3GTOK

Backtracked rna polymerase ii complex with 15mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtoK00
1R9TK 2E2IK 5M5XK 2E2JK 2NVXC 2JA7C 4QJVA 1TWAK 4A3DC 3HOYK 2A69A 4BBRK 5IYDK 3GTLK 1WCMC 1ZYRA 5M3FK 3S17C 4A3MK 2WAQD 3I4MK 4ZH4A 2VUMC 3RZOC 4YG2A 4BBSK 5FLMK 3M3YK 3HOVK 3S1QC 4OINA 3M4OK 3S2DK 4A3FC 5IP9K 2JA6C 4A3EK 1TWGC 4YFNA 4KMUA 4XLNA 3RZDK 1K83K 3HOWC 3PO2K 4C3IK 4OIQA 4A3IK 2NVYC 3GTOC 4QIWD 5C3EC 4A3JK 2E2HC 1Y1VK 3I4NK 4A3CK 3HOUK 3CQZC 1TWCC 3GTMC 4A3GC 4C2MK 3HOZC 3S1NK 3FKIC 4G7OA 3S15C 4X6AC 4BY7C 3DXJA 4JK1A 2NVXK 2JA7K 2YU9C 3HOXC 4A3DK 4Y52C 3K7AC 2R7ZC 4A3KC 5IP7C 1WCMK 5M3MK 3S17K 1TWFC 5M5WK 1I50C 5C4JC 1SFOK 4OIRA 2VUMK 3GTQC 3PO3C 5C4XC 5C44C 3S1QK 4G7ZA 4Y7NC 4A3FK 2JA6K 4YFKA 4A93C 1XPPA 1TWGK 3HOWK 4A3LC 1YNJA 4XLPA 4MEXA 2NVYK 3GTOK 4C3HK 2A6EA 5C3EK 2WAQL 1Y1WC 1I6VA 2NVQC 2O5JA 3CQZK 3GTPC 1I6HC 1I3QC 1TWCK 1TWHC 3GTMK 4A3GK 3HOZK 3H3VD 3FKIK 1HQMA 3S1MC 4OIPA 2R93C 2R92C 3S15K 1YNNA 4X6AK 4BY7K 3S1RC 4OIOA 5TMCA 2YU9K 3HOXK 4Y52K 2BE5A 4QIWL 3K7AK 2R7ZK 5IYBC 4A3KK 2PMZD 4LLGA 5IP7K 5IYCC 1TWFK 3GTJC 3S16C 5C4JK 1I50K 3GTQK 2WB1D 3PO3K 5C4XK 5C44K 4Q4ZA 2B63C 3RZOK 4MQ9A 4Y7NK 2JA5C 2PMZL 4A93K 4A3LK 3HKZD 3H0GC 3S2HC 4AYBD 3M4OC 3GTKC 2PA8D 4A3EC 2Y0SD 4LK1A 1Y1WK 2O5IA 3GTPK 1I3QK 1TWHK 2E2HK 3GTGC 1Y1VC 3S1MK 4GZYA 5M5YK 2R93K 4MEYA 2R92K 5FJ8K 2JA8C 3S1RK 3EQLA 4BY1C 2NVTC 2A68A 1SMYA 5IYBK 4BXXC 4A3BC 5IYCK 4QJVB 4LJZA 3GTJK 4G7HA 3S14C 3WODA 3S16K 3H3VL 1R9TC 2E2IC 2E2JC 2B63K 5TMFA 1TWAC 3HOYC 4BBRC 5IYDC 1SFOC 2JA5K 4NOIA 3GTLC 4YFXA 4KN7A 1IW7A 4A3MC 3I4MC 3H0GK 3S2HK 3GTKK 4BBSC 5FLMC 3M3YC 3HOVC 4Q5SA 2A6HA 2CW0A 3S2DC 4KN4A 5IP9C 2WB1L 4XSZA 3PO2C 3RZDC 1K83C 2NVQK 3GTGK 1I6HK 4A3IC 3I4NC 4A3CC 4A3JC 2JA8K 3HKZL 5D4DA 4BY1K 2PPBA 2NVTK 3HOUC 4AYBL 4XSXA 2PA8L 4LK0A 2Y0SL 4BXXK 3S1NC 4A3BK 4C3JK 1BDFA 3S14K
chains in the Genus database with same CATH superfamily
1DCOA 1EQRA 4A3DC 3HOYK 1WCMC 5M3FK 3Q3QA 4KMHA 1BGWA 3BP8C 4A3MK 4P5AA 4YG2A 4BBSK 1O2BA 3M3YK 4A3FC 1UV7A 4KMUA 3RZDK 4LOWA 4OIQA 3GTOC 3CQZC 2R92A 3GTMC 1WQGA 3FKIC 1VGXA 3LAJA 1R9TA 3DXJA 4GTEA 4JK1A 2JA7K 4G0WA 1TWFC 5M5WK 1DCHA 3GDZA 4GTBA 1WOPA 2P5MA 4P5BA 1BJTA 2JA6K 1XPPA 3HOWK 4KMDA 1K83A 1YNJA 4XLPA 2NVYK 4C3HK 5C3EK 1J6XA 1Y1WC 2NVQC 1IE0A 1O25A 2EBBA 3HOZK 1HQMA 4X6AK 4OIOA 3HOXK 4WILA 3ERED 4A3KK 5IP7K 1WCMA 4LLGA 3FOEA 3S16C 5C4JK 1XZPB 5C44K 4Q4ZA 4Y7NK 4O2DA 5EGHA 3H0GC 3S2HC 3GTOA 3QX3A 3CQZA 2O5IA 3GTMA 1TWHK 1O2AA 3FKIA 4XCHA 5FJ8K 3TFHA 3S1RK 2Y3PA 1YX2A 4KATA 4BXXC 2JH3A 1TWFA 4GTLA 3FHZA 3GTJK 3N0CA 3S14C 2E2JC 1ZQ1C 4RMFA 4BBRC 5IYDC 2GAGC 3GTLC 3GTKK 5FLMC 4Q5SA 1Y1WA 2A6HA 2NVYA 5IP9C 2GAHC 4XSZA 3PO2C 2E2HA 1XZQA 4BLBA 3I4NC 4A3CC 4A3JC 4KMAA 2NVTK 1KQ4A 4C2MC 4KAWX 1BDFA 4PAAA 4G0VA 1R9TK 1O28A 2E2IK 5M5XK 1XXBA 3H0GA 3I4MK 3RZOC 2PHCB 4ZH4A 2VUMC 4G0UA 1O26A 3S1QC 2FQOA 4OINA 3M4OK 3S2DK 4A3EK 1PJ6A 1TWGC 1WSVA 3V4GA 1K83K 4KASA 3GSIA 4C3IK 3SZZA 3HOUK 1TWCC 4A3GC 3A8IA 3N3YA 4G7OA 4BKWA 1YCLA 3MMLB 3S15C 4BY7C 1WSRA 3GTJA 2YU9C 4A3DK 2P8TA 3K7AC 2R7ZC 1VH2A 3GTLA 1WCMK 1DCPA 3GTQC 3OPFA 1G51A 3PO3C 5C4XC 2ZUEA 3GTKA 4A3FK 4GTFA 1VRQC 4A93C 2XCQA 4DDQA 1USOA 3GTOK 3AQPA 1Y1VA 4M1XA 2O5JA 1RU0A 3CQZK 1I6HC 3GTMK 3GIRA 1IS1A 1XXAA 3FKIK 3S1MC 3TFIA 1YNNA 1WOOA 5TMCA 3AH5A 2E2IA 4J3NA 5IYCC 1TWFK 1WORA 1SFOA 2VUMA 2WB1D 2GSNA 2B63C 2JA5C 2PMZL 1TWGA 4AYBD 5IOQA 1Y1WK 1XZQB 1X31C 4GFQA 1TWCA 2E2HK 4GTDA 3GTGC 2JA8C 3EQLA 4BY1C 2YU9A 1SMYA 2R7ZA 4C3JC 4GTCA 3S16K 3GTQA 1PJ5A 5TMFA 1TWAC 4LR2A 4NOIA 4YFXA 4KN7A 5IOTA 1IW7A 3H0GK 3S2HK 1F7UA 5JVOA 3HOVC 1J6VA 4KN4A 2WB1L 4P9SA 4A3IC 5CJ9A 3HXAA 4AYBL 4XSXA 1AB4A 4BXXK 3S1NC 1O29A 3S14K 2NVXC 2E2JK 2RGRA 2ZFZA 4KB2A 4QJVA 2B63A 2A69A 4BBRK 5IYDK 3GTLK 2GSUA 1ZYRA 4FM9A 3S17C 2WAQD 1O2FB 5FLMK 2RH6A 5IP9K 3PO2K 3GTGA 4QIWD 3I4NK 4A3JK 4A3CK 1Y1VK 1XXCA 4C2MK 3GEHA 1GE9A 1O27A 4PABA 1TWAA 4Y52C 1I50C 2W7VA 1SFOK 2VUMK 3OEPA 3N0BA 3L4JA 4G7ZA 3S1QK 4YFKA 4GTAA 1TWGK 4A3LC 3GEIA 1J6WA 4BLAA 4MEXA 2WAQL 1I6VA 3GTPC 1I3QC 1TWCK 4A3GK 3T01A 3H3VD 2R93C 2R92C 3S15K 4BY7K 5IORA 2NVXA 2YU9K 2BE5A 4QIWL 3K7AK 3VA7A 5IYBC 2R7ZK 2PMZD 3GTQK 3PO3K 5C4XK 1WIHA 4MQ9A 1JQWA 4A93K 1ZBSA 3HKZD 3T02A 3M4OC 2PA8D 4A3EC 4LK1A 3JSTA 1INNA 4FZBA 1IQ0A 3A8JA 3S1MK 4GZYA 1DD5A 5M5YK 4MEYA 3AD8C 2A68A 2XCOA 5E68A 2XCRB 3LAPA 4A3BC 5IYCK 3ADAC 4KDDA 4KM9A 4LJZA 4QJVB 1I50A 3H3VL 3AD7C 1J98A 2B63K 3HOYC 2FQTA 2JA5K 4AH6A 1V5VA 1JOEA 1C0AA 4A3MC 4BBSC 1IL2A 3M3YC 2CW0A 3GTPA 1I3QA 3RZDC 2NVQK 3GTGK 2R93A 1PJ7A 2JA8K 3HKZL 4KARA 4BY1K 2PPBA 3TTGA 2PA8L 4LK0A 4C3JK 3G4CA 2CFAB 2JA7C 1TWAK 1EH1A 4WJ3M 2V6UA 3NUHA 3HOVK 3BUEA 3CAGA 2JA6C 3HOWC 4YFNA 4XLNA 3FOFA 4A3IK 2NVYC 4C3HC 5C3EC 2E2HC 5HL8A 4KC6A 4KM8A 2ZUFA 1ZVUA 3HOZC 3S1NK 1B4BA 1WQHA 4X6AC 3T00A 2NVXK 1B4AA 3HOXC 3TFJA 5IP7C 4A3KC 5M3MK 4C45A 3S17K 2JA5A 5C4JC 4OIRA 5JFEA 1IBAA 5C44C 1F7VA 4Y7NC 3S0XA 5IOSA 2GSOA 2A6EA 1TWHC 1WQFA 2V6SA 3OREA 1EI6A 1VJEA 1VLOA 3LPXA 4OIPA 3S1RC 2JA7A 3L4KA 5L46A 4Y52K 2KWAA 3GTJC 1BS2A 1I50K 2CFAA 3RZOK 1F9NA 1O24A 2JA6A 5EGEA 3BP3A 4A3LK 1WOSA 5TJ3A 3GTKC 2Y0SD 1L0WA 3GTPK 1I3QK 1JVIA 3SZYA 1Y1VC 2R93K 2R92K 3GEEA 2NVTC 4ILDA 4WJ4A 5IYBK 3A8KA 3G4AA 4GT9A 5CHPA 4G7HA 3WODA 1ISEA 1R9TC 2E2IC 1EK8A 3AQOA 1SFOC 2V6TA 3IPJA 1XZPA 3I4MC 1F93A 3AD9C 1USMA 1ZXOA 4LQYA 4KB4A 1HI9A 1TWHA 3S2DC 1K83C 4C3IC 1I6HK 2D6FC 5D4DA 3HOUC 2Y0SL 1EFWA 4A3BK
chains in the Genus database with same CATH topology
1R9TK 2E2IK 5M5XK 2E2JK 2NVXC 2JA7C 4QJVA 1TWAK 4A3DC 3HOYK 2A69A 4BBRK 5IYDK 3GTLK 1WCMC 1ZYRA 5M3FK 3S17C 4A3MK 2WAQD 3I4MK 4ZH4A 2VUMC 3RZOC 4YG2A 4BBSK 5FLMK 3M3YK 3HOVK 3S1QC 4OINA 3M4OK 3S2DK 4A3FC 5IP9K 2JA6C 4A3EK 1TWGC 4YFNA 4KMUA 4XLNA 3RZDK 1K83K 3HOWC 3PO2K 4C3IK 4OIQA 4A3IK 2NVYC 3GTOC 4QIWD 5C3EC 4A3JK 2E2HC 1Y1VK 3I4NK 4A3CK 3HOUK 3CQZC 1TWCC 3GTMC 4A3GC 4C2MK 3HOZC 3S1NK 3FKIC 4G7OA 3S15C 4X6AC 4BY7C 3DXJA 4JK1A 2NVXK 2JA7K 2YU9C 3HOXC 4A3DK 4Y52C 3K7AC 2R7ZC 4A3KC 5IP7C 1WCMK 5M3MK 3S17K 1TWFC 5M5WK 1I50C 5C4JC 1SFOK 4OIRA 2VUMK 3GTQC 3PO3C 5C4XC 5C44C 3S1QK 4G7ZA 4Y7NC 4A3FK 2JA6K 4YFKA 4A93C 1XPPA 1TWGK 3HOWK 4A3LC 1YNJA 4XLPA 4MEXA 2NVYK 3GTOK 4C3HK 2A6EA 5C3EK 2WAQL 1Y1WC 1I6VA 2NVQC 2O5JA 3CQZK 3GTPC 1I6HC 1I3QC 1TWCK 1TWHC 3GTMK 4A3GK 3HOZK 3H3VD 3FKIK 1HQMA 3S1MC 4OIPA 2R93C 2R92C 3S15K 1YNNA 4X6AK 4BY7K 3S1RC 4OIOA 5TMCA 2YU9K 3HOXK 4Y52K 2BE5A 4QIWL 3K7AK 2R7ZK 5IYBC 4A3KK 2PMZD 4LLGA 5IP7K 5IYCC 1TWFK 3GTJC 3S16C 5C4JK 1I50K 3GTQK 2WB1D 3PO3K 5C4XK 5C44K 4Q4ZA 2B63C 3RZOK 4MQ9A 4Y7NK 2JA5C 2PMZL 4A93K 4A3LK 3HKZD 3H0GC 3S2HC 4AYBD 3M4OC 3GTKC 2PA8D 4A3EC 2Y0SD 4LK1A 1Y1WK 2O5IA 3GTPK 1I3QK 1TWHK 2E2HK 3GTGC 1Y1VC 3S1MK 4GZYA 5M5YK 2R93K 4MEYA 2R92K 5FJ8K 2JA8C 3S1RK 3EQLA 4BY1C 2NVTC 2A68A 1SMYA 5IYBK 4BXXC 4A3BC 5IYCK 4QJVB 4LJZA 3GTJK 4G7HA 3S14C 3WODA 3S16K 3H3VL 1R9TC 2E2IC 2E2JC 2B63K 5TMFA 1TWAC 3HOYC 4BBRC 5IYDC 1SFOC 2JA5K 4NOIA 3GTLC 4YFXA 4KN7A 1IW7A 4A3MC 3I4MC 3H0GK 3S2HK 3GTKK 4BBSC 5FLMC 3M3YC 3HOVC 4Q5SA 2A6HA 2CW0A 3S2DC 4KN4A 5IP9C 2WB1L 4XSZA 3PO2C 3RZDC 1K83C 2NVQK 3GTGK 1I6HK 4A3IC 3I4NC 4A3CC 4A3JC 2JA8K 3HKZL 5D4DA 4BY1K 2PPBA 2NVTK 3HOUC 4AYBL 4XSXA 2PA8L 4LK0A 2Y0SL 4BXXK 3S1NC 4A3BK 4C3JK 1BDFA 3S14K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T K;  2E2I K;  5M5X K;  2E2J K;  2NVX C;  2JA7 C;  4QJV A;  1TWA K;  4A3D C;  3HOY K;  2A69 A;  4BBR K;  5IYD K;  3GTL K;  1WCM C;  1ZYR A;  5M3F K;  3S17 C;  4A3M K;  2WAQ D;  3I4M K;  4ZH4 A;  2VUM C;  3RZO C;  4YG2 A;  4BBS K;  5FLM K;  3M3Y K;  3HOV K;  3S1Q C;  4OIN A;  3M4O K;  3S2D K;  4A3F C;  5IP9 K;  2JA6 C;  4A3E K;  1TWG C;  4YFN A;  4KMU A;  4XLN A;  3RZD K;  1K83 K;  3HOW C;  3PO2 K;  4C3I K;  4OIQ A;  4A3I K;  2NVY C;  3GTO C;  4QIW D;  5C3E C;  4A3J K;  2E2H C;  1Y1V K;  3I4N K;  4A3C K;  3HOU K;  3CQZ C;  1TWC C;  3GTM C;  4A3G C;  4C2M K;  3HOZ C;  3S1N K;  3FKI C;  4G7O A;  3S15 C;  4X6A C;  4BY7 C;  3DXJ A;  4JK1 A;  2NVX K;  2JA7 K;  2YU9 C;  3HOX C;  4A3D K;  4Y52 C;  3K7A C;  2R7Z C;  4A3K C;  5IP7 C;  1WCM K;  5M3M K;  3S17 K;  1TWF C;  5M5W K;  1I50 C;  5C4J C;  1SFO K;  4OIR A;  2VUM K;  3GTQ C;  3PO3 C;  5C4X C;  5C44 C;  3S1Q K;  4G7Z A;  4Y7N C;  4A3F K;  2JA6 K;  4YFK A;  4A93 C;  1XPP A;  1TWG K;  3HOW K;  4A3L C;  1YNJ A;  4XLP A;  4MEX A;  2NVY K;  3GTO K;  4C3H K;  2A6E A;  5C3E K;  2WAQ L;  1Y1W C;  1I6V A;  2NVQ C;  2O5J A;  3CQZ K;  3GTP C;  1I6H C;  1I3Q C;  1TWC K;  1TWH C;  3GTM K;  4A3G K;  3HOZ K;  3H3V D;  3FKI K;  1HQM A;  3S1M C;  4OIP A;  2R93 C;  2R92 C;  3S15 K;  1YNN A;  4X6A K;  4BY7 K;  3S1R C;  4OIO A;  5TMC A;  2YU9 K;  3HOX K;  4Y52 K;  2BE5 A;  4QIW L;  3K7A K;  2R7Z K;  5IYB C;  4A3K K;  2PMZ D;  4LLG A;  5IP7 K;  5IYC C;  1TWF K;  3GTJ C;  3S16 C;  5C4J K;  1I50 K;  3GTQ K;  2WB1 D;  3PO3 K;  5C4X K;  5C44 K;  4Q4Z A;  2B63 C;  3RZO K;  4MQ9 A;  4Y7N K;  2JA5 C;  2PMZ L;  4A93 K;  4A3L K;  3HKZ D;  3H0G C;  3S2H C;  4AYB D;  3M4O C;  3GTK C;  2PA8 D;  4A3E C;  2Y0S D;  4LK1 A;  1Y1W K;  2O5I A;  3GTP K;  1I3Q K;  1TWH K;  2E2H K;  3GTG C;  1Y1V C;  3S1M K;  4GZY A;  5M5Y K;  2R93 K;  4MEY A;  2R92 K;  5FJ8 K;  2JA8 C;  3S1R K;  3EQL A;  4BY1 C;  2NVT C;  2A68 A;  1SMY A;  5IYB K;  4BXX C;  4A3B C;  5IYC K;  4QJV B;  4LJZ A;  3GTJ K;  4G7H A;  3S14 C;  3WOD A;  3S16 K;  3H3V L;  1R9T C;  2E2I C;  2E2J C;  2B63 K;  5TMF A;  1TWA C;  3HOY C;  4BBR C;  5IYD C;  1SFO C;  2JA5 K;  4NOI A;  3GTL C;  4YFX A;  4KN7 A;  1IW7 A;  4A3M C;  3I4M C;  3H0G K;  3S2H K;  3GTK K;  4BBS C;  5FLM C;  3M3Y C;  3HOV C;  4Q5S A;  2A6H A;  2CW0 A;  3S2D C;  4KN4 A;  5IP9 C;  2WB1 L;  4XSZ A;  3PO2 C;  3RZD C;  1K83 C;  2NVQ K;  3GTG K;  1I6H K;  4A3I C;  3I4N C;  4A3C C;  4A3J C;  2JA8 K;  3HKZ L;  5D4D A;  4BY1 K;  2PPB A;  2NVT K;  3HOU C;  4AYB L;  4XSX A;  2PA8 L;  4LK0 A;  2Y0S L;  4BXX K;  3S1N C;  4A3B K;  4C3J K;  1BDF A;  3S14 K; 
#chains in the Genus database with same CATH topology
 1DCO A;  1EQR A;  4A3D C;  3HOY K;  1WCM C;  5M3F K;  3Q3Q A;  4KMH A;  1BGW A;  3BP8 C;  4A3M K;  4P5A A;  4YG2 A;  4BBS K;  1O2B A;  3M3Y K;  4A3F C;  1UV7 A;  4KMU A;  3RZD K;  4LOW A;  4OIQ A;  3GTO C;  3CQZ C;  2R92 A;  3GTM C;  1WQG A;  3FKI C;  1VGX A;  3LAJ A;  1R9T A;  3DXJ A;  4GTE A;  4JK1 A;  2JA7 K;  4G0W A;  1TWF C;  5M5W K;  1DCH A;  3GDZ A;  4GTB A;  1WOP A;  2P5M A;  4P5B A;  1BJT A;  2JA6 K;  1XPP A;  3HOW K;  4KMD A;  1K83 A;  1YNJ A;  4XLP A;  2NVY K;  4C3H K;  5C3E K;  1J6X A;  1Y1W C;  2NVQ C;  1IE0 A;  1O25 A;  2EBB A;  3HOZ K;  1HQM A;  4X6A K;  4OIO A;  3HOX K;  4WIL A;  3ERE D;  4A3K K;  5IP7 K;  1WCM A;  4LLG A;  3FOE A;  3S16 C;  5C4J K;  1XZP B;  5C44 K;  4Q4Z A;  4Y7N K;  4O2D A;  5EGH A;  3H0G C;  3S2H C;  3GTO A;  3QX3 A;  3CQZ A;  2O5I A;  3GTM A;  1TWH K;  1O2A A;  3FKI A;  4XCH A;  5FJ8 K;  3TFH A;  3S1R K;  2Y3P A;  1YX2 A;  4KAT A;  4BXX C;  2JH3 A;  1TWF A;  4GTL A;  3FHZ A;  3GTJ K;  3N0C A;  3S14 C;  2E2J C;  1ZQ1 C;  4RMF A;  4BBR C;  5IYD C;  2GAG C;  3GTL C;  3GTK K;  5FLM C;  4Q5S A;  1Y1W A;  2A6H A;  2NVY A;  5IP9 C;  2GAH C;  4XSZ A;  3PO2 C;  2E2H A;  1XZQ A;  4BLB A;  3I4N C;  4A3C C;  4A3J C;  4KMA A;  2NVT K;  1KQ4 A;  4C2M C;  4KAW X;  1BDF A;  4PAA A;  4G0V A;  1R9T K;  1O28 A;  2E2I K;  5M5X K;  1XXB A;  3H0G A;  3I4M K;  3RZO C;  2PHC B;  4ZH4 A;  2VUM C;  4G0U A;  1O26 A;  3S1Q C;  2FQO A;  4OIN A;  3M4O K;  3S2D K;  4A3E K;  1PJ6 A;  1TWG C;  1WSV A;  3V4G A;  1K83 K;  4KAS A;  3GSI A;  4C3I K;  3SZZ A;  3HOU K;  1TWC C;  4A3G C;  3A8I A;  3N3Y A;  4G7O A;  4BKW A;  1YCL A;  3MML B;  3S15 C;  4BY7 C;  1WSR A;  3GTJ A;  2YU9 C;  4A3D K;  2P8T A;  3K7A C;  2R7Z C;  1VH2 A;  3GTL A;  1WCM K;  1DCP A;  3GTQ C;  3OPF A;  1G51 A;  3PO3 C;  5C4X C;  2ZUE A;  3GTK A;  4A3F K;  4GTF A;  1VRQ C;  4A93 C;  2XCQ A;  4DDQ A;  1USO A;  3GTO K;  3AQP A;  1Y1V A;  4M1X A;  2O5J A;  1RU0 A;  3CQZ K;  1I6H C;  3GTM K;  3GIR A;  1IS1 A;  1XXA A;  3FKI K;  3S1M C;  3TFI A;  1YNN A;  1WOO A;  5TMC A;  3AH5 A;  2E2I A;  4J3N A;  5IYC C;  1TWF K;  1WOR A;  1SFO A;  2VUM A;  2WB1 D;  2GSN A;  2B63 C;  2JA5 C;  2PMZ L;  1TWG A;  4AYB D;  5IOQ A;  1Y1W K;  1XZQ B;  1X31 C;  4GFQ A;  1TWC A;  2E2H K;  4GTD A;  3GTG C;  2JA8 C;  3EQL A;  4BY1 C;  2YU9 A;  1SMY A;  2R7Z A;  4C3J C;  4GTC A;  3S16 K;  3GTQ A;  1PJ5 A;  5TMF A;  1TWA C;  4LR2 A;  4NOI A;  4YFX A;  4KN7 A;  5IOT A;  1IW7 A;  3H0G K;  3S2H K;  1F7U A;  5JVO A;  3HOV C;  1J6V A;  4KN4 A;  2WB1 L;  4P9S A;  4A3I C;  5CJ9 A;  3HXA A;  4AYB L;  4XSX A;  1AB4 A;  4BXX K;  3S1N C;  1O29 A;  3S14 K;  2NVX C;  2E2J K;  2RGR A;  2ZFZ A;  4KB2 A;  4QJV A;  2B63 A;  2A69 A;  4BBR K;  5IYD K;  3GTL K;  2GSU A;  1ZYR A;  4FM9 A;  3S17 C;  2WAQ D;  1O2F B;  5FLM K;  2RH6 A;  5IP9 K;  3PO2 K;  3GTG A;  4QIW D;  3I4N K;  4A3J K;  4A3C K;  1Y1V K;  1XXC A;  4C2M K;  3GEH A;  1GE9 A;  1O27 A;  4PAB A;  1TWA A;  4Y52 C;  1I50 C;  2W7V A;  1SFO K;  2VUM K;  3OEP A;  3N0B A;  3L4J A;  4G7Z A;  3S1Q K;  4YFK A;  4GTA A;  1TWG K;  4A3L C;  3GEI A;  1J6W A;  4BLA A;  4MEX A;  2WAQ L;  1I6V A;  3GTP C;  1I3Q C;  1TWC K;  4A3G K;  3T01 A;  3H3V D;  2R93 C;  2R92 C;  3S15 K;  4BY7 K;  5IOR A;  2NVX A;  2YU9 K;  2BE5 A;  4QIW L;  3K7A K;  3VA7 A;  5IYB C;  2R7Z K;  2PMZ D;  3GTQ K;  3PO3 K;  5C4X K;  1WIH A;  4MQ9 A;  1JQW A;  4A93 K;  1ZBS A;  3HKZ D;  3T02 A;  3M4O C;  2PA8 D;  4A3E C;  4LK1 A;  3JST A;  1INN A;  4FZB A;  1IQ0 A;  3A8J A;  3S1M K;  4GZY A;  1DD5 A;  5M5Y K;  4MEY A;  3AD8 C;  2A68 A;  2XCO A;  5E68 A;  2XCR B;  3LAP A;  4A3B C;  5IYC K;  3ADA C;  4KDD A;  4KM9 A;  4LJZ A;  4QJV B;  1I50 A;  3H3V L;  3AD7 C;  1J98 A;  2B63 K;  3HOY C;  2FQT A;  2JA5 K;  4AH6 A;  1V5V A;  1JOE A;  1C0A A;  4A3M C;  4BBS C;  1IL2 A;  3M3Y C;  2CW0 A;  3GTP A;  1I3Q A;  3RZD C;  2NVQ K;  3GTG K;  2R93 A;  1PJ7 A;  2JA8 K;  3HKZ L;  4KAR A;  4BY1 K;  2PPB A;  3TTG A;  2PA8 L;  4LK0 A;  4C3J K;  3G4C A;  2CFA B;  2JA7 C;  1TWA K;  1EH1 A;  4WJ3 M;  2V6U A;  3NUH A;  3HOV K;  3BUE A;  3CAG A;  2JA6 C;  3HOW C;  4YFN A;  4XLN A;  3FOF A;  4A3I K;  2NVY C;  4C3H C;  5C3E C;  2E2H C;  5HL8 A;  4KC6 A;  4KM8 A;  2ZUF A;  1ZVU A;  3HOZ C;  3S1N K;  1B4B A;  1WQH A;  4X6A C;  3T00 A;  2NVX K;  1B4A A;  3HOX C;  3TFJ A;  5IP7 C;  4A3K C;  5M3M K;  4C45 A;  3S17 K;  2JA5 A;  5C4J C;  4OIR A;  5JFE A;  1IBA A;  5C44 C;  1F7V A;  4Y7N C;  3S0X A;  5IOS A;  2GSO A;  2A6E A;  1TWH C;  1WQF A;  2V6S A;  3ORE A;  1EI6 A;  1VJE A;  1VLO A;  3LPX A;  4OIP A;  3S1R C;  2JA7 A;  3L4K A;  5L46 A;  4Y52 K;  2KWA A;  3GTJ C;  1BS2 A;  1I50 K;  2CFA A;  3RZO K;  1F9N A;  1O24 A;  2JA6 A;  5EGE A;  3BP3 A;  4A3L K;  1WOS A;  5TJ3 A;  3GTK C;  2Y0S D;  1L0W A;  3GTP K;  1I3Q K;  1JVI A;  3SZY A;  1Y1V C;  2R93 K;  2R92 K;  3GEE A;  2NVT C;  4ILD A;  4WJ4 A;  5IYB K;  3A8K A;  3G4A A;  4GT9 A;  5CHP A;  4G7H A;  3WOD A;  1ISE A;  1R9T C;  2E2I C;  1EK8 A;  3AQO A;  1SFO C;  2V6T A;  3IPJ A;  1XZP A;  3I4M C;  1F93 A;  3AD9 C;  1USM A;  1ZXO A;  4LQY A;  4KB4 A;  1HI9 A;  1TWH A;  3S2D C;  1K83 C;  4C3I C;  1I6H K;  2D6F C;  5D4D A;  3HOU C;  2Y0S L;  1EFW A;  4A3B K; 
#chains in the Genus database with same CATH homology
 1R9T K;  2E2I K;  5M5X K;  2E2J K;  2NVX C;  2JA7 C;  4QJV A;  1TWA K;  4A3D C;  3HOY K;  2A69 A;  4BBR K;  5IYD K;  3GTL K;  1WCM C;  1ZYR A;  5M3F K;  3S17 C;  4A3M K;  2WAQ D;  3I4M K;  4ZH4 A;  2VUM C;  3RZO C;  4YG2 A;  4BBS K;  5FLM K;  3M3Y K;  3HOV K;  3S1Q C;  4OIN A;  3M4O K;  3S2D K;  4A3F C;  5IP9 K;  2JA6 C;  4A3E K;  1TWG C;  4YFN A;  4KMU A;  4XLN A;  3RZD K;  1K83 K;  3HOW C;  3PO2 K;  4C3I K;  4OIQ A;  4A3I K;  2NVY C;  3GTO C;  4QIW D;  5C3E C;  4A3J K;  2E2H C;  1Y1V K;  3I4N K;  4A3C K;  3HOU K;  3CQZ C;  1TWC C;  3GTM C;  4A3G C;  4C2M K;  3HOZ C;  3S1N K;  3FKI C;  4G7O A;  3S15 C;  4X6A C;  4BY7 C;  3DXJ A;  4JK1 A;  2NVX K;  2JA7 K;  2YU9 C;  3HOX C;  4A3D K;  4Y52 C;  3K7A C;  2R7Z C;  4A3K C;  5IP7 C;  1WCM K;  5M3M K;  3S17 K;  1TWF C;  5M5W K;  1I50 C;  5C4J C;  1SFO K;  4OIR A;  2VUM K;  3GTQ C;  3PO3 C;  5C4X C;  5C44 C;  3S1Q K;  4G7Z A;  4Y7N C;  4A3F K;  2JA6 K;  4YFK A;  4A93 C;  1XPP A;  1TWG K;  3HOW K;  4A3L C;  1YNJ A;  4XLP A;  4MEX A;  2NVY K;  3GTO K;  4C3H K;  2A6E A;  5C3E K;  2WAQ L;  1Y1W C;  1I6V A;  2NVQ C;  2O5J A;  3CQZ K;  3GTP C;  1I6H C;  1I3Q C;  1TWC K;  1TWH C;  3GTM K;  4A3G K;  3HOZ K;  3H3V D;  3FKI K;  1HQM A;  3S1M C;  4OIP A;  2R93 C;  2R92 C;  3S15 K;  1YNN A;  4X6A K;  4BY7 K;  3S1R C;  4OIO A;  5TMC A;  2YU9 K;  3HOX K;  4Y52 K;  2BE5 A;  4QIW L;  3K7A K;  2R7Z K;  5IYB C;  4A3K K;  2PMZ D;  4LLG A;  5IP7 K;  5IYC C;  1TWF K;  3GTJ C;  3S16 C;  5C4J K;  1I50 K;  3GTQ K;  2WB1 D;  3PO3 K;  5C4X K;  5C44 K;  4Q4Z A;  2B63 C;  3RZO K;  4MQ9 A;  4Y7N K;  2JA5 C;  2PMZ L;  4A93 K;  4A3L K;  3HKZ D;  3H0G C;  3S2H C;  4AYB D;  3M4O C;  3GTK C;  2PA8 D;  4A3E C;  2Y0S D;  4LK1 A;  1Y1W K;  2O5I A;  3GTP K;  1I3Q K;  1TWH K;  2E2H K;  3GTG C;  1Y1V C;  3S1M K;  4GZY A;  5M5Y K;  2R93 K;  4MEY A;  2R92 K;  5FJ8 K;  2JA8 C;  3S1R K;  3EQL A;  4BY1 C;  2NVT C;  2A68 A;  1SMY A;  5IYB K;  4BXX C;  4A3B C;  5IYC K;  4QJV B;  4LJZ A;  3GTJ K;  4G7H A;  3S14 C;  3WOD A;  3S16 K;  3H3V L;  1R9T C;  2E2I C;  2E2J C;  2B63 K;  5TMF A;  1TWA C;  3HOY C;  4BBR C;  5IYD C;  1SFO C;  2JA5 K;  4NOI A;  3GTL C;  4YFX A;  4KN7 A;  1IW7 A;  4A3M C;  3I4M C;  3H0G K;  3S2H K;  3GTK K;  4BBS C;  5FLM C;  3M3Y C;  3HOV C;  4Q5S A;  2A6H A;  2CW0 A;  3S2D C;  4KN4 A;  5IP9 C;  2WB1 L;  4XSZ A;  3PO2 C;  3RZD C;  1K83 C;  2NVQ K;  3GTG K;  1I6H K;  4A3I C;  3I4N C;  4A3C C;  4A3J C;  2JA8 K;  3HKZ L;  5D4D A;  4BY1 K;  2PPB A;  2NVT K;  3HOU C;  4AYB L;  4XSX A;  2PA8 L;  4LK0 A;  2Y0S L;  4BXX K;  3S1N C;  4A3B K;  4C3J K;  1BDF A;  3S14 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...