3GTPJ

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna-rna hybrid
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtpJ00
3BQZA 5IOZA 1QRYA 5FKNA 1OJLA 1NK3P 5FLVA 3BQYA 1TWAJ 3FISA 2DMTA 1CQTA 4QIWN 5EEAA 3BR1A 1FIPA 4DW6A 5J1YA 3HOZJ 2G0EA 4M3FA 1IUFA 5HODA 4A3CJ 2M2EA 3HGGA 5E3NA 2JK3A 3BG9A 2PMZN 4A3BJ 2O7OA 3IH3A 4C3HJ 1IDZA 5C4XJ 1QVTA 5IPAA 5C4JJ 3I4MJ 2EZLA 4A93J 9ANTA 3JREA 2NS7A 5J1RA 2Y0SN 5IP6A 2NS8A 1WH5A 2N8GA 1JGGA 4JX5A 5FKOA 1RKTA 2LY9A 3B6CA 2DA3A 4MFEA 5K7ZA 4XICA 4V2FA 5EG0B 5IYDJ 4D7MA 2O9LA 2JMWA 4I76A 2LVSA 3GTKJ 1ETKA 2AHQA 2E19A 2JN6A 3FIWA 4IHVA 3A03A 2ID6A 1BL0A 3BR3A 1FTZA 3RZOJ 2LLKA 1XG1A 2KT0A 4M6VA 1ETXA 4XK4A 1MBFA 4IEJA 1HF0A 3MVPA 1UG2A 1EF4A 1JUPA 1H89C 5JLXA 1S7EA 2DN0A 2CJJA 4I6ZA 4XRSA 2R5ZA 2DA5A 1ZGWA 2LFBA 4IHWA 1OFCX 1XC5A 2Y31A 3JRAA 2DJNA 5F04A 1I6HJ 5F0CA 5M3FJ 3BG3A 1ORKA 5EDNA 1HDPA 2IBDA 4C3IJ 1JJ6C 5J1UA 3LSGA 3BTCA 1LE8B 2WAQN 4XRMA 3HGYA 1G2HA 1OCTC 2ECBA 2Y9YA 4DZJA 3GTGJ 1AU7A 2XGCA 3LSRA 3Q3SA 4FTHA 3WHBA 1NK2P 3W6VA 3S1MJ 2M8GX 3TW6A 5JLWA 1Z0XA 1WCMJ 2E2JJ 4FE4A 1P7JA 1TWHJ 2HOAA 1U9NA 2NVXJ 2IEKA 3C2BA 4EEFG 4JYKA 4BKXA 2L7FP 3GTOJ 2DA7A 1AKHA 3HKZN 1JTXA 2EBIA 4FCYA 1BW6A 5F0FA 1GV5A 2YS9A 1JKPC 4W97A 3ZQGA 4C3JJ 2R5YB 2OPTA 4LOCA 4XIDA 1Y1WJ 2D5VA 4AUXA 4X1EA 4A3JJ 2HOSA 1UHSA 2LD5A 2JA6J 1A6IA 2DMNA 1JTYA 1TWFJ 4M3DA 4IHXA 2E2IJ 1MBJA 2DMUA 4S0HB 3LSJA 4D5FA 2DA2A 4J19A 3PO2J 3GTQJ 5E3LA 1Q1VA 2K40A 1IDYA 4L5EA 2NOGA 2NVYJ 4M3EA 5BNGA 5E3MA 4A3FJ 3B6AA 3QPSA 3IH4A 5M5WJ 3MN2A 3S2HJ 4QSHA 1IRZA 1MBKA 1RKWA 2XPWA 1ETVA 1WH7A 2K9NA 2X6OA 5M5YJ 2ELKA 3CMYA 1XS9A 1U78A 1P7IA 2YU9J 3HOVJ 4A3IJ 2EZKA 5IYBJ 3GTMJ 4A69C 3LNQA 2R5YA 1R9TJ 2EZIA 2E2HJ 2FX0A 1B8IB 2E1OA 3SFIA 3A01B 1ZR4A 2R92J 1Z77A 1FTTA 1JT0A 1WI3A 1BA5A 1IV6A 2IAIA 1K83J 3ZQCA 4MLOA 5F0HA 3FKIJ 3QQAA 1W0TA 3NAUA 2DA4A 2I10A 1FJLA 3K2AA 1RPWA 1VF9A 2L7MP 2DMPA 5C3EJ 5IYCJ 1JKRC 4ABZA 4AYBN 2QF7A 5K7HA 1IGNA 1X2NA 2MGQA 4UUSA 4FE7A 1X2MA 2MG4A 5E3OA 3OIOA 4M3BA 3GTPJ 2XGEA 1IC8A 2JA7J 1MBHA 3NARA 2Y30A 3BTJA 1RR7A 1X58A 4V2GA 5EGOB 2NVTJ 2QCOA 2CU7A 1GDTA 2HQ5A 1B8IA 4A3MJ 2EH3A 4CYCA 1VFCA 3QPLA 3OSGA 2LTPA 1UMQA 1TWCJ 2K9QA 1GT0C 3FK6A 2HOTA 2X9DA 2CQQA 3BG5A 3ZQFA 5EG0A 2L9RA 1ZK8A 4G12A 1MH4A 3HBLA 1HCRA 1TC3C 2HDDA 1JT6A 3JRBA 2W48A 2HXIA 2H8RA 2CRGA 3ZQHA 3G1MA 4B4CA 3HEFA 4UUSB 3O8GA 3TEDA 1WPKA 3TP0A 2OF7A 5EYRA 2VKVA 4XRSG 3ZQLA 3BR6A 2XSDC 1YRNA 1POGA 2DMQA 4BY1J 1GVDA 1IJWC 3SDGA 3E7LA 5EGOA 2JA5J 2ZB9A 1MBEA 3A02A 3OSFA 2H1KA 1U9OA 2VPRA 3G1LA 1GUUA 2GBYA 3S1QJ 2MW8A 3DCFA 3HOYJ 3S16J 3S17J 4AC0A 4RDUA 1H8AC 3CCYA 1MBGA 3PO3J 2R7ZJ 2B63J 5K7FA 4C2MJ 1ZQ3P 1QVUA 1MSEC 3JRGA 1LE8A 2R5ZB 2DA1A 4W1UA 3OOUA 3TP3A 1D5YA 2XGDA 3S14J 4IHYA 3ZOBA 4A3LJ 1PUFA 3HB9A 3BT9A 3A01A 3JRDA 3RZDJ 1YRNB 4Y52J 1LFBA 3S1RJ 3GBGA 1K61A 3S15J 4B3AA 1BW5A 2FQ4A 1GV2A 5M5XJ 2K9SA 1ENHA 3L1PA 1JUSA 4DYCA 5M3MJ 5EZGA 2ME0A 3LSPA 3GTJJ 2O8KA 3WHCA 2GM4A 1MH3A 3GTLJ 1T33A 3CQZJ 1LFUP 2M9HA 3ZQIA 5FLMJ 1E3OC 2EQRA 1ETOA 1ZTRA 3TW7A 2HYJA 1BJZA 4UUTA 2RAEA 4QTRA 1ETWA 2ME6A 3S1NJ 1ETYA 2NVQJ 2VI6A 1RESA 3H0GJ 2ID3A 2AO9A 2CUFA 5EZHA 5FKMA 1ZR2A 4MO7A 4BY7J 3HDDA 5F1JA 4A3DJ 4DYRA 1PUFB 2DA6A 4BBRJ 4FISA 1I50J 4A3GJ 2VKEA 5FKKA 4JX4A 2L0KA 5EF6A 2EZHA 2HI3A 2DTZA 5C44J 4A3EJ 2Y9ZA 4B1RA 3BR5A 2YUSA 2JA8J 3BTLA 5J3LA 2HXOA 4DZPA 3Q0VA 3MKLA 3HOUJ 1FIAA 4MIMA 3SJMA 1I3QJ 2CQXA 4BBSJ 5FJ8J 1F43A 2Y2ZA 3BTIA 5GPAA 1TWGJ 2P81A 4BXXJ 1RETA 2XB0X 2MSYA 1QPIA 1B72A 3PM1A 4Y7NJ 3M4OJ 1NTCA 1ZKGA 5IP9J 3JR9A 1HOMA 3BR2A 4GFBA 2CUEA 1HLVA 2R0QC 3S2DJ 3UKGA 2JWTA 2TCTA 3CDLA 1JKQC 2X48A 1JKOC 2LK2A 2TRTA 1U8BA 3G1OA 3HOWJ 2XPVA 5DTDA 2M34A 5IP7J 1SFOJ 5F08A 3VPRA 1ETQA 4CYCB 5GPCA 3Q0WA 1ITYA 2KDZA 1IG7A 3LOCA 1DU6A 1OCPA 4HNVA 4RBOA 2GLOA 3HM5A 1MSFC 3F0CA 4M3GA 3JRHA 4X6AJ 1A5JA 1F36A 1VNDA 3Q0UA 3M3YJ 3FK7A 2LP0A 1WGXA 2FJ1A 3IH2A 2WV1A 4D5CA 1H88C 1APLC 1JUMA 1FEXA 2XPUA 1Y1VJ 3I4NJ 2LKXA 3K7AJ 5FKLA 2FD5A 3IV5A 5DS9A 1AHDP 2L7ZA 4A3KJ 3RKQA 3JRCA 1T56A 2JJ7A 2WB1N 4D7NA 2ECCA 4MFDA 5GP9A 5F27A 1W0UA 3RQIA 1SANA 3H3VK 1HDDC 3HOXJ 2R93J 2M0CA 2COBA 4JP0A 1AKHB 1JJ8C 3JRIA 2XB5A 1B72B 1O4XA 2VUMJ 3JRFA 3D1NI 1MNMC 1DU0A 1VI0A 4DYQA 5IOYA 3DEWA 4JX6A 2XRLA 4NDLA 2LR8A 3BR0A 3O8HA
chains in the Genus database with same CATH superfamily
5IOZA 4E7SA 1QRYA 2F4MB 2X6XA 3SDBA 3J7ZI 3RKYA 2OCEA 3BQYA 3DQVC 3IP4B 2OUMA 1R58A 3FISA 2K9MA 3A2KA 3CCUI 4QIWN 1WKMA 3MWMA 1I27A 4BE0A 5D4RA 2G0EA 3FZVA 4QWQA 2W25A 2ZFUA 2CGPA 1TBXA 3JAMK 1TQPA 3HGGA 4RGSA 5E3NA 4LK0F 4M71A 4WX9A 1GHCA 4B48A 3A1YA 2V9KA 2D2WA 4A3BJ 5C4XJ 3CUOA 5D4SA 4EQQA 2YX4A 5C4JJ 1XCVA 2RQQA 3I4MJ 2EZLA 4GGGA 4KIFA 4A93J 9ANTA 3PSIA 3K4MA 4E70A 2DT5A 3M1EA 1G8XA 2GAUA 2L9NA 2CW8A 1W7PA 1KU2A 2IW5A 1QQIA 1WH5A 2N8GA 2K3FA 3KE2A 4F52A 1RKTA 4MFEA 2DA3A 3W3CA 1MNDA 4M9XA 3K1PA 3AL0B 4FX0A 2C6YA 5IYDJ 1U0JA 2L3DA 2AHQA 1SEUA 3DPLC 3VSKA 3E3VA 4HX8A 3M7GA 2ID6A 3J81K 3CO7C 1BL0A 2OZ6A 4BGDA 1FTZA 3RZOJ 2FOKA 1MDMA 1T08B 2KT0A 4M6VA 4NC8A 1MBFA 2JPBA 4IEJA 4EJVA 1EF4A 1JUPA 5ILUA 4LLGF 1N77A 2FU4A 5HLGA 3J7AY 3F72A 2K4JA 1ZH5A 2X6YA 4GYGA 1Z6TA 3HYIA 4FETA 2LF8A 3PIOF 4IHWA 1UHWA 2MH2A 3W2VA 4R79A 1R00A 1XTAA 2DCEA 2DJNA 1HKSA 5F04A 3K70C 3OYCA 4M9SA 1JGSA 5F0CA 5KNLA 3HTSB 1ORKA 1VQMI 2E34A 5D5VB 4C3IJ 3LSGA 3FWEA 4BJTA 1LE8B 3CDIA 1PYVA 5FFXA 4ZDLA 2ECBA 1R71A 2LMDA 3P7NA 4HDUA 1W5TA 1AU7A 2XGCA 3RI4A 4EGZA 5H6QA 3I55I 1FPQA 2HKXA 2QQBA 3WHBA 2HNHA 2DDBA 5JLWA 1FBSA 1Z0XA 3F21A 1U3EM 5J4VA 2E2JJ 1P7JA 3VYSB 4WK8F 1U9NA 1ACIA 1T8IA 1LDDA 4AM3A 2P5VA 2LYCA 2PEXA 1KGSA 1YE9A 4L9JA 4FCYA 2V6EA 1BW6A 1GV5A 4UUVA 4ZJZA 1D0YA 2E60A 4LOCA 1Y1WJ 3L7WA 5J47A 2GA2A 1LQ1A 2E7XA 4NQWA 4ZYAA 3K69A 4IZZA 4O5VA 4HQMA 3ZMUA 1PJRA 1CF7A 1OCRH 1A6IA 5EEHA 4IHXA 4IHSA 3FDYA 2MC4A 4S0HB 5GTIC 4D5FA 2DA2A 2HTSA 4N4NB 4CYDA 2DBBA 3H35A 2RDPA 3C1DA 2E1MB 4PZJA 4XBFA 5CVJA 1X4PA 1FYMA 2ZSHB 3CC4I 3M8EA 4OAYA 2NVYJ 2Z9OA 3K9TA 5BNGA 2EV6A 4RA2A 3VYRB 1G3SA 4LG3A 1UFMA 3QPSA 1H0MA 1O7LA 3CO6C 1G59A 4BUPA 2HR3A 1YQAA 5BS6A 5K5QA 5E1ZB 2X6OA 3KP5A 1XS9A 3KEOA 2LDUA 4UNOA 3HOVJ 2YU9J 4A3IJ 2EWNA 5IYBJ 2X51A 2BYVE 4K2EA 2EZIA 1UJ8A 1FT9A 4GDFA 5J4YA 1R6RA 1FTTA 2FF4A 1JT0A 4EV0A 3G4SI 1IXCA 3WTWC 1CF7B 1HKTA 2D1VA 3TKYA 1LPQA 3AG1H 3BDDA 4HDVA 3CCQI 4UY8I 3VB2A 3H5AA 4YIFA 1TT0A 3GVAA 4ESBA 1FY7A 2DA4A 2I10A 4IL6C 1WJ5A 1K6YA 1RPWA 2AQEA 2L7MP 4MTDA 1X3UA 4F3QA 4AIDA 2KPMA 2LC2A 4ABZA 3N05A 4XLEA 4IVNA 2QF7A 2FXAA 5CQEA 2PMHA 1U8RA 3HTUA 1IGNA 2MGQA 3EQLF 1X2MA 2FUG2 2WBMA 3OIOA 3RKXA 2JUCA 3RTRA 2Y30A 3BTJA 1X58A 4F91B 2A61A 1R1TA 2UXXA 3PNVA 1ON1A 2QCOA 5ILSA 5DD4A 2CU7A 4UVBA 4ESFA 1B4AA 3S2WA 1B8IA 4BJ6C 3C2HA 1W5CC 4CYCA 4U7DA 3OSGA 2QYOA 2COMA 1TWCJ 2K9QA 3GX4X 3EUHA 3FK6A 4S05A 2DYRH 2M8EA 2ZXIA 2CQQA 1YIJI 3ZQFA 5DV5A 2L9RA 3DU5A 5HLIA 1HQCA 4Y4RA 2IGNA 3OS0A 3MD2A 4G12A 1MH4A 1ONVA 1FOYA 3DFGA 3HBLA 1TC3C 4KITB 2EIKH 2CS3A 2W48A 1J59A 2HXIA 2CH0A 4P55A 2PBIA 1ZLKA 2DFFA 2G7UA 3KFWX 4B4CA 1QHGA 1YW8A 1SVOA 2XSJC 3TEDA 1WPKA 4G6TB 5BPDA 4II3A 4XRSG 4HF1A 2E7WA 2V26A 2HEOA 1ZRDA 5FFZA 2XSDC 3B02A 3RJPA 1FMWA 1GVDA 2D45A 1IJWC 2R7QA 1EJ9A 1IN4A 1WJFA 3SDGA 1ZHFA 1SFKA 2PMUA 3T1BA 3A02A 3FMSA 3ABKH 1U9OA 4L5JA 1GUUA 3S1QJ 3KPHA 3GYHX 3QYEA 4MEYF 1BI3A 3HOYJ 1UCRA 4HLXA 2H94A 3KP6A 5TISC 1D8KA 2LG4A 3TMOA 1QGPA 3RYPA 3E6BA 5GTHC 1E17A 1QVUA 4I09A 3E6MA 3WTSC 1D1CA 3LA3A 1WJDA 2FBIA 3OOUA 4IRGA 3TP3A 2OV7A 2XGDA 4F93B 3ZOBA 4F7ZA 2O5RA 3BT9A 2F5EA 3RZDJ 2BGCA 1YJWI 1LDJA 2ETHA 3GBGA 3PNTA 2GWRA 3MMYB 1LB2A 3L1PA 3CMAI 1A35A 4AVZA 1QZYA 3PQKA 1T2KA 3LSPA 2QBYA 2KIUA 3WG7H 4U7BA 2ZJPF 1KYWA 1FX7A 2E1NA 1T38A 1VQNI 1MH3A 1T33A 4ZDOA 2M9HA 2QKMB 3S3NA 1ETOA 1OYIA 2VODA 3PIPF 1IN5A 2HYJA 2RAEA 3GLXA 3HRSA 3ZR8X 1IRFA 4KIGA 1YS7A 3K4BA 1ZG3A 3LMMA 2ZXWH 1TQMA 2VI6A 3GCMA 3OR2C 1BR1A 1Z1DA 5IY5H 3JTHA 3R0JA 4BY7J 1EV7A 1KONA 4E6KG 5F1JA 2JPCA 3HDDA 2F48A 3ZP5A 2DA6A 4FISA 4G94A 1I50J 1D1BA 2I5UA 1YOVB 1K4TA 4PJLA 1X1DA 2L0KA 2R3SA 3NRVA 2DTZA 2VJ4A 4AIJA 2Y9ZA 4M6XA 4B1RA 2PX9A 3M9AA 4IHTA 2K27A 4KN4X 1HXDA 2HWVA 3BTLA 4WCGA 4BDZA 1IW7F 3Q0VA 3TOAA 4XOPA 4PJJA 1O3RA 2UXNA 3I0TA 4O3MA 2CQXA 1TQIA 4BBSJ 5FJ8J 4R1HA 4U0YA 2R7TA 3I59B 1TWGJ 4OWRB 5DM7F 3REOA 4Q4ZF 1BOBA 3PJRA 2M4GA 4BE1A 2XB0X 2MLKA 4KUMA 1TNTA 1QPIA 3M4OJ 1ZKGA 3FXLA 2V7FA 5B1BH 2LOOA 3OR1C 4R8HA 2R0QC 3S2DJ 2JWTA 1U5TA 3FM5A 1JKQC 4ITVA 1S7OA 1KA8A 1OCCH 4AVPA 1JHHA 3GFJA 1U8BA 4ZZLA 5DCMB 3M8FA 4XQFA 4G9YA 5ILVA 3MCZA 1QZZA 1SFOJ 5F08A 3HJEA 1M1EB 4CYCB 1BC8C 3Q9VA 5GPCA 3Q0WA 5E20A 5LGTA 3QAHA 1SVMA 2OQRA 1W7PB 1DP7P 3DKYA 3SEQA 4HNVA 2GLOA 4AIKA 4PUSA 3HM5A 2VXZA 2YSRA 3F0CA 4M3GA 3BJ6A 3ZMTA 2PI0A 2A68F 5AIQA 3BP8A 1T98A 1DQUA 2EA2A 2ZJRF 2LP0A 2VJ5A 1WGXA 2LBFA 4D5CA 1APLC 2BV6A 1Z91A 3CESA 1Y1VJ 1NH3A 1T6SA 4B43A 2F5VA 3KP4A 2FD5A 2AXLA 1GLNA 3NEUA 1L3LA 5DS9A 1AHDP 4RS8A 2A5WA 4HF2A 1KYZA 2GOXB 5LRRA 2MBFA 2EFWA 3JRCA 1TW3A 4D7NA 1WJEA 5F27A 4ZYEA 2JRTA 1W0UA 3H3VK 3W6KB 3HOXJ 2R93J 5DUIA 4LIUA 4G7ZF 4FX4A 2W85A 3L00A 3G6EI 1XSDA 1DU0A 2JTVA 1HW5A 1HC8A 3M07A 2XRLA 2KZVA 1MMNA 1B1BA 4L18B 3H9GA 2LR8A 4HEA2 1X4OA 1XD7A 1WJBA 3MEXA 3OYHA 2Z16A 4EM0B 2DJIA 3HUGA 4BHPA 1OJLA 3N4MA 1NK3P 3SFZA 4ZH4F 2DMTA 2R4GA 2V1DA 3U9GA 3BR1A 3HOZJ 2QUFA 4M3FA 1IUFA 1R22A 4EM2A 3OL4A 2GXBA 1QA6A 3AFHA 2CUZA 1FYKA 4PDKA 4CSWA 3FHNA 4J01A 3H5NA 1IDZA 2OTJI 2F4IA 4I99C 5GADJ 2VC0A 1LEBA 3PFYA 3EPZA 5IPAA 5IT9K 5CVIA 4AYBA 3JREA 4RLQA 3X2QH 3OS2A 2DT6A 3DF8A 1MJ9A 5IP6A 3ZMSA 1BR2A 3V4GA 1JGGA 1R23A 4JX5A 1ZGJA 4IQ4A 2LY9A 3B6CA 3H36A 1IRXA 3I53A 4LB6B 5FD6A 4XICA 3I64A 3KETA 2HVSA 2L4AA 1BM9A 5EG0B 2ZSIB 2VQLA 2MD0A 5D8KB 4XN3A 4I76A 2H27A 3GTKJ 1S9HA 4XLCA 2IA1A 5JI6A 1OPCA 4XKBA 1SFUA 2GXAA 2M7BA 3R4KA 2CUJA 1Y39A 3BJAA 2P7CB 2ICWG 3LQQA 2CFOA 2V6CA 3TGNA 2LLKA 2VE9A 1ETXA 4XK4A 5JVTA 2F5CA 1UG2A 4BAYA 2V9PA 5ERIA 2CFXA 2ZKZA 1I39A 1S7EA 4HX4A 3V8LA 2LY2A 2CJJA 1HBXG 2CQ7A 4I6ZA 4XRSA 2R5ZA 2R7RA 1ZGWA 1V54H 5CVVA 4WXHA 1OFCX 3K4CA 1A36A 3JRAA 4YIRX 3CP8A 3WGIA 2M45A 3S32A 3ZGKA 1RIOH 2CQKA 4KYWA 1WI9A 3HIFA 1U6GA 3CUQA 2Z99A 3BY6A 3BG3A 3ZMVA 3EUKL 4B8XA 1VQ4I 2HS5A 5FLXK 2GIZA 1HW2A 2Z33A 1HDPA 3LFUA 4GO1A 3CJRB 1G4DA 2HYGD 2FQ3A 2KMUA 2VB6A 2CQNA 3BC8A 1YHQI 2HGCA 4DZJA 2IGMA 5FLXZ 1VQ8I 3H9JA 4LG0B 4BQQA 2ESNA 4ENMA 2X6WA 1R5ID 3OIPA 4MQ9F 3W6VA 1TZLA 2VT2A 3BROA 4C9YA 3DLAA 3C2GA 3FMQA 2V1XA 1TWHJ 4FE4A 3HPGA 2VQHA 1JE8A 5ICGA 2R7WA 4L0ZB 3VOEA 2NVXJ 1NG6A 2EILH 5FB2A 2BE5F 1ZN2A 2LREA 1FP2A 1Q1HA 2QSFX 3GTOJ 2JSPA 2EBIA 1OCOH 3HKZN 3WTUC 2PN6A 1O3SA 2FMYA 1JKPC 3ZQGA 2OPTA 5DDGA 4XIDA 3WODF 2VKDA 3G3ZA 1I1GA 1X1AA 4P9FA 4A3JJ 1VQLI 3VSLA 1W36D 1JTYA 4M3DA 4RAYA 3OYJA 2DMUA 3LSJA 2DT7B 4XONA 1YW9A 1R4NB 1KU9A 2EINH 2HVQA 3K4LA 1Q1VA 2V1UA 2K40A 1DPUA 1ON2A 4M3EA 2P5LC 2ISYA 2CWEA 2VJJA 3RDIA 2XC7A 3FXJA 2RGVA 5DCMA 4V19K 3IHUA 1IRZA 1MBKA 3LSKA 1RKWA 4OU0A 3L2UA 1DGRM 2HU9A 4NNJA 4NC7A 2EZKA 2L2OA 4ZTFA 1BBYA 1MJBA 4WF2A 3GTMJ 2O8XA 4HV5A 2RV8A 2MD5A 2ZC2A 4ENJA 3FMRA 1ZR4A 3ZCOA 1Z77A 2BVLA 1C0WA 1WI3A 1FWZA 1YIOA 3HSFA 2HYFA 3CC7I 3OV8A 2ESHA 3R6SA 3FKIJ 3WTTC 3QQAA 1G3YA 5J40A 1W0TA 3NAUA 3FXMA 5EJCA 3FM3A 3AKZA 4PJ0C 4KICA 2KLOA 1FJLA 1X19A 2EFNA 2H6BA 2MH9A 4RM2A 5E8IA 5C3EJ 5BPIA 2VASA 1BIAA 1OR7C 1X2NA 4MQVA 4UUSA 3G73A 1YYVA 4XM3A 1J0RA 1D0ZA 1Z05A 4M73A 4V2GA 1N78A 2L01A 4FASD 2HQ5A 1D5VA 2WA0A 2WC2A 4A3MJ 1K6OA 3LSMA 3GLLA 4FT8A 1VFCA 1UZCA 2QBYB 1N75A 2L7KA 2LTPA 4EJOA 2G7HA 2XHKA 4ETSA 2VQCA 3K4KA 3Q9SA 1VQPI 2JVHA 2DODA 2ELHA 2VIXA 3GFLA 5CJ9A 1K79A 2Z3YA 3TQNA 2XASA 4YG2F 4CUGA 4OIQF 5JVGF 4YEJA 2X4HA 1YI2I 3ELKA 2A6TA 3ECOA 1V5GA 2CRGA 2OU2A 2VE8A 3HEFA 3OOPA 2QGUA 3O8GA 5D8LB 2UWMA 2M5WA 2IJLA 4XRFA 5EYRA 3ABTA 3CCLI 4YFNF 4NUBA 1AOYA 4XKCA 3BR6A 2BY1A 1YRNA 3O3KA 4BY1J 1FC3A 2OQGA 4HAMA 3H3ZA 3T5XA 5EGOA 1S3JA 3WTXC 2JA5J 2ZB9A 1MBEA 2EIJH 5L3CA 1A31A 2LKPA 2QLZA 2FA5A 3U21A 3GMEA 2MW8A 3HHHA 5A2QZ 3QU6A 2L4MA 4AC0A 1H8AC 5JHUA 5HDNA 2HTJA 3CCYA 2FEZA 4ZYHA 5LGNA 1MIJA 5HDGA 2YPRA 4LITA 2MA3A 3DEEA 5KK1A 4PJMA 2R7ZJ 4PCQA 5K7FA 3MZHA 4O6JA 5D6FA 1LE8A 2R5ZB 2HZTA 2WY7Q 3D5RC 3K10A 4E7LA 3S14J 4XL9A 4BYYA 4Q5SF 1PUFA 3HB9A 4HBLA 4Y52J 2JA2A 1EH6A 3DBHB 3I9V2 4AWXB 1KQ0A 2DPDA 2Z5UA 3S1RJ 4ASNA 5FROA 3ERED 1K61A 5HNFA 3S15J 4Y17A 3IC7A 2QQ8A 1GV2A 1XGOA 2Z2SB 4GYIA 4YFKF 1EKEA 1ENHA 1FYLA 5HLHA 1SMTA 1Y8RB 5EZGA 2EIMH 4UVCA 4JQFA 4YIIA 4IOAF 3GTJJ 1U2WA 1S5LC 1E3HA 1MZBA 2M7AA 2W84A 5ICEA 4HW0A 3WHCA 4A0XA 4RB0A 4D0PA 3GXOA 3B73A 3RIRA 3ZQQA 1DUXC 3GTLJ 2FNPA 1P4XA 3FKJA 5FLMJ 3BLYA 3AL0C 1R5HA 3I3LA 1PP8F 3TW7A 2YX7A 1BJZA 5CKTA 2O03A 4QTRA 2KISA 2VJIA 4BE2A 1VQOI 2E35A 4LIVA 3WE2A 5D6EA 2M3AA 5EZHA 4Z6YA 4E7JA 4BJ5C 5FKMA 4MO7A 2GOMA 4CCNA 4A3DJ 2KP6A 2DFHA 4BBRJ 4XOTA 4BXUA 3TO6A 4A3GJ 3TO9A 4ZDPA 1BOAA 5EF6A 2XROA 2EFPA 3C3WA 2ELJA 2WTEA 4A12A 2CO5A 3OYKA 3GWZA 3HOSA 1RRJA 2HXOA 3CZ6A 3H3UA 5L3BA 4RLFA 3KEYA 2IVMA 4MIMA 3SJMA 3I54A 2DAOA 1SFEA 4G8XA 2Y0MA 2Y2ZA 4WXCA 2R7UA 1FLIA 4BXXJ 5E79C 2W24A 1RETA 2P4WA 2P6SA 5FO5A 2MSYA 1FOXA 4HNUA 3HKZA 4Y7NJ 1NTCA 5IP9J 3JR9A 3BR2A 3BG7A 1W36C 3DTKA 4GFBA 1HSJA 2TCTA 3CDLA 6PAXA 1OYYA 1P92A 3ECHA 3WGHA 4WWCA 3CDHA 1I5ZA 2VOOA 2XF5A 4I7HA 5IT9Z 1E0EA 3G1OA 3L2QA 1DP3A 4PFOA 2DI3A 2M34A 5IP7J 5F6FA 1ETQA 3ABMH 4IQJA 1XSVA 2DOEA 3H9QA 2KDZA 1IG7A 1IO2A 3UNGC 4CCLA 2M4KA 3IRQA 3E6DA 3CCEI 3OYNA 4A6DA 2KIMA 5E1WA 1MSFC 2QSGX 5K5OA 1T39A 3AG2H 3JRHA 4KMFA 5BMZA 2EV0A 4KN7X 1R1VA 4OIPF 4X6AJ 5H6RA 2PFBA 3RPQA 4WXDA 2BZTA 2BW3B 4ESJA 2O6GE 3J7AO 3PFIA 3HSEA 2WV1A 5HLTA 3QRFF 3VWBA 1JUMA 3ZQ7A 3VYUB 2LBFB 2ZMEA 3J7YJ 3I4NJ 3K7AJ 3K1MA 5L3DA 1TP4A 3KLOA 3MAJA 3H0DA 3WU2C 1XCBA 2MLGA 3WTVC 3RKQA 3KIOA 1XPXA 3DP7A 3QODA 1SANA 4XLAA 1HDDC 3OYEA 1QO0D 5BOXA 1Z9CA 2COBA 1AKHB 1QPMA 4B3XA 2VUMJ 1RI7A 3D1NI 1HA8A 4KT5C 2DQRA 5IOYA 4DBRA 1J5YA 2FMLA 2MYSA 3V42A 2CYYA 1DDNA 1F5TA 1EH8A 3O8HA 1S6LA 3BQZA 4MGRA 5DUKA 3R0AA 3HXLA 2XGXA 2J5PA 1G6NA 1RC9A 1VQ7I 5HDKA 5FLVA 4CZZA 1CQTA 2ZBKA 2QKLB 3LSHA 5EEAA 3C7JA 4CO8A 1FIPA 4DW6A 5J1YA 1OMIA 3DBLB 3RYRA 3H5RA 5HODA 1RR8C 2QSHX 4OIOF 3HOTA 3AAFA 2XRNA 3BG9A 2PMZN 1REPC 2ZNYA 4QPQA 3IH3A 4OINF 4C3HJ 3ABLH 2DU9A 1MD0A 3BOQA 3CC2I 3A0HC 3IAS2 4CH7A 1ZG5A 2E1MC 1GXPA 2NS7A 2K9LA 1QHHD 4M74A 2KFDA 2M1BA 2F6CA 3PUBA 5DEQA 2PMZA 2Y69H 5K7ZA 1PP7U 1SFXA 1W7PD 2XF6A 1B9NA 2WB1A 4V2FA 2CV2A 2EJRA 2IPQX 2PJRB 2JMWA 4IF4A 5TRDA 1VZ0A 3K6GA 1E3PA 2NAZA 3EUAA 3BZ6A 4II2A 4XNFA 1TW2A 1BC7C 2YU3A 3T8TA 3S3OA 2R7SA 1U5TC 3BR3A 1IV8A 1X1CA 1LFPA 1BI0A 2VBYA 2E71A 2H6CA 1HF0A 1XB4A 3IWFA 1FBUA 2NNYA 1SMYF 2OJED 2HVRA 3S93A 3HRTA 3HC7A 3WTZA 5EEGA 5HOOA 1Y0NA 2XUBA 1YX3A 4N0BA 4E7KA 4ZZDA 2DA5A 3ROUA 2V1NA 4UB8C 2LFBA 1XC5A 3RKWA 2Y31A 4I98B 4RAGA 1IN8A 2KQRA 1OQYA 1X1BA 3TL4X 1I6HJ 5M3FJ 2JZYA 4HNTA 4X0GA 2H09A 2IBDA 5J1UA 2IGKA 1G3WA 1MNEA 3BTCA 4A6EA 5DCFA 4DIQA 1QBJA 5H20A 3FXKA 1LNWA 4OMYA 1OCTC 1PVEA 2Y9YA 3GTGJ 1R1UA 1P2FA 2IA0A 3BG6A 4L9VA 4PGGA 2CSOA 1WWXA 3KYCB 4FTHA 1RNLA 1XSXA 1TL8A 3S1MJ 2M8GX 4KDPA 3TW6A 1ERDA 1YLFA 2STTA 2VOPA 2DTRA 4KISA 2HOAA 1VQ5I 1O3QA 2F4OB 1W4MA 2IEKA 3C2BA 5J6XA 4JYKA 2L7FP 4P96A 2WADA 2BY0A 2DA7A 2ZNZA 1JTXA 2QQ9A 3R60A 2VONA 1YX5A 1USSA 2YS9A 1ZYRF 3TDUC 2OBPA 2PJPA 3DKXA 1D0XA 3CCJI 3JTGA 2R5YB 3NWSA 2NNNA 2MC3A 4HF0A 2PQ8A 5L3FA 4EJWA 5H2FC 3VEPA 2D5VA 4AUXA 4X1EA 4MEXF 3V7RA 3HL2A 2LD5A 3S8PA 2Y75A 4KA4A 2GQQA 1LEAA 4RMNA 3IL2A 4JBAA 4J19A 3GTQJ 1ZARA 2ZMEC 4XMYA 2FSWA 2ISZA 2O61A 5E3LA 2X0LA 3CJQB 2STWA 4NB5A 1YJ9I 4L5EA 3D5SC 2NOGA 2L5QA 1OCZH 1YS6A 3N97A 2XAUA 3D0SA 3CLQA 4A3FJ 2B9SA 1WHUA 3F8MA 4U88A 3VYTB 1MKMA 3IH4A 4HX7A 5M5WJ 2XVCA 4L0YB 3S2HJ 4CCJA 4RGRA 3I59A 3H1CA 5JR3A 1KQ9A 4BL0B 1D1AA 2XPWA 1ETVA 1WH7A 2WAEA 2O3FA 1STZA 1VQ9I 3F9KA 3ISPA 1FMVA 4HPQA 1Y6IA 4A69C 2R5YA 2FE3A 1TT5B 2E2HJ 2FX0A 5LD2C 1B8IB 3A01B 3E5XA 2E5NA 5F1RA 3CP2A 2R92J 2LH9A 1IXRC 2DFEA 5HS8A 3OYBA 2G9WA 2ZJQF 3MZ8A 5LLQA 3OS1A 2LF7A 4MLOA 3DPUA 2MABA 1GXQA 3BJOA 1WQ2A 4LB5A 3WU1B 4CXFA 2GIVA 2LY1A 2HZDA 3K2AA 3JW4A 4XSZF 3LL7A 3R61A 3T8RA 1JKRC 2DPUA 2DYSH 1SD7A 2HFHA 1TTYA 3ULQB 1OR7A 4KMUX 4M3BA 2EPFA 2V79A 2XGEA 1IC8A 3SQNA 1MBHA 3NARA 5LHGA 1H9TA 5EGOB 4EMSA 4E7IA 2NVTJ 1J9IA 2BVMA 3HSRA 4I0AA 2Q0OA 1SD4A 3F6VA 1Y0UA 4XLFA 4IX7A 4BNCA 1VTNC 3I5UA 3QPLA 2DK5A 2WAQA 1GT0C 2HOTA 1A04A 5ICFA 3LA7A 3CUQC 2BOLA 2X9DA 3BG5A 3FXUA 2AXTC 2IS6A 1XMXA 4C30A 1ZK8A 4HQEA 4IXAA 1HCRA 5IT3A 2NS0A 4C2TA 1O7FA 4UHTA 1OLTA 1YW7A 2E5ZA 2ZFWA 5LGUA 2H8RA 3DBRB 2FBKA 4G6DA 2XAHA 3G1MA 3AG4H 1I1SA 2KJCA 2IGOA 3TP0A 3BPVA 2Y0SA 5B3SH 1FZPB 1EH7A 3LQRA 4BS9A 2K02A 1YO5C 5DD8A 4Q48A 2K86A 2H1LA 3CCVI 5TJJA 1MMSA 1L0OC 3P9KA 1SVLA 5KAFC 2IA2A 2YR2A 2WV0A 3IUOA 3P9IA 1K78A 2X1CA 4LGWA 1V55H 3TOBA 5E18F 2H1KA 2VPRA 3G1LA 3LAPA 2GBYA 4E7ZA 3J80Z 5ICCA 1LVKA 2JVGA 3DCFA 3DTEA 1N25A 3RQ4A 3S17J 2KIQA 4RDUA 4KIBA 1UHMA 3L2WA 2NVUB 3J81Z 3MKWB 2L9SA 3PO3J 1BJAA 1HKQA 3OL3A 5FD5A 1ZG1A 4S04A 2X1DA 3KLNA 5BQTA 2DA1A 1MW7A 1UELB 4PFPA 1PUEE 2A6HF 2VBXA 3OYMA 3KX2A 4CHUA 3U2RA 3E6CC 4A3LJ 1WJAA 3A01A 4LFUA 4Q47A 1LFBA 1B9MA 4AIHA 3TBIA 1BW5A 2KHMA 2B0LA 3OWTA 4HV6A 4B47A 2FQ4A 4D9JA 5M5XJ 2HKOA 1S72I 2K9SA 2Z1DA 5E8GA 1LVAA 1ZELA 3CJNA 2Q8KA 1LUJB 2DQLA 4DYCA 5M3MJ 4ZYDA 2E1CA 4EGYA 2EFOA 4BACA 3ZRGA 4P5OA 4I02A 4Y3OA 4XR6A 1YFHA 1B59A 1V4RA 3L09A 2RREA 3CQZJ 5LRSA 1R49A 2RNGA 4L9NA 4NBQA 4H0EA 3IAM2 1MJAA 3U1DA 3CMEI 1ETWA 1TLHB 2ME6A 1E2XA 3EDPA 3S1NJ 4OAZA 2OZUA 1JXSA 1RESA 1WRJA 1WZ2A 2ID3A 1KU7A 2BHZA 3KYLA 3WTYC 3P5JA 2ACJA 1XMAA 3ZN1A 3F8BA 3E0JB 1PUFB 5FRNA 1F1ZA 3CLOA 2VKEA 4JX4A 3MFKA 1KU3A 1NG7A 2R7FA 1W1WE 4EVIA 1V5EA 2NXNB 1FOWA 3BR5A 3PQJA 4CCMA 3HPHA 4DNCA 2JA8J 2LRDA 4DZPA 2P0WA 3PL8A 3WU0A 3G71I 2V4JC 2KRFA 3HOUJ 3CTAA 1FIAA 5HS9A 1F43A 2BY2A 1Z3YA 1YTYA 1K4SA 5GAHJ 5GPAA 3K4NA 2P81A 3FBIB 3FXOA 2KRHA 2UUZA 1HOMA 3E1SA 4N9IA 2CUEA 2OA4A 2WY8Q 2ZMEB 4E7HA 4A2UA 2GZWA 1WFXA 2OD5A 2TDXA 4Y13A 3ZXSA 3MKZA 2X48A 1OKRA 4OIRF 1JKOC 2LK2A 2TRTA 1P4AA 1LDKB 4BXFA 4DBQA 3HOWJ 1D8JA 5DTDA 5JFRA 4ENNA 1T95A 3SZTA 1YITI 2XKPA 1ITYA 4LD5A 2KJBA 2P6TA 4YFXF 1DU6A 2IS2A 5FGMA 2M87A 5K5RA 2RN7A 2BEOA 2K85A 2P5KA 4IRIA 2AS5F 2F5FA 3QYBA 2HPIA 2NOJB 2EK5A 3GF2A 5CLSA 2CV1A 1V5FA 1F36A 2PJRA 2BY3A 4XN0A 4EJTA 1VNDA 1UG0A 3M3YJ 3CF2A 1RUNA 3FK7A 2FJ1A 2DW4A 1H88C 1XN7A 4BQAA 3O6BB 1IN6A 3L9FA 5TGTA 4BHCA 4AU7A 2XPUA 5B66C 2VBWA 3HRUA 1X3ZB 5D5WB 5FKLA 1BI2A 4U0VA 4BQOA 2ZO4A 3IV5A 3K70D 2DOFA 4YELA 3SHFA 3C18A 1K7AA 1Z67A 1XMKA 4A3KJ 2W82A 1T56A 3ZMZA 2ECCA 5GP9A 3RQIA 2M0CA 3MZYA 4DQ2A 2XB5A 2K3PA 3JRFA 1MNMC 3OY9A 2M0MA 5AONA 1VI0A 2VXDA 2A69F 1BIBA 4P9UA 4JX6A 2BBYA 5GAEJ 3O2PE 2A3SA 2ZXHA 1Y56A 1B6AA 1IAWA 3FBNB 4B44A 4ZYGA 5FKNA 4J00A 1XDSA 3AG3H 2VL8A 4F92B 1BN5A 3F3XA 4P1WA 1TWAJ 4A5NA 4EM1A 2ZJ2A 3VDXA 1MDMB 5HNHA 4ON0A 4ZC3A 3QYFA 4A3CJ 1F9NA 2M2EA 3DEUA 4CA0A 3K2ZA 2ZXJA 2JK3A 2R7VA 2UZKA 2A07F 4E4HA 2O7OA 3IKVA 1QVTA 2QM3A 3V7CA 1WSUA 3KYDB 5AIPA 2QENA 1Z7LA 2QQAA 3H92A 4OMZA 5J1RA 2Y0SN 3I4PA 2XIGA 2OAZA 2NS8A 1JHFA 2LKSA 4B09A 2A5YB 1I3AA 5FKOA 1VQ6I 4RAZA 2FOWA 2RKHA 4PSXA 3HUGB 2J5OA 2JSCA 3QU3A 4XLHA 4XSXF 2DLLA 4RM3A 4XLNF 1PDNC 2HQNA 2DK8A 2IXSA 2VN2A 4D7MA 2O9LA 2LVSA 1ETKA 3I58A 3BZCA 2E19A 4IOCF 2JN6A 2B7EA 2VT3A 5CPRB 3FIWA 4IHVA 3BCBA 3A03A 3V8KA 3ERMA 2ADUA 1VQKI 2W7NA 4Y33A 1WJCA 1LKXA 3BPXA 4ZTJA 3UR3C 4AD9A 1BR4A 1S8NA 1XG1A 3GZNB 4G7HF 1Z3XA 3MVPA 1IRGA 1ZLJA 5CVRA 3CJTB 1H89C 5JLXA 3K4JA 1IN7A 2DN0A 2LSOA 4MTEA 4BEHA 1HW1A 1R7JA 1H9GA 1LJ9A 1KQ8A 2QWWA 2EV5A 3DKWA 3EUHC 1UAAA 1P6RA 1T0FA 3LSIA 2P8TA 5EDNA 3GZ5A 1JJ6C 2KRCA 1ULYA 3WG9A 3ASNH 5K1YA 2WAQN 4TV7A 4NHJA 4XRMA 3HGYA 4C2UA 1G2HA 2XAQA 3DV8A 3MQ0A 4IKFA 1U5TB 1O57A 4LMYA 3LSRA 3QPHA 2IS1A 1F4KA 3Q3SA 2CG4A 1NK2P 3CUQB 4UVAA 4HZFA 4XKWA 1WCMJ 3V7SA 1R4MB 1HSTA 2KZGA 2RNJA 2HQRA 4IJAA 2XKOA 1RZ4A 2W4SA 4EEFG 4BKXA 3JAMZ 5LEKA 4XORA 3K1NA 1S7AA 2BHYA 1AKHA 3EETA 3L2CA 1ZGAA 2MFZA 3NQOA 5F0FA 3OYDA 2IP2A 4W97A 4C3JJ 4PGHA 2I8DA 5LHIA 3VODA 5B1AH 4DOZA 2HOSA 1UHSA 3T0YA 2JA6J 3FXRA 5A2QK 2DMNA 1MGTA 1TWFJ 3OYAA 1EA3A 3RSNA 3COAC 1MBJA 1J75A 2E2IJ 3RPUA 2NYXA 1UB9A 3PO2J 2DO7A 4D1QA 2W00A 5LFAA 2BXYA 4RAFA 4U0WA 1YJNI 1IDYA 1Z7UA 5B5EC 5E3MA 4PSWA 2EFQA 3B6AA 3GO5A 4PK4A 4RGXA 3MN2A 5CQGA 5KAIC 4QSHA 3LWFA 3SYTA 4CCOA 1AWCA 1W5SA 2FNAA 5HVQC 2K9NA 5M5YJ 3J80K 2ELKA 3CMYA 1U78A 1P7IA 2PG4A 4HRIA 2CW7A 1GVJA 3LNQA 3CF5F 5L3GA 1R9TJ 4LG0A 5LBQA 4A0ZA 2K7LA 3ABUA 4XLPF 2E1OA 3SFIA 3CD6I 2GXGA 2HQAA 4I2OA 3D5LA 1I6XA 1BA5A 1SC7A 2XAFA 1IV6A 3WGGA 3HG9A 2IAIA 2EB7A 2HOEA 2IT0A 3ZPLA 1K83J 2QZ8A 3ZQCA 5F0HA 4NQWB 3DPTA 3SEZA 5D5UB 4XKVA 3V8JA 4KJZA 2O0YA 3I56I 1ODDA 3KP3A 1VF9A 1XGMA 4MHGA 2DMPA 1FSHA 5IYCJ 4HOBA 4AYBN 1TNSA 3GUDA 1WVRA 2DOAA 1IUYA 2F2EA 5K7HA 4FE7A 2MG4A 5E3OA 3OYFA 2K4BA 3I71A 3GTPJ 4LJZF 1AA7A 1OISA 2JA7J 2DFIA 3L2RA 1RR7A 3NWTA 3BZKA 1QU3A 4PJNA 1S29A 4HSTA 1XX5A 5D5XB 2XAGA 3E5QA 3F8CA 2KKOA 2VBZA 3F23A 1GDTA 4KT6A 1Y8QB 4EATA 2VKHA 2AQFA 2EH3A 5F64A 3ML6A 1CGPA 2JRMA 2NRAC 4A5MA 2KDOA 3CCSI 2P7VB 1UMQA 5L3EA 3ASOH 1P9QC 2Y48A 1USTA 3BWGA 3FHZA 3Q5FA 2V9VA 2L02A 4G6QA 1JI8A 3FX3A 4M9ZA 4NC6A 1FBQA 4RB1A 1V3FA 5EG0A 4GXOA 4OOIA 4IPAA 4KNYA 2HDDA 1JT6A 3JRBA 1SAUA 2HPMA 1IF1A 2L9VA 3ZQHA 2A6EF 3GEZA 2KIFA 3KEQA 3ONQA 4UUSB 4Z2YA 3PSFA 1SAXA 3W2AA 2OF7A 1J7KA 2Q1ZB 2VKVA 3QPTA 4KFCA 4ANJA 1DPRA 3GW2A 3ZQLA 4N9HA 3GFMA 4FQGA 5J8FA 3OYGA 3W2WA 4BDYA 1POGA 5KHDA 2VLAA 2DMQA 3HZJA 2R7XA 4LLLA 2RQPA 1R5GA 3PUFA 4FHTA 1MMDA 3E7LA 1ZRCA 3CMMA 1MMAA 3OSFA 4N4OB 4UV9A 2L54A 3LSTA 3W6JB 5FRMA 2A05A 2K5CA 3PNYA 5J8CA 1T0FC 3S16J 5CVUA 4CDGA 4HSRA 2F5DA 3P9CA 1MBGA 2X1EA 2E36A 2B63J 4Y15A 3QWLA 4GRIA 1ZRFA 3G2BA 4C2MJ 1ZQ3P 3ZMDA 1MSEC 3JRGA 2RC4A 2QVOA 4BEHB 4W1UA 4CICA 4RB3C 4HA8A 3JSPA 3GFIA 1D5YA 1ZREA 4QLCU 4IHYA 3DWLE 5HS7A 1D3YA 4L5IA 4DJAA 4UV8A 3JRDA 4IO9F 1YRNB 2H8WA 4BHBA 3F8NA 3WE3A 4B3AA 2HDWA 3QOPA 2XV4S 3MKYB 3DXJF 2JUGA 2CW0F 1JUSA 3L2VA 3F6OA 4YRVA 1J2XA 2JQ7A 2ME0A 4ENKA 1K78B 4F55A 3OYIA 2O8KA 1DGWY 1X1PA 1FNNA 2DXIA 4G7OF 3LAJA 3EYIA 2GM4A 2PLYA 2Q2EA 2XDVA 4IRHA 1LFUP 4LLNA 1IZ1A 2LNBA 3ZQIA 3SZPA 3F8FA 1E3OC 2EQRA 3K0LA 4H4KC 2CV0A 2HDCA 1ZTRA 4UUTA 3OYLA 4QPOA 2R7DA 2EA4A 5CYVA 1ETYA 1SD5A 4M72A 3TO7A 2NVQJ 3H0GJ 5DM6F 2AO9A 3VFZA 2CUFA 1R36A 5JHFA 1ZR2A 2OC6A 2XF7A 1OYWA 4DYRA 2XAJA 4RGUA 3BCAA 2D1HA 3LA2A 2BW3A 3FXQA 5FKKA 2RVCA 3E97A 5KVRA 2EZHA 3HRMA 3HHGA 2HI3A 5C44J 4A3EJ 2YUSA 2JT1A 3QP6A 5J3LA 2M30A 3A4CA 4JOMA 3TDZC 1FSEA 2Q2EB 3MKLA 4A0YA 1XGSA 4BQNA 1RUOA 1I3QJ 1J09A 2GA1A 3M8JA 2QA4I 3ZN0A 3BTIA 5DYMA 1XGNA 1YG2A 3RCOA 3A0BC 3KCCA 3S3MA 3CCRI 3KP2A 1Z6RA 1ZAOA 2ZCWA 3CCMI 1B72A 3PM1A 2VPLA 1KZHA 1G3TA 1HLVA 3OIQA 3M1CA 3UKGA 1FP1D 1A6QA 3GZ6A 2KL4A 4EJUA 3F22A 3ESWB 2DDAA 2VQGA 5E17F 1MMGA 3IKTA 2CMPA 2XPVA 3RPUD 1XDUA 4UB6C 3VPRA 3OMYA 3KP7A 4UXNA 3FF5A 2FRHA 2W1OA 3LOCA 2R7OA 3KZZA 1OCPA 3DTIA 4RBOA 1P4WA 3JSOA 3QP5A 2BXZA 2VC1A 1X3WB 1O3TA 1A5JA 5ED4A 2OCCH 2FBHA 3KZIC 4HLYA 1QZEA 2QEXI 4I01A 3Q0UA 2IRFG 4I0BA 4CCKA 5LEJA 3IH2A 4RB2C 5GAGJ 2UV1A 3DU6A 4U87A 1FEXA 3SXYA 2LKXA 4JK1X 3IRRA 4BH9A 5LHHA 2X85A 1IXSB 2L7ZA 2OTLI 3EYYA 4LK1F 3DLLF 1SD6A 3QOEA 2W57A 4M6YA 1NHAA 3U1KA 2JJ7A 3SZGA 2WB1N 3JCUC 4MFDA 5KCMA 4BU2A 3LFKA 4CZCA 1FOKA 4HYEA 4JP0A 1JJ8C 1BI1A 3JRIA 2WWYA 1QNTA 1B72B 2WAFA 3E5UA 5E1XA 1O4XA 4GCVA 4CGZA 1Z21A 4L9TA 4DYQA 3DEWA 4DGWB 3IWZA 4HG2A 4MNUA 4NDLA 3KZYA 2IS4A 3BR0A
chains in the Genus database with same CATH topology
3BQZA 5IOZA 1QRYA 5FKNA 1OJLA 1NK3P 5FLVA 3BQYA 1TWAJ 3FISA 2DMTA 1CQTA 4QIWN 5EEAA 3BR1A 1FIPA 4DW6A 5J1YA 3HOZJ 2G0EA 4M3FA 1IUFA 5HODA 4A3CJ 2M2EA 3HGGA 5E3NA 2JK3A 3BG9A 2PMZN 4A3BJ 2O7OA 3IH3A 4C3HJ 1IDZA 5C4XJ 1QVTA 5IPAA 5C4JJ 3I4MJ 2EZLA 4A93J 9ANTA 3JREA 2NS7A 5J1RA 2Y0SN 5IP6A 2NS8A 1WH5A 2N8GA 1JGGA 4JX5A 5FKOA 1RKTA 2LY9A 3B6CA 2DA3A 4MFEA 5K7ZA 4XICA 4V2FA 5EG0B 5IYDJ 4D7MA 2O9LA 2JMWA 4I76A 2LVSA 3GTKJ 1ETKA 2AHQA 2E19A 2JN6A 3FIWA 4IHVA 3A03A 2ID6A 1BL0A 3BR3A 1FTZA 3RZOJ 2LLKA 1XG1A 2KT0A 4M6VA 1ETXA 4XK4A 1MBFA 4IEJA 1HF0A 3MVPA 1UG2A 1EF4A 1JUPA 1H89C 5JLXA 1S7EA 2DN0A 2CJJA 4I6ZA 4XRSA 2R5ZA 2DA5A 1ZGWA 2LFBA 4IHWA 1OFCX 1XC5A 2Y31A 3JRAA 2DJNA 5F04A 1I6HJ 5F0CA 5M3FJ 3BG3A 1ORKA 5EDNA 1HDPA 2IBDA 4C3IJ 1JJ6C 5J1UA 3LSGA 3BTCA 1LE8B 2WAQN 4XRMA 3HGYA 1G2HA 1OCTC 2ECBA 2Y9YA 4DZJA 3GTGJ 1AU7A 2XGCA 3LSRA 3Q3SA 4FTHA 3WHBA 1NK2P 3W6VA 3S1MJ 2M8GX 3TW6A 5JLWA 1Z0XA 1WCMJ 2E2JJ 4FE4A 1P7JA 1TWHJ 2HOAA 1U9NA 2NVXJ 2IEKA 3C2BA 4EEFG 4JYKA 4BKXA 2L7FP 3GTOJ 2DA7A 1AKHA 3HKZN 1JTXA 2EBIA 4FCYA 1BW6A 5F0FA 1GV5A 2YS9A 1JKPC 4W97A 3ZQGA 4C3JJ 2R5YB 2OPTA 4LOCA 4XIDA 1Y1WJ 2D5VA 4AUXA 4X1EA 4A3JJ 2HOSA 1UHSA 2LD5A 2JA6J 1A6IA 2DMNA 1JTYA 1TWFJ 4M3DA 4IHXA 2E2IJ 1MBJA 2DMUA 4S0HB 3LSJA 4D5FA 2DA2A 4J19A 3PO2J 3GTQJ 5E3LA 1Q1VA 2K40A 1IDYA 4L5EA 2NOGA 2NVYJ 4M3EA 5BNGA 5E3MA 4A3FJ 3B6AA 3QPSA 3IH4A 5M5WJ 3MN2A 3S2HJ 4QSHA 1IRZA 1MBKA 1RKWA 2XPWA 1ETVA 1WH7A 2K9NA 2X6OA 5M5YJ 2ELKA 3CMYA 1XS9A 1U78A 1P7IA 2YU9J 3HOVJ 4A3IJ 2EZKA 5IYBJ 3GTMJ 4A69C 3LNQA 2R5YA 1R9TJ 2EZIA 2E2HJ 2FX0A 1B8IB 2E1OA 3SFIA 3A01B 1ZR4A 2R92J 1Z77A 1FTTA 1JT0A 1WI3A 1BA5A 1IV6A 2IAIA 1K83J 3ZQCA 4MLOA 5F0HA 3FKIJ 3QQAA 1W0TA 3NAUA 2DA4A 2I10A 1FJLA 3K2AA 1RPWA 1VF9A 2L7MP 2DMPA 5C3EJ 5IYCJ 1JKRC 4ABZA 4AYBN 2QF7A 5K7HA 1IGNA 1X2NA 2MGQA 4UUSA 4FE7A 1X2MA 2MG4A 5E3OA 3OIOA 4M3BA 3GTPJ 2XGEA 1IC8A 2JA7J 1MBHA 3NARA 2Y30A 3BTJA 1RR7A 1X58A 4V2GA 5EGOB 2NVTJ 2QCOA 2CU7A 1GDTA 2HQ5A 1B8IA 4A3MJ 2EH3A 4CYCA 1VFCA 3QPLA 3OSGA 2LTPA 1UMQA 1TWCJ 2K9QA 1GT0C 3FK6A 2HOTA 2X9DA 2CQQA 3BG5A 3ZQFA 5EG0A 2L9RA 1ZK8A 4G12A 1MH4A 3HBLA 1HCRA 1TC3C 2HDDA 1JT6A 3JRBA 2W48A 2HXIA 2H8RA 2CRGA 3ZQHA 3G1MA 4B4CA 3HEFA 4UUSB 3O8GA 3TEDA 1WPKA 3TP0A 2OF7A 5EYRA 2VKVA 4XRSG 3ZQLA 3BR6A 2XSDC 1YRNA 1POGA 2DMQA 4BY1J 1GVDA 1IJWC 3SDGA 3E7LA 5EGOA 2JA5J 2ZB9A 1MBEA 3A02A 3OSFA 2H1KA 1U9OA 2VPRA 3G1LA 1GUUA 2GBYA 3S1QJ 2MW8A 3DCFA 3HOYJ 3S16J 3S17J 4AC0A 4RDUA 1H8AC 3CCYA 1MBGA 3PO3J 2R7ZJ 2B63J 5K7FA 4C2MJ 1ZQ3P 1QVUA 1MSEC 3JRGA 1LE8A 2R5ZB 2DA1A 4W1UA 3OOUA 3TP3A 1D5YA 2XGDA 3S14J 4IHYA 3ZOBA 4A3LJ 1PUFA 3HB9A 3BT9A 3A01A 3JRDA 3RZDJ 1YRNB 4Y52J 1LFBA 3S1RJ 3GBGA 1K61A 3S15J 4B3AA 1BW5A 2FQ4A 1GV2A 5M5XJ 2K9SA 1ENHA 3L1PA 1JUSA 4DYCA 5M3MJ 5EZGA 2ME0A 3LSPA 3GTJJ 2O8KA 3WHCA 2GM4A 1MH3A 3GTLJ 1T33A 3CQZJ 1LFUP 2M9HA 3ZQIA 5FLMJ 1E3OC 2EQRA 1ETOA 1ZTRA 3TW7A 2HYJA 1BJZA 4UUTA 2RAEA 4QTRA 1ETWA 2ME6A 3S1NJ 1ETYA 2NVQJ 2VI6A 1RESA 3H0GJ 2ID3A 2AO9A 2CUFA 5EZHA 5FKMA 1ZR2A 4MO7A 4BY7J 3HDDA 5F1JA 4A3DJ 4DYRA 1PUFB 2DA6A 4BBRJ 4FISA 1I50J 4A3GJ 2VKEA 5FKKA 4JX4A 2L0KA 5EF6A 2EZHA 2HI3A 2DTZA 5C44J 4A3EJ 2Y9ZA 4B1RA 3BR5A 2YUSA 2JA8J 3BTLA 5J3LA 2HXOA 4DZPA 3Q0VA 3MKLA 3HOUJ 1FIAA 4MIMA 3SJMA 1I3QJ 2CQXA 4BBSJ 5FJ8J 1F43A 2Y2ZA 3BTIA 5GPAA 1TWGJ 2P81A 4BXXJ 1RETA 2XB0X 2MSYA 1QPIA 1B72A 3PM1A 4Y7NJ 3M4OJ 1NTCA 1ZKGA 5IP9J 3JR9A 1HOMA 3BR2A 4GFBA 2CUEA 1HLVA 2R0QC 3S2DJ 3UKGA 2JWTA 2TCTA 3CDLA 1JKQC 2X48A 1JKOC 2LK2A 2TRTA 1U8BA 3G1OA 3HOWJ 2XPVA 5DTDA 2M34A 5IP7J 1SFOJ 5F08A 3VPRA 1ETQA 4CYCB 5GPCA 3Q0WA 1ITYA 2KDZA 1IG7A 3LOCA 1DU6A 1OCPA 4HNVA 4RBOA 2GLOA 3HM5A 1MSFC 3F0CA 4M3GA 3JRHA 4X6AJ 1A5JA 1F36A 1VNDA 3Q0UA 3M3YJ 3FK7A 2LP0A 1WGXA 2FJ1A 3IH2A 2WV1A 4D5CA 1H88C 1APLC 1JUMA 1FEXA 2XPUA 1Y1VJ 3I4NJ 2LKXA 3K7AJ 5FKLA 2FD5A 3IV5A 5DS9A 1AHDP 2L7ZA 4A3KJ 3RKQA 3JRCA 1T56A 2JJ7A 2WB1N 4D7NA 2ECCA 4MFDA 5GP9A 5F27A 1W0UA 3RQIA 1SANA 3H3VK 1HDDC 3HOXJ 2R93J 2M0CA 2COBA 4JP0A 1AKHB 1JJ8C 3JRIA 2XB5A 1B72B 1O4XA 2VUMJ 3JRFA 3D1NI 1MNMC 1DU0A 1VI0A 4DYQA 5IOYA 3DEWA 4JX6A 2XRLA 4NDLA 2LR8A 3BR0A 3O8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQZ A;  5IOZ A;  1QRY A;  5FKN A;  1OJL A;  1NK3 P;  5FLV A;  3BQY A;  1TWA J;  3FIS A;  2DMT A;  1CQT A;  4QIW N;  5EEA A;  3BR1 A;  1FIP A;  4DW6 A;  5J1Y A;  3HOZ J;  2G0E A;  4M3F A;  1IUF A;  5HOD A;  4A3C J;  2M2E A;  3HGG A;  5E3N A;  2JK3 A;  3BG9 A;  2PMZ N;  4A3B J;  2O7O A;  3IH3 A;  4C3H J;  1IDZ A;  5C4X J;  1QVT A;  5IPA A;  5C4J J;  3I4M J;  2EZL A;  4A93 J;  9ANT A;  3JRE A;  2NS7 A;  5J1R A;  2Y0S N;  5IP6 A;  2NS8 A;  1WH5 A;  2N8G A;  1JGG A;  4JX5 A;  5FKO A;  1RKT A;  2LY9 A;  3B6C A;  2DA3 A;  4MFE A;  5K7Z A;  4XIC A;  4V2F A;  5EG0 B;  5IYD J;  4D7M A;  2O9L A;  2JMW A;  4I76 A;  2LVS A;  3GTK J;  1ETK A;  2AHQ A;  2E19 A;  2JN6 A;  3FIW A;  4IHV A;  3A03 A;  2ID6 A;  1BL0 A;  3BR3 A;  1FTZ A;  3RZO J;  2LLK A;  1XG1 A;  2KT0 A;  4M6V A;  1ETX A;  4XK4 A;  1MBF A;  4IEJ A;  1HF0 A;  3MVP A;  1UG2 A;  1EF4 A;  1JUP A;  1H89 C;  5JLX A;  1S7E A;  2DN0 A;  2CJJ A;  4I6Z A;  4XRS A;  2R5Z A;  2DA5 A;  1ZGW A;  2LFB A;  4IHW A;  1OFC X;  1XC5 A;  2Y31 A;  3JRA A;  2DJN A;  5F04 A;  1I6H J;  5F0C A;  5M3F J;  3BG3 A;  1ORK A;  5EDN A;  1HDP A;  2IBD A;  4C3I J;  1JJ6 C;  5J1U A;  3LSG A;  3BTC A;  1LE8 B;  2WAQ N;  4XRM A;  3HGY A;  1G2H A;  1OCT C;  2ECB A;  2Y9Y A;  4DZJ A;  3GTG J;  1AU7 A;  2XGC A;  3LSR A;  3Q3S A;  4FTH A;  3WHB A;  1NK2 P;  3W6V A;  3S1M J;  2M8G X;  3TW6 A;  5JLW A;  1Z0X A;  1WCM J;  2E2J J;  4FE4 A;  1P7J A;  1TWH J;  2HOA A;  1U9N A;  2NVX J;  2IEK A;  3C2B A;  4EEF G;  4JYK A;  4BKX A;  2L7F P;  3GTO J;  2DA7 A;  1AKH A;  3HKZ N;  1JTX A;  2EBI A;  4FCY A;  1BW6 A;  5F0F A;  1GV5 A;  2YS9 A;  1JKP C;  4W97 A;  3ZQG A;  4C3J J;  2R5Y B;  2OPT A;  4LOC A;  4XID A;  1Y1W J;  2D5V A;  4AUX A;  4X1E A;  4A3J J;  2HOS A;  1UHS A;  2LD5 A;  2JA6 J;  1A6I A;  2DMN A;  1JTY A;  1TWF J;  4M3D A;  4IHX A;  2E2I J;  1MBJ A;  2DMU A;  4S0H B;  3LSJ A;  4D5F A;  2DA2 A;  4J19 A;  3PO2 J;  3GTQ J;  5E3L A;  1Q1V A;  2K40 A;  1IDY A;  4L5E A;  2NOG A;  2NVY J;  4M3E A;  5BNG A;  5E3M A;  4A3F J;  3B6A A;  3QPS A;  3IH4 A;  5M5W J;  3MN2 A;  3S2H J;  4QSH A;  1IRZ A;  1MBK A;  1RKW A;  2XPW A;  1ETV A;  1WH7 A;  2K9N A;  2X6O A;  5M5Y J;  2ELK A;  3CMY A;  1XS9 A;  1U78 A;  1P7I A;  2YU9 J;  3HOV J;  4A3I J;  2EZK A;  5IYB J;  3GTM J;  4A69 C;  3LNQ A;  2R5Y A;  1R9T J;  2EZI A;  2E2H J;  2FX0 A;  1B8I B;  2E1O A;  3SFI A;  3A01 B;  1ZR4 A;  2R92 J;  1Z77 A;  1FTT A;  1JT0 A;  1WI3 A;  1BA5 A;  1IV6 A;  2IAI A;  1K83 J;  3ZQC A;  4MLO A;  5F0H A;  3FKI J;  3QQA A;  1W0T A;  3NAU A;  2DA4 A;  2I10 A;  1FJL A;  3K2A A;  1RPW A;  1VF9 A;  2L7M P;  2DMP A;  5C3E J;  5IYC J;  1JKR C;  4ABZ A;  4AYB N;  2QF7 A;  5K7H A;  1IGN A;  1X2N A;  2MGQ A;  4UUS A;  4FE7 A;  1X2M A;  2MG4 A;  5E3O A;  3OIO A;  4M3B A;  3GTP J;  2XGE A;  1IC8 A;  2JA7 J;  1MBH A;  3NAR A;  2Y30 A;  3BTJ A;  1RR7 A;  1X58 A;  4V2G A;  5EGO B;  2NVT J;  2QCO A;  2CU7 A;  1GDT A;  2HQ5 A;  1B8I A;  4A3M J;  2EH3 A;  4CYC A;  1VFC A;  3QPL A;  3OSG A;  2LTP A;  1UMQ A;  1TWC J;  2K9Q A;  1GT0 C;  3FK6 A;  2HOT A;  2X9D A;  2CQQ A;  3BG5 A;  3ZQF A;  5EG0 A;  2L9R A;  1ZK8 A;  4G12 A;  1MH4 A;  3HBL A;  1HCR A;  1TC3 C;  2HDD A;  1JT6 A;  3JRB A;  2W48 A;  2HXI A;  2H8R A;  2CRG A;  3ZQH A;  3G1M A;  4B4C A;  3HEF A;  4UUS B;  3O8G A;  3TED A;  1WPK A;  3TP0 A;  2OF7 A;  5EYR A;  2VKV A;  4XRS G;  3ZQL A;  3BR6 A;  2XSD C;  1YRN A;  1POG A;  2DMQ A;  4BY1 J;  1GVD A;  1IJW C;  3SDG A;  3E7L A;  5EGO A;  2JA5 J;  2ZB9 A;  1MBE A;  3A02 A;  3OSF A;  2H1K A;  1U9O A;  2VPR A;  3G1L A;  1GUU A;  2GBY A;  3S1Q J;  2MW8 A;  3DCF A;  3HOY J;  3S16 J;  3S17 J;  4AC0 A;  4RDU A;  1H8A C;  3CCY A;  1MBG A;  3PO3 J;  2R7Z J;  2B63 J;  5K7F A;  4C2M J;  1ZQ3 P;  1QVU A;  1MSE C;  3JRG A;  1LE8 A;  2R5Z B;  2DA1 A;  4W1U A;  3OOU A;  3TP3 A;  1D5Y A;  2XGD A;  3S14 J;  4IHY A;  3ZOB A;  4A3L J;  1PUF A;  3HB9 A;  3BT9 A;  3A01 A;  3JRD A;  3RZD J;  1YRN B;  4Y52 J;  1LFB A;  3S1R J;  3GBG A;  1K61 A;  3S15 J;  4B3A A;  1BW5 A;  2FQ4 A;  1GV2 A;  5M5X J;  2K9S A;  1ENH A;  3L1P A;  1JUS A;  4DYC A;  5M3M J;  5EZG A;  2ME0 A;  3LSP A;  3GTJ J;  2O8K A;  3WHC A;  2GM4 A;  1MH3 A;  3GTL J;  1T33 A;  3CQZ J;  1LFU P;  2M9H A;  3ZQI A;  5FLM J;  1E3O C;  2EQR A;  1ETO A;  1ZTR A;  3TW7 A;  2HYJ A;  1BJZ A;  4UUT A;  2RAE A;  4QTR A;  1ETW A;  2ME6 A;  3S1N J;  1ETY A;  2NVQ J;  2VI6 A;  1RES A;  3H0G J;  2ID3 A;  2AO9 A;  2CUF A;  5EZH A;  5FKM A;  1ZR2 A;  4MO7 A;  4BY7 J;  3HDD A;  5F1J A;  4A3D J;  4DYR A;  1PUF B;  2DA6 A;  4BBR J;  4FIS A;  1I50 J;  4A3G J;  2VKE A;  5FKK A;  4JX4 A;  2L0K A;  5EF6 A;  2EZH A;  2HI3 A;  2DTZ A;  5C44 J;  4A3E J;  2Y9Z A;  4B1R A;  3BR5 A;  2YUS A;  2JA8 J;  3BTL A;  5J3L A;  2HXO A;  4DZP A;  3Q0V A;  3MKL A;  3HOU J;  1FIA A;  4MIM A;  3SJM A;  1I3Q J;  2CQX A;  4BBS J;  5FJ8 J;  1F43 A;  2Y2Z A;  3BTI A;  5GPA A;  1TWG J;  2P81 A;  4BXX J;  1RET A;  2XB0 X;  2MSY A;  1QPI A;  1B72 A;  3PM1 A;  4Y7N J;  3M4O J;  1NTC A;  1ZKG A;  5IP9 J;  3JR9 A;  1HOM A;  3BR2 A;  4GFB A;  2CUE A;  1HLV A;  2R0Q C;  3S2D J;  3UKG A;  2JWT A;  2TCT A;  3CDL A;  1JKQ C;  2X48 A;  1JKO C;  2LK2 A;  2TRT A;  1U8B A;  3G1O A;  3HOW J;  2XPV A;  5DTD A;  2M34 A;  5IP7 J;  1SFO J;  5F08 A;  3VPR A;  1ETQ A;  4CYC B;  5GPC A;  3Q0W A;  1ITY A;  2KDZ A;  1IG7 A;  3LOC A;  1DU6 A;  1OCP A;  4HNV A;  4RBO A;  2GLO A;  3HM5 A;  1MSF C;  3F0C A;  4M3G A;  3JRH A;  4X6A J;  1A5J A;  1F36 A;  1VND A;  3Q0U A;  3M3Y J;  3FK7 A;  2LP0 A;  1WGX A;  2FJ1 A;  3IH2 A;  2WV1 A;  4D5C A;  1H88 C;  1APL C;  1JUM A;  1FEX A;  2XPU A;  1Y1V J;  3I4N J;  2LKX A;  3K7A J;  5FKL A;  2FD5 A;  3IV5 A;  5DS9 A;  1AHD P;  2L7Z A;  4A3K J;  3RKQ A;  3JRC A;  1T56 A;  2JJ7 A;  2WB1 N;  4D7N A;  2ECC A;  4MFD A;  5GP9 A;  5F27 A;  1W0U A;  3RQI A;  1SAN A;  3H3V K;  1HDD C;  3HOX J;  2R93 J;  2M0C A;  2COB A;  4JP0 A;  1AKH B;  1JJ8 C;  3JRI A;  2XB5 A;  1B72 B;  1O4X A;  2VUM J;  3JRF A;  3D1N I;  1MNM C;  1DU0 A;  1VI0 A;  4DYQ A;  5IOY A;  3DEW A;  4JX6 A;  2XRL A;  4NDL A;  2LR8 A;  3BR0 A;  3O8H A; 
#chains in the Genus database with same CATH topology
 5IOZ A;  4E7S A;  1QRY A;  2F4M B;  2X6X A;  3SDB A;  3J7Z I;  3RKY A;  2OCE A;  3BQY A;  3DQV C;  3IP4 B;  2OUM A;  1R58 A;  3FIS A;  2K9M A;  3A2K A;  3CCU I;  4QIW N;  1WKM A;  3MWM A;  1I27 A;  4BE0 A;  5D4R A;  2G0E A;  3FZV A;  4QWQ A;  2W25 A;  2ZFU A;  2CGP A;  1TBX A;  3JAM K;  1TQP A;  3HGG A;  4RGS A;  5E3N A;  4LK0 F;  4M71 A;  4WX9 A;  1GHC A;  4B48 A;  3A1Y A;  2V9K A;  2D2W A;  4A3B J;  5C4X J;  3CUO A;  5D4S A;  4EQQ A;  2YX4 A;  5C4J J;  1XCV A;  2RQQ A;  3I4M J;  2EZL A;  4GGG A;  4KIF A;  4A93 J;  9ANT A;  3PSI A;  3K4M A;  4E70 A;  2DT5 A;  3M1E A;  1G8X A;  2GAU A;  2L9N A;  2CW8 A;  1W7P A;  1KU2 A;  2IW5 A;  1QQI A;  1WH5 A;  2N8G A;  2K3F A;  3KE2 A;  4F52 A;  1RKT A;  4MFE A;  2DA3 A;  3W3C A;  1MND A;  4M9X A;  3K1P A;  3AL0 B;  4FX0 A;  2C6Y A;  5IYD J;  1U0J A;  2L3D A;  2AHQ A;  1SEU A;  3DPL C;  3VSK A;  3E3V A;  4HX8 A;  3M7G A;  2ID6 A;  3J81 K;  3CO7 C;  1BL0 A;  2OZ6 A;  4BGD A;  1FTZ A;  3RZO J;  2FOK A;  1MDM A;  1T08 B;  2KT0 A;  4M6V A;  4NC8 A;  1MBF A;  2JPB A;  4IEJ A;  4EJV A;  1EF4 A;  1JUP A;  5ILU A;  4LLG F;  1N77 A;  2FU4 A;  5HLG A;  3J7A Y;  3F72 A;  2K4J A;  1ZH5 A;  2X6Y A;  4GYG A;  1Z6T A;  3HYI A;  4FET A;  2LF8 A;  3PIO F;  4IHW A;  1UHW A;  2MH2 A;  3W2V A;  4R79 A;  1R00 A;  1XTA A;  2DCE A;  2DJN A;  1HKS A;  5F04 A;  3K70 C;  3OYC A;  4M9S A;  1JGS A;  5F0C A;  5KNL A;  3HTS B;  1ORK A;  1VQM I;  2E34 A;  5D5V B;  4C3I J;  3LSG A;  3FWE A;  4BJT A;  1LE8 B;  3CDI A;  1PYV A;  5FFX A;  4ZDL A;  2ECB A;  1R71 A;  2LMD A;  3P7N A;  4HDU A;  1W5T A;  1AU7 A;  2XGC A;  3RI4 A;  4EGZ A;  5H6Q A;  3I55 I;  1FPQ A;  2HKX A;  2QQB A;  3WHB A;  2HNH A;  2DDB A;  5JLW A;  1FBS A;  1Z0X A;  3F21 A;  1U3E M;  5J4V A;  2E2J J;  1P7J A;  3VYS B;  4WK8 F;  1U9N A;  1ACI A;  1T8I A;  1LDD A;  4AM3 A;  2P5V A;  2LYC A;  2PEX A;  1KGS A;  1YE9 A;  4L9J A;  4FCY A;  2V6E A;  1BW6 A;  1GV5 A;  4UUV A;  4ZJZ A;  1D0Y A;  2E60 A;  4LOC A;  1Y1W J;  3L7W A;  5J47 A;  2GA2 A;  1LQ1 A;  2E7X A;  4NQW A;  4ZYA A;  3K69 A;  4IZZ A;  4O5V A;  4HQM A;  3ZMU A;  1PJR A;  1CF7 A;  1OCR H;  1A6I A;  5EEH A;  4IHX A;  4IHS A;  3FDY A;  2MC4 A;  4S0H B;  5GTI C;  4D5F A;  2DA2 A;  2HTS A;  4N4N B;  4CYD A;  2DBB A;  3H35 A;  2RDP A;  3C1D A;  2E1M B;  4PZJ A;  4XBF A;  5CVJ A;  1X4P A;  1FYM A;  2ZSH B;  3CC4 I;  3M8E A;  4OAY A;  2NVY J;  2Z9O A;  3K9T A;  5BNG A;  2EV6 A;  4RA2 A;  3VYR B;  1G3S A;  4LG3 A;  1UFM A;  3QPS A;  1H0M A;  1O7L A;  3CO6 C;  1G59 A;  4BUP A;  2HR3 A;  1YQA A;  5BS6 A;  5K5Q A;  5E1Z B;  2X6O A;  3KP5 A;  1XS9 A;  3KEO A;  2LDU A;  4UNO A;  3HOV J;  2YU9 J;  4A3I J;  2EWN A;  5IYB J;  2X51 A;  2BYV E;  4K2E A;  2EZI A;  1UJ8 A;  1FT9 A;  4GDF A;  5J4Y A;  1R6R A;  1FTT A;  2FF4 A;  1JT0 A;  4EV0 A;  3G4S I;  1IXC A;  3WTW C;  1CF7 B;  1HKT A;  2D1V A;  3TKY A;  1LPQ A;  3AG1 H;  3BDD A;  4HDV A;  3CCQ I;  4UY8 I;  3VB2 A;  3H5A A;  4YIF A;  1TT0 A;  3GVA A;  4ESB A;  1FY7 A;  2DA4 A;  2I10 A;  4IL6 C;  1WJ5 A;  1K6Y A;  1RPW A;  2AQE A;  2L7M P;  4MTD A;  1X3U A;  4F3Q A;  4AID A;  2KPM A;  2LC2 A;  4ABZ A;  3N05 A;  4XLE A;  4IVN A;  2QF7 A;  2FXA A;  5CQE A;  2PMH A;  1U8R A;  3HTU A;  1IGN A;  2MGQ A;  3EQL F;  1X2M A;  2FUG 2;  2WBM A;  3OIO A;  3RKX A;  2JUC A;  3RTR A;  2Y30 A;  3BTJ A;  1X58 A;  4F91 B;  2A61 A;  1R1T A;  2UXX A;  3PNV A;  1ON1 A;  2QCO A;  5ILS A;  5DD4 A;  2CU7 A;  4UVB A;  4ESF A;  1B4A A;  3S2W A;  1B8I A;  4BJ6 C;  3C2H A;  1W5C C;  4CYC A;  4U7D A;  3OSG A;  2QYO A;  2COM A;  1TWC J;  2K9Q A;  3GX4 X;  3EUH A;  3FK6 A;  4S05 A;  2DYR H;  2M8E A;  2ZXI A;  2CQQ A;  1YIJ I;  3ZQF A;  5DV5 A;  2L9R A;  3DU5 A;  5HLI A;  1HQC A;  4Y4R A;  2IGN A;  3OS0 A;  3MD2 A;  4G12 A;  1MH4 A;  1ONV A;  1FOY A;  3DFG A;  3HBL A;  1TC3 C;  4KIT B;  2EIK H;  2CS3 A;  2W48 A;  1J59 A;  2HXI A;  2CH0 A;  4P55 A;  2PBI A;  1ZLK A;  2DFF A;  2G7U A;  3KFW X;  4B4C A;  1QHG A;  1YW8 A;  1SVO A;  2XSJ C;  3TED A;  1WPK A;  4G6T B;  5BPD A;  4II3 A;  4XRS G;  4HF1 A;  2E7W A;  2V26 A;  2HEO A;  1ZRD A;  5FFZ A;  2XSD C;  3B02 A;  3RJP A;  1FMW A;  1GVD A;  2D45 A;  1IJW C;  2R7Q A;  1EJ9 A;  1IN4 A;  1WJF A;  3SDG A;  1ZHF A;  1SFK A;  2PMU A;  3T1B A;  3A02 A;  3FMS A;  3ABK H;  1U9O A;  4L5J A;  1GUU A;  3S1Q J;  3KPH A;  3GYH X;  3QYE A;  4MEY F;  1BI3 A;  3HOY J;  1UCR A;  4HLX A;  2H94 A;  3KP6 A;  5TIS C;  1D8K A;  2LG4 A;  3TMO A;  1QGP A;  3RYP A;  3E6B A;  5GTH C;  1E17 A;  1QVU A;  4I09 A;  3E6M A;  3WTS C;  1D1C A;  3LA3 A;  1WJD A;  2FBI A;  3OOU A;  4IRG A;  3TP3 A;  2OV7 A;  2XGD A;  4F93 B;  3ZOB A;  4F7Z A;  2O5R A;  3BT9 A;  2F5E A;  3RZD J;  2BGC A;  1YJW I;  1LDJ A;  2ETH A;  3GBG A;  3PNT A;  2GWR A;  3MMY B;  1LB2 A;  3L1P A;  3CMA I;  1A35 A;  4AVZ A;  1QZY A;  3PQK A;  1T2K A;  3LSP A;  2QBY A;  2KIU A;  3WG7 H;  4U7B A;  2ZJP F;  1KYW A;  1FX7 A;  2E1N A;  1T38 A;  1VQN I;  1MH3 A;  1T33 A;  4ZDO A;  2M9H A;  2QKM B;  3S3N A;  1ETO A;  1OYI A;  2VOD A;  3PIP F;  1IN5 A;  2HYJ A;  2RAE A;  3GLX A;  3HRS A;  3ZR8 X;  1IRF A;  4KIG A;  1YS7 A;  3K4B A;  1ZG3 A;  3LMM A;  2ZXW H;  1TQM A;  2VI6 A;  3GCM A;  3OR2 C;  1BR1 A;  1Z1D A;  5IY5 H;  3JTH A;  3R0J A;  4BY7 J;  1EV7 A;  1KON A;  4E6K G;  5F1J A;  2JPC A;  3HDD A;  2F48 A;  3ZP5 A;  2DA6 A;  4FIS A;  4G94 A;  1I50 J;  1D1B A;  2I5U A;  1YOV B;  1K4T A;  4PJL A;  1X1D A;  2L0K A;  2R3S A;  3NRV A;  2DTZ A;  2VJ4 A;  4AIJ A;  2Y9Z A;  4M6X A;  4B1R A;  2PX9 A;  3M9A A;  4IHT A;  2K27 A;  4KN4 X;  1HXD A;  2HWV A;  3BTL A;  4WCG A;  4BDZ A;  1IW7 F;  3Q0V A;  3TOA A;  4XOP A;  4PJJ A;  1O3R A;  2UXN A;  3I0T A;  4O3M A;  2CQX A;  1TQI A;  4BBS J;  5FJ8 J;  4R1H A;  4U0Y A;  2R7T A;  3I59 B;  1TWG J;  4OWR B;  5DM7 F;  3REO A;  4Q4Z F;  1BOB A;  3PJR A;  2M4G A;  4BE1 A;  2XB0 X;  2MLK A;  4KUM A;  1TNT A;  1QPI A;  3M4O J;  1ZKG A;  3FXL A;  2V7F A;  5B1B H;  2LOO A;  3OR1 C;  4R8H A;  2R0Q C;  3S2D J;  2JWT A;  1U5T A;  3FM5 A;  1JKQ C;  4ITV A;  1S7O A;  1KA8 A;  1OCC H;  4AVP A;  1JHH A;  3GFJ A;  1U8B A;  4ZZL A;  5DCM B;  3M8F A;  4XQF A;  4G9Y A;  5ILV A;  3MCZ A;  1QZZ A;  1SFO J;  5F08 A;  3HJE A;  1M1E B;  4CYC B;  1BC8 C;  3Q9V A;  5GPC A;  3Q0W A;  5E20 A;  5LGT A;  3QAH A;  1SVM A;  2OQR A;  1W7P B;  1DP7 P;  3DKY A;  3SEQ A;  4HNV A;  2GLO A;  4AIK A;  4PUS A;  3HM5 A;  2VXZ A;  2YSR A;  3F0C A;  4M3G A;  3BJ6 A;  3ZMT A;  2PI0 A;  2A68 F;  5AIQ A;  3BP8 A;  1T98 A;  1DQU A;  2EA2 A;  2ZJR F;  2LP0 A;  2VJ5 A;  1WGX A;  2LBF A;  4D5C A;  1APL C;  2BV6 A;  1Z91 A;  3CES A;  1Y1V J;  1NH3 A;  1T6S A;  4B43 A;  2F5V A;  3KP4 A;  2FD5 A;  2AXL A;  1GLN A;  3NEU A;  1L3L A;  5DS9 A;  1AHD P;  4RS8 A;  2A5W A;  4HF2 A;  1KYZ A;  2GOX B;  5LRR A;  2MBF A;  2EFW A;  3JRC A;  1TW3 A;  4D7N A;  1WJE A;  5F27 A;  4ZYE A;  2JRT A;  1W0U A;  3H3V K;  3W6K B;  3HOX J;  2R93 J;  5DUI A;  4LIU A;  4G7Z F;  4FX4 A;  2W85 A;  3L00 A;  3G6E I;  1XSD A;  1DU0 A;  2JTV A;  1HW5 A;  1HC8 A;  3M07 A;  2XRL A;  2KZV A;  1MMN A;  1B1B A;  4L18 B;  3H9G A;  2LR8 A;  4HEA 2;  1X4O A;  1XD7 A;  1WJB A;  3MEX A;  3OYH A;  2Z16 A;  4EM0 B;  2DJI A;  3HUG A;  4BHP A;  1OJL A;  3N4M A;  1NK3 P;  3SFZ A;  4ZH4 F;  2DMT A;  2R4G A;  2V1D A;  3U9G A;  3BR1 A;  3HOZ J;  2QUF A;  4M3F A;  1IUF A;  1R22 A;  4EM2 A;  3OL4 A;  2GXB A;  1QA6 A;  3AFH A;  2CUZ A;  1FYK A;  4PDK A;  4CSW A;  3FHN A;  4J01 A;  3H5N A;  1IDZ A;  2OTJ I;  2F4I A;  4I99 C;  5GAD J;  2VC0 A;  1LEB A;  3PFY A;  3EPZ A;  5IPA A;  5IT9 K;  5CVI A;  4AYB A;  3JRE A;  4RLQ A;  3X2Q H;  3OS2 A;  2DT6 A;  3DF8 A;  1MJ9 A;  5IP6 A;  3ZMS A;  1BR2 A;  3V4G A;  1JGG A;  1R23 A;  4JX5 A;  1ZGJ A;  4IQ4 A;  2LY9 A;  3B6C A;  3H36 A;  1IRX A;  3I53 A;  4LB6 B;  5FD6 A;  4XIC A;  3I64 A;  3KET A;  2HVS A;  2L4A A;  1BM9 A;  5EG0 B;  2ZSI B;  2VQL A;  2MD0 A;  5D8K B;  4XN3 A;  4I76 A;  2H27 A;  3GTK J;  1S9H A;  4XLC A;  2IA1 A;  5JI6 A;  1OPC A;  4XKB A;  1SFU A;  2GXA A;  2M7B A;  3R4K A;  2CUJ A;  1Y39 A;  3BJA A;  2P7C B;  2ICW G;  3LQQ A;  2CFO A;  2V6C A;  3TGN A;  2LLK A;  2VE9 A;  1ETX A;  4XK4 A;  5JVT A;  2F5C A;  1UG2 A;  4BAY A;  2V9P A;  5ERI A;  2CFX A;  2ZKZ A;  1I39 A;  1S7E A;  4HX4 A;  3V8L A;  2LY2 A;  2CJJ A;  1HBX G;  2CQ7 A;  4I6Z A;  4XRS A;  2R5Z A;  2R7R A;  1ZGW A;  1V54 H;  5CVV A;  4WXH A;  1OFC X;  3K4C A;  1A36 A;  3JRA A;  4YIR X;  3CP8 A;  3WGI A;  2M45 A;  3S32 A;  3ZGK A;  1RIO H;  2CQK A;  4KYW A;  1WI9 A;  3HIF A;  1U6G A;  3CUQ A;  2Z99 A;  3BY6 A;  3BG3 A;  3ZMV A;  3EUK L;  4B8X A;  1VQ4 I;  2HS5 A;  5FLX K;  2GIZ A;  1HW2 A;  2Z33 A;  1HDP A;  3LFU A;  4GO1 A;  3CJR B;  1G4D A;  2HYG D;  2FQ3 A;  2KMU A;  2VB6 A;  2CQN A;  3BC8 A;  1YHQ I;  2HGC A;  4DZJ A;  2IGM A;  5FLX Z;  1VQ8 I;  3H9J A;  4LG0 B;  4BQQ A;  2ESN A;  4ENM A;  2X6W A;  1R5I D;  3OIP A;  4MQ9 F;  3W6V A;  1TZL A;  2VT2 A;  3BRO A;  4C9Y A;  3DLA A;  3C2G A;  3FMQ A;  2V1X A;  1TWH J;  4FE4 A;  3HPG A;  2VQH A;  1JE8 A;  5ICG A;  2R7W A;  4L0Z B;  3VOE A;  2NVX J;  1NG6 A;  2EIL H;  5FB2 A;  2BE5 F;  1ZN2 A;  2LRE A;  1FP2 A;  1Q1H A;  2QSF X;  3GTO J;  2JSP A;  2EBI A;  1OCO H;  3HKZ N;  3WTU C;  2PN6 A;  1O3S A;  2FMY A;  1JKP C;  3ZQG A;  2OPT A;  5DDG A;  4XID A;  3WOD F;  2VKD A;  3G3Z A;  1I1G A;  1X1A A;  4P9F A;  4A3J J;  1VQL I;  3VSL A;  1W36 D;  1JTY A;  4M3D A;  4RAY A;  3OYJ A;  2DMU A;  3LSJ A;  2DT7 B;  4XON A;  1YW9 A;  1R4N B;  1KU9 A;  2EIN H;  2HVQ A;  3K4L A;  1Q1V A;  2V1U A;  2K40 A;  1DPU A;  1ON2 A;  4M3E A;  2P5L C;  2ISY A;  2CWE A;  2VJJ A;  3RDI A;  2XC7 A;  3FXJ A;  2RGV A;  5DCM A;  4V19 K;  3IHU A;  1IRZ A;  1MBK A;  3LSK A;  1RKW A;  4OU0 A;  3L2U A;  1DGR M;  2HU9 A;  4NNJ A;  4NC7 A;  2EZK A;  2L2O A;  4ZTF A;  1BBY A;  1MJB A;  4WF2 A;  3GTM J;  2O8X A;  4HV5 A;  2RV8 A;  2MD5 A;  2ZC2 A;  4ENJ A;  3FMR A;  1ZR4 A;  3ZCO A;  1Z77 A;  2BVL A;  1C0W A;  1WI3 A;  1FWZ A;  1YIO A;  3HSF A;  2HYF A;  3CC7 I;  3OV8 A;  2ESH A;  3R6S A;  3FKI J;  3WTT C;  3QQA A;  1G3Y A;  5J40 A;  1W0T A;  3NAU A;  3FXM A;  5EJC A;  3FM3 A;  3AKZ A;  4PJ0 C;  4KIC A;  2KLO A;  1FJL A;  1X19 A;  2EFN A;  2H6B A;  2MH9 A;  4RM2 A;  5E8I A;  5C3E J;  5BPI A;  2VAS A;  1BIA A;  1OR7 C;  1X2N A;  4MQV A;  4UUS A;  3G73 A;  1YYV A;  4XM3 A;  1J0R A;  1D0Z A;  1Z05 A;  4M73 A;  4V2G A;  1N78 A;  2L01 A;  4FAS D;  2HQ5 A;  1D5V A;  2WA0 A;  2WC2 A;  4A3M J;  1K6O A;  3LSM A;  3GLL A;  4FT8 A;  1VFC A;  1UZC A;  2QBY B;  1N75 A;  2L7K A;  2LTP A;  4EJO A;  2G7H A;  2XHK A;  4ETS A;  2VQC A;  3K4K A;  3Q9S A;  1VQP I;  2JVH A;  2DOD A;  2ELH A;  2VIX A;  3GFL A;  5CJ9 A;  1K79 A;  2Z3Y A;  3TQN A;  2XAS A;  4YG2 F;  4CUG A;  4OIQ F;  5JVG F;  4YEJ A;  2X4H A;  1YI2 I;  3ELK A;  2A6T A;  3ECO A;  1V5G A;  2CRG A;  2OU2 A;  2VE8 A;  3HEF A;  3OOP A;  2QGU A;  3O8G A;  5D8L B;  2UWM A;  2M5W A;  2IJL A;  4XRF A;  5EYR A;  3ABT A;  3CCL I;  4YFN F;  4NUB A;  1AOY A;  4XKC A;  3BR6 A;  2BY1 A;  1YRN A;  3O3K A;  4BY1 J;  1FC3 A;  2OQG A;  4HAM A;  3H3Z A;  3T5X A;  5EGO A;  1S3J A;  3WTX C;  2JA5 J;  2ZB9 A;  1MBE A;  2EIJ H;  5L3C A;  1A31 A;  2LKP A;  2QLZ A;  2FA5 A;  3U21 A;  3GME A;  2MW8 A;  3HHH A;  5A2Q Z;  3QU6 A;  2L4M A;  4AC0 A;  1H8A C;  5JHU A;  5HDN A;  2HTJ A;  3CCY A;  2FEZ A;  4ZYH A;  5LGN A;  1MIJ A;  5HDG A;  2YPR A;  4LIT A;  2MA3 A;  3DEE A;  5KK1 A;  4PJM A;  2R7Z J;  4PCQ A;  5K7F A;  3MZH A;  4O6J A;  5D6F A;  1LE8 A;  2R5Z B;  2HZT A;  2WY7 Q;  3D5R C;  3K10 A;  4E7L A;  3S14 J;  4XL9 A;  4BYY A;  4Q5S F;  1PUF A;  3HB9 A;  4HBL A;  4Y52 J;  2JA2 A;  1EH6 A;  3DBH B;  3I9V 2;  4AWX B;  1KQ0 A;  2DPD A;  2Z5U A;  3S1R J;  4ASN A;  5FRO A;  3ERE D;  1K61 A;  5HNF A;  3S15 J;  4Y17 A;  3IC7 A;  2QQ8 A;  1GV2 A;  1XGO A;  2Z2S B;  4GYI A;  4YFK F;  1EKE A;  1ENH A;  1FYL A;  5HLH A;  1SMT A;  1Y8R B;  5EZG A;  2EIM H;  4UVC A;  4JQF A;  4YII A;  4IOA F;  3GTJ J;  1U2W A;  1S5L C;  1E3H A;  1MZB A;  2M7A A;  2W84 A;  5ICE A;  4HW0 A;  3WHC A;  4A0X A;  4RB0 A;  4D0P A;  3GXO A;  3B73 A;  3RIR A;  3ZQQ A;  1DUX C;  3GTL J;  2FNP A;  1P4X A;  3FKJ A;  5FLM J;  3BLY A;  3AL0 C;  1R5H A;  3I3L A;  1PP8 F;  3TW7 A;  2YX7 A;  1BJZ A;  5CKT A;  2O03 A;  4QTR A;  2KIS A;  2VJI A;  4BE2 A;  1VQO I;  2E35 A;  4LIV A;  3WE2 A;  5D6E A;  2M3A A;  5EZH A;  4Z6Y A;  4E7J A;  4BJ5 C;  5FKM A;  4MO7 A;  2GOM A;  4CCN A;  4A3D J;  2KP6 A;  2DFH A;  4BBR J;  4XOT A;  4BXU A;  3TO6 A;  4A3G J;  3TO9 A;  4ZDP A;  1BOA A;  5EF6 A;  2XRO A;  2EFP A;  3C3W A;  2ELJ A;  2WTE A;  4A12 A;  2CO5 A;  3OYK A;  3GWZ A;  3HOS A;  1RRJ A;  2HXO A;  3CZ6 A;  3H3U A;  5L3B A;  4RLF A;  3KEY A;  2IVM A;  4MIM A;  3SJM A;  3I54 A;  2DAO A;  1SFE A;  4G8X A;  2Y0M A;  2Y2Z A;  4WXC A;  2R7U A;  1FLI A;  4BXX J;  5E79 C;  2W24 A;  1RET A;  2P4W A;  2P6S A;  5FO5 A;  2MSY A;  1FOX A;  4HNU A;  3HKZ A;  4Y7N J;  1NTC A;  5IP9 J;  3JR9 A;  3BR2 A;  3BG7 A;  1W36 C;  3DTK A;  4GFB A;  1HSJ A;  2TCT A;  3CDL A;  6PAX A;  1OYY A;  1P92 A;  3ECH A;  3WGH A;  4WWC A;  3CDH A;  1I5Z A;  2VOO A;  2XF5 A;  4I7H A;  5IT9 Z;  1E0E A;  3G1O A;  3L2Q A;  1DP3 A;  4PFO A;  2DI3 A;  2M34 A;  5IP7 J;  5F6F A;  1ETQ A;  3ABM H;  4IQJ A;  1XSV A;  2DOE A;  3H9Q A;  2KDZ A;  1IG7 A;  1IO2 A;  3UNG C;  4CCL A;  2M4K A;  3IRQ A;  3E6D A;  3CCE I;  3OYN A;  4A6D A;  2KIM A;  5E1W A;  1MSF C;  2QSG X;  5K5O A;  1T39 A;  3AG2 H;  3JRH A;  4KMF A;  5BMZ A;  2EV0 A;  4KN7 X;  1R1V A;  4OIP F;  4X6A J;  5H6R A;  2PFB A;  3RPQ A;  4WXD A;  2BZT A;  2BW3 B;  4ESJ A;  2O6G E;  3J7A O;  3PFI A;  3HSE A;  2WV1 A;  5HLT A;  3QRF F;  3VWB A;  1JUM A;  3ZQ7 A;  3VYU B;  2LBF B;  2ZME A;  3J7Y J;  3I4N J;  3K7A J;  3K1M A;  5L3D A;  1TP4 A;  3KLO A;  3MAJ A;  3H0D A;  3WU2 C;  1XCB A;  2MLG A;  3WTV C;  3RKQ A;  3KIO A;  1XPX A;  3DP7 A;  3QOD A;  1SAN A;  4XLA A;  1HDD C;  3OYE A;  1QO0 D;  5BOX A;  1Z9C A;  2COB A;  1AKH B;  1QPM A;  4B3X A;  2VUM J;  1RI7 A;  3D1N I;  1HA8 A;  4KT5 C;  2DQR A;  5IOY A;  4DBR A;  1J5Y A;  2FML A;  2MYS A;  3V42 A;  2CYY A;  1DDN A;  1F5T A;  1EH8 A;  3O8H A;  1S6L A;  3BQZ A;  4MGR A;  5DUK A;  3R0A A;  3HXL A;  2XGX A;  2J5P A;  1G6N A;  1RC9 A;  1VQ7 I;  5HDK A;  5FLV A;  4CZZ A;  1CQT A;  2ZBK A;  2QKL B;  3LSH A;  5EEA A;  3C7J A;  4CO8 A;  1FIP A;  4DW6 A;  5J1Y A;  1OMI A;  3DBL B;  3RYR A;  3H5R A;  5HOD A;  1RR8 C;  2QSH X;  4OIO F;  3HOT A;  3AAF A;  2XRN A;  3BG9 A;  2PMZ N;  1REP C;  2ZNY A;  4QPQ A;  3IH3 A;  4OIN F;  4C3H J;  3ABL H;  2DU9 A;  1MD0 A;  3BOQ A;  3CC2 I;  3A0H C;  3IAS 2;  4CH7 A;  1ZG5 A;  2E1M C;  1GXP A;  2NS7 A;  2K9L A;  1QHH D;  4M74 A;  2KFD A;  2M1B A;  2F6C A;  3PUB A;  5DEQ A;  2PMZ A;  2Y69 H;  5K7Z A;  1PP7 U;  1SFX A;  1W7P D;  2XF6 A;  1B9N A;  2WB1 A;  4V2F A;  2CV2 A;  2EJR A;  2IPQ X;  2PJR B;  2JMW A;  4IF4 A;  5TRD A;  1VZ0 A;  3K6G A;  1E3P A;  2NAZ A;  3EUA A;  3BZ6 A;  4II2 A;  4XNF A;  1TW2 A;  1BC7 C;  2YU3 A;  3T8T A;  3S3O A;  2R7S A;  1U5T C;  3BR3 A;  1IV8 A;  1X1C A;  1LFP A;  1BI0 A;  2VBY A;  2E71 A;  2H6C A;  1HF0 A;  1XB4 A;  3IWF A;  1FBU A;  2NNY A;  1SMY F;  2OJE D;  2HVR A;  3S93 A;  3HRT A;  3HC7 A;  3WTZ A;  5EEG A;  5HOO A;  1Y0N A;  2XUB A;  1YX3 A;  4N0B A;  4E7K A;  4ZZD A;  2DA5 A;  3ROU A;  2V1N A;  4UB8 C;  2LFB A;  1XC5 A;  3RKW A;  2Y31 A;  4I98 B;  4RAG A;  1IN8 A;  2KQR A;  1OQY A;  1X1B A;  3TL4 X;  1I6H J;  5M3F J;  2JZY A;  4HNT A;  4X0G A;  2H09 A;  2IBD A;  5J1U A;  2IGK A;  1G3W A;  1MNE A;  3BTC A;  4A6E A;  5DCF A;  4DIQ A;  1QBJ A;  5H20 A;  3FXK A;  1LNW A;  4OMY A;  1OCT C;  1PVE A;  2Y9Y A;  3GTG J;  1R1U A;  1P2F A;  2IA0 A;  3BG6 A;  4L9V A;  4PGG A;  2CSO A;  1WWX A;  3KYC B;  4FTH A;  1RNL A;  1XSX A;  1TL8 A;  3S1M J;  2M8G X;  4KDP A;  3TW6 A;  1ERD A;  1YLF A;  2STT A;  2VOP A;  2DTR A;  4KIS A;  2HOA A;  1VQ5 I;  1O3Q A;  2F4O B;  1W4M A;  2IEK A;  3C2B A;  5J6X A;  4JYK A;  2L7F P;  4P96 A;  2WAD A;  2BY0 A;  2DA7 A;  2ZNZ A;  1JTX A;  2QQ9 A;  3R60 A;  2VON A;  1YX5 A;  1USS A;  2YS9 A;  1ZYR F;  3TDU C;  2OBP A;  2PJP A;  3DKX A;  1D0X A;  3CCJ I;  3JTG A;  2R5Y B;  3NWS A;  2NNN A;  2MC3 A;  4HF0 A;  2PQ8 A;  5L3F A;  4EJW A;  5H2F C;  3VEP A;  2D5V A;  4AUX A;  4X1E A;  4MEX F;  3V7R A;  3HL2 A;  2LD5 A;  3S8P A;  2Y75 A;  4KA4 A;  2GQQ A;  1LEA A;  4RMN A;  3IL2 A;  4JBA A;  4J19 A;  3GTQ J;  1ZAR A;  2ZME C;  4XMY A;  2FSW A;  2ISZ A;  2O61 A;  5E3L A;  2X0L A;  3CJQ B;  2STW A;  4NB5 A;  1YJ9 I;  4L5E A;  3D5S C;  2NOG A;  2L5Q A;  1OCZ H;  1YS6 A;  3N97 A;  2XAU A;  3D0S A;  3CLQ A;  4A3F J;  2B9S A;  1WHU A;  3F8M A;  4U88 A;  3VYT B;  1MKM A;  3IH4 A;  4HX7 A;  5M5W J;  2XVC A;  4L0Y B;  3S2H J;  4CCJ A;  4RGR A;  3I59 A;  3H1C A;  5JR3 A;  1KQ9 A;  4BL0 B;  1D1A A;  2XPW A;  1ETV A;  1WH7 A;  2WAE A;  2O3F A;  1STZ A;  1VQ9 I;  3F9K A;  3ISP A;  1FMV A;  4HPQ A;  1Y6I A;  4A69 C;  2R5Y A;  2FE3 A;  1TT5 B;  2E2H J;  2FX0 A;  5LD2 C;  1B8I B;  3A01 B;  3E5X A;  2E5N A;  5F1R A;  3CP2 A;  2R92 J;  2LH9 A;  1IXR C;  2DFE A;  5HS8 A;  3OYB A;  2G9W A;  2ZJQ F;  3MZ8 A;  5LLQ A;  3OS1 A;  2LF7 A;  4MLO A;  3DPU A;  2MAB A;  1GXQ A;  3BJO A;  1WQ2 A;  4LB5 A;  3WU1 B;  4CXF A;  2GIV A;  2LY1 A;  2HZD A;  3K2A A;  3JW4 A;  4XSZ F;  3LL7 A;  3R61 A;  3T8R A;  1JKR C;  2DPU A;  2DYS H;  1SD7 A;  2HFH A;  1TTY A;  3ULQ B;  1OR7 A;  4KMU X;  4M3B A;  2EPF A;  2V79 A;  2XGE A;  1IC8 A;  3SQN A;  1MBH A;  3NAR A;  5LHG A;  1H9T A;  5EGO B;  4EMS A;  4E7I A;  2NVT J;  1J9I A;  2BVM A;  3HSR A;  4I0A A;  2Q0O A;  1SD4 A;  3F6V A;  1Y0U A;  4XLF A;  4IX7 A;  4BNC A;  1VTN C;  3I5U A;  3QPL A;  2DK5 A;  2WAQ A;  1GT0 C;  2HOT A;  1A04 A;  5ICF A;  3LA7 A;  3CUQ C;  2BOL A;  2X9D A;  3BG5 A;  3FXU A;  2AXT C;  2IS6 A;  1XMX A;  4C30 A;  1ZK8 A;  4HQE A;  4IXA A;  1HCR A;  5IT3 A;  2NS0 A;  4C2T A;  1O7F A;  4UHT A;  1OLT A;  1YW7 A;  2E5Z A;  2ZFW A;  5LGU A;  2H8R A;  3DBR B;  2FBK A;  4G6D A;  2XAH A;  3G1M A;  3AG4 H;  1I1S A;  2KJC A;  2IGO A;  3TP0 A;  3BPV A;  2Y0S A;  5B3S H;  1FZP B;  1EH7 A;  3LQR A;  4BS9 A;  2K02 A;  1YO5 C;  5DD8 A;  4Q48 A;  2K86 A;  2H1L A;  3CCV I;  5TJJ A;  1MMS A;  1L0O C;  3P9K A;  1SVL A;  5KAF C;  2IA2 A;  2YR2 A;  2WV0 A;  3IUO A;  3P9I A;  1K78 A;  2X1C A;  4LGW A;  1V55 H;  3TOB A;  5E18 F;  2H1K A;  2VPR A;  3G1L A;  3LAP A;  2GBY A;  4E7Z A;  3J80 Z;  5ICC A;  1LVK A;  2JVG A;  3DCF A;  3DTE A;  1N25 A;  3RQ4 A;  3S17 J;  2KIQ A;  4RDU A;  4KIB A;  1UHM A;  3L2W A;  2NVU B;  3J81 Z;  3MKW B;  2L9S A;  3PO3 J;  1BJA A;  1HKQ A;  3OL3 A;  5FD5 A;  1ZG1 A;  4S04 A;  2X1D A;  3KLN A;  5BQT A;  2DA1 A;  1MW7 A;  1UEL B;  4PFP A;  1PUE E;  2A6H F;  2VBX A;  3OYM A;  3KX2 A;  4CHU A;  3U2R A;  3E6C C;  4A3L J;  1WJA A;  3A01 A;  4LFU A;  4Q47 A;  1LFB A;  1B9M A;  4AIH A;  3TBI A;  1BW5 A;  2KHM A;  2B0L A;  3OWT A;  4HV6 A;  4B47 A;  2FQ4 A;  4D9J A;  5M5X J;  2HKO A;  1S72 I;  2K9S A;  2Z1D A;  5E8G A;  1LVA A;  1ZEL A;  3CJN A;  2Q8K A;  1LUJ B;  2DQL A;  4DYC A;  5M3M J;  4ZYD A;  2E1C A;  4EGY A;  2EFO A;  4BAC A;  3ZRG A;  4P5O A;  4I02 A;  4Y3O A;  4XR6 A;  1YFH A;  1B59 A;  1V4R A;  3L09 A;  2RRE A;  3CQZ J;  5LRS A;  1R49 A;  2RNG A;  4L9N A;  4NBQ A;  4H0E A;  3IAM 2;  1MJA A;  3U1D A;  3CME I;  1ETW A;  1TLH B;  2ME6 A;  1E2X A;  3EDP A;  3S1N J;  4OAZ A;  2OZU A;  1JXS A;  1RES A;  1WRJ A;  1WZ2 A;  2ID3 A;  1KU7 A;  2BHZ A;  3KYL A;  3WTY C;  3P5J A;  2ACJ A;  1XMA A;  3ZN1 A;  3F8B A;  3E0J B;  1PUF B;  5FRN A;  1F1Z A;  3CLO A;  2VKE A;  4JX4 A;  3MFK A;  1KU3 A;  1NG7 A;  2R7F A;  1W1W E;  4EVI A;  1V5E A;  2NXN B;  1FOW A;  3BR5 A;  3PQJ A;  4CCM A;  3HPH A;  4DNC A;  2JA8 J;  2LRD A;  4DZP A;  2P0W A;  3PL8 A;  3WU0 A;  3G71 I;  2V4J C;  2KRF A;  3HOU J;  3CTA A;  1FIA A;  5HS9 A;  1F43 A;  2BY2 A;  1Z3Y A;  1YTY A;  1K4S A;  5GAH J;  5GPA A;  3K4N A;  2P81 A;  3FBI B;  3FXO A;  2KRH A;  2UUZ A;  1HOM A;  3E1S A;  4N9I A;  2CUE A;  2OA4 A;  2WY8 Q;  2ZME B;  4E7H A;  4A2U A;  2GZW A;  1WFX A;  2OD5 A;  2TDX A;  4Y13 A;  3ZXS A;  3MKZ A;  2X48 A;  1OKR A;  4OIR F;  1JKO C;  2LK2 A;  2TRT A;  1P4A A;  1LDK B;  4BXF A;  4DBQ A;  3HOW J;  1D8J A;  5DTD A;  5JFR A;  4ENN A;  1T95 A;  3SZT A;  1YIT I;  2XKP A;  1ITY A;  4LD5 A;  2KJB A;  2P6T A;  4YFX F;  1DU6 A;  2IS2 A;  5FGM A;  2M87 A;  5K5R A;  2RN7 A;  2BEO A;  2K85 A;  2P5K A;  4IRI A;  2AS5 F;  2F5F A;  3QYB A;  2HPI A;  2NOJ B;  2EK5 A;  3GF2 A;  5CLS A;  2CV1 A;  1V5F A;  1F36 A;  2PJR A;  2BY3 A;  4XN0 A;  4EJT A;  1VND A;  1UG0 A;  3M3Y J;  3CF2 A;  1RUN A;  3FK7 A;  2FJ1 A;  2DW4 A;  1H88 C;  1XN7 A;  4BQA A;  3O6B B;  1IN6 A;  3L9F A;  5TGT A;  4BHC A;  4AU7 A;  2XPU A;  5B66 C;  2VBW A;  3HRU A;  1X3Z B;  5D5W B;  5FKL A;  1BI2 A;  4U0V A;  4BQO A;  2ZO4 A;  3IV5 A;  3K70 D;  2DOF A;  4YEL A;  3SHF A;  3C18 A;  1K7A A;  1Z67 A;  1XMK A;  4A3K J;  2W82 A;  1T56 A;  3ZMZ A;  2ECC A;  5GP9 A;  3RQI A;  2M0C A;  3MZY A;  4DQ2 A;  2XB5 A;  2K3P A;  3JRF A;  1MNM C;  3OY9 A;  2M0M A;  5AON A;  1VI0 A;  2VXD A;  2A69 F;  1BIB A;  4P9U A;  4JX6 A;  2BBY A;  5GAE J;  3O2P E;  2A3S A;  2ZXH A;  1Y56 A;  1B6A A;  1IAW A;  3FBN B;  4B44 A;  4ZYG A;  5FKN A;  4J00 A;  1XDS A;  3AG3 H;  2VL8 A;  4F92 B;  1BN5 A;  3F3X A;  4P1W A;  1TWA J;  4A5N A;  4EM1 A;  2ZJ2 A;  3VDX A;  1MDM B;  5HNH A;  4ON0 A;  4ZC3 A;  3QYF A;  4A3C J;  1F9N A;  2M2E A;  3DEU A;  4CA0 A;  3K2Z A;  2ZXJ A;  2JK3 A;  2R7V A;  2UZK A;  2A07 F;  4E4H A;  2O7O A;  3IKV A;  1QVT A;  2QM3 A;  3V7C A;  1WSU A;  3KYD B;  5AIP A;  2QEN A;  1Z7L A;  2QQA A;  3H92 A;  4OMZ A;  5J1R A;  2Y0S N;  3I4P A;  2XIG A;  2OAZ A;  2NS8 A;  1JHF A;  2LKS A;  4B09 A;  2A5Y B;  1I3A A;  5FKO A;  1VQ6 I;  4RAZ A;  2FOW A;  2RKH A;  4PSX A;  3HUG B;  2J5O A;  2JSC A;  3QU3 A;  4XLH A;  4XSX F;  2DLL A;  4RM3 A;  4XLN F;  1PDN C;  2HQN A;  2DK8 A;  2IXS A;  2VN2 A;  4D7M A;  2O9L A;  2LVS A;  1ETK A;  3I58 A;  3BZC A;  2E19 A;  4IOC F;  2JN6 A;  2B7E A;  2VT3 A;  5CPR B;  3FIW A;  4IHV A;  3BCB A;  3A03 A;  3V8K A;  3ERM A;  2ADU A;  1VQK I;  2W7N A;  4Y33 A;  1WJC A;  1LKX A;  3BPX A;  4ZTJ A;  3UR3 C;  4AD9 A;  1BR4 A;  1S8N A;  1XG1 A;  3GZN B;  4G7H F;  1Z3X A;  3MVP A;  1IRG A;  1ZLJ A;  5CVR A;  3CJT B;  1H89 C;  5JLX A;  3K4J A;  1IN7 A;  2DN0 A;  2LSO A;  4MTE A;  4BEH A;  1HW1 A;  1R7J A;  1H9G A;  1LJ9 A;  1KQ8 A;  2QWW A;  2EV5 A;  3DKW A;  3EUH C;  1UAA A;  1P6R A;  1T0F A;  3LSI A;  2P8T A;  5EDN A;  3GZ5 A;  1JJ6 C;  2KRC A;  1ULY A;  3WG9 A;  3ASN H;  5K1Y A;  2WAQ N;  4TV7 A;  4NHJ A;  4XRM A;  3HGY A;  4C2U A;  1G2H A;  2XAQ A;  3DV8 A;  3MQ0 A;  4IKF A;  1U5T B;  1O57 A;  4LMY A;  3LSR A;  3QPH A;  2IS1 A;  1F4K A;  3Q3S A;  2CG4 A;  1NK2 P;  3CUQ B;  4UVA A;  4HZF A;  4XKW A;  1WCM J;  3V7S A;  1R4M B;  1HST A;  2KZG A;  2RNJ A;  2HQR A;  4IJA A;  2XKO A;  1RZ4 A;  2W4S A;  4EEF G;  4BKX A;  3JAM Z;  5LEK A;  4XOR A;  3K1N A;  1S7A A;  2BHY A;  1AKH A;  3EET A;  3L2C A;  1ZGA A;  2MFZ A;  3NQO A;  5F0F A;  3OYD A;  2IP2 A;  4W97 A;  4C3J J;  4PGH A;  2I8D A;  5LHI A;  3VOD A;  5B1A H;  4DOZ A;  2HOS A;  1UHS A;  3T0Y A;  2JA6 J;  3FXR A;  5A2Q K;  2DMN A;  1MGT A;  1TWF J;  3OYA A;  1EA3 A;  3RSN A;  3COA C;  1MBJ A;  1J75 A;  2E2I J;  3RPU A;  2NYX A;  1UB9 A;  3PO2 J;  2DO7 A;  4D1Q A;  2W00 A;  5LFA A;  2BXY A;  4RAF A;  4U0W A;  1YJN I;  1IDY A;  1Z7U A;  5B5E C;  5E3M A;  4PSW A;  2EFQ A;  3B6A A;  3GO5 A;  4PK4 A;  4RGX A;  3MN2 A;  5CQG A;  5KAI C;  4QSH A;  3LWF A;  3SYT A;  4CCO A;  1AWC A;  1W5S A;  2FNA A;  5HVQ C;  2K9N A;  5M5Y J;  3J80 K;  2ELK A;  3CMY A;  1U78 A;  1P7I A;  2PG4 A;  4HRI A;  2CW7 A;  1GVJ A;  3LNQ A;  3CF5 F;  5L3G A;  1R9T J;  4LG0 A;  5LBQ A;  4A0Z A;  2K7L A;  3ABU A;  4XLP F;  2E1O A;  3SFI A;  3CD6 I;  2GXG A;  2HQA A;  4I2O A;  3D5L A;  1I6X A;  1BA5 A;  1SC7 A;  2XAF A;  1IV6 A;  3WGG A;  3HG9 A;  2IAI A;  2EB7 A;  2HOE A;  2IT0 A;  3ZPL A;  1K83 J;  2QZ8 A;  3ZQC A;  5F0H A;  4NQW B;  3DPT A;  3SEZ A;  5D5U B;  4XKV A;  3V8J A;  4KJZ A;  2O0Y A;  3I56 I;  1ODD A;  3KP3 A;  1VF9 A;  1XGM A;  4MHG A;  2DMP A;  1FSH A;  5IYC J;  4HOB A;  4AYB N;  1TNS A;  3GUD A;  1WVR A;  2DOA A;  1IUY A;  2F2E A;  5K7H A;  4FE7 A;  2MG4 A;  5E3O A;  3OYF A;  2K4B A;  3I71 A;  3GTP J;  4LJZ F;  1AA7 A;  1OIS A;  2JA7 J;  2DFI A;  3L2R A;  1RR7 A;  3NWT A;  3BZK A;  1QU3 A;  4PJN A;  1S29 A;  4HST A;  1XX5 A;  5D5X B;  2XAG A;  3E5Q A;  3F8C A;  2KKO A;  2VBZ A;  3F23 A;  1GDT A;  4KT6 A;  1Y8Q B;  4EAT A;  2VKH A;  2AQF A;  2EH3 A;  5F64 A;  3ML6 A;  1CGP A;  2JRM A;  2NRA C;  4A5M A;  2KDO A;  3CCS I;  2P7V B;  1UMQ A;  5L3E A;  3ASO H;  1P9Q C;  2Y48 A;  1UST A;  3BWG A;  3FHZ A;  3Q5F A;  2V9V A;  2L02 A;  4G6Q A;  1JI8 A;  3FX3 A;  4M9Z A;  4NC6 A;  1FBQ A;  4RB1 A;  1V3F A;  5EG0 A;  4GXO A;  4OOI A;  4IPA A;  4KNY A;  2HDD A;  1JT6 A;  3JRB A;  1SAU A;  2HPM A;  1IF1 A;  2L9V A;  3ZQH A;  2A6E F;  3GEZ A;  2KIF A;  3KEQ A;  3ONQ A;  4UUS B;  4Z2Y A;  3PSF A;  1SAX A;  3W2A A;  2OF7 A;  1J7K A;  2Q1Z B;  2VKV A;  3QPT A;  4KFC A;  4ANJ A;  1DPR A;  3GW2 A;  3ZQL A;  4N9H A;  3GFM A;  4FQG A;  5J8F A;  3OYG A;  3W2W A;  4BDY A;  1POG A;  5KHD A;  2VLA A;  2DMQ A;  3HZJ A;  2R7X A;  4LLL A;  2RQP A;  1R5G A;  3PUF A;  4FHT A;  1MMD A;  3E7L A;  1ZRC A;  3CMM A;  1MMA A;  3OSF A;  4N4O B;  4UV9 A;  2L54 A;  3LST A;  3W6J B;  5FRM A;  2A05 A;  2K5C A;  3PNY A;  5J8C A;  1T0F C;  3S16 J;  5CVU A;  4CDG A;  4HSR A;  2F5D A;  3P9C A;  1MBG A;  2X1E A;  2E36 A;  2B63 J;  4Y15 A;  3QWL A;  4GRI A;  1ZRF A;  3G2B A;  4C2M J;  1ZQ3 P;  3ZMD A;  1MSE C;  3JRG A;  2RC4 A;  2QVO A;  4BEH B;  4W1U A;  4CIC A;  4RB3 C;  4HA8 A;  3JSP A;  3GFI A;  1D5Y A;  1ZRE A;  4QLC U;  4IHY A;  3DWL E;  5HS7 A;  1D3Y A;  4L5I A;  4DJA A;  4UV8 A;  3JRD A;  4IO9 F;  1YRN B;  2H8W A;  4BHB A;  3F8N A;  3WE3 A;  4B3A A;  2HDW A;  3QOP A;  2XV4 S;  3MKY B;  3DXJ F;  2JUG A;  2CW0 F;  1JUS A;  3L2V A;  3F6O A;  4YRV A;  1J2X A;  2JQ7 A;  2ME0 A;  4ENK A;  1K78 B;  4F55 A;  3OYI A;  2O8K A;  1DGW Y;  1X1P A;  1FNN A;  2DXI A;  4G7O F;  3LAJ A;  3EYI A;  2GM4 A;  2PLY A;  2Q2E A;  2XDV A;  4IRH A;  1LFU P;  4LLN A;  1IZ1 A;  2LNB A;  3ZQI A;  3SZP A;  3F8F A;  1E3O C;  2EQR A;  3K0L A;  4H4K C;  2CV0 A;  2HDC A;  1ZTR A;  4UUT A;  3OYL A;  4QPO A;  2R7D A;  2EA4 A;  5CYV A;  1ETY A;  1SD5 A;  4M72 A;  3TO7 A;  2NVQ J;  3H0G J;  5DM6 F;  2AO9 A;  3VFZ A;  2CUF A;  1R36 A;  5JHF A;  1ZR2 A;  2OC6 A;  2XF7 A;  1OYW A;  4DYR A;  2XAJ A;  4RGU A;  3BCA A;  2D1H A;  3LA2 A;  2BW3 A;  3FXQ A;  5FKK A;  2RVC A;  3E97 A;  5KVR A;  2EZH A;  3HRM A;  3HHG A;  2HI3 A;  5C44 J;  4A3E J;  2YUS A;  2JT1 A;  3QP6 A;  5J3L A;  2M30 A;  3A4C A;  4JOM A;  3TDZ C;  1FSE A;  2Q2E B;  3MKL A;  4A0Y A;  1XGS A;  4BQN A;  1RUO A;  1I3Q J;  1J09 A;  2GA1 A;  3M8J A;  2QA4 I;  3ZN0 A;  3BTI A;  5DYM A;  1XGN A;  1YG2 A;  3RCO A;  3A0B C;  3KCC A;  3S3M A;  3CCR I;  3KP2 A;  1Z6R A;  1ZAO A;  2ZCW A;  3CCM I;  1B72 A;  3PM1 A;  2VPL A;  1KZH A;  1G3T A;  1HLV A;  3OIQ A;  3M1C A;  3UKG A;  1FP1 D;  1A6Q A;  3GZ6 A;  2KL4 A;  4EJU A;  3F22 A;  3ESW B;  2DDA A;  2VQG A;  5E17 F;  1MMG A;  3IKT A;  2CMP A;  2XPV A;  3RPU D;  1XDU A;  4UB6 C;  3VPR A;  3OMY A;  3KP7 A;  4UXN A;  3FF5 A;  2FRH A;  2W1O A;  3LOC A;  2R7O A;  3KZZ A;  1OCP A;  3DTI A;  4RBO A;  1P4W A;  3JSO A;  3QP5 A;  2BXZ A;  2VC1 A;  1X3W B;  1O3T A;  1A5J A;  5ED4 A;  2OCC H;  2FBH A;  3KZI C;  4HLY A;  1QZE A;  2QEX I;  4I01 A;  3Q0U A;  2IRF G;  4I0B A;  4CCK A;  5LEJ A;  3IH2 A;  4RB2 C;  5GAG J;  2UV1 A;  3DU6 A;  4U87 A;  1FEX A;  3SXY A;  2LKX A;  4JK1 X;  3IRR A;  4BH9 A;  5LHH A;  2X85 A;  1IXS B;  2L7Z A;  2OTL I;  3EYY A;  4LK1 F;  3DLL F;  1SD6 A;  3QOE A;  2W57 A;  4M6Y A;  1NHA A;  3U1K A;  2JJ7 A;  3SZG A;  2WB1 N;  3JCU C;  4MFD A;  5KCM A;  4BU2 A;  3LFK A;  4CZC A;  1FOK A;  4HYE A;  4JP0 A;  1JJ8 C;  1BI1 A;  3JRI A;  2WWY A;  1QNT A;  1B72 B;  2WAF A;  3E5U A;  5E1X A;  1O4X A;  4GCV A;  4CGZ A;  1Z21 A;  4L9T A;  4DYQ A;  3DEW A;  4DGW B;  3IWZ A;  4HG2 A;  4MNU A;  4NDL A;  3KZY A;  2IS4 A;  3BR0 A; 
#chains in the Genus database with same CATH homology
 3BQZ A;  5IOZ A;  1QRY A;  5FKN A;  1OJL A;  1NK3 P;  5FLV A;  3BQY A;  1TWA J;  3FIS A;  2DMT A;  1CQT A;  4QIW N;  5EEA A;  3BR1 A;  1FIP A;  4DW6 A;  5J1Y A;  3HOZ J;  2G0E A;  4M3F A;  1IUF A;  5HOD A;  4A3C J;  2M2E A;  3HGG A;  5E3N A;  2JK3 A;  3BG9 A;  2PMZ N;  4A3B J;  2O7O A;  3IH3 A;  4C3H J;  1IDZ A;  5C4X J;  1QVT A;  5IPA A;  5C4J J;  3I4M J;  2EZL A;  4A93 J;  9ANT A;  3JRE A;  2NS7 A;  5J1R A;  2Y0S N;  5IP6 A;  2NS8 A;  1WH5 A;  2N8G A;  1JGG A;  4JX5 A;  5FKO A;  1RKT A;  2LY9 A;  3B6C A;  2DA3 A;  4MFE A;  5K7Z A;  4XIC A;  4V2F A;  5EG0 B;  5IYD J;  4D7M A;  2O9L A;  2JMW A;  4I76 A;  2LVS A;  3GTK J;  1ETK A;  2AHQ A;  2E19 A;  2JN6 A;  3FIW A;  4IHV A;  3A03 A;  2ID6 A;  1BL0 A;  3BR3 A;  1FTZ A;  3RZO J;  2LLK A;  1XG1 A;  2KT0 A;  4M6V A;  1ETX A;  4XK4 A;  1MBF A;  4IEJ A;  1HF0 A;  3MVP A;  1UG2 A;  1EF4 A;  1JUP A;  1H89 C;  5JLX A;  1S7E A;  2DN0 A;  2CJJ A;  4I6Z A;  4XRS A;  2R5Z A;  2DA5 A;  1ZGW A;  2LFB A;  4IHW A;  1OFC X;  1XC5 A;  2Y31 A;  3JRA A;  2DJN A;  5F04 A;  1I6H J;  5F0C A;  5M3F J;  3BG3 A;  1ORK A;  5EDN A;  1HDP A;  2IBD A;  4C3I J;  1JJ6 C;  5J1U A;  3LSG A;  3BTC A;  1LE8 B;  2WAQ N;  4XRM A;  3HGY A;  1G2H A;  1OCT C;  2ECB A;  2Y9Y A;  4DZJ A;  3GTG J;  1AU7 A;  2XGC A;  3LSR A;  3Q3S A;  4FTH A;  3WHB A;  1NK2 P;  3W6V A;  3S1M J;  2M8G X;  3TW6 A;  5JLW A;  1Z0X A;  1WCM J;  2E2J J;  4FE4 A;  1P7J A;  1TWH J;  2HOA A;  1U9N A;  2NVX J;  2IEK A;  3C2B A;  4EEF G;  4JYK A;  4BKX A;  2L7F P;  3GTO J;  2DA7 A;  1AKH A;  3HKZ N;  1JTX A;  2EBI A;  4FCY A;  1BW6 A;  5F0F A;  1GV5 A;  2YS9 A;  1JKP C;  4W97 A;  3ZQG A;  4C3J J;  2R5Y B;  2OPT A;  4LOC A;  4XID A;  1Y1W J;  2D5V A;  4AUX A;  4X1E A;  4A3J J;  2HOS A;  1UHS A;  2LD5 A;  2JA6 J;  1A6I A;  2DMN A;  1JTY A;  1TWF J;  4M3D A;  4IHX A;  2E2I J;  1MBJ A;  2DMU A;  4S0H B;  3LSJ A;  4D5F A;  2DA2 A;  4J19 A;  3PO2 J;  3GTQ J;  5E3L A;  1Q1V A;  2K40 A;  1IDY A;  4L5E A;  2NOG A;  2NVY J;  4M3E A;  5BNG A;  5E3M A;  4A3F J;  3B6A A;  3QPS A;  3IH4 A;  5M5W J;  3MN2 A;  3S2H J;  4QSH A;  1IRZ A;  1MBK A;  1RKW A;  2XPW A;  1ETV A;  1WH7 A;  2K9N A;  2X6O A;  5M5Y J;  2ELK A;  3CMY A;  1XS9 A;  1U78 A;  1P7I A;  2YU9 J;  3HOV J;  4A3I J;  2EZK A;  5IYB J;  3GTM J;  4A69 C;  3LNQ A;  2R5Y A;  1R9T J;  2EZI A;  2E2H J;  2FX0 A;  1B8I B;  2E1O A;  3SFI A;  3A01 B;  1ZR4 A;  2R92 J;  1Z77 A;  1FTT A;  1JT0 A;  1WI3 A;  1BA5 A;  1IV6 A;  2IAI A;  1K83 J;  3ZQC A;  4MLO A;  5F0H A;  3FKI J;  3QQA A;  1W0T A;  3NAU A;  2DA4 A;  2I10 A;  1FJL A;  3K2A A;  1RPW A;  1VF9 A;  2L7M P;  2DMP A;  5C3E J;  5IYC J;  1JKR C;  4ABZ A;  4AYB N;  2QF7 A;  5K7H A;  1IGN A;  1X2N A;  2MGQ A;  4UUS A;  4FE7 A;  1X2M A;  2MG4 A;  5E3O A;  3OIO A;  4M3B A;  3GTP J;  2XGE A;  1IC8 A;  2JA7 J;  1MBH A;  3NAR A;  2Y30 A;  3BTJ A;  1RR7 A;  1X58 A;  4V2G A;  5EGO B;  2NVT J;  2QCO A;  2CU7 A;  1GDT A;  2HQ5 A;  1B8I A;  4A3M J;  2EH3 A;  4CYC A;  1VFC A;  3QPL A;  3OSG A;  2LTP A;  1UMQ A;  1TWC J;  2K9Q A;  1GT0 C;  3FK6 A;  2HOT A;  2X9D A;  2CQQ A;  3BG5 A;  3ZQF A;  5EG0 A;  2L9R A;  1ZK8 A;  4G12 A;  1MH4 A;  3HBL A;  1HCR A;  1TC3 C;  2HDD A;  1JT6 A;  3JRB A;  2W48 A;  2HXI A;  2H8R A;  2CRG A;  3ZQH A;  3G1M A;  4B4C A;  3HEF A;  4UUS B;  3O8G A;  3TED A;  1WPK A;  3TP0 A;  2OF7 A;  5EYR A;  2VKV A;  4XRS G;  3ZQL A;  3BR6 A;  2XSD C;  1YRN A;  1POG A;  2DMQ A;  4BY1 J;  1GVD A;  1IJW C;  3SDG A;  3E7L A;  5EGO A;  2JA5 J;  2ZB9 A;  1MBE A;  3A02 A;  3OSF A;  2H1K A;  1U9O A;  2VPR A;  3G1L A;  1GUU A;  2GBY A;  3S1Q J;  2MW8 A;  3DCF A;  3HOY J;  3S16 J;  3S17 J;  4AC0 A;  4RDU A;  1H8A C;  3CCY A;  1MBG A;  3PO3 J;  2R7Z J;  2B63 J;  5K7F A;  4C2M J;  1ZQ3 P;  1QVU A;  1MSE C;  3JRG A;  1LE8 A;  2R5Z B;  2DA1 A;  4W1U A;  3OOU A;  3TP3 A;  1D5Y A;  2XGD A;  3S14 J;  4IHY A;  3ZOB A;  4A3L J;  1PUF A;  3HB9 A;  3BT9 A;  3A01 A;  3JRD A;  3RZD J;  1YRN B;  4Y52 J;  1LFB A;  3S1R J;  3GBG A;  1K61 A;  3S15 J;  4B3A A;  1BW5 A;  2FQ4 A;  1GV2 A;  5M5X J;  2K9S A;  1ENH A;  3L1P A;  1JUS A;  4DYC A;  5M3M J;  5EZG A;  2ME0 A;  3LSP A;  3GTJ J;  2O8K A;  3WHC A;  2GM4 A;  1MH3 A;  3GTL J;  1T33 A;  3CQZ J;  1LFU P;  2M9H A;  3ZQI A;  5FLM J;  1E3O C;  2EQR A;  1ETO A;  1ZTR A;  3TW7 A;  2HYJ A;  1BJZ A;  4UUT A;  2RAE A;  4QTR A;  1ETW A;  2ME6 A;  3S1N J;  1ETY A;  2NVQ J;  2VI6 A;  1RES A;  3H0G J;  2ID3 A;  2AO9 A;  2CUF A;  5EZH A;  5FKM A;  1ZR2 A;  4MO7 A;  4BY7 J;  3HDD A;  5F1J A;  4A3D J;  4DYR A;  1PUF B;  2DA6 A;  4BBR J;  4FIS A;  1I50 J;  4A3G J;  2VKE A;  5FKK A;  4JX4 A;  2L0K A;  5EF6 A;  2EZH A;  2HI3 A;  2DTZ A;  5C44 J;  4A3E J;  2Y9Z A;  4B1R A;  3BR5 A;  2YUS A;  2JA8 J;  3BTL A;  5J3L A;  2HXO A;  4DZP A;  3Q0V A;  3MKL A;  3HOU J;  1FIA A;  4MIM A;  3SJM A;  1I3Q J;  2CQX A;  4BBS J;  5FJ8 J;  1F43 A;  2Y2Z A;  3BTI A;  5GPA A;  1TWG J;  2P81 A;  4BXX J;  1RET A;  2XB0 X;  2MSY A;  1QPI A;  1B72 A;  3PM1 A;  4Y7N J;  3M4O J;  1NTC A;  1ZKG A;  5IP9 J;  3JR9 A;  1HOM A;  3BR2 A;  4GFB A;  2CUE A;  1HLV A;  2R0Q C;  3S2D J;  3UKG A;  2JWT A;  2TCT A;  3CDL A;  1JKQ C;  2X48 A;  1JKO C;  2LK2 A;  2TRT A;  1U8B A;  3G1O A;  3HOW J;  2XPV A;  5DTD A;  2M34 A;  5IP7 J;  1SFO J;  5F08 A;  3VPR A;  1ETQ A;  4CYC B;  5GPC A;  3Q0W A;  1ITY A;  2KDZ A;  1IG7 A;  3LOC A;  1DU6 A;  1OCP A;  4HNV A;  4RBO A;  2GLO A;  3HM5 A;  1MSF C;  3F0C A;  4M3G A;  3JRH A;  4X6A J;  1A5J A;  1F36 A;  1VND A;  3Q0U A;  3M3Y J;  3FK7 A;  2LP0 A;  1WGX A;  2FJ1 A;  3IH2 A;  2WV1 A;  4D5C A;  1H88 C;  1APL C;  1JUM A;  1FEX A;  2XPU A;  1Y1V J;  3I4N J;  2LKX A;  3K7A J;  5FKL A;  2FD5 A;  3IV5 A;  5DS9 A;  1AHD P;  2L7Z A;  4A3K J;  3RKQ A;  3JRC A;  1T56 A;  2JJ7 A;  2WB1 N;  4D7N A;  2ECC A;  4MFD A;  5GP9 A;  5F27 A;  1W0U A;  3RQI A;  1SAN A;  3H3V K;  1HDD C;  3HOX J;  2R93 J;  2M0C A;  2COB A;  4JP0 A;  1AKH B;  1JJ8 C;  3JRI A;  2XB5 A;  1B72 B;  1O4X A;  2VUM J;  3JRF A;  3D1N I;  1MNM C;  1DU0 A;  1VI0 A;  4DYQ A;  5IOY A;  3DEW A;  4JX6 A;  2XRL A;  4NDL A;  2LR8 A;  3BR0 A;  3O8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...