2NVQC 3HOZK 2W7VA 3GTMA 4XCHA 5E68A 1YCLA 3HKZD 5C3EK 5IYBK 1EI6A 3S0XA 1B4BA 1TWFA 2ZFZA 2E2IC 3RZOK 1VJEA 3S1QC 1X31C 4M1XA 4C3HC 2VUMK 4OIQA 1I6VA 3GTPC 1XZQA 4OIOA 4A3GK 2ZUFA 1SFOK 1TWAC 4KB4A 4QIWD 3S1NC 1ZBSA 3OEPA 2E2JC 3NUHA 3A8IA 4A3EK 4AYBD 3GEHA 3GSIA 1WIHA 2JA6K 1GE9A 4BXXC 1V5VA 3CQZK 4BLBA 3FKIK 1WCMK 4Y52C 2GAGC 3I4MC 1TWCK 3AH5A 2O5JA 4A3KC 3S14C 4G0WA 1TWHC 3H0GK 4MQ9A 3S15C 1HQMA 1XXCA 4GTCA 3GTJK 3ADAC 3AD9C 4KB2A 1I6HK 5L46A 2CW0A 1I3QK 2JH3A 1EH1A 3HOYC 1B4AA 1XZPB 4A3IC 4KATA 1Y1WA 2WAQL 1ZXOA 4P5AA 1YX2A 4A3MC 1Y1VK 3I4NK 3S1RK 3S16C 4BY1K 4A3CC 4YG2A 5IOSA 1R9TA 4PABA 3OREA 3AQPA 4A93K 1JVIA 4WJ4A 2R7ZC 2JA7A 3DXJA 3LAJA 1PJ5A 4Y7NK 2JA5A 4DDQA 4KM9A 5IYDK 3GTQK 4YFKA 2XCOA 4AH6A 3Q3QA 3TTGA 5M5WK 3M3YC 1VRQC 4P9SA 1USOA 2FQTA 5JVOA 2NVTC 3S2DC 4OIPA 1XXAA 1I50A 1DCPA 3LPXA 3HOWK 4GTAA 2R93K 4C3IK 3PO2K 2GSOA 2XCQA 5C4JK 2E2IK 4XLPA 5M3MK 4LK1A 3GTKC 5CHPA 4LOWA 1O28A 4BBSC 3QX3A 2JA7C 3HOVC 1ISEA 3T01A 3V4GA 3H3VD 3S17K 5M5XK 2XCRB 3GIRA 3GTPA 2E2HC 4BKWA 1K83C 1TWAA 5M5YK 5CJ9A 1BS2A 4C3JC 1O25A 1G51A 3AD7C 1I50C 3GTMK 5IP7K 4A3KK 3N3YA 3T02A 3AQOA 5EGEA 2A68A 1TWFK 4KMDA 2V6TA 3FOFA 1BGWA 4OIRA 3HOXK 1XZQB 1JOEA 2WB1D 2CFAB 1TWHA 4MEXA 4A3BC 3L4JA 1EQRA 4LJZA 4GTFA 4BBRC 2R92K 4C2MK 5IYCC 4KC6A 4G7HA 2P5MA 1XXBA 3JSTA 5IP9K 4A3JC 2GSUA 1VH2A 2CFAA 1O29A 2PA8L 4G7ZA 1WSVA 3M4OK 1YNNA 3GTOK 2YU9A 2V6SA 4KDDA 1XPPA 3FOEA 4A3FC 2A69A 3N0CA 3RZDK 2JA8K 1TWGA 4Q4ZA 2R7ZA 1J6XA 3GEEA 3HOUC 4GT9A 5M3FK 5C44K 5FLMC 3LAPA 1F7VA 4X6AC 3GTGC 1Y1WK 1BJTA 2NVYC 2RGRA 3HXAA 3S2HC 1IS1A 2P8TA 1R9TK 5FJ8K 5IOTA 3GTLK 2GAHC 4BY7C 2YU9C 5C4XK 3MMLB 1F9NA 1VLOA 2NVXC 4KMAA 4KMHA 2JA5K 4A3DK 3FKIA 3HOZC 3GTKA 1TWGC 5C3EC 4NOIA 5IYBC 4KASA 3G4CA 4GTBA 4A3LK 1J98A 2E2HA 3PO3K 1JQWA 3RZOC 1WSRA 1K83A 1WORA 1HI9A 2VUMC 1I50K 4KN7A 3TFHA 5IORA 5HL8A 1SFOC 3GEIA 4WJ3M 2B63A 2NVQK 1ZVUA 4A3EC 4O2DA 5TMCA 3G4AA 1VGXA 2JA6C 1UV7A 1PJ7A 5JFEA 3CQZC 3S1QK 3FKIC 4C3HK 1WQFA 3GTPK 2PPBA 1TWCC 1TWAK 1IL2A 3H0GC 1ZQ1C 3GTQA 3S1NK 1O26A 4YFXA 2E2JK 4GTEA 3GTJC 1I6HC 4FZBA 4YFNA 3S1MC 2PMZL 4BXXK 4QJVA 3VA7A 2B63C 1O2BA 2Y3PA 3L4KA 1Y1VC 3I4NC 4Y52K 3I4MK 4BLAA 4BY1C 3S14K 1TWHK 1WOOA 1WQGA 4MEYA 4KN4A 3S15K 4A93C 5EGHA 2O5IA 3GTGA 3HOYK 4XLNA 4A3IK 2KWAA 5IYDC 3GTQC 2NVYA 4A3MK 1C0AA 4C45A 1WQHA 4OINA 3S16K 4A3CK 1IBAA 3K7AC 1SMYA 3T00A 4FM9A 3HOWC 1TWGK 2R93C 3IPJA 4C3IC 2R7ZK 3PO2C 2NVXA 5C4JC 2Y0SL 1F93A 3OPFA 4G0UA 3EQLA 1IE0A 4XSZA
chains in the Genus database with same CATH topology
3S2HK 4A3LC 2NVXC 3HOWK 2R93K 2JA5K 2WAQD 4C3IK 3M3YK 3PO2K 3HOZC 3WODA 3PO3C 4A3DK 1YNJA 2WB1L 3HKZL 5C4JK 3H3VL 1TWGC 2Y0SD 5C3EC 4NOIA 5IYBC 2E2IK 2NVTK 3S17C 3S2DK 2YU9K 4XLPA 1BDFA 5M3MK 4LK1A 4BY7K 3GTKC 4A3LK 2NVXK 4BBSC 4XSXA 3PO3K 2NVQC 3HOZK 3RZOC 4JK1A 2JA7C 3HOVC 2VUMC 3HKZD 1I50K 2A6HA 4KN7A 5C3EK 3H3VD 5IYBK 3S17K 5M5XK 1SFOC 2E2HC 4G7OA 4QIWL 3GTMC 3GTKK 1K83C 4BBSK 2E2IC 5IP7C 5M5YK 2NVQK 3RZOK 3S1QC 1IW7A 2JA7K 3HOVK 2VUMK 4OIQA 1I6VA 4A3EC 4OIOA 1TWFC 4AYBL 5TMCA 3GTPC 4GZYA 4A3GK 2A6EA 1SFOK 2E2HK 1TWAC 3HOXC 2JA6C 3GTMK 1I50C 4QIWD 1K83K 3S1NC 5IP7K 3CQZC 2BE5A 4A3KK 3S1QK 2E2JC 3S1MK 3FKIC 4C3HK 4C3JK 3GTPK 2A68A 4A3EK 1TWFK 4AYBD 2PPBA 1TWCC 2R92C 2B63K 5D4DA 4OIRA 1ZYRA 1TWAK 3HOXK 2JA6K 2WB1D 3H0GC 4BXXC 5IP9C 4A3GC 3S1NK 4MEXA 3CQZK 4A3BC 4YFXA 2E2JK 3FKIK 3GTJC 3M4OC 4LJZA 1WCMK 4Y52C 1I6HC 2R92K 4BBRC 3GTOC 1TWCK 4C2MK 4YFNA 5IYCC 4A3KC 3I4MC 3S14C 2O5JA 3S1MC 1TWHC 4G7HA 2PMZL 3H0GK 4BXXK 5IP9K 4QJVA 4A3JC 2B63C 4MQ9A 4A3BK 3S15C 2PA8L 1HQMA 4G7ZA 1Y1VC 3GTJK 3M4OK 1YNNA 3RZDC 3I4NC 1I6HK 4Y52K 2JA8C 2CW0A 4BBRK 3GTOK 3I4MK 1I3QK 4BY1C 4LK0A 5IYCK 3S14K 1TWHK 3HOYC 2PMZD 4Q5SA 4A3IC 1WCMC 2WAQL 1XPPA 4MEYA 4A3JK 5C44C 4A3FC 4KN4A 3S15K 4A3MC 4QJVB 1Y1VK 2A69A 4A93C 3K7AK 3RZDK 3I4NK 3S1RK 2JA8K 2O5IA 3S16C 1Y1WC 4BY1K 4YG2A 4A3CC 4Q4ZA 3HOYK 4XLNA 4A3IK 3HOUC 1I3QC 5C44K 5TMFA 5IYDC 4ZH4A 5FLMC 5M3FK 4A3FK 3GTQC 4A3MK 4X6AC 3GTGC 4LLGA 4A93K 2R7ZC 4OINA 3DXJA 1R9TC 3S16K 1Y1WK 4A3CK 4Y7NK 3GTLC 3K7AC 1SMYA 2NVYC 3S1RC 4KMUA 3HOUK 5C4XC 5IYDK 3GTQK 4YFKA 5FLMK 3S2HC 4X6AK 3GTGK 3HOWC 1TWGK 5M5WK 2R93C 2JA5C 3M3YC 4A3DC 2R7ZK 3PO2C 1R9TK 5FJ8K 3GTLK 5C4JC 2PA8D 2Y0SL 4BY7C 2NVTC 3S2DC 2NVYK 3EQLA 4OIPA 2YU9C 5C4XK 4Y7NC 4XSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H K;  4A3L C;  2NVX C;  3HOW K;  2R93 K;  2JA5 K;  2WAQ D;  4C3I K;  3M3Y K;  3PO2 K;  3HOZ C;  3WOD A;  3PO3 C;  4A3D K;  1YNJ A;  2WB1 L;  3HKZ L;  5C4J K;  3H3V L;  1TWG C;  2Y0S D;  5C3E C;  4NOI A;  5IYB C;  2E2I K;  2NVT K;  3S17 C;  3S2D K;  2YU9 K;  4XLP A;  1BDF A;  5M3M K;  4LK1 A;  4BY7 K;  3GTK C;  4A3L K;  2NVX K;  4BBS C;  4XSX A;  3PO3 K;  2NVQ C;  3HOZ K;  3RZO C;  4JK1 A;  2JA7 C;  3HOV C;  2VUM C;  3HKZ D;  1I50 K;  2A6H A;  4KN7 A;  5C3E K;  3H3V D;  5IYB K;  3S17 K;  5M5X K;  1SFO C;  2E2H C;  4G7O A;  4QIW L;  3GTM C;  3GTK K;  1K83 C;  4BBS K;  2E2I C;  5IP7 C;  5M5Y K;  2NVQ K;  3RZO K;  3S1Q C;  1IW7 A;  2JA7 K;  3HOV K;  2VUM K;  4OIQ A;  1I6V A;  4A3E C;  4OIO A;  1TWF C;  4AYB L;  5TMC A;  3GTP C;  4GZY A;  4A3G K;  2A6E A;  1SFO K;  2E2H K;  1TWA C;  3HOX C;  2JA6 C;  3GTM K;  1I50 C;  4QIW D;  1K83 K;  3S1N C;  5IP7 K;  3CQZ C;  2BE5 A;  4A3K K;  3S1Q K;  2E2J C;  3S1M K;  3FKI C;  4C3H K;  4C3J K;  3GTP K;  2A68 A;  4A3E K;  1TWF K;  4AYB D;  2PPB A;  1TWC C;  2R92 C;  2B63 K;  5D4D A;  4OIR A;  1ZYR A;  1TWA K;  3HOX K;  2JA6 K;  2WB1 D;  3H0G C;  4BXX C;  5IP9 C;  4A3G C;  3S1N K;  4MEX A;  3CQZ K;  4A3B C;  4YFX A;  2E2J K;  3FKI K;  3GTJ C;  3M4O C;  4LJZ A;  1WCM K;  4Y52 C;  1I6H C;  2R92 K;  4BBR C;  3GTO C;  1TWC K;  4C2M K;  4YFN A;  5IYC C;  4A3K C;  3I4M C;  3S14 C;  2O5J A;  3S1M C;  1TWH C;  4G7H A;  2PMZ L;  3H0G K;  4BXX K;  5IP9 K;  4QJV A;  4A3J C;  2B63 C;  4MQ9 A;  4A3B K;  3S15 C;  2PA8 L;  1HQM A;  4G7Z A;  1Y1V C;  3GTJ K;  3M4O K;  1YNN A;  3RZD C;  3I4N C;  1I6H K;  4Y52 K;  2JA8 C;  2CW0 A;  4BBR K;  3GTO K;  3I4M K;  1I3Q K;  4BY1 C;  4LK0 A;  5IYC K;  3S14 K;  1TWH K;  3HOY C;  2PMZ D;  4Q5S A;  4A3I C;  1WCM C;  2WAQ L;  1XPP A;  4MEY A;  4A3J K;  5C44 C;  4A3F C;  4KN4 A;  3S15 K;  4A3M C;  4QJV B;  1Y1V K;  2A69 A;  4A93 C;  3K7A K;  3RZD K;  3I4N K;  3S1R K;  2JA8 K;  2O5I A;  3S16 C;  1Y1W C;  4BY1 K;  4YG2 A;  4A3C C;  4Q4Z A;  3HOY K;  4XLN A;  4A3I K;  3HOU C;  1I3Q C;  5C44 K;  5TMF A;  5IYD C;  4ZH4 A;  5FLM C;  5M3F K;  4A3F K;  3GTQ C;  4A3M K;  4X6A C;  3GTG C;  4LLG A;  4A93 K;  2R7Z C;  4OIN A;  3DXJ A;  1R9T C;  3S16 K;  1Y1W K;  4A3C K;  4Y7N K;  3GTL C;  3K7A C;  1SMY A;  2NVY C;  3S1R C;  4KMU A;  3HOU K;  5C4X C;  5IYD K;  3GTQ K;  4YFK A;  5FLM K;  3S2H C;  4X6A K;  3GTG K;  3HOW C;  1TWG K;  5M5W K;  2R93 C;  2JA5 C;  3M3Y C;  4A3D C;  2R7Z K;  3PO2 C;  1R9T K;  5FJ8 K;  3GTL K;  5C4J C;  2PA8 D;  2Y0S L;  4BY7 C;  2NVT C;  3S2D C;  2NVY K;  3EQL A;  4OIP A;  2YU9 C;  5C4X K;  4Y7N C;  4XSZ A; 
#chains in the Genus database with same CATH topology
 3GDZ A;  4GFQ A;  4RMF A;  1EFW A;  2WAQ D;  1WOP A;  3M3Y K;  1KQ4 A;  1YNJ A;  2WB1 L;  3HKZ L;  2R92 A;  4GTL A;  4ILD A;  2NVT K;  3S17 C;  1J6V A;  3S2D K;  2VUM A;  3A8K A;  1SFO A;  1DD5 A;  4JK1 A;  3GTO A;  2A6H A;  1O2F B;  4G7O A;  4G0V A;  4QIW L;  3GTM C;  3GTK K;  4BBS K;  5IP7 C;  2JA6 A;  3SZZ A;  3FHZ A;  1IW7 A;  2JA7 K;  3HOV K;  1DCO A;  3CQZ A;  4AYB L;  1TWF C;  4GZY A;  4KAW X;  2A6E A;  1L0W A;  1WCM A;  1IQ0 A;  3HOX C;  1DCH A;  2E2H K;  1TWC A;  1K83 K;  3BP3 A;  2BE5 A;  3H0G A;  3S1M K;  4C3J K;  1INN A;  1J6W A;  5IOQ A;  2R92 C;  4P5B A;  4C2M C;  3GTJ A;  5D4D A;  2B63 K;  1ZYR A;  1I3Q A;  5IP9 C;  3ERE D;  4A3G C;  3M4O C;  2GSN A;  1XZP A;  3GTL A;  3GTO C;  1Y1V A;  5TJ3 A;  4A3B K;  3BP8 C;  1O2A A;  3RZD C;  1AB4 A;  2JA8 C;  4BBR K;  4LK0 A;  5IYC K;  3N0B A;  1PJ6 A;  2PMZ D;  3A8J A;  4Q5S A;  1WCM C;  2D6F C;  4A3J K;  5C44 C;  2ZUE A;  3SZY A;  4QJV B;  3K7A K;  1RU0 A;  1O24 A;  1Y1W C;  4KAR A;  2FQO A;  4LR2 A;  4KM8 A;  2EBB A;  3BUE A;  2V6U A;  1I3Q C;  4A3F K;  5TMF A;  4ZH4 A;  4LLG A;  4J3N A;  1R9T C;  2R93 A;  3GTL C;  1USM A;  4GTD A;  3S1R C;  4KMU A;  3HOU K;  5C4X C;  5FLM K;  2E2I A;  4X6A K;  3GTG K;  3TFJ A;  2JA5 C;  4A3D C;  3AD8 C;  1EK8 A;  2PA8 D;  2NVY K;  4PAA A;  2RH6 A;  4Y7N C;  3S2H K;  4A3L C;  1O27 A;  3PO3 C;  3WOD A;  1F7U A;  3H3V L;  2Y0S D;  4BY7 K;  4WIL A;  4LQY A;  3TFI A;  1WOS A;  2YU9 K;  1BDF A;  3CAG A;  2NVX K;  4XSX A;  2PHC B;  2NVQ C;  3HOZ K;  2W7V A;  3GTM A;  4XCH A;  5E68 A;  1YCL A;  3HKZ D;  5C3E K;  5IYB K;  1EI6 A;  3S0X A;  1B4B A;  1TWF A;  2ZFZ A;  2E2I C;  3RZO K;  1VJE A;  3S1Q C;  1X31 C;  4M1X A;  4C3H C;  2VUM K;  4OIQ A;  1I6V A;  3GTP C;  1XZQ A;  4OIO A;  4A3G K;  2ZUF A;  1SFO K;  1TWA C;  4KB4 A;  4QIW D;  3S1N C;  1ZBS A;  3OEP A;  2E2J C;  3NUH A;  3A8I A;  4A3E K;  4AYB D;  3GEH A;  3GSI A;  1WIH A;  2JA6 K;  1GE9 A;  4BXX C;  1V5V A;  3CQZ K;  4BLB A;  3FKI K;  1WCM K;  4Y52 C;  2GAG C;  3I4M C;  1TWC K;  3AH5 A;  2O5J A;  4A3K C;  3S14 C;  4G0W A;  1TWH C;  3H0G K;  4MQ9 A;  3S15 C;  1HQM A;  1XXC A;  4GTC A;  3GTJ K;  3ADA C;  3AD9 C;  4KB2 A;  1I6H K;  5L46 A;  2CW0 A;  1I3Q K;  2JH3 A;  1EH1 A;  3HOY C;  1B4A A;  1XZP B;  4A3I C;  4KAT A;  1Y1W A;  2WAQ L;  1ZXO A;  4P5A A;  1YX2 A;  4A3M C;  1Y1V K;  3I4N K;  3S1R K;  3S16 C;  4BY1 K;  4A3C C;  4YG2 A;  5IOS A;  1R9T A;  4PAB A;  3ORE A;  3AQP A;  4A93 K;  1JVI A;  4WJ4 A;  2R7Z C;  2JA7 A;  3DXJ A;  3LAJ A;  1PJ5 A;  4Y7N K;  2JA5 A;  4DDQ A;  4KM9 A;  5IYD K;  3GTQ K;  4YFK A;  2XCO A;  4AH6 A;  3Q3Q A;  3TTG A;  5M5W K;  3M3Y C;  1VRQ C;  4P9S A;  1USO A;  2FQT A;  5JVO A;  2NVT C;  3S2D C;  4OIP A;  1XXA A;  1I50 A;  1DCP A;  3LPX A;  3HOW K;  4GTA A;  2R93 K;  4C3I K;  3PO2 K;  2GSO A;  2XCQ A;  5C4J K;  2E2I K;  4XLP A;  5M3M K;  4LK1 A;  3GTK C;  5CHP A;  4LOW A;  1O28 A;  4BBS C;  3QX3 A;  2JA7 C;  3HOV C;  1ISE A;  3T01 A;  3V4G A;  3H3V D;  3S17 K;  5M5X K;  2XCR B;  3GIR A;  3GTP A;  2E2H C;  4BKW A;  1K83 C;  1TWA A;  5M5Y K;  5CJ9 A;  1BS2 A;  4C3J C;  1O25 A;  1G51 A;  3AD7 C;  1I50 C;  3GTM K;  5IP7 K;  4A3K K;  3N3Y A;  3T02 A;  3AQO A;  5EGE A;  2A68 A;  1TWF K;  4KMD A;  2V6T A;  3FOF A;  1BGW A;  4OIR A;  3HOX K;  1XZQ B;  1JOE A;  2WB1 D;  2CFA B;  1TWH A;  4MEX A;  4A3B C;  3L4J A;  1EQR A;  4LJZ A;  4GTF A;  4BBR C;  2R92 K;  4C2M K;  5IYC C;  4KC6 A;  4G7H A;  2P5M A;  1XXB A;  3JST A;  5IP9 K;  4A3J C;  2GSU A;  1VH2 A;  2CFA A;  1O29 A;  2PA8 L;  4G7Z A;  1WSV A;  3M4O K;  1YNN A;  3GTO K;  2YU9 A;  2V6S A;  4KDD A;  1XPP A;  3FOE A;  4A3F C;  2A69 A;  3N0C A;  3RZD K;  2JA8 K;  1TWG A;  4Q4Z A;  2R7Z A;  1J6X A;  3GEE A;  3HOU C;  4GT9 A;  5M3F K;  5C44 K;  5FLM C;  3LAP A;  1F7V A;  4X6A C;  3GTG C;  1Y1W K;  1BJT A;  2NVY C;  2RGR A;  3HXA A;  3S2H C;  1IS1 A;  2P8T A;  1R9T K;  5FJ8 K;  5IOT A;  3GTL K;  2GAH C;  4BY7 C;  2YU9 C;  5C4X K;  3MML B;  1F9N A;  1VLO A;  2NVX C;  4KMA A;  4KMH A;  2JA5 K;  4A3D K;  3FKI A;  3HOZ C;  3GTK A;  1TWG C;  5C3E C;  4NOI A;  5IYB C;  4KAS A;  3G4C A;  4GTB A;  4A3L K;  1J98 A;  2E2H A;  3PO3 K;  1JQW A;  3RZO C;  1WSR A;  1K83 A;  1WOR A;  1HI9 A;  2VUM C;  1I50 K;  4KN7 A;  3TFH A;  5IOR A;  5HL8 A;  1SFO C;  3GEI A;  4WJ3 M;  2B63 A;  2NVQ K;  1ZVU A;  4A3E C;  4O2D A;  5TMC A;  3G4A A;  1VGX A;  2JA6 C;  1UV7 A;  1PJ7 A;  5JFE A;  3CQZ C;  3S1Q K;  3FKI C;  4C3H K;  1WQF A;  3GTP K;  2PPB A;  1TWC C;  1TWA K;  1IL2 A;  3H0G C;  1ZQ1 C;  3GTQ A;  3S1N K;  1O26 A;  4YFX A;  2E2J K;  4GTE A;  3GTJ C;  1I6H C;  4FZB A;  4YFN A;  3S1M C;  2PMZ L;  4BXX K;  4QJV A;  3VA7 A;  2B63 C;  1O2B A;  2Y3P A;  3L4K A;  1Y1V C;  3I4N C;  4Y52 K;  3I4M K;  4BLA A;  4BY1 C;  3S14 K;  1TWH K;  1WOO A;  1WQG A;  4MEY A;  4KN4 A;  3S15 K;  4A93 C;  5EGH A;  2O5I A;  3GTG A;  3HOY K;  4XLN A;  4A3I K;  2KWA A;  5IYD C;  3GTQ C;  2NVY A;  4A3M K;  1C0A A;  4C45 A;  1WQH A;  4OIN A;  3S16 K;  4A3C K;  1IBA A;  3K7A C;  1SMY A;  3T00 A;  4FM9 A;  3HOW C;  1TWG K;  2R93 C;  3IPJ A;  4C3I C;  2R7Z K;  3PO2 C;  2NVX A;  5C4J C;  2Y0S L;  1F93 A;  3OPF A;  4G0U A;  3EQL A;  1IE0 A;  4XSZ A; 
#chains in the Genus database with same CATH homology
 3S2H K;  4A3L C;  2NVX C;  3HOW K;  2R93 K;  2JA5 K;  2WAQ D;  4C3I K;  3M3Y K;  3PO2 K;  3HOZ C;  3WOD A;  3PO3 C;  4A3D K;  1YNJ A;  2WB1 L;  3HKZ L;  5C4J K;  3H3V L;  1TWG C;  2Y0S D;  5C3E C;  4NOI A;  5IYB C;  2E2I K;  2NVT K;  3S17 C;  3S2D K;  2YU9 K;  4XLP A;  1BDF A;  5M3M K;  4LK1 A;  4BY7 K;  3GTK C;  4A3L K;  2NVX K;  4BBS C;  4XSX A;  3PO3 K;  2NVQ C;  3HOZ K;  3RZO C;  4JK1 A;  2JA7 C;  3HOV C;  2VUM C;  3HKZ D;  1I50 K;  2A6H A;  4KN7 A;  5C3E K;  3H3V D;  5IYB K;  3S17 K;  5M5X K;  1SFO C;  2E2H C;  4G7O A;  4QIW L;  3GTM C;  3GTK K;  1K83 C;  4BBS K;  2E2I C;  5IP7 C;  5M5Y K;  2NVQ K;  3RZO K;  3S1Q C;  1IW7 A;  2JA7 K;  3HOV K;  2VUM K;  4OIQ A;  1I6V A;  4A3E C;  4OIO A;  1TWF C;  4AYB L;  5TMC A;  3GTP C;  4GZY A;  4A3G K;  2A6E A;  1SFO K;  2E2H K;  1TWA C;  3HOX C;  2JA6 C;  3GTM K;  1I50 C;  4QIW D;  1K83 K;  3S1N C;  5IP7 K;  3CQZ C;  2BE5 A;  4A3K K;  3S1Q K;  2E2J C;  3S1M K;  3FKI C;  4C3H K;  4C3J K;  3GTP K;  2A68 A;  4A3E K;  1TWF K;  4AYB D;  2PPB A;  1TWC C;  2R92 C;  2B63 K;  5D4D A;  4OIR A;  1ZYR A;  1TWA K;  3HOX K;  2JA6 K;  2WB1 D;  3H0G C;  4BXX C;  5IP9 C;  4A3G C;  3S1N K;  4MEX A;  3CQZ K;  4A3B C;  4YFX A;  2E2J K;  3FKI K;  3GTJ C;  3M4O C;  4LJZ A;  1WCM K;  4Y52 C;  1I6H C;  2R92 K;  4BBR C;  3GTO C;  1TWC K;  4C2M K;  4YFN A;  5IYC C;  4A3K C;  3I4M C;  3S14 C;  2O5J A;  3S1M C;  1TWH C;  4G7H A;  2PMZ L;  3H0G K;  4BXX K;  5IP9 K;  4QJV A;  4A3J C;  2B63 C;  4MQ9 A;  4A3B K;  3S15 C;  2PA8 L;  1HQM A;  4G7Z A;  1Y1V C;  3GTJ K;  3M4O K;  1YNN A;  3RZD C;  3I4N C;  1I6H K;  4Y52 K;  2JA8 C;  2CW0 A;  4BBR K;  3GTO K;  3I4M K;  1I3Q K;  4BY1 C;  4LK0 A;  5IYC K;  3S14 K;  1TWH K;  3HOY C;  2PMZ D;  4Q5S A;  4A3I C;  1WCM C;  2WAQ L;  1XPP A;  4MEY A;  4A3J K;  5C44 C;  4A3F C;  4KN4 A;  3S15 K;  4A3M C;  4QJV B;  1Y1V K;  2A69 A;  4A93 C;  3K7A K;  3RZD K;  3I4N K;  3S1R K;  2JA8 K;  2O5I A;  3S16 C;  1Y1W C;  4BY1 K;  4YG2 A;  4A3C C;  4Q4Z A;  3HOY K;  4XLN A;  4A3I K;  3HOU C;  1I3Q C;  5C44 K;  5TMF A;  5IYD C;  4ZH4 A;  5FLM C;  5M3F K;  4A3F K;  3GTQ C;  4A3M K;  4X6A C;  3GTG C;  4LLG A;  4A93 K;  2R7Z C;  4OIN A;  3DXJ A;  1R9T C;  3S16 K;  1Y1W K;  4A3C K;  4Y7N K;  3GTL C;  3K7A C;  1SMY A;  2NVY C;  3S1R C;  4KMU A;  3HOU K;  5C4X C;  5IYD K;  3GTQ K;  4YFK A;  5FLM K;  3S2H C;  4X6A K;  3GTG K;  3HOW C;  1TWG K;  5M5W K;  2R93 C;  2JA5 C;  3M3Y C;  4A3D C;  2R7Z K;  3PO2 C;  1R9T K;  5FJ8 K;  3GTL K;  5C4J C;  2PA8 D;  2Y0S L;  4BY7 C;  2NVT C;  3S2D C;  2NVY K;  3EQL A;  4OIP A;  2YU9 C;  5C4X K;  4Y7N C;  4XSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...