3GTPJ

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtpJ00
2L7MP 5EGOA 2NOGA 5FLVA 1HLVA 5F27A 4ABZA 4XRSG 5JLWA 2FX0A 5IOZA 4JX6A 5F1JA 4XK4A 1U8BA 1Y1WJ 3JRBA 4BY7J 2WAQN 4CYCB 1PUFA 4MFDA 3GBGA 3L1PA 2NVQJ 5IPAA 5EG0A 5C4XJ 2EZIA 1JUMA 3BR1A 2E2IJ 2R93J 1MNMC 1D5YA 1IJWC 3TP0A 2JWTA 1APLC 2NS8A 4A69C 4C3JJ 5F0CA 4B4CA 3ZQIA 3MKLA 2O9LA 5EGOB 5F0FA 3FK6A 2DMUA 2CQQA 2JJ7A 2LK2A 3WHCA 1FIAA 1VFCA 1BA5A 3JR9A 2HXOA 4D5FA 1R9TJ 2B63J 1IRZA 2FQ4A 2L0KA 2LR8A 1PUFB 1TWAJ 3ZQCA 3HDDA 3HOVJ 5K7ZA 2PMZN 1IUFA 3BG3A 1P7IA 5EYRA 5BNGA 1BL0A 4C3HJ 3PM1A 2X48A 2X9DA 4D7MA 2MSYA 1K83J 2NVYJ 2DA7A 2JA7J 1OCPA 3HM5A 4JP0A 2HI3A 4MO7A 4AUXA 1LE8A 4BXXJ 2E2JJ 2Y9ZA 1SFOJ 4Y52J 2P81A 3RQIA 1A5JA 5C44J 1JKPC 3HOWJ 3BR0A 3BG5A 3K2AA 4LOCA 1VF9A 5FKNA 2W48A 4RDUA 2G0EA 3OSFA 2EQRA 4QIWN 1MH4A 2R5ZB 2XRLA 4M3GA 2DA3A 3LSJA 1B72A 1RPWA 3G1LA 4BKXA 1HDPA 3BR5A 3F0CA 3BQYA 2LFBA 4D5CA 4DZJA 2LKXA 5IP6A 2LLKA 4A3MJ 3RKQA 1AKHA 3BTIA 3VPRA 4W97A 4EEFG 1MSFC 3JRIA 4IHYA 1LE8B 2HYJA 3S14J 1ETWA 1T33A 5J1YA 2COBA 2DMTA 2R0QC 2DJNA 4A3FJ 3TW7A 3JRGA 2IBDA 2XPVA 2VKEA 3E7LA 1JT0A 1AU7A 3Q3SA 1MBGA 1X2NA 2HDDA 4A3BJ 5IOYA 5M5YJ 1I3QJ 1B72B 1IV6A 3S17J 3S1NJ 2E1OA 2Y2ZA 2ID6A 1RETA 2LTPA 3ZQHA 3LSPA 3HOXJ 1AKHB 3JRAA 2MW8A 5GP9A 5IP7J 3MN2A 3FKIJ 3HGGA 4M6VA 1MSEC 4FTHA 3HGYA 1XC5A 4GFBA 5FKOA 5J1UA 1ZGWA 2Y30A 2XB0X 2HOTA 1WH5A 1G2HA 1EF4A 3HKZN 3IH2A 1DU6A 5IP9J 3H0GJ 1JKRC 1XS9A 2FD5A 1WGXA 3IH4A 1H8AC 2ME0A 5E3LA 1TWHJ 4DYRA 2N8GA 3Q0VA 5EF6A 3S1QJ 1UHSA 1JT6A 3QPLA 4X1EA 2YU9J 2DTZA 4NDLA 1Q1VA 4MFEA 3BQZA 1NK3P 3H3VK 4B3AA 4D7NA 5M5XJ 3O8GA 2I10A 2L9RA 3ZQGA 5FLMJ 4C2MJ 4JX4A 2DA4A 2EZHA 1GV2A 3M4OJ 3HEFA 1E3OC 1MBJA 2EH3A 1MH3A 2IEKA 4A3JJ 1W0TA 4MIMA 5E3MA 5DS9A 2R5ZA 2DA2A 3A01A 3CQZJ 1B8IA 3C2BA 3SFIA 2ZB9A 2CQXA 2L7ZA 4RBOA 1DU0A 1YRNA 3S15J 1IDZA 1FEXA 2Y9YA 2VUMJ 1ZR2A 1JGGA 5E3NA 1RR7A 3WHBA 4FE7A 2XGDA 2IAIA 2MGQA 5F08A 1TWGJ 3FISA 1JJ8C 4FCYA 2DMQA 5EZHA 5M3FJ 2JN6A 4W1UA 2LY9A 3RZDJ 5FKLA 3GTQJ 2DMNA 1QVTA 3G1MA 3GTGJ 2CRGA 3HOYJ 2ECCA 4JX5A 4A3DJ 4JYKA 1U9NA 2XPUA 4A93J 4A3GJ 2HXIA 3A01B 5EZGA 1B8IB 3FIWA 5C4JJ 1Z0XA 3HOUJ 1YRNB 1JJ6C 2NVXJ 1ETQA 2O7OA 5HODA 2DA1A 3OIOA 3HOZJ 3S1RJ 3K7AJ 1Y1VJ 2CUFA 4J19A 2AHQA 2OF7A 3BR3A 4A3KJ 3TW6A 1TC3C 2K9SA 4BBSJ 1JKOC 4IHWA 4AYBN 2JA6J 3NARA 1UMQA 1FTTA 1POGA 1HF0A 3GTKJ 3HBLA 1GV5A 4V2FA 2NS7A 1LFBA 4X6AJ 1GDTA 2GM4A 5EEAA 4M3FA 1S7EA 1BW5A 1ZK8A 1ZTRA 2L7FP 3BT9A 2NVTJ 1ORKA 2DA6A 3BR2A 3I4MJ 1GT0C 1NTCA 4A3CJ 4IHVA 3A03A 4XICA 3DEWA 2M34A 2RAEA 2Y0SN 2ECBA 3LOCA 3ZOBA 1HCRA 2K9QA 2HOSA 4G12A 2AO9A 1K61A 1I50J 2DMPA 1UG2A 3HB9A 3CMYA 1IC8A 4HNVA 4BBRJ 1RKTA 3PO3J 2EZLA 1VNDA 1ETVA 3O8HA 3SJMA 1ENHA 1MBHA 1IGNA 1AHDP 1NK2P 1OFCX 4A3EJ 3BG9A 4AC0A 1QVUA 3JRHA 3A02A 5K7FA 2TCTA 2E2HJ 4UUSA 2DN0A 1SANA 3JRCA 1X58A 1W0UA 1ITYA 1P7JA 3TP3A 4FISA 5GPCA 2VKVA 4Y7NJ 4DW6A 2XSDC 1T56A 2VI6A 3JRFA 1U9OA 3S1MJ 5C3EJ 3ZQFA 2D5VA 3S2HJ 1HDDC 4V2GA 3Q0WA 2WB1N 1LFUP 5IYCJ 4B1RA 2GBYA 1I6HJ 5GPAA 3JREA 2Y31A 1JTYA 3OOUA 1H89C 1ETKA 5FKMA 3UKGA 2HQ5A 3B6AA 1FIPA 2R5YA 4UUSB 3Q0UA 1ETYA 3QPSA 3NAUA 2R92J 3IV5A 5F04A 2MG4A 2QF7A 2DA5A 4XIDA 1FTZA 2YUSA 4XRMA 4DYCA 1WCMJ 2XGCA 1OCTC 3RZOJ 2WV1A 2FJ1A 3LSRA 2O8KA 3PO2J 4QTRA 3JRDA 3LSGA 2JA5J 3G1OA 3IH3A 3W6VA 3BTCA 3ZQLA 5EG0B 1IDYA 4MLOA 1QRYA 3I4NJ 4M3DA 5DTDA 1CQTA 2CJJA 2M8GX 1O4XA 4DZPA 2R5YB 1WI3A 2XB5A 2GLOA 1F36A 3QQAA 4S0HB 1QPIA 1ETXA 5JLXA 1IG7A 5IYBJ 1F43A 1WH7A 5FKKA 1U78A 3TEDA 1TWCJ 1ZQ3P 2K40A 2TRTA 2ME6A 1GVDA 3BR6A 4QSHA 5E3OA 4IEJA 3GTLJ 2ELKA 4UUTA 3BTLA 3B6CA 5FJ8J 3OSGA 2CU7A 4A3IJ 4BY1J 2JA8J 2M9HA 3CDLA 3D1NI 3GTJJ 1FJLA 4L5EA 4DYQA 5K7HA 3MVPA 4IHXA 1Z77A 1JKQC 1JUPA 2ID3A 9ANTA 2R7ZJ 1JTXA 2CUEA 1GUUA 2EBIA 3DCFA 1ZKGA 2X6OA 2OPTA 2M0CA 1XG1A 4C3IJ 2JMWA 2H1KA 2QCOA 1RKWA 1WPKA 3CCYA 4I76A 1A6IA 1H88C 1X2MA 4A3LJ 1VI0A 2E19A 3GTPJ 1TWFJ 3LNQA 5J3LA 2EZKA 1OJLA 3SDGA 2XGEA 1RESA 4CYCA 2KDZA 3S16J 3M3YJ 2HOAA 3GTOJ 5F0HA 2LVSA 2LP0A 1MBKA 5EDNA 5IYDJ 2KT0A 5J1RA 1BW6A 5M3MJ 1BJZA 5M5WJ 3GTMJ 1ZR4A 1JUSA 2YS9A 3S2DJ 4M3BA 2XPWA 2VPRA 4M3EA 1HOMA 2JK3A 3BTJA 1ETOA 4FE4A 4XRSA 1MBEA 2K9NA 2H8RA 2LD5A 1MBFA 3FK7A 2M2EA 4I6ZA
chains in the Genus database with same CATH superfamily
2L7MP 3CC2I 3PUFA 4FASD 2K85A 5F27A 1VZ0A 2EFQA 4ABZA 1IRXA 2RNJA 3A0HC 1J7KA 3DPUA 3GCMA 4XRSG 4BJ5C 5BPIA 4UV9A 5IT9K 1PP8F 4HW0A 4ENMA 1Y1WJ 2ZCWA 5DV5A 3EYYA 3HL2A 4CYCB 3K4LA 4LGWA 3LAJA 1PUFA 1DDNA 1XPXA 4MFDA 3WTZA 3X2QH 1PVEA 5EG0A 1LKXA 3L2VA 2STTA 4EM1A 4I0AA 1MDMA 2ESHA 1JUMA 3PL8A 2CGPA 5TISC 3ECHA 3I0TA 1WVRA 2WWYA 3O3KA 1D5YA 3AG4H 3HKZA 1S29A 4GYGA 2CS3A 3G71I 2F5CA 5F0CA 3MKLA 4HG2A 5AONA 3FKJA 1PDNC 1V5EA 1KGSA 5EGOB 5A2QK 4PJLA 2HPMA 2O9LA 3FK6A 2X85A 1CF7A 2CQQA 3P5JA 2LK2A 4E7HA 3U21A 2W25A 4KIFA 1VFCA 2HXOA 4D5FA 1R9TJ 3KCCA 2UWMA 4RAZA 2M5WA 3HDDA 3KP3A 2X4HA 2LDUA 1WJEA 2PMZN 3CCUI 2QM3A 2RGVA 2K27A 1I1GA 1YW9A 4CCKA 2X6XA 1X1DA 3SZTA 2MSYA 3HOTA 3SYTA 2F2EA 2JA7J 1OCPA 2GXGA 3WGHA 1LQ1A 4AUXA 3BPXA 1G59A 2L4MA 2Y9ZA 4ZYGA 4LIUA 4YFNF 4Y52J 4IHTA 3RQIA 5E18F 3I3LA 5HOOA 4XLHA 2RKHA 1J59A 3K2AA 4LOCA 4LLGF 4ESBA 3ONQA 1H0MA 3B02A 3IHUA 2G0EA 3QODA 2A07F 2YSRA 2QVOA 3EUHA 2PLYA 1S9HA 3EQLF 2DA3A 1HC8A 1B72A 3G1LA 4HX8A 3V42A 2GOXB 1SEUA 2LKXA 2LLKA 2VLAA 3RKQA 1BOBA 3VPRA 4W97A 4EEFG 2YPRA 1X3UA 4RAGA 3OYCA 1B6AA 4AVPA 1JXSA 1LE8B 2B7EA 1H9TA 2HYJA 2XSJC 3S14J 3ECOA 3CLOA 3FM5A 4LG3A 1HXDA 2W4SA 4AVZA 4S04A 5ICCA 1FNNA 1VQ8I 1SD4A 2COBA 2DMTA 5H20A 4ESFA 2I5UA 1K4SA 3IAM2 1W36C 1Q1HA 2J5OA 2KJBA 4XSXF 2PMUA 4ZDPA 1F9NA 2BEOA 1OMIA 4ZJZA 4A3BJ 1X2NA 1ON2A 3F6OA 2CH0A 1J2XA 2F48A 3LQQA 3DF8A 3QU6A 3DP7A 3HSFA 2ID6A 4I01A 2CQ7A 4M9ZA 1W4MA 2Z9OA 5J4VA 3HGGA 4GXOA 2PJRB 3M8EA 4ZDOA 3FM3A 4FTHA 3HRMA 3M07A 2OCCH 1XC5A 5J1UA 1X3ZB 5J8FA 4OIPF 2XB0X 3E3VA 2W85A 4XOTA 4G7ZF 2HOTA 2RNGA 1QPMA 1EA3A 3PNTA 2MC3A 1UZCA 2KIUA 2LREA 1V5GA 4WWCA 5BPDA 3ABLH 2FD5A 4RGUA 5GADJ 2QEXI 4XLFA 3IH4A 4ESJA 2IW5A 1H9GA 2ZFUA 3H9GA 4BDYA 2P7CB 1TWHJ 5LGNA 3F6VA 3Q0VA 3T0YA 5EF6A 3AG1H 4DBRA 4G6TB 2BE5F 2YU9J 2DTZA 4NDLA 3BQZA 1AA7A 1NK3P 3TO9A 4KA4A 1CGPA 3H3VK 4YIIA 1D3YA 2QQ8A 4B3XA 3GFMA 3KYDB 3KP5A 2FE3A 2VKHA 5FLXZ 3S3MA 4JX4A 2IEKA 2DPUA 4XN3A 4XLNF 1V3FA 1I6XA 2CFOA 4HPQA 3FDYA 3OYIA 4L0YB 5LRSA 2D1VA 4XKWA 2M4KA 2DA2A 3C2HA 3A01A 2EILH 2W57A 4M73A 2CQNA 3WTSC 1U8RA 2VOPA 1B8IA 3SFIA 2B0LA 4UUVA 1FOXA 2L54A 2W82A 1R58A 2L4AA 3L2WA 2C6YA 2FF4A 1YIOA 2FXAA 2VUMJ 2KZGA 1REPC 3FHNA 1MMGA 2XGDA 5HVQC 2XROA 4CH7A 5F08A 1TWGJ 3FISA 3MZYA 4AIHA 1FYKA 2V6CA 3WTVC 4OOIA 5M3FJ 1K79A 4HA8A 3K4NA 3C3WA 1K4TA 3TL4X 3RZDJ 3GTQJ 1WHUA 4ON0A 1OR7A 3DU5A 4YRVA 1IXSB 1QVTA 1IN4A 1G3YA 1MGTA 2VXZA 2ZXIA 4U0WA 1E3PA 4PDKA 2LC2A 4JYKA 1U9NA 4M6XA 3I54A 1YX3A 2DYRH 1YHQI 1MD0A 2KPMA 1JJ6C 2NVXJ 1ETQA 5HODA 4NHJA 4P9UA 3DQVC 1ONVA 3HOZJ 4U87A 1WRJA 4IHSA 1TBXA 3CP8A 4ZYDA 2EA2A 4N4NB 3K0LA 4G7OF 3KEQA 1TC3C 2K9SA 1Y0NA 4BBSJ 3K1NA 1WWXA 4BJ6C 3FXUA 3DFGA 1OYYA 2P0WA 1KZHA 3ZRGA 3GTKJ 1LUJB 3RQ4A 2CV0A 2V9VA 1IZ1A 1TLHB 5EEAA 4FT8A 2NAZA 2X1DA 1BW5A 1A35A 3GF2A 2Z33A 4L9NA 1F4KA 4MEXF 3CCEI 2P5LC 1D0ZA 1KQ0A 2DA6A 5D4SA 1SAXA 1LDDA 4DIQA 4A3CJ 5D4RA 3DKWA 2RC4A 3WG7H 4CCLA 2M34A 3G73A 2Y0SN 2VBWA 3JCUC 4ZYEA 1HCRA 2DW4A 2L2OA 4L0ZB 5TRDA 4MEYF 1IC8A 4KIGA 4EM2A 3PO3J 2EZLA 1VNDA 2XKPA 5E1XA 2QZ8A 3O6BB 4TV7A 4DJAA 3RI4A 3CC4I 3F8FA 1MBHA 1AHDP 1R6RA 3IUOA 3HHHA 3S2WA 4A0ZA 4A3EJ 2G7UA 2WV0A 2EIMH 2UZKA 4AC0A 1QVUA 4HSRA 2VB6A 5K7FA 4L9TA 4XQFA 3RTRA 2DN0A 1PUEE 1MMAA 2O03A 2PN6A 2KL4A 3GXOA 2IA0A 2R7QA 3JRCA 3F8BA 1SD5A 2WY8Q 3T1BA 3TP3A 1KU3A 4CDGA 3C7JA 3OYEA 5GPCA 4AM3A 2MC4A 4DW6A 4Q47A 4HV5A 1YS6A 1RUNA 3ISPA 1XB4A 3S2HJ 4V2GA 3AL0C 2O8XA 2WB1N 3V7RA 1LFUP 2HKXA 2JSPA 1Z7LA 4IXAA 5BMZA 2K3FA 1F1ZA 2HDWA 3ABKH 1JTYA 3OOUA 2E7XA 1ETKA 3UKGA 2ADUA 5CVUA 3B6AA 3GW2A 1FIPA 3K4JA 4UUSB 2BVLA 1WJCA 1XGSA 4WF2A 3OYFA 2R92J 4BHCA 2RQPA 2H6BA 2QF7A 3HSRA 4XIDA 1FTZA 1E3HA 2NS0A 5HLTA 4DYCA 3HG9A 3KEOA 3NWTA 2XGCA 4ZC3A 3GO5A 4ITVA 3FX3A 1ZELA 4HYEA 2FJ1A 1T38A 1IN6A 4FETA 4QTRA 3H5RA 3E1SA 4BQQA 4AIKA 3IH3A 4UNOA 5GAGJ 3GZ6A 1DP3A 3I4NJ 1VQLI 1YJWI 2FA5A 3QYEA 4UB8C 1QGPA 4XM3A 1CQTA 5J40A 1O3RA 4C2TA 5FFXA 2R3SA 4DZPA 3T5XA 3F8CA 2R5YB 3DU6A 5KVRA 2XB5A 1LFPA 4BHBA 3ABUA 1ETXA 2KRCA 4NUBA 3W2VA 1X1BA 2HVSA 2TDXA 4R79A 1SVOA 3TBIA 1IV8A 2A3SA 3BZ6A 2BGCA 1ZREA 2K40A 2ME6A 3BR6A 2R7TA 2HTSA 2HVQA 2LMDA 4CCNA 2WTEA 1XMAA 5E3OA 3GTLJ 3IKVA 3QYFA 2VKDA 3BTLA 2VQLA 2CU7A 2L02A 4BY1J 2JA8J 3CC7I 2M9HA 3NRVA 4BU2A 1Z3XA 4L5EA 4DYQA 5JVTA 3VYTB 1ZH5A 4IHXA 2W00A 2QSFX 4MTDA 3JSPA 1P9QC 2ID3A 2F4IA 3OYDA 1JTXA 4UY8I 4E7LA 2K5CA 1J0RA 3DCFA 1MMDA 2X6OA 1D8JA 2Q1ZB 4RAFA 2JMWA 2UV1A 4Y33A 1OKRA 2ZXJA 3ASOH 4BAYA 1QHHD 5GAEJ 2Y0MA 1H88C 4E7SA 2KDOA 2WADA 4B09A 2IS1A 3N05A 4A6EA 2Z1DA 3CCRI 2XIGA 2HTJA 1QZZA 3SFZA 3QAHA 3FXRA 5F0HA 2LP0A 5EDNA 1DGWY 1QHGA 2KT0A 3BZCA 3PIPF 4CZCA 5M3MJ 3FZVA 1I27A 1W7PB 3W2WA 3GTMJ 3RDIA 1T39A 3BWGA 2JVHA 1XDUA 3K10A 3CF5F 2YS9A 1ZRFA 3S2DJ 2OD5A 2VPRA 4M3EA 3BTJA 2O0YA 3IWFA 1XTAA 5DM7F 4UHTA 2H8RA 3HUGA 1MBFA 4EJWA 2M2EA 4I6ZA 5DDGA 1MKMA 2NOGA 5LGUA 2VODA 5CQGA 4PSXA 4HV6A 2PEXA 1G3TA 4JX6A 2L9VA 3JW4A 2CO5A 2HYGD 2WAQN 4BQNA 3K6GA 3GFJA 2IGMA 2MH9A 3GBGA 2NVQJ 1QU3A 3BCAA 3OYKA 5C4XJ 2LNBA 4EJTA 3BR1A 2E2IJ 1M1EB 3ZQQA 1IJWC 2R7XA 1IN7A 1TQIA 3P9IA 2NS8A 4B8XA 4C3JJ 2G7HA 1YO5C 1FPQA 2EV6A 5ICGA 3NEUA 1B59A 1O3TA 5F0FA 3F8MA 4II3A 4RB3C 2OTLI 4BQAA 1QZEA 3DKXA 1OCRH 2CV2A 2VE9A 2LR8A 3DLAA 3OOPA 1PUFB 4JQFA 5CJ9A 3ZQCA 3E6DA 1YW8A 3HTSB 3HOVJ 3LL7A 3M7GA 1FMWA 1R5HA 2QWWA 1Z7UA 3C2GA 1HKQA 3FHZA 1MDMB 3OMYA 2NRAC 3I53A 2COMA 1IW7F 3U2RA 1MIJA 4Z6YA 2NVYJ 3FWEA 3PNVA 4EATA 3HM5A 2XKOA 2UUZA 2HI3A 2UXXA 4YIFA 4MO7A 1XSDA 2OJED 4BXXJ 5D6FA 2E2JJ 3ZN0A 1SFOJ 1RIOH 3WTWC 2P81A 1O3QA 1A31A 2M4GA 4BL0B 1JKPC 4MGRA 4NC7A 3E5UA 2DTRA 3HRSA 4M9XA 3J81Z 1XGMA 1YFHA 1WJ5A 2VE8A 4PZJA 3ZGKA 2P5VA 4KUMA 5DUIA 4U0YA 2JZYA 1FP1D 4BUPA 2XRLA 1VQKI 2QSGX 4PGGA 2BVMA 1G3SA 4Q48A 3VDXA 4WXDA 1SD7A 1HSJA 4JOMA 1BI2A 3BR5A 1BOAA 3BCBA 3BQYA 1WSUA 3EUKL 2LFBA 1LB2A 4RM2A 4A3MJ 5IP6A 4KFCA 2IGKA 1AKHA 1IN5A 4ZDLA 1MSFC 4N0BA 5BS6A 4YG2F 5K5QA 5HNHA 4IHYA 2K9MA 5BQTA 2R7SA 4FHTA 1S7AA 5ICEA 3MMYB 2QBYA 3RSNA 4RA2A 4Q4ZF 2RREA 3T8TA 2Z5UA 3FXQA 5DCMA 2HQRA 3R61A 2DJNA 2D45A 3PFIA 3TW7A 1V4RA 3CDIA 1XCBA 1YQAA 1HW5A 1W36D 5D6EA 2XPVA 2VKEA 2DU9A 1MZBA 1JT0A 2IS2A 2HDDA 1I3QJ 2AQFA 1B72B 2V7FA 3S17J 3S1NJ 2E1OA 2A61A 2P6TA 3V7CA 2Y2ZA 3ZQHA 3L9FA 3CLQA 3MN2A 2D2WA 4HEA2 1LNWA 4M6VA 5J6XA 1MSEC 3CD6I 3HZJA 4IVNA 1VTNC 1NHAA 4O3MA 5CLSA 2FQ3A 2Y30A 1Z91A 3LWFA 4C30A 1UAAA 2IA1A 2MYSA 1SC7A 1G2HA 4XBFA 3HKZN 1DU6A 2A05A 3CCLI 4BE0A 4UV8A 1I3AA 1JKRC 1XSVA 1SVMA 1VQMI 1WGXA 1HBXG 2ME0A 2M0MA 2VBYA 2R7FA 1Y6IA 3LSIA 5E3LA 3D0SA 4K2EA 2LSOA 1IXCA 1O3SA 4RLFA 2W7NA 1HA8A 2Z2SB 2JPBA 3S3NA 1C0WA 2R7RA 3QPLA 1D1BA 2P5KA 2LY2A 5M5XJ 3O8GA 5HLIA 2I10A 3AFHA 4HSTA 1X1CA 2PI0A 4C2MJ 3J80K 3RCOA 2Z3YA 1N25A 1XN7A 1Z6RA 1Y39A 3OL4A 1E3OC 1AWCA 4DBQA 1MBJA 2EH3A 1MH3A 4KYWA 2FBIA 1G3WA 1ZARA 4NQWA 3ABMH 2DQLA 1FYLA 5B1BH 2XGXA 3A1YA 1BBYA 4FQGA 4C2UA 3C2BA 2XAUA 1DU0A 3S15J 1YRNA 2EK5A 1X4PA 4ENKA 1ODDA 4ZTJA 2K02A 2YX7A 2Y9YA 4I0BA 1S72I 1QQIA 3WHBA 1HW1A 3OYGA 2IAIA 1D8KA 3PNYA 1JJ8C 2V1NA 3OL3A 5EZHA 4LB5A 1RI7A 2A6EF 5HNFA 2F5VA 2ZMEC 4M71A 1D1CA 1SD6A 2GIVA 4EMSA 3L2RA 3WTUC 2IA2A 2KRFA 3DTEA 2DAOA 4XONA 1RR8C 2XAGA 3GTGJ 1P92A 3FMQA 4JX5A 1A6QA 3HYIA 2XPUA 4A3GJ 3A01B 2DFIA 3R0AA 1J5YA 1SMTA 1B8IB 4PCQA 3JAMZ 3G3ZA 3E6MA 3KPHA 1D0YA 3GZNB 5ERIA 2O6GE 3H0DA 1LJ9A 3QOPA 4J19A 3TKYA 3TW6A 4ENNA 1T2KA 3ZMTA 1YJNI 2MH2A 3LMMA 1BC8C 1JKOC 4AYBN 2JA6J 3NARA 1HF0A 1T6SA 3KIOA 4ZTFA 2A5WA 3HBLA 3E97A 2K7LA 2BZTA 4R1HA 1FP2A 3I5UA 3DEEA 2GM4A 1D5VA 4M3FA 2B9SA 4BXFA 3WGGA 1ZRCA 2OA4A 3KLOA 1ZTRA 1TT5B 3K4CA 4PSWA 3DBLB 1OPCA 2DFFA 1ERDA 3VSLA 4KISA 3CJRB 2F5DA 2OQGA 3GZ5A 4L5JA 3BOQA 4AD9A 1GT0C 2HOEA 1EV7A 4RGRA 1MMSA 3TO6A 3A03A 4MHGA 1SVLA 3KEYA 4XICA 4EGZA 3H92A 3SEQA 2RAEA 3PQKA 1K78A 4IQJA 2FNPA 2DDAA 3W6JB 2DQRA 3T8RA 3MAJA 4EJVA 1K61A 3IL2A 2DMPA 1UG2A 2VBZA 2GXAA 2WBMA 2A68F 4BBRJ 1RZ4A 2ZFWA 4I7HA 2M3AA 2Y75A 1ETVA 1Z1DA 3O8HA 4YFXF 5LHIA 2OTJI 2R7VA 3SJMA 3VB2A 2E5ZA 1ENHA 1B1BA 1TTYA 2H8WA 1V54H 1Y56A 3OV8A 1FC3A 3BG9A 4XKVA 1E2XA 2OAZA 2TCTA 2VQCA 5LEJA 2DDBA 3DLLF 2XAHA 4E7ZA 1PJRA 1WJFA 2M87A 2JT1A 1YW7A 3CZ6A 4U7BA 2WY7Q 5DD8A 4NNJA 2R7WA 1RRJA 3RPUD 3IC7A 5B1AH 1ITYA 2O5RA 1BJAA 3ERMA 2XSDC 1R4MB 3VYUB 4F91B 5C3EJ 2D5VA 4Y15A 3Q0WA 4UXNA 3BG7A 2Q0OA 3CF2A 3KLNA 2A5YB 4RGXA 4B1RA 5FGMA 2VOOA 3AG2H 4HBLA 5CYVA 3PUBA 3KZIC 3M8FA 1Z05A 2QQ9A 1XGOA 2HQ5A 1QZYA 1X19A 1YX5A 2P6SA 3Q0UA 3HPHA 2MG4A 3OS0A 2FBHA 4BEHA 3SXYA 3WTXC 1HKTA 3BJAA 3GFIA 2ZXWH 2QGUA 2PMHA 5CVVA 1WCMJ 2KLOA 1A36A 1OCTC 2EB7A 3CDHA 3GEZA 3G2BA 5KAFC 3CO6C 2QKMB 1O7LA 3NWSA 3OYMA 2O8KA 3VEPA 3JSOA 4OIQF 5JHFA 1USTA 3CUQA 3IAS2 3LSGA 3I64A 4G8XA 5LHHA 3W6VA 4GO1A 1IDYA 1SMYF 1XCVA 4F55A 4HDVA 1U5TC 4IRIA 1XGNA 2XVCA 4IZZA 1O4XA 2FEZA 4F93B 2R4GA 4X0GA 1WI3A 4PJMA 1F36A 3V4GA 2IXSA 3B73A 2QUFA 3FXLA 2DK5A 5ED4A 3AKZA 1LDKB 4B48A 5HLHA 2HGCA 3C1DA 2ZNZA 1B9MA 2AXTC 2DT5A 3SHFA 4B47A 2LBFA 1VQ9I 4E7IA 3HJEA 4CICA 4G6QA 1OQYA 1TWCJ 2VXDA 1R7JA 2TRTA 3FF5A 4LFUA 1S6LA 2VT2A 4IOCF 4EJOA 5EEGA 3LA7A 1JE8A 3K2ZA 3O2PE 2ACJA 2GA2A 3ZQ7A 5GTIC 1R71A 1S7OA 3D1NI 3PSIA 1SFKA 2IP2A 3GTJJ 3WU1B 2BY1A 1D0XA 1FJLA 3I59A 5FROA 4G9YA 5K7HA 3C18A 1FWZA 1JKQC 3D5LA 9ANTA 1ULYA 2R7ZJ 3FXJA 2CUEA 1NG6A 3HXLA 1ZKGA 1NH3A 2HR3A 2DBBA 2M0CA 2OPTA 2DJIA 4NB5A 4C3IJ 2QCOA 3AG3H 3COAC 1RKWA 4ZH4F 3S3OA 1T0FC 3F9KA 4HOBA 4R8HA 2EFWA 2IVMA 1X2MA 2JVGA 4A3LJ 1JI8A 3LNQA 4HF0A 1YG2A 3BPVA 4FX0A 1UELB 3TOAA 1DP7P 1R23A 2Y69H 2KDZA 2VJIA 2ISZA 1N77A 3OYLA 1MBKA 5J1RA 5FB2A 2OU2A 1BI0A 3PQJA 4J00A 2D1HA 1B9NA 4RM3A 5EJCA 5H2FC 2Z16A 4M3BA 4EJUA 1HOMA 2GZWA 2JK3A 4FE4A 4XRSA 1QO0D 2X0LA 1MBEA 1YE9A 2ZJRF 1WZ2A 2K9NA 4MTEA 3K70D 4IHWA 5DCFA 1HLVA 2V6EA 5JLWA 1P2FA 3MKWB 2FX0A 5IOZA 2LRDA 5F1JA 4XK4A 1ZG1A 4B44A 2HNHA 1KU9A 4QWQA 1U8BA 4KMFA 2KHMA 3JRBA 3CMEI 4PJNA 1ZG5A 5LGTA 1ZHFA 4MNUA 5CPRB 2V79A 3KYCB 5LEKA 3RPQA 5JFRA 2EZIA 2R93J 2R7UA 3ZMZA 1I39A 2BY3A 2H27A 2KIQA 2O61A 1GHCA 2M1BA 5ILSA 2PBIA 1APLC 5FLXK 4F52A 2BYVE 2STWA 3HUGB 3GLXA 4B4CA 3ZQIA 3WTTC 1QNTA 5J47A 1L3LA 1IF1A 2CUZA 1FBSA 2DMUA 2EPFA 2JJ7A 4EQQA 1VQNI 2ZMEA 1FIAA 2NXNB 2LOOA 1BA5A 3JR9A 2B63J 2AXLA 2L0KA 3E0JB 1TWAJ 1VQ5I 4BE1A 1UFMA 5L3CA 2VT3A 4A0YA 4BXUA 1IUFA 3ZN1A 2L01A 3I71A 2HPIA 2DYSH 4E7JA 6PAXA 2WB1A 2F4OB 2WC2A 2X48A 2X9DA 4D9JA 3EDPA 4CHUA 1OLTA 3L7WA 3UNGC 5FD5A 3IRQA 4ZZLA 2VJJA 4L9JA 2VC1A 3FBIB 2FUG2 3VODA 3KE2A 3W3CA 3RIRA 4AWXB 1PP7U 1V5FA 2EFPA 3J7AO 1A5JA 3K69A 3TQNA 4P96A 3BR0A 5TJJA 3CCVI 3SDBA 3OS2A 4NBQA 2W48A 4RDUA 3VYSB 2Q2EA 3OSFA 1BC7C 3H5NA 2ZNYA 4M3GA 1A04A 2QQBA 2IRFG 2BHZA 2OV7A 1W5CC 1R5GA 3SEZA 3TOBA 1S5LC 2CSOA 4DZJA 1ZG3A 2RQQA 3BTIA 3QPHA 4KT6A 3G4SI 1ZN2A 3K4BA 4XSZF 3QPTA 4OIRF 2E1MC 3LA2A 3GUDA 1ETWA 4AIDA 4PFPA 1T33A 4A5NA 2G9WA 5J1YA 2E1NA 4A3FJ 1SFXA 2DFEA 2CQKA 2R7OA 3JRGA 2KFDA 2L5QA 3BC8A 2GA1A 2IS6A 3OIPA 3LSMA 1MBGA 5J8CA 2JPCA 5M5YJ 3J7ZI 3GYHX 1T95A 1UJ8A 2RDPA 4IF4A 1KQ8A 2OZ6A 2H09A 2LTPA 1MNDA 3FMRA 3LSPA 3LAPA 3H9QA 1BR2A 2BW3A 5D8KB 3HOXJ 1AKHB 2MW8A 1GVJA 2FSWA 3K70C 2ETHA 4RGSA 4GFBA 2QBYB 1ZGWA 2VJ4A 1D1AA 2NVUB 2M30A 3LSTA 5DCMB 1EF4A 2BXZA 1HW2A 4U0VA 3IH2A 3V8JA 4KNYA 2AQEA 3H0GJ 1XD7A 3RKWA 3KYLA 4BHPA 4PJ0C 5E79C 2IGOA 2EV5A 3WE3A 2NNYA 5IT9Z 1X1AA 5LLQA 2DCEA 4M9SA 3ESWB 4M6YA 4OU0A 3OIQA 4DYRA 4HLYA 2KISA 4E7KA 4QLCU 1JT6A 5JHUA 4WK8F 4MFEA 4JBAA 5JR3A 1MJBA 4WXHA 3BJ6A 4B3AA 4D7NA 2PG4A 1YIJI 2L9RA 3ZQGA 1ZLKA 2KJCA 1FLIA 4EV0A 3AL0B 2MLGA 2DA4A 1VQPI 2EZHA 3HEFA 1UHWA 5L3EA 1W0TA 1DPUA 5A2QZ 5E3MA 4P1WA 1U5TA 5DS9A 2CW7A 3LSHA 2PJPA 2RV8A 1J75A 2ZJQF 3MZHA 2CQXA 2K4BA 2CG4A 3H9JA 2WAQA 3K4KA 1IDZA 3PFYA 2QSHX 4P9FA 3CCMI 2HQNA 2EFOA 3GWZA 1JGGA 5E3NA 4WXCA 3KP6A 4OIOF 5F64A 3KP7A 4E4HA 2E5NA 2MGQA 1JGSA 2MABA 4DNCA 4FCYA 4EM0B 1UHMA 2DMQA 2JN6A 3QRFF 1SFEA 2PX9A 2BOLA 5FRMA 2QENA 4XLAA 3DTIA 3WE2A 1KYWA 2DMNA 4I02A 4NQWB 2CRGA 3HOYJ 3CUOA 3VSKA 2K9LA 2OCEA 3BY6A 4XNFA 4A3DJ 4DGWB 1Y8QB 5EZGA 3S93A 3HIFA 1GXQA 3H5AA 5C4JJ 1SFUA 4XORA 2E60A 3HOUJ 1YRNB 2XAJA 3OIOA 1J09A 2JUGA 3K7AJ 4HQMA 1R36A 2VBXA 2AHQA 3BR3A 2V1XA 3WODF 2QA4I 1DUXC 3KFWX 1FOKA 1UMQA 4G94A 4XLCA 1FTTA 1POGA 2DODA 2HZTA 5K5RA 4YEJA 4DOZA 1FOYA 4A5MA 3MEXA 4MQ9F 5LFAA 1U3EM 2V4JC 2EINH 4X6AJ 1EH6A 2E7WA 2JUCA 5B5EC 1GDTA 2ZXHA 3KX2A 4Z2YA 2K4JA 1S7EA 2F5EA 1ZK8A 2BXYA 4KMUX 3MFKA 1R1TA 2ELHA 2L7FP 3ULQB 2NVTJ 2P7VB 3IRRA 4IO9F 4PFOA 1ORKA 5CVJA 2V9PA 2P4WA 3P9KA 2V26A 4PGHA 3BR2A 2W1OA 3RPUA 4ZYHA 3CO7C 1GLNA 3HOSA 2NYXA 3QP5A 4U7DA 2Q8KA 3VOEA 2ZKZA 2DOEA 3ZOBA 1OCCH 2K9QA 2HOSA 4G12A 2AO9A 2OBPA 3F23A 3FBNB 3HB9A 1BIAA 2OC6A 2XAFA 2BV6A 4BQOA 2EWNA 4O6JA 3EPZA 3L2UA 1TQPA 2WA0A 1IGNA 4ETSA 2K3PA 1JHHA 2BY2A 2VIXA 3EYIA 4N9HA 2CV1A 3A02A 3JTHA 3FXKA 1YS7A 4ZZDA 1OYWA 3OR1C 2DPDA 4I09A 5DYMA 2F6CA 1W5TA 3EUAA 1YI2I 3WGIA 3LFKA 4BGDA 4M74A 4UB6C 1VQ7I 5D5WB 4N4OB 1QBJA 1W0UA 4KN4X 3DXJF 1K78B 1GXPA 2IS4A 2VKVA 2VC0A 5CVRA 2VI6A 1HQCA 4D0PA 2DLLA 2LG4A 2P8TA 2L3DA 5FRNA 1E0EA 2X1CA 4B43A 1LVKA 5IYCJ 4OINF 1R1UA 4XLEA 3F21A 4V19K 1I6HJ 5GPAA 4Y4RA 3JREA 2Y31A 1UG0A 4CYDA 1H89C 5LHGA 3H3ZA 3OYBA 2A6TA 1LEAA 1R49A 1RNLA 1ETYA 2CWEA 3IV5A 2XF7A 3K4MA 5E8GA 1USSA 4LG0A 2YUSA 4XRMA 2XDVA 4IRGA 2JQ7A 1YLFA 2HKOA 2LF8A 4XOPA 5JVGF 5F1RA 1P4AA 5BOXA 2ZJPF 4OMYA 2JSCA 2GQQA 2WV1A 4QPOA 3MKZA 3GFLA 3RZOJ 3ELKA 4GCVA 3R4KA 3LSRA 3PO2J 2GIZA 3I58A 4A2UA 1FSEA 2JA5J 3DEUA 4ENJA 3ZQLA 1Y0UA 2HU9A 3GVAA 5JI6A 4MLOA 1QRYA 5KNLA 5KAIC 4M3DA 5DTDA 4IRHA 4CXFA 1FT9A 1WJAA 4U88A 2M7BA 2HYFA 5CVIA 5B66C 1IRGA 3ZMVA 3QQAA 4IX7A 1QPIA 1WQ2A 3DTKA 2DO7A 4KN7X 1Z21A 4BEHB 2WAEA 3J81K 2GOMA 2LYCA 2PMZA 1WH7A 5FKKA 1U78A 1YOVB 3TEDA 2YR2A 3Q9SA 2HFHA 2IJLA 1GVDA 3OYHA 4QSHA 4LK1F 4IEJA 4D1QA 1EJ9A 2KP6A 2ELKA 4LIVA 5FFZA 4CCJA 1TL8A 3DKYA 3CUQB 3OY9A 3OSGA 3ABTA 1XX5A 3I55I 1N75A 2LF7A 2GAUA 3HTUA 2W84A 1K6OA 2M45A 3ZMDA 1Z77A 4WX9A 1EH7A 1TW2A 1LDJA 1GUUA 4IL6C 4KDPA 2M8EA 4ZYAA 3ZP5A 3KP2A 3W2AA 1FZPB 3CP2A 5ICFA 3S32A 3DV8A 2LBFB 3MKYB 2EIJH 1WJDA 1WPKA 2ZO4A 4I76A 1A6IA 1BIBA 2A6HF 3M9AA 3F22A 5FO5A 1VI0A 2E19A 1MJ9A 3GTPJ 3MCZA 5J3LA 3MZ8A 1X1PA 5HS7A 3ZMUA 3G6EI 3IWZA 1UCRA 5KK1A 2I8DA 4CYCA 3BG6A 3S16J 5K5OA 1KONA 3GTOJ 2HZDA 4L5IA 5GAHJ 1HKSA 4AYBA 3I59B 1T8IA 4II2A 1TQMA 2AS5F 1WFXA 1BJZA 1ZR4A 1BI3A 1W7PD 4BE2A 1JUSA 1UB9A 3BZKA 3P7NA 3K9TA 4WCGA 1FSHA 5HS9A 2DFHA 2MA3A 2MFZA 1BM9A 5E17F 2LD5A 5H6QA 1U2WA 4CUGA 1WH5A 2ISYA 1IAWA 1XDSA 5EGOA 4HDUA 5FLVA 3J7AY 4OWRB 2JRMA 1Z9CA 1Z6TA 4LJZF 3LFUA 3KP4A 4BY7J 4LK0F 4HRIA 4AIJA 2UXNA 3DPTA 3EETA 4NC6A 3L1PA 2NNNA 5IPAA 4XKCA 2KIFA 2HVRA 3ZPLA 1TP4A 2E35A 1MNMC 1OYIA 3TGNA 3TMOA 2KMUA 3TP0A 2JWTA 3Q9VA 4A69C 3E5QA 2QKLB 3ZCOA 5H6RA 4LMYA 2O3FA 1G4DA 2CMPA 3SQNA 2IGNA 3HHGA 2HS5A 2EIKH 3WHCA 5IT3A 3GLLA 4F3QA 1NG7A 4HX4A 1IRZA 4YELA 3RYPA 2FQ4A 4UVAA 2DT7B 2V1DA 2JRTA 5K7ZA 2LH9A 4XRFA 3BP8A 3WU2C 3BG3A 1X3WB 1P7IA 3MD2A 2GXBA 5L3BA 5EYRA 4CSWA 2K86A 5BNGA 4C3HJ 5HS8A 1BL0A 3FMSA 2KIMA 3PM1A 3CJNA 4D7MA 1FBUA 2EA4A 1K83J 2DA7A 4JP0A 4CA0A 1IUYA 1ON1A 3PJRA 1KA8A 1T08B 1B4AA 2CYYA 3F8NA 1LE8A 4F7ZA 2H94A 5DD4A 5D5VB 1E17A 5HDGA 1FX7A 5C44J 2ZSIB 3CJTB 3HOWJ 4BNCA 2ZMEB 3BG5A 3BDDA 5AIPA 3QP6A 3KZYA 1VF9A 4P55A 5FKNA 3JAMK 3KETA 1Z3YA 3DBHB 2FOKA 2EQRA 1XMXA 4QIWN 2E1CA 1MH4A 5B3SH 2ZC2A 3KZZA 2R5ZB 3LSJA 2XF5A 1RPWA 4BKXA 1HDPA 1ZGJA 3F0CA 1FBQA 2F5FA 2FNAA 3E5XA 4D5CA 1W1WE 4XN0A 2ZBKA 3JRIA 1G8XA 2FOWA 4BYYA 2PJRA 3CESA 5D5XB 1R22A 1YYVA 4EGYA 2DI3A 1P4WA 5L3FA 2IT0A 2X6YA 2PFBA 3TDZC 3A4CA 3E6BA 4A12A 1RC9A 2R0QC 5TGTA 3QYBA 3RYRA 4JK1X 2MD0A 3CCSI 2Q2EB 4O5VA 4GYIA 2IBDA 3VFZA 3E7LA 1XMKA 4I98B 1AU7A 3Q3SA 1JHFA 1IRFA 3R60A 5IOYA 1IV6A 3RKXA 3D5SC 3ML6A 1YJ9I 1RETA 1K7AA 3JRAA 4LITA 5AIQA 5GP9A 5IP7J 3FKIJ 2F4MB 2H1LA 1MJAA 4GDFA 2WAFA 4CZZA 3HGYA 1PYVA 3OWTA 5FKOA 4Y3OA 3N4MA 3W6KB 3PIOF 4L18B 1TZLA 2XAQA 3E6CC 1IN8A 3WG9A 3RKYA 5IP9J 1U6GA 1XS9A 3CMAI 5DM6F 1W5SA 4ASNA 4XLPF 2BHYA 3CCJI 2Y0SA 4UVBA 2E36A 1H8AC 5D8LB 1I1SA 4E6KG 3FXMA 2CW8A 1XSXA 2KRHA 4PK4A 3HC7A 2N8GA 2BW3B 3TDUC 4HX7A 4S05A 3ASNH 3S1QJ 1UHSA 4X1EA 1KQ9A 1Q1VA 2XV4S 5ILVA 2OUMA 3QOEA 3CTAA 2YU3A 1Y8RB 3HPGA 3M1EA 5FLMJ 4Q5SF 4CCMA 2VQHA 4YIRX 1GV2A 4NC8A 3M4OJ 4PUSA 5LRRA 2YX4A 4A3JJ 3GMEA 2JTVA 4MIMA 4IKFA 2XHKA 4PJJA 2FU4A 4UVCA 4BH9A 2R5ZA 3CQZJ 4CO8A 2ZB9A 2L7ZA 4RBOA 1FMVA 4H4KC 2V9KA 1FEXA 3HSEA 3H1CA 3OYJA 1FYMA 2MLKA 2FBKA 1ZR2A 1RR7A 4XR6A 4FE7A 2GWRA 1DGRM 1EKEA 4FX4A 5KCMA 5IY5H 5J4YA 2X51A 1MNEA 4HF1A 3J7YJ 1FY7A 4W1UA 4C9YA 2LY9A 2QLZA 5DEQA 3BLYA 3BJOA 5FKLA 3DPLC 1I5ZA 1LVAA 4A0XA 4RB1A 2Z99A 3G1MA 1U5TB 4KITB 2ECCA 1KU7A 2VASA 4A93J 1KYZA 2HXIA 3ROUA 5HDNA 3FIWA 3V7SA 1LEBA 1Z0XA 4LD5A 3L2CA 3CJQB 2O7OA 3L09A 2ELJA 1R4NB 2DA1A 1EH8A 3S1RJ 2QYOA 1Y1VJ 1Z67A 2CUFA 4RAYA 2OF7A 4A3KJ 4BACA 3P9CA 3TO7A 1R1VA 3R6SA 3S8PA 4HNTA 3D5RC 2RVCA 2L9NA 3DBRB 3AAFA 3A2KA 1K6YA 2E71A 1TNSA 1GV5A 2ICWG 3HRTA 2DOFA 2NS7A 4KT5C 1LFBA 4V2FA 1YTYA 4Y17A 1ZLJA 3EUHC 3SZPA 3NQOA 2VPLA 3K1MA 1O7FA 2BBYA 3I4PA 3BT9A 3QU3A 2HWVA 2L7KA 1P6RA 5KHDA 3OS1A 2H6CA 3I4MJ 2VJ5A 1TW3A 1MW7A 1NTCA 1SAUA 4A6DA 4IHVA 3LA3A 4XL9A 1KU2A 3DEWA 4HZFA 1FOWA 2ECBA 3LOCA 3Q5FA 4CCOA 1VQOI 3UR3C 1I50J 4F92B 2LY1A 2HQAA 3IP4B 2X6WA 3CMYA 4HNVA 1RKTA 3WU0A 4HLXA 4H0EA 4OMZA 2KQRA 1G6NA 5CKTA 4HF2A 1VQ4I 1ZRDA 1NK2P 1OFCX 2IPQX 1N78A 2CFXA 1WJBA 2CW0F 3JRHA 2E2HJ 4HNUA 3V8LA 4UUSA 2OZUA 3U1DA 2CUJA 2JA2A 1SANA 5ILUA 3L00A 2HEOA 1X4OA 2HDCA 1X58A 5E20A 3R0JA 4P5OA 4EVIA 4IJAA 2VQGA 3WTYC 1P7JA 1QA6A 4FISA 4GRIA 4L9VA 4Y7NJ 2DXIA 4I2OA 1T56A 5CQEA 4YFKF 1U9OA 3OYAA 3JRFA 2VONA 3S1MJ 4AU7A 2ZJ2A 3ZQFA 1HDDC 4XMYA 3OYNA 1OCZH 3QWLA 1OISA 3LQRA 1U0JA 3F72A 2GBYA 2XF6A 5E1ZB 1BI1A 1BR1A 1TT0A 2M7AA 3HRUA 1YITI 3J80Z 3GX4X 3IKTA 5FKMA 4G6DA 5LD2C 4CGZA 1DPRA 1ZAOA 2R5YA 4IOAF 3QPSA 3NAUA 4GGGA 1OCOH 2L9SA 5F04A 3V8KA 2DK8A 2KKOA 2DA5A 4KIBA 3REOA 2PQ8A 1L0OC 2EJRA 2FRHA 1TNTA 2MBFA 1VQ6I 2ESNA 3H36A 4RMNA 1LPQA 1S8NA 1HSTA 3H35A 4HAMA 2R7DA 3DWLE 5D5UB 3ZR8X 4M72A 2W24A 3M8JA 2EV0A 1ZGAA 4DQ2A 3JRDA 1BR4A 4QPQA 3G1OA 4BS9A 4OAYA 1J9IA 1P4XA 3BTCA 5L3DA 5EG0B 3U9GA 3LSKA 3VYRB 2XRNA 3JTGA 4J01A 2CJJA 1DQUA 2M8GX 3M1CA 2FMYA 2LKPA 5EEHA 1O57A 2VN2A 5F6FA 2GLOA 4RS8A 4OAZA 4ANJA 4S0HB 1R5ID 4RB2C 5FD6A 5JLXA 1S3JA 1IG7A 3CMMA 4LLLA 3ZMSA 4G7HF 4LG0B 5IYBJ 1F43A 3BROA 4BDZA 1CF7B 2EFNA 1ZQ3P 4LLNA 1R00A 1MMNA 1T98A 3N97A 1T0FA 1RUOA 2V1UA 2A69F 4Y13A 3L2QA 3VWBA 2NOJB 4KICA 2BY0A 3PSFA 4UUTA 3CUQC 3B6CA 3K1PA 5FJ8J 4MQVA 2VL8A 2KZVA 1BN5A 5GTHC 4A3IJ 2XUBA 3A0BC 4I99C 3CDLA 3H3UA 1OR7C 4IPAA 3CCQI 4RLQA 1IXRC 3MWMA 4XKBA 4BJTA 3MVPA 2ZSHB 3FXOA 5HDKA 1W7PA 3OR2C 1JUPA 1WKMA 2OQRA 2DT6A 3U1KA 5K1YA 3MQ0A 2LKSA 1STZA 2EBIA 1ZYRF 1F5TA 1ACIA 1XG1A 2E1MB 1V55H 2H1KA 2MD5A 4KJZA 2XC7A 1IO2A 3CCYA 4HQEA 2QQAA 5E1WA 1TWFJ 4E70A 1WI9A 2EZKA 1OJLA 3F3XA 4LB6B 2XGEA 3SDGA 1RESA 2E34A 2DOAA 2Y48A 3M3YJ 2HOAA 3ZXSA 2LVSA 5IYDJ 5L3GA 3SZGA 4N9IA 4RB0A 3I56I 3ERED 5HLGA 1AOYA 1BW6A 5M5WJ 2XASA 2RN7A 5DUKA 5LBQA 2X1EA 5E8IA 2XPWA 3I9V2 1ETOA 4IQ4A 3RJPA 2J5PA 2FMLA 3FK7A
chains in the Genus database with same CATH topology
2L7MP 5EGOA 2NOGA 5FLVA 1HLVA 5F27A 4ABZA 4XRSG 5JLWA 2FX0A 5IOZA 4JX6A 5F1JA 4XK4A 1U8BA 1Y1WJ 3JRBA 4BY7J 2WAQN 4CYCB 1PUFA 4MFDA 3GBGA 3L1PA 2NVQJ 5IPAA 5EG0A 5C4XJ 2EZIA 1JUMA 3BR1A 2E2IJ 2R93J 1MNMC 1D5YA 1IJWC 3TP0A 2JWTA 1APLC 2NS8A 4A69C 4C3JJ 5F0CA 4B4CA 3ZQIA 3MKLA 2O9LA 5EGOB 5F0FA 3FK6A 2DMUA 2CQQA 2JJ7A 2LK2A 3WHCA 1FIAA 1VFCA 1BA5A 3JR9A 2HXOA 4D5FA 1R9TJ 2B63J 1IRZA 2FQ4A 2L0KA 2LR8A 1PUFB 1TWAJ 3ZQCA 3HDDA 3HOVJ 5K7ZA 2PMZN 1IUFA 3BG3A 1P7IA 5EYRA 5BNGA 1BL0A 4C3HJ 3PM1A 2X48A 2X9DA 4D7MA 2MSYA 1K83J 2NVYJ 2DA7A 2JA7J 1OCPA 3HM5A 4JP0A 2HI3A 4MO7A 4AUXA 1LE8A 4BXXJ 2E2JJ 2Y9ZA 1SFOJ 4Y52J 2P81A 3RQIA 1A5JA 5C44J 1JKPC 3HOWJ 3BR0A 3BG5A 3K2AA 4LOCA 1VF9A 5FKNA 2W48A 4RDUA 2G0EA 3OSFA 2EQRA 4QIWN 1MH4A 2R5ZB 2XRLA 4M3GA 2DA3A 3LSJA 1B72A 1RPWA 3G1LA 4BKXA 1HDPA 3BR5A 3F0CA 3BQYA 2LFBA 4D5CA 4DZJA 2LKXA 5IP6A 2LLKA 4A3MJ 3RKQA 1AKHA 3BTIA 3VPRA 4W97A 4EEFG 1MSFC 3JRIA 4IHYA 1LE8B 2HYJA 3S14J 1ETWA 1T33A 5J1YA 2COBA 2DMTA 2R0QC 2DJNA 4A3FJ 3TW7A 3JRGA 2IBDA 2XPVA 2VKEA 3E7LA 1JT0A 1AU7A 3Q3SA 1MBGA 1X2NA 2HDDA 4A3BJ 5IOYA 5M5YJ 1I3QJ 1B72B 1IV6A 3S17J 3S1NJ 2E1OA 2Y2ZA 2ID6A 1RETA 2LTPA 3ZQHA 3LSPA 3HOXJ 1AKHB 3JRAA 2MW8A 5GP9A 5IP7J 3MN2A 3FKIJ 3HGGA 4M6VA 1MSEC 4FTHA 3HGYA 1XC5A 4GFBA 5FKOA 5J1UA 1ZGWA 2Y30A 2XB0X 2HOTA 1WH5A 1G2HA 1EF4A 3HKZN 3IH2A 1DU6A 5IP9J 3H0GJ 1JKRC 1XS9A 2FD5A 1WGXA 3IH4A 1H8AC 2ME0A 5E3LA 1TWHJ 4DYRA 2N8GA 3Q0VA 5EF6A 3S1QJ 1UHSA 1JT6A 3QPLA 4X1EA 2YU9J 2DTZA 4NDLA 1Q1VA 4MFEA 3BQZA 1NK3P 3H3VK 4B3AA 4D7NA 5M5XJ 3O8GA 2I10A 2L9RA 3ZQGA 5FLMJ 4C2MJ 4JX4A 2DA4A 2EZHA 1GV2A 3M4OJ 3HEFA 1E3OC 1MBJA 2EH3A 1MH3A 2IEKA 4A3JJ 1W0TA 4MIMA 5E3MA 5DS9A 2R5ZA 2DA2A 3A01A 3CQZJ 1B8IA 3C2BA 3SFIA 2ZB9A 2CQXA 2L7ZA 4RBOA 1DU0A 1YRNA 3S15J 1IDZA 1FEXA 2Y9YA 2VUMJ 1ZR2A 1JGGA 5E3NA 1RR7A 3WHBA 4FE7A 2XGDA 2IAIA 2MGQA 5F08A 1TWGJ 3FISA 1JJ8C 4FCYA 2DMQA 5EZHA 5M3FJ 2JN6A 4W1UA 2LY9A 3RZDJ 5FKLA 3GTQJ 2DMNA 1QVTA 3G1MA 3GTGJ 2CRGA 3HOYJ 2ECCA 4JX5A 4A3DJ 4JYKA 1U9NA 2XPUA 4A93J 4A3GJ 2HXIA 3A01B 5EZGA 1B8IB 3FIWA 5C4JJ 1Z0XA 3HOUJ 1YRNB 1JJ6C 2NVXJ 1ETQA 2O7OA 5HODA 2DA1A 3OIOA 3HOZJ 3S1RJ 3K7AJ 1Y1VJ 2CUFA 4J19A 2AHQA 2OF7A 3BR3A 4A3KJ 3TW6A 1TC3C 2K9SA 4BBSJ 1JKOC 4IHWA 4AYBN 2JA6J 3NARA 1UMQA 1FTTA 1POGA 1HF0A 3GTKJ 3HBLA 1GV5A 4V2FA 2NS7A 1LFBA 4X6AJ 1GDTA 2GM4A 5EEAA 4M3FA 1S7EA 1BW5A 1ZK8A 1ZTRA 2L7FP 3BT9A 2NVTJ 1ORKA 2DA6A 3BR2A 3I4MJ 1GT0C 1NTCA 4A3CJ 4IHVA 3A03A 4XICA 3DEWA 2M34A 2RAEA 2Y0SN 2ECBA 3LOCA 3ZOBA 1HCRA 2K9QA 2HOSA 4G12A 2AO9A 1K61A 1I50J 2DMPA 1UG2A 3HB9A 3CMYA 1IC8A 4HNVA 4BBRJ 1RKTA 3PO3J 2EZLA 1VNDA 1ETVA 3O8HA 3SJMA 1ENHA 1MBHA 1IGNA 1AHDP 1NK2P 1OFCX 4A3EJ 3BG9A 4AC0A 1QVUA 3JRHA 3A02A 5K7FA 2TCTA 2E2HJ 4UUSA 2DN0A 1SANA 3JRCA 1X58A 1W0UA 1ITYA 1P7JA 3TP3A 4FISA 5GPCA 2VKVA 4Y7NJ 4DW6A 2XSDC 1T56A 2VI6A 3JRFA 1U9OA 3S1MJ 5C3EJ 3ZQFA 2D5VA 3S2HJ 1HDDC 4V2GA 3Q0WA 2WB1N 1LFUP 5IYCJ 4B1RA 2GBYA 1I6HJ 5GPAA 3JREA 2Y31A 1JTYA 3OOUA 1H89C 1ETKA 5FKMA 3UKGA 2HQ5A 3B6AA 1FIPA 2R5YA 4UUSB 3Q0UA 1ETYA 3QPSA 3NAUA 2R92J 3IV5A 5F04A 2MG4A 2QF7A 2DA5A 4XIDA 1FTZA 2YUSA 4XRMA 4DYCA 1WCMJ 2XGCA 1OCTC 3RZOJ 2WV1A 2FJ1A 3LSRA 2O8KA 3PO2J 4QTRA 3JRDA 3LSGA 2JA5J 3G1OA 3IH3A 3W6VA 3BTCA 3ZQLA 5EG0B 1IDYA 4MLOA 1QRYA 3I4NJ 4M3DA 5DTDA 1CQTA 2CJJA 2M8GX 1O4XA 4DZPA 2R5YB 1WI3A 2XB5A 2GLOA 1F36A 3QQAA 4S0HB 1QPIA 1ETXA 5JLXA 1IG7A 5IYBJ 1F43A 1WH7A 5FKKA 1U78A 3TEDA 1TWCJ 1ZQ3P 2K40A 2TRTA 2ME6A 1GVDA 3BR6A 4QSHA 5E3OA 4IEJA 3GTLJ 2ELKA 4UUTA 3BTLA 3B6CA 5FJ8J 3OSGA 2CU7A 4A3IJ 4BY1J 2JA8J 2M9HA 3CDLA 3D1NI 3GTJJ 1FJLA 4L5EA 4DYQA 5K7HA 3MVPA 4IHXA 1Z77A 1JKQC 1JUPA 2ID3A 9ANTA 2R7ZJ 1JTXA 2CUEA 1GUUA 2EBIA 3DCFA 1ZKGA 2X6OA 2OPTA 2M0CA 1XG1A 4C3IJ 2JMWA 2H1KA 2QCOA 1RKWA 1WPKA 3CCYA 4I76A 1A6IA 1H88C 1X2MA 4A3LJ 1VI0A 2E19A 3GTPJ 1TWFJ 3LNQA 5J3LA 2EZKA 1OJLA 3SDGA 2XGEA 1RESA 4CYCA 2KDZA 3S16J 3M3YJ 2HOAA 3GTOJ 5F0HA 2LVSA 2LP0A 1MBKA 5EDNA 5IYDJ 2KT0A 5J1RA 1BW6A 5M3MJ 1BJZA 5M5WJ 3GTMJ 1ZR4A 1JUSA 2YS9A 3S2DJ 4M3BA 2XPWA 2VPRA 4M3EA 1HOMA 2JK3A 3BTJA 1ETOA 4FE4A 4XRSA 1MBEA 2K9NA 2H8RA 2LD5A 1MBFA 3FK7A 2M2EA 4I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7M P;  5EGO A;  2NOG A;  5FLV A;  1HLV A;  5F27 A;  4ABZ A;  4XRS G;  5JLW A;  2FX0 A;  5IOZ A;  4JX6 A;  5F1J A;  4XK4 A;  1U8B A;  1Y1W J;  3JRB A;  4BY7 J;  2WAQ N;  4CYC B;  1PUF A;  4MFD A;  3GBG A;  3L1P A;  2NVQ J;  5IPA A;  5EG0 A;  5C4X J;  2EZI A;  1JUM A;  3BR1 A;  2E2I J;  2R93 J;  1MNM C;  1D5Y A;  1IJW C;  3TP0 A;  2JWT A;  1APL C;  2NS8 A;  4A69 C;  4C3J J;  5F0C A;  4B4C A;  3ZQI A;  3MKL A;  2O9L A;  5EGO B;  5F0F A;  3FK6 A;  2DMU A;  2CQQ A;  2JJ7 A;  2LK2 A;  3WHC A;  1FIA A;  1VFC A;  1BA5 A;  3JR9 A;  2HXO A;  4D5F A;  1R9T J;  2B63 J;  1IRZ A;  2FQ4 A;  2L0K A;  2LR8 A;  1PUF B;  1TWA J;  3ZQC A;  3HDD A;  3HOV J;  5K7Z A;  2PMZ N;  1IUF A;  3BG3 A;  1P7I A;  5EYR A;  5BNG A;  1BL0 A;  4C3H J;  3PM1 A;  2X48 A;  2X9D A;  4D7M A;  2MSY A;  1K83 J;  2NVY J;  2DA7 A;  2JA7 J;  1OCP A;  3HM5 A;  4JP0 A;  2HI3 A;  4MO7 A;  4AUX A;  1LE8 A;  4BXX J;  2E2J J;  2Y9Z A;  1SFO J;  4Y52 J;  2P81 A;  3RQI A;  1A5J A;  5C44 J;  1JKP C;  3HOW J;  3BR0 A;  3BG5 A;  3K2A A;  4LOC A;  1VF9 A;  5FKN A;  2W48 A;  4RDU A;  2G0E A;  3OSF A;  2EQR A;  4QIW N;  1MH4 A;  2R5Z B;  2XRL A;  4M3G A;  2DA3 A;  3LSJ A;  1B72 A;  1RPW A;  3G1L A;  4BKX A;  1HDP A;  3BR5 A;  3F0C A;  3BQY A;  2LFB A;  4D5C A;  4DZJ A;  2LKX A;  5IP6 A;  2LLK A;  4A3M J;  3RKQ A;  1AKH A;  3BTI A;  3VPR A;  4W97 A;  4EEF G;  1MSF C;  3JRI A;  4IHY A;  1LE8 B;  2HYJ A;  3S14 J;  1ETW A;  1T33 A;  5J1Y A;  2COB A;  2DMT A;  2R0Q C;  2DJN A;  4A3F J;  3TW7 A;  3JRG A;  2IBD A;  2XPV A;  2VKE A;  3E7L A;  1JT0 A;  1AU7 A;  3Q3S A;  1MBG A;  1X2N A;  2HDD A;  4A3B J;  5IOY A;  5M5Y J;  1I3Q J;  1B72 B;  1IV6 A;  3S17 J;  3S1N J;  2E1O A;  2Y2Z A;  2ID6 A;  1RET A;  2LTP A;  3ZQH A;  3LSP A;  3HOX J;  1AKH B;  3JRA A;  2MW8 A;  5GP9 A;  5IP7 J;  3MN2 A;  3FKI J;  3HGG A;  4M6V A;  1MSE C;  4FTH A;  3HGY A;  1XC5 A;  4GFB A;  5FKO A;  5J1U A;  1ZGW A;  2Y30 A;  2XB0 X;  2HOT A;  1WH5 A;  1G2H A;  1EF4 A;  3HKZ N;  3IH2 A;  1DU6 A;  5IP9 J;  3H0G J;  1JKR C;  1XS9 A;  2FD5 A;  1WGX A;  3IH4 A;  1H8A C;  2ME0 A;  5E3L A;  1TWH J;  4DYR A;  2N8G A;  3Q0V A;  5EF6 A;  3S1Q J;  1UHS A;  1JT6 A;  3QPL A;  4X1E A;  2YU9 J;  2DTZ A;  4NDL A;  1Q1V A;  4MFE A;  3BQZ A;  1NK3 P;  3H3V K;  4B3A A;  4D7N A;  5M5X J;  3O8G A;  2I10 A;  2L9R A;  3ZQG A;  5FLM J;  4C2M J;  4JX4 A;  2DA4 A;  2EZH A;  1GV2 A;  3M4O J;  3HEF A;  1E3O C;  1MBJ A;  2EH3 A;  1MH3 A;  2IEK A;  4A3J J;  1W0T A;  4MIM A;  5E3M A;  5DS9 A;  2R5Z A;  2DA2 A;  3A01 A;  3CQZ J;  1B8I A;  3C2B A;  3SFI A;  2ZB9 A;  2CQX A;  2L7Z A;  4RBO A;  1DU0 A;  1YRN A;  3S15 J;  1IDZ A;  1FEX A;  2Y9Y A;  2VUM J;  1ZR2 A;  1JGG A;  5E3N A;  1RR7 A;  3WHB A;  4FE7 A;  2XGD A;  2IAI A;  2MGQ A;  5F08 A;  1TWG J;  3FIS A;  1JJ8 C;  4FCY A;  2DMQ A;  5EZH A;  5M3F J;  2JN6 A;  4W1U A;  2LY9 A;  3RZD J;  5FKL A;  3GTQ J;  2DMN A;  1QVT A;  3G1M A;  3GTG J;  2CRG A;  3HOY J;  2ECC A;  4JX5 A;  4A3D J;  4JYK A;  1U9N A;  2XPU A;  4A93 J;  4A3G J;  2HXI A;  3A01 B;  5EZG A;  1B8I B;  3FIW A;  5C4J J;  1Z0X A;  3HOU J;  1YRN B;  1JJ6 C;  2NVX J;  1ETQ A;  2O7O A;  5HOD A;  2DA1 A;  3OIO A;  3HOZ J;  3S1R J;  3K7A J;  1Y1V J;  2CUF A;  4J19 A;  2AHQ A;  2OF7 A;  3BR3 A;  4A3K J;  3TW6 A;  1TC3 C;  2K9S A;  4BBS J;  1JKO C;  4IHW A;  4AYB N;  2JA6 J;  3NAR A;  1UMQ A;  1FTT A;  1POG A;  1HF0 A;  3GTK J;  3HBL A;  1GV5 A;  4V2F A;  2NS7 A;  1LFB A;  4X6A J;  1GDT A;  2GM4 A;  5EEA A;  4M3F A;  1S7E A;  1BW5 A;  1ZK8 A;  1ZTR A;  2L7F P;  3BT9 A;  2NVT J;  1ORK A;  2DA6 A;  3BR2 A;  3I4M J;  1GT0 C;  1NTC A;  4A3C J;  4IHV A;  3A03 A;  4XIC A;  3DEW A;  2M34 A;  2RAE A;  2Y0S N;  2ECB A;  3LOC A;  3ZOB A;  1HCR A;  2K9Q A;  2HOS A;  4G12 A;  2AO9 A;  1K61 A;  1I50 J;  2DMP A;  1UG2 A;  3HB9 A;  3CMY A;  1IC8 A;  4HNV A;  4BBR J;  1RKT A;  3PO3 J;  2EZL A;  1VND A;  1ETV A;  3O8H A;  3SJM A;  1ENH A;  1MBH A;  1IGN A;  1AHD P;  1NK2 P;  1OFC X;  4A3E J;  3BG9 A;  4AC0 A;  1QVU A;  3JRH A;  3A02 A;  5K7F A;  2TCT A;  2E2H J;  4UUS A;  2DN0 A;  1SAN A;  3JRC A;  1X58 A;  1W0U A;  1ITY A;  1P7J A;  3TP3 A;  4FIS A;  5GPC A;  2VKV A;  4Y7N J;  4DW6 A;  2XSD C;  1T56 A;  2VI6 A;  3JRF A;  1U9O A;  3S1M J;  5C3E J;  3ZQF A;  2D5V A;  3S2H J;  1HDD C;  4V2G A;  3Q0W A;  2WB1 N;  1LFU P;  5IYC J;  4B1R A;  2GBY A;  1I6H J;  5GPA A;  3JRE A;  2Y31 A;  1JTY A;  3OOU A;  1H89 C;  1ETK A;  5FKM A;  3UKG A;  2HQ5 A;  3B6A A;  1FIP A;  2R5Y A;  4UUS B;  3Q0U A;  1ETY A;  3QPS A;  3NAU A;  2R92 J;  3IV5 A;  5F04 A;  2MG4 A;  2QF7 A;  2DA5 A;  4XID A;  1FTZ A;  2YUS A;  4XRM A;  4DYC A;  1WCM J;  2XGC A;  1OCT C;  3RZO J;  2WV1 A;  2FJ1 A;  3LSR A;  2O8K A;  3PO2 J;  4QTR A;  3JRD A;  3LSG A;  2JA5 J;  3G1O A;  3IH3 A;  3W6V A;  3BTC A;  3ZQL A;  5EG0 B;  1IDY A;  4MLO A;  1QRY A;  3I4N J;  4M3D A;  5DTD A;  1CQT A;  2CJJ A;  2M8G X;  1O4X A;  4DZP A;  2R5Y B;  1WI3 A;  2XB5 A;  2GLO A;  1F36 A;  3QQA A;  4S0H B;  1QPI A;  1ETX A;  5JLX A;  1IG7 A;  5IYB J;  1F43 A;  1WH7 A;  5FKK A;  1U78 A;  3TED A;  1TWC J;  1ZQ3 P;  2K40 A;  2TRT A;  2ME6 A;  1GVD A;  3BR6 A;  4QSH A;  5E3O A;  4IEJ A;  3GTL J;  2ELK A;  4UUT A;  3BTL A;  3B6C A;  5FJ8 J;  3OSG A;  2CU7 A;  4A3I J;  4BY1 J;  2JA8 J;  2M9H A;  3CDL A;  3D1N I;  3GTJ J;  1FJL A;  4L5E A;  4DYQ A;  5K7H A;  3MVP A;  4IHX A;  1Z77 A;  1JKQ C;  1JUP A;  2ID3 A;  9ANT A;  2R7Z J;  1JTX A;  2CUE A;  1GUU A;  2EBI A;  3DCF A;  1ZKG A;  2X6O A;  2OPT A;  2M0C A;  1XG1 A;  4C3I J;  2JMW A;  2H1K A;  2QCO A;  1RKW A;  1WPK A;  3CCY A;  4I76 A;  1A6I A;  1H88 C;  1X2M A;  4A3L J;  1VI0 A;  2E19 A;  3GTP J;  1TWF J;  3LNQ A;  5J3L A;  2EZK A;  1OJL A;  3SDG A;  2XGE A;  1RES A;  4CYC A;  2KDZ A;  3S16 J;  3M3Y J;  2HOA A;  3GTO J;  5F0H A;  2LVS A;  2LP0 A;  1MBK A;  5EDN A;  5IYD J;  2KT0 A;  5J1R A;  1BW6 A;  5M3M J;  1BJZ A;  5M5W J;  3GTM J;  1ZR4 A;  1JUS A;  2YS9 A;  3S2D J;  4M3B A;  2XPW A;  2VPR A;  4M3E A;  1HOM A;  2JK3 A;  3BTJ A;  1ETO A;  4FE4 A;  4XRS A;  1MBE A;  2K9N A;  2H8R A;  2LD5 A;  1MBF A;  3FK7 A;  2M2E A;  4I6Z A; 
#chains in the Genus database with same CATH topology
 2L7M P;  3CC2 I;  3PUF A;  4FAS D;  2K85 A;  5F27 A;  1VZ0 A;  2EFQ A;  4ABZ A;  1IRX A;  2RNJ A;  3A0H C;  1J7K A;  3DPU A;  3GCM A;  4XRS G;  4BJ5 C;  5BPI A;  4UV9 A;  5IT9 K;  1PP8 F;  4HW0 A;  4ENM A;  1Y1W J;  2ZCW A;  5DV5 A;  3EYY A;  3HL2 A;  4CYC B;  3K4L A;  4LGW A;  3LAJ A;  1PUF A;  1DDN A;  1XPX A;  4MFD A;  3WTZ A;  3X2Q H;  1PVE A;  5EG0 A;  1LKX A;  3L2V A;  2STT A;  4EM1 A;  4I0A A;  1MDM A;  2ESH A;  1JUM A;  3PL8 A;  2CGP A;  5TIS C;  3ECH A;  3I0T A;  1WVR A;  2WWY A;  3O3K A;  1D5Y A;  3AG4 H;  3HKZ A;  1S29 A;  4GYG A;  2CS3 A;  3G71 I;  2F5C A;  5F0C A;  3MKL A;  4HG2 A;  5AON A;  3FKJ A;  1PDN C;  1V5E A;  1KGS A;  5EGO B;  5A2Q K;  4PJL A;  2HPM A;  2O9L A;  3FK6 A;  2X85 A;  1CF7 A;  2CQQ A;  3P5J A;  2LK2 A;  4E7H A;  3U21 A;  2W25 A;  4KIF A;  1VFC A;  2HXO A;  4D5F A;  1R9T J;  3KCC A;  2UWM A;  4RAZ A;  2M5W A;  3HDD A;  3KP3 A;  2X4H A;  2LDU A;  1WJE A;  2PMZ N;  3CCU I;  2QM3 A;  2RGV A;  2K27 A;  1I1G A;  1YW9 A;  4CCK A;  2X6X A;  1X1D A;  3SZT A;  2MSY A;  3HOT A;  3SYT A;  2F2E A;  2JA7 J;  1OCP A;  2GXG A;  3WGH A;  1LQ1 A;  4AUX A;  3BPX A;  1G59 A;  2L4M A;  2Y9Z A;  4ZYG A;  4LIU A;  4YFN F;  4Y52 J;  4IHT A;  3RQI A;  5E18 F;  3I3L A;  5HOO A;  4XLH A;  2RKH A;  1J59 A;  3K2A A;  4LOC A;  4LLG F;  4ESB A;  3ONQ A;  1H0M A;  3B02 A;  3IHU A;  2G0E A;  3QOD A;  2A07 F;  2YSR A;  2QVO A;  3EUH A;  2PLY A;  1S9H A;  3EQL F;  2DA3 A;  1HC8 A;  1B72 A;  3G1L A;  4HX8 A;  3V42 A;  2GOX B;  1SEU A;  2LKX A;  2LLK A;  2VLA A;  3RKQ A;  1BOB A;  3VPR A;  4W97 A;  4EEF G;  2YPR A;  1X3U A;  4RAG A;  3OYC A;  1B6A A;  4AVP A;  1JXS A;  1LE8 B;  2B7E A;  1H9T A;  2HYJ A;  2XSJ C;  3S14 J;  3ECO A;  3CLO A;  3FM5 A;  4LG3 A;  1HXD A;  2W4S A;  4AVZ A;  4S04 A;  5ICC A;  1FNN A;  1VQ8 I;  1SD4 A;  2COB A;  2DMT A;  5H20 A;  4ESF A;  2I5U A;  1K4S A;  3IAM 2;  1W36 C;  1Q1H A;  2J5O A;  2KJB A;  4XSX F;  2PMU A;  4ZDP A;  1F9N A;  2BEO A;  1OMI A;  4ZJZ A;  4A3B J;  1X2N A;  1ON2 A;  3F6O A;  2CH0 A;  1J2X A;  2F48 A;  3LQQ A;  3DF8 A;  3QU6 A;  3DP7 A;  3HSF A;  2ID6 A;  4I01 A;  2CQ7 A;  4M9Z A;  1W4M A;  2Z9O A;  5J4V A;  3HGG A;  4GXO A;  2PJR B;  3M8E A;  4ZDO A;  3FM3 A;  4FTH A;  3HRM A;  3M07 A;  2OCC H;  1XC5 A;  5J1U A;  1X3Z B;  5J8F A;  4OIP F;  2XB0 X;  3E3V A;  2W85 A;  4XOT A;  4G7Z F;  2HOT A;  2RNG A;  1QPM A;  1EA3 A;  3PNT A;  2MC3 A;  1UZC A;  2KIU A;  2LRE A;  1V5G A;  4WWC A;  5BPD A;  3ABL H;  2FD5 A;  4RGU A;  5GAD J;  2QEX I;  4XLF A;  3IH4 A;  4ESJ A;  2IW5 A;  1H9G A;  2ZFU A;  3H9G A;  4BDY A;  2P7C B;  1TWH J;  5LGN A;  3F6V A;  3Q0V A;  3T0Y A;  5EF6 A;  3AG1 H;  4DBR A;  4G6T B;  2BE5 F;  2YU9 J;  2DTZ A;  4NDL A;  3BQZ A;  1AA7 A;  1NK3 P;  3TO9 A;  4KA4 A;  1CGP A;  3H3V K;  4YII A;  1D3Y A;  2QQ8 A;  4B3X A;  3GFM A;  3KYD B;  3KP5 A;  2FE3 A;  2VKH A;  5FLX Z;  3S3M A;  4JX4 A;  2IEK A;  2DPU A;  4XN3 A;  4XLN F;  1V3F A;  1I6X A;  2CFO A;  4HPQ A;  3FDY A;  3OYI A;  4L0Y B;  5LRS A;  2D1V A;  4XKW A;  2M4K A;  2DA2 A;  3C2H A;  3A01 A;  2EIL H;  2W57 A;  4M73 A;  2CQN A;  3WTS C;  1U8R A;  2VOP A;  1B8I A;  3SFI A;  2B0L A;  4UUV A;  1FOX A;  2L54 A;  2W82 A;  1R58 A;  2L4A A;  3L2W A;  2C6Y A;  2FF4 A;  1YIO A;  2FXA A;  2VUM J;  2KZG A;  1REP C;  3FHN A;  1MMG A;  2XGD A;  5HVQ C;  2XRO A;  4CH7 A;  5F08 A;  1TWG J;  3FIS A;  3MZY A;  4AIH A;  1FYK A;  2V6C A;  3WTV C;  4OOI A;  5M3F J;  1K79 A;  4HA8 A;  3K4N A;  3C3W A;  1K4T A;  3TL4 X;  3RZD J;  3GTQ J;  1WHU A;  4ON0 A;  1OR7 A;  3DU5 A;  4YRV A;  1IXS B;  1QVT A;  1IN4 A;  1G3Y A;  1MGT A;  2VXZ A;  2ZXI A;  4U0W A;  1E3P A;  4PDK A;  2LC2 A;  4JYK A;  1U9N A;  4M6X A;  3I54 A;  1YX3 A;  2DYR H;  1YHQ I;  1MD0 A;  2KPM A;  1JJ6 C;  2NVX J;  1ETQ A;  5HOD A;  4NHJ A;  4P9U A;  3DQV C;  1ONV A;  3HOZ J;  4U87 A;  1WRJ A;  4IHS A;  1TBX A;  3CP8 A;  4ZYD A;  2EA2 A;  4N4N B;  3K0L A;  4G7O F;  3KEQ A;  1TC3 C;  2K9S A;  1Y0N A;  4BBS J;  3K1N A;  1WWX A;  4BJ6 C;  3FXU A;  3DFG A;  1OYY A;  2P0W A;  1KZH A;  3ZRG A;  3GTK J;  1LUJ B;  3RQ4 A;  2CV0 A;  2V9V A;  1IZ1 A;  1TLH B;  5EEA A;  4FT8 A;  2NAZ A;  2X1D A;  1BW5 A;  1A35 A;  3GF2 A;  2Z33 A;  4L9N A;  1F4K A;  4MEX F;  3CCE I;  2P5L C;  1D0Z A;  1KQ0 A;  2DA6 A;  5D4S A;  1SAX A;  1LDD A;  4DIQ A;  4A3C J;  5D4R A;  3DKW A;  2RC4 A;  3WG7 H;  4CCL A;  2M34 A;  3G73 A;  2Y0S N;  2VBW A;  3JCU C;  4ZYE A;  1HCR A;  2DW4 A;  2L2O A;  4L0Z B;  5TRD A;  4MEY F;  1IC8 A;  4KIG A;  4EM2 A;  3PO3 J;  2EZL A;  1VND A;  2XKP A;  5E1X A;  2QZ8 A;  3O6B B;  4TV7 A;  4DJA A;  3RI4 A;  3CC4 I;  3F8F A;  1MBH A;  1AHD P;  1R6R A;  3IUO A;  3HHH A;  3S2W A;  4A0Z A;  4A3E J;  2G7U A;  2WV0 A;  2EIM H;  2UZK A;  4AC0 A;  1QVU A;  4HSR A;  2VB6 A;  5K7F A;  4L9T A;  4XQF A;  3RTR A;  2DN0 A;  1PUE E;  1MMA A;  2O03 A;  2PN6 A;  2KL4 A;  3GXO A;  2IA0 A;  2R7Q A;  3JRC A;  3F8B A;  1SD5 A;  2WY8 Q;  3T1B A;  3TP3 A;  1KU3 A;  4CDG A;  3C7J A;  3OYE A;  5GPC A;  4AM3 A;  2MC4 A;  4DW6 A;  4Q47 A;  4HV5 A;  1YS6 A;  1RUN A;  3ISP A;  1XB4 A;  3S2H J;  4V2G A;  3AL0 C;  2O8X A;  2WB1 N;  3V7R A;  1LFU P;  2HKX A;  2JSP A;  1Z7L A;  4IXA A;  5BMZ A;  2K3F A;  1F1Z A;  2HDW A;  3ABK H;  1JTY A;  3OOU A;  2E7X A;  1ETK A;  3UKG A;  2ADU A;  5CVU A;  3B6A A;  3GW2 A;  1FIP A;  3K4J A;  4UUS B;  2BVL A;  1WJC A;  1XGS A;  4WF2 A;  3OYF A;  2R92 J;  4BHC A;  2RQP A;  2H6B A;  2QF7 A;  3HSR A;  4XID A;  1FTZ A;  1E3H A;  2NS0 A;  5HLT A;  4DYC A;  3HG9 A;  3KEO A;  3NWT A;  2XGC A;  4ZC3 A;  3GO5 A;  4ITV A;  3FX3 A;  1ZEL A;  4HYE A;  2FJ1 A;  1T38 A;  1IN6 A;  4FET A;  4QTR A;  3H5R A;  3E1S A;  4BQQ A;  4AIK A;  3IH3 A;  4UNO A;  5GAG J;  3GZ6 A;  1DP3 A;  3I4N J;  1VQL I;  1YJW I;  2FA5 A;  3QYE A;  4UB8 C;  1QGP A;  4XM3 A;  1CQT A;  5J40 A;  1O3R A;  4C2T A;  5FFX A;  2R3S A;  4DZP A;  3T5X A;  3F8C A;  2R5Y B;  3DU6 A;  5KVR A;  2XB5 A;  1LFP A;  4BHB A;  3ABU A;  1ETX A;  2KRC A;  4NUB A;  3W2V A;  1X1B A;  2HVS A;  2TDX A;  4R79 A;  1SVO A;  3TBI A;  1IV8 A;  2A3S A;  3BZ6 A;  2BGC A;  1ZRE A;  2K40 A;  2ME6 A;  3BR6 A;  2R7T A;  2HTS A;  2HVQ A;  2LMD A;  4CCN A;  2WTE A;  1XMA A;  5E3O A;  3GTL J;  3IKV A;  3QYF A;  2VKD A;  3BTL A;  2VQL A;  2CU7 A;  2L02 A;  4BY1 J;  2JA8 J;  3CC7 I;  2M9H A;  3NRV A;  4BU2 A;  1Z3X A;  4L5E A;  4DYQ A;  5JVT A;  3VYT B;  1ZH5 A;  4IHX A;  2W00 A;  2QSF X;  4MTD A;  3JSP A;  1P9Q C;  2ID3 A;  2F4I A;  3OYD A;  1JTX A;  4UY8 I;  4E7L A;  2K5C A;  1J0R A;  3DCF A;  1MMD A;  2X6O A;  1D8J A;  2Q1Z B;  4RAF A;  2JMW A;  2UV1 A;  4Y33 A;  1OKR A;  2ZXJ A;  3ASO H;  4BAY A;  1QHH D;  5GAE J;  2Y0M A;  1H88 C;  4E7S A;  2KDO A;  2WAD A;  4B09 A;  2IS1 A;  3N05 A;  4A6E A;  2Z1D A;  3CCR I;  2XIG A;  2HTJ A;  1QZZ A;  3SFZ A;  3QAH A;  3FXR A;  5F0H A;  2LP0 A;  5EDN A;  1DGW Y;  1QHG A;  2KT0 A;  3BZC A;  3PIP F;  4CZC A;  5M3M J;  3FZV A;  1I27 A;  1W7P B;  3W2W A;  3GTM J;  3RDI A;  1T39 A;  3BWG A;  2JVH A;  1XDU A;  3K10 A;  3CF5 F;  2YS9 A;  1ZRF A;  3S2D J;  2OD5 A;  2VPR A;  4M3E A;  3BTJ A;  2O0Y A;  3IWF A;  1XTA A;  5DM7 F;  4UHT A;  2H8R A;  3HUG A;  1MBF A;  4EJW A;  2M2E A;  4I6Z A;  5DDG A;  1MKM A;  2NOG A;  5LGU A;  2VOD A;  5CQG A;  4PSX A;  4HV6 A;  2PEX A;  1G3T A;  4JX6 A;  2L9V A;  3JW4 A;  2CO5 A;  2HYG D;  2WAQ N;  4BQN A;  3K6G A;  3GFJ A;  2IGM A;  2MH9 A;  3GBG A;  2NVQ J;  1QU3 A;  3BCA A;  3OYK A;  5C4X J;  2LNB A;  4EJT A;  3BR1 A;  2E2I J;  1M1E B;  3ZQQ A;  1IJW C;  2R7X A;  1IN7 A;  1TQI A;  3P9I A;  2NS8 A;  4B8X A;  4C3J J;  2G7H A;  1YO5 C;  1FPQ A;  2EV6 A;  5ICG A;  3NEU A;  1B59 A;  1O3T A;  5F0F A;  3F8M A;  4II3 A;  4RB3 C;  2OTL I;  4BQA A;  1QZE A;  3DKX A;  1OCR H;  2CV2 A;  2VE9 A;  2LR8 A;  3DLA A;  3OOP A;  1PUF B;  4JQF A;  5CJ9 A;  3ZQC A;  3E6D A;  1YW8 A;  3HTS B;  3HOV J;  3LL7 A;  3M7G A;  1FMW A;  1R5H A;  2QWW A;  1Z7U A;  3C2G A;  1HKQ A;  3FHZ A;  1MDM B;  3OMY A;  2NRA C;  3I53 A;  2COM A;  1IW7 F;  3U2R A;  1MIJ A;  4Z6Y A;  2NVY J;  3FWE A;  3PNV A;  4EAT A;  3HM5 A;  2XKO A;  2UUZ A;  2HI3 A;  2UXX A;  4YIF A;  4MO7 A;  1XSD A;  2OJE D;  4BXX J;  5D6F A;  2E2J J;  3ZN0 A;  1SFO J;  1RIO H;  3WTW C;  2P81 A;  1O3Q A;  1A31 A;  2M4G A;  4BL0 B;  1JKP C;  4MGR A;  4NC7 A;  3E5U A;  2DTR A;  3HRS A;  4M9X A;  3J81 Z;  1XGM A;  1YFH A;  1WJ5 A;  2VE8 A;  4PZJ A;  3ZGK A;  2P5V A;  4KUM A;  5DUI A;  4U0Y A;  2JZY A;  1FP1 D;  4BUP A;  2XRL A;  1VQK I;  2QSG X;  4PGG A;  2BVM A;  1G3S A;  4Q48 A;  3VDX A;  4WXD A;  1SD7 A;  1HSJ A;  4JOM A;  1BI2 A;  3BR5 A;  1BOA A;  3BCB A;  3BQY A;  1WSU A;  3EUK L;  2LFB A;  1LB2 A;  4RM2 A;  4A3M J;  5IP6 A;  4KFC A;  2IGK A;  1AKH A;  1IN5 A;  4ZDL A;  1MSF C;  4N0B A;  5BS6 A;  4YG2 F;  5K5Q A;  5HNH A;  4IHY A;  2K9M A;  5BQT A;  2R7S A;  4FHT A;  1S7A A;  5ICE A;  3MMY B;  2QBY A;  3RSN A;  4RA2 A;  4Q4Z F;  2RRE A;  3T8T A;  2Z5U A;  3FXQ A;  5DCM A;  2HQR A;  3R61 A;  2DJN A;  2D45 A;  3PFI A;  3TW7 A;  1V4R A;  3CDI A;  1XCB A;  1YQA A;  1HW5 A;  1W36 D;  5D6E A;  2XPV A;  2VKE A;  2DU9 A;  1MZB A;  1JT0 A;  2IS2 A;  2HDD A;  1I3Q J;  2AQF A;  1B72 B;  2V7F A;  3S17 J;  3S1N J;  2E1O A;  2A61 A;  2P6T A;  3V7C A;  2Y2Z A;  3ZQH A;  3L9F A;  3CLQ A;  3MN2 A;  2D2W A;  4HEA 2;  1LNW A;  4M6V A;  5J6X A;  1MSE C;  3CD6 I;  3HZJ A;  4IVN A;  1VTN C;  1NHA A;  4O3M A;  5CLS A;  2FQ3 A;  2Y30 A;  1Z91 A;  3LWF A;  4C30 A;  1UAA A;  2IA1 A;  2MYS A;  1SC7 A;  1G2H A;  4XBF A;  3HKZ N;  1DU6 A;  2A05 A;  3CCL I;  4BE0 A;  4UV8 A;  1I3A A;  1JKR C;  1XSV A;  1SVM A;  1VQM I;  1WGX A;  1HBX G;  2ME0 A;  2M0M A;  2VBY A;  2R7F A;  1Y6I A;  3LSI A;  5E3L A;  3D0S A;  4K2E A;  2LSO A;  1IXC A;  1O3S A;  4RLF A;  2W7N A;  1HA8 A;  2Z2S B;  2JPB A;  3S3N A;  1C0W A;  2R7R A;  3QPL A;  1D1B A;  2P5K A;  2LY2 A;  5M5X J;  3O8G A;  5HLI A;  2I10 A;  3AFH A;  4HST A;  1X1C A;  2PI0 A;  4C2M J;  3J80 K;  3RCO A;  2Z3Y A;  1N25 A;  1XN7 A;  1Z6R A;  1Y39 A;  3OL4 A;  1E3O C;  1AWC A;  4DBQ A;  1MBJ A;  2EH3 A;  1MH3 A;  4KYW A;  2FBI A;  1G3W A;  1ZAR A;  4NQW A;  3ABM H;  2DQL A;  1FYL A;  5B1B H;  2XGX A;  3A1Y A;  1BBY A;  4FQG A;  4C2U A;  3C2B A;  2XAU A;  1DU0 A;  3S15 J;  1YRN A;  2EK5 A;  1X4P A;  4ENK A;  1ODD A;  4ZTJ A;  2K02 A;  2YX7 A;  2Y9Y A;  4I0B A;  1S72 I;  1QQI A;  3WHB A;  1HW1 A;  3OYG A;  2IAI A;  1D8K A;  3PNY A;  1JJ8 C;  2V1N A;  3OL3 A;  5EZH A;  4LB5 A;  1RI7 A;  2A6E F;  5HNF A;  2F5V A;  2ZME C;  4M71 A;  1D1C A;  1SD6 A;  2GIV A;  4EMS A;  3L2R A;  3WTU C;  2IA2 A;  2KRF A;  3DTE A;  2DAO A;  4XON A;  1RR8 C;  2XAG A;  3GTG J;  1P92 A;  3FMQ A;  4JX5 A;  1A6Q A;  3HYI A;  2XPU A;  4A3G J;  3A01 B;  2DFI A;  3R0A A;  1J5Y A;  1SMT A;  1B8I B;  4PCQ A;  3JAM Z;  3G3Z A;  3E6M A;  3KPH A;  1D0Y A;  3GZN B;  5ERI A;  2O6G E;  3H0D A;  1LJ9 A;  3QOP A;  4J19 A;  3TKY A;  3TW6 A;  4ENN A;  1T2K A;  3ZMT A;  1YJN I;  2MH2 A;  3LMM A;  1BC8 C;  1JKO C;  4AYB N;  2JA6 J;  3NAR A;  1HF0 A;  1T6S A;  3KIO A;  4ZTF A;  2A5W A;  3HBL A;  3E97 A;  2K7L A;  2BZT A;  4R1H A;  1FP2 A;  3I5U A;  3DEE A;  2GM4 A;  1D5V A;  4M3F A;  2B9S A;  4BXF A;  3WGG A;  1ZRC A;  2OA4 A;  3KLO A;  1ZTR A;  1TT5 B;  3K4C A;  4PSW A;  3DBL B;  1OPC A;  2DFF A;  1ERD A;  3VSL A;  4KIS A;  3CJR B;  2F5D A;  2OQG A;  3GZ5 A;  4L5J A;  3BOQ A;  4AD9 A;  1GT0 C;  2HOE A;  1EV7 A;  4RGR A;  1MMS A;  3TO6 A;  3A03 A;  4MHG A;  1SVL A;  3KEY A;  4XIC A;  4EGZ A;  3H92 A;  3SEQ A;  2RAE A;  3PQK A;  1K78 A;  4IQJ A;  2FNP A;  2DDA A;  3W6J B;  2DQR A;  3T8R A;  3MAJ A;  4EJV A;  1K61 A;  3IL2 A;  2DMP A;  1UG2 A;  2VBZ A;  2GXA A;  2WBM A;  2A68 F;  4BBR J;  1RZ4 A;  2ZFW A;  4I7H A;  2M3A A;  2Y75 A;  1ETV A;  1Z1D A;  3O8H A;  4YFX F;  5LHI A;  2OTJ I;  2R7V A;  3SJM A;  3VB2 A;  2E5Z A;  1ENH A;  1B1B A;  1TTY A;  2H8W A;  1V54 H;  1Y56 A;  3OV8 A;  1FC3 A;  3BG9 A;  4XKV A;  1E2X A;  2OAZ A;  2TCT A;  2VQC A;  5LEJ A;  2DDB A;  3DLL F;  2XAH A;  4E7Z A;  1PJR A;  1WJF A;  2M87 A;  2JT1 A;  1YW7 A;  3CZ6 A;  4U7B A;  2WY7 Q;  5DD8 A;  4NNJ A;  2R7W A;  1RRJ A;  3RPU D;  3IC7 A;  5B1A H;  1ITY A;  2O5R A;  1BJA A;  3ERM A;  2XSD C;  1R4M B;  3VYU B;  4F91 B;  5C3E J;  2D5V A;  4Y15 A;  3Q0W A;  4UXN A;  3BG7 A;  2Q0O A;  3CF2 A;  3KLN A;  2A5Y B;  4RGX A;  4B1R A;  5FGM A;  2VOO A;  3AG2 H;  4HBL A;  5CYV A;  3PUB A;  3KZI C;  3M8F A;  1Z05 A;  2QQ9 A;  1XGO A;  2HQ5 A;  1QZY A;  1X19 A;  1YX5 A;  2P6S A;  3Q0U A;  3HPH A;  2MG4 A;  3OS0 A;  2FBH A;  4BEH A;  3SXY A;  3WTX C;  1HKT A;  3BJA A;  3GFI A;  2ZXW H;  2QGU A;  2PMH A;  5CVV A;  1WCM J;  2KLO A;  1A36 A;  1OCT C;  2EB7 A;  3CDH A;  3GEZ A;  3G2B A;  5KAF C;  3CO6 C;  2QKM B;  1O7L A;  3NWS A;  3OYM A;  2O8K A;  3VEP A;  3JSO A;  4OIQ F;  5JHF A;  1UST A;  3CUQ A;  3IAS 2;  3LSG A;  3I64 A;  4G8X A;  5LHH A;  3W6V A;  4GO1 A;  1IDY A;  1SMY F;  1XCV A;  4F55 A;  4HDV A;  1U5T C;  4IRI A;  1XGN A;  2XVC A;  4IZZ A;  1O4X A;  2FEZ A;  4F93 B;  2R4G A;  4X0G A;  1WI3 A;  4PJM A;  1F36 A;  3V4G A;  2IXS A;  3B73 A;  2QUF A;  3FXL A;  2DK5 A;  5ED4 A;  3AKZ A;  1LDK B;  4B48 A;  5HLH A;  2HGC A;  3C1D A;  2ZNZ A;  1B9M A;  2AXT C;  2DT5 A;  3SHF A;  4B47 A;  2LBF A;  1VQ9 I;  4E7I A;  3HJE A;  4CIC A;  4G6Q A;  1OQY A;  1TWC J;  2VXD A;  1R7J A;  2TRT A;  3FF5 A;  4LFU A;  1S6L A;  2VT2 A;  4IOC F;  4EJO A;  5EEG A;  3LA7 A;  1JE8 A;  3K2Z A;  3O2P E;  2ACJ A;  2GA2 A;  3ZQ7 A;  5GTI C;  1R71 A;  1S7O A;  3D1N I;  3PSI A;  1SFK A;  2IP2 A;  3GTJ J;  3WU1 B;  2BY1 A;  1D0X A;  1FJL A;  3I59 A;  5FRO A;  4G9Y A;  5K7H A;  3C18 A;  1FWZ A;  1JKQ C;  3D5L A;  9ANT A;  1ULY A;  2R7Z J;  3FXJ A;  2CUE A;  1NG6 A;  3HXL A;  1ZKG A;  1NH3 A;  2HR3 A;  2DBB A;  2M0C A;  2OPT A;  2DJI A;  4NB5 A;  4C3I J;  2QCO A;  3AG3 H;  3COA C;  1RKW A;  4ZH4 F;  3S3O A;  1T0F C;  3F9K A;  4HOB A;  4R8H A;  2EFW A;  2IVM A;  1X2M A;  2JVG A;  4A3L J;  1JI8 A;  3LNQ A;  4HF0 A;  1YG2 A;  3BPV A;  4FX0 A;  1UEL B;  3TOA A;  1DP7 P;  1R23 A;  2Y69 H;  2KDZ A;  2VJI A;  2ISZ A;  1N77 A;  3OYL A;  1MBK A;  5J1R A;  5FB2 A;  2OU2 A;  1BI0 A;  3PQJ A;  4J00 A;  2D1H A;  1B9N A;  4RM3 A;  5EJC A;  5H2F C;  2Z16 A;  4M3B A;  4EJU A;  1HOM A;  2GZW A;  2JK3 A;  4FE4 A;  4XRS A;  1QO0 D;  2X0L A;  1MBE A;  1YE9 A;  2ZJR F;  1WZ2 A;  2K9N A;  4MTE A;  3K70 D;  4IHW A;  5DCF A;  1HLV A;  2V6E A;  5JLW A;  1P2F A;  3MKW B;  2FX0 A;  5IOZ A;  2LRD A;  5F1J A;  4XK4 A;  1ZG1 A;  4B44 A;  2HNH A;  1KU9 A;  4QWQ A;  1U8B A;  4KMF A;  2KHM A;  3JRB A;  3CME I;  4PJN A;  1ZG5 A;  5LGT A;  1ZHF A;  4MNU A;  5CPR B;  2V79 A;  3KYC B;  5LEK A;  3RPQ A;  5JFR A;  2EZI A;  2R93 J;  2R7U A;  3ZMZ A;  1I39 A;  2BY3 A;  2H27 A;  2KIQ A;  2O61 A;  1GHC A;  2M1B A;  5ILS A;  2PBI A;  1APL C;  5FLX K;  4F52 A;  2BYV E;  2STW A;  3HUG B;  3GLX A;  4B4C A;  3ZQI A;  3WTT C;  1QNT A;  5J47 A;  1L3L A;  1IF1 A;  2CUZ A;  1FBS A;  2DMU A;  2EPF A;  2JJ7 A;  4EQQ A;  1VQN I;  2ZME A;  1FIA A;  2NXN B;  2LOO A;  1BA5 A;  3JR9 A;  2B63 J;  2AXL A;  2L0K A;  3E0J B;  1TWA J;  1VQ5 I;  4BE1 A;  1UFM A;  5L3C A;  2VT3 A;  4A0Y A;  4BXU A;  1IUF A;  3ZN1 A;  2L01 A;  3I71 A;  2HPI A;  2DYS H;  4E7J A;  6PAX A;  2WB1 A;  2F4O B;  2WC2 A;  2X48 A;  2X9D A;  4D9J A;  3EDP A;  4CHU A;  1OLT A;  3L7W A;  3UNG C;  5FD5 A;  3IRQ A;  4ZZL A;  2VJJ A;  4L9J A;  2VC1 A;  3FBI B;  2FUG 2;  3VOD A;  3KE2 A;  3W3C A;  3RIR A;  4AWX B;  1PP7 U;  1V5F A;  2EFP A;  3J7A O;  1A5J A;  3K69 A;  3TQN A;  4P96 A;  3BR0 A;  5TJJ A;  3CCV I;  3SDB A;  3OS2 A;  4NBQ A;  2W48 A;  4RDU A;  3VYS B;  2Q2E A;  3OSF A;  1BC7 C;  3H5N A;  2ZNY A;  4M3G A;  1A04 A;  2QQB A;  2IRF G;  2BHZ A;  2OV7 A;  1W5C C;  1R5G A;  3SEZ A;  3TOB A;  1S5L C;  2CSO A;  4DZJ A;  1ZG3 A;  2RQQ A;  3BTI A;  3QPH A;  4KT6 A;  3G4S I;  1ZN2 A;  3K4B A;  4XSZ F;  3QPT A;  4OIR F;  2E1M C;  3LA2 A;  3GUD A;  1ETW A;  4AID A;  4PFP A;  1T33 A;  4A5N A;  2G9W A;  5J1Y A;  2E1N A;  4A3F J;  1SFX A;  2DFE A;  2CQK A;  2R7O A;  3JRG A;  2KFD A;  2L5Q A;  3BC8 A;  2GA1 A;  2IS6 A;  3OIP A;  3LSM A;  1MBG A;  5J8C A;  2JPC A;  5M5Y J;  3J7Z I;  3GYH X;  1T95 A;  1UJ8 A;  2RDP A;  4IF4 A;  1KQ8 A;  2OZ6 A;  2H09 A;  2LTP A;  1MND A;  3FMR A;  3LSP A;  3LAP A;  3H9Q A;  1BR2 A;  2BW3 A;  5D8K B;  3HOX J;  1AKH B;  2MW8 A;  1GVJ A;  2FSW A;  3K70 C;  2ETH A;  4RGS A;  4GFB A;  2QBY B;  1ZGW A;  2VJ4 A;  1D1A A;  2NVU B;  2M30 A;  3LST A;  5DCM B;  1EF4 A;  2BXZ A;  1HW2 A;  4U0V A;  3IH2 A;  3V8J A;  4KNY A;  2AQE A;  3H0G J;  1XD7 A;  3RKW A;  3KYL A;  4BHP A;  4PJ0 C;  5E79 C;  2IGO A;  2EV5 A;  3WE3 A;  2NNY A;  5IT9 Z;  1X1A A;  5LLQ A;  2DCE A;  4M9S A;  3ESW B;  4M6Y A;  4OU0 A;  3OIQ A;  4DYR A;  4HLY A;  2KIS A;  4E7K A;  4QLC U;  1JT6 A;  5JHU A;  4WK8 F;  4MFE A;  4JBA A;  5JR3 A;  1MJB A;  4WXH A;  3BJ6 A;  4B3A A;  4D7N A;  2PG4 A;  1YIJ I;  2L9R A;  3ZQG A;  1ZLK A;  2KJC A;  1FLI A;  4EV0 A;  3AL0 B;  2MLG A;  2DA4 A;  1VQP I;  2EZH A;  3HEF A;  1UHW A;  5L3E A;  1W0T A;  1DPU A;  5A2Q Z;  5E3M A;  4P1W A;  1U5T A;  5DS9 A;  2CW7 A;  3LSH A;  2PJP A;  2RV8 A;  1J75 A;  2ZJQ F;  3MZH A;  2CQX A;  2K4B A;  2CG4 A;  3H9J A;  2WAQ A;  3K4K A;  1IDZ A;  3PFY A;  2QSH X;  4P9F A;  3CCM I;  2HQN A;  2EFO A;  3GWZ A;  1JGG A;  5E3N A;  4WXC A;  3KP6 A;  4OIO F;  5F64 A;  3KP7 A;  4E4H A;  2E5N A;  2MGQ A;  1JGS A;  2MAB A;  4DNC A;  4FCY A;  4EM0 B;  1UHM A;  2DMQ A;  2JN6 A;  3QRF F;  1SFE A;  2PX9 A;  2BOL A;  5FRM A;  2QEN A;  4XLA A;  3DTI A;  3WE2 A;  1KYW A;  2DMN A;  4I02 A;  4NQW B;  2CRG A;  3HOY J;  3CUO A;  3VSK A;  2K9L A;  2OCE A;  3BY6 A;  4XNF A;  4A3D J;  4DGW B;  1Y8Q B;  5EZG A;  3S93 A;  3HIF A;  1GXQ A;  3H5A A;  5C4J J;  1SFU A;  4XOR A;  2E60 A;  3HOU J;  1YRN B;  2XAJ A;  3OIO A;  1J09 A;  2JUG A;  3K7A J;  4HQM A;  1R36 A;  2VBX A;  2AHQ A;  3BR3 A;  2V1X A;  3WOD F;  2QA4 I;  1DUX C;  3KFW X;  1FOK A;  1UMQ A;  4G94 A;  4XLC A;  1FTT A;  1POG A;  2DOD A;  2HZT A;  5K5R A;  4YEJ A;  4DOZ A;  1FOY A;  4A5M A;  3MEX A;  4MQ9 F;  5LFA A;  1U3E M;  2V4J C;  2EIN H;  4X6A J;  1EH6 A;  2E7W A;  2JUC A;  5B5E C;  1GDT A;  2ZXH A;  3KX2 A;  4Z2Y A;  2K4J A;  1S7E A;  2F5E A;  1ZK8 A;  2BXY A;  4KMU X;  3MFK A;  1R1T A;  2ELH A;  2L7F P;  3ULQ B;  2NVT J;  2P7V B;  3IRR A;  4IO9 F;  4PFO A;  1ORK A;  5CVJ A;  2V9P A;  2P4W A;  3P9K A;  2V26 A;  4PGH A;  3BR2 A;  2W1O A;  3RPU A;  4ZYH A;  3CO7 C;  1GLN A;  3HOS A;  2NYX A;  3QP5 A;  4U7D A;  2Q8K A;  3VOE A;  2ZKZ A;  2DOE A;  3ZOB A;  1OCC H;  2K9Q A;  2HOS A;  4G12 A;  2AO9 A;  2OBP A;  3F23 A;  3FBN B;  3HB9 A;  1BIA A;  2OC6 A;  2XAF A;  2BV6 A;  4BQO A;  2EWN A;  4O6J A;  3EPZ A;  3L2U A;  1TQP A;  2WA0 A;  1IGN A;  4ETS A;  2K3P A;  1JHH A;  2BY2 A;  2VIX A;  3EYI A;  4N9H A;  2CV1 A;  3A02 A;  3JTH A;  3FXK A;  1YS7 A;  4ZZD A;  1OYW A;  3OR1 C;  2DPD A;  4I09 A;  5DYM A;  2F6C A;  1W5T A;  3EUA A;  1YI2 I;  3WGI A;  3LFK A;  4BGD A;  4M74 A;  4UB6 C;  1VQ7 I;  5D5W B;  4N4O B;  1QBJ A;  1W0U A;  4KN4 X;  3DXJ F;  1K78 B;  1GXP A;  2IS4 A;  2VKV A;  2VC0 A;  5CVR A;  2VI6 A;  1HQC A;  4D0P A;  2DLL A;  2LG4 A;  2P8T A;  2L3D A;  5FRN A;  1E0E A;  2X1C A;  4B43 A;  1LVK A;  5IYC J;  4OIN F;  1R1U A;  4XLE A;  3F21 A;  4V19 K;  1I6H J;  5GPA A;  4Y4R A;  3JRE A;  2Y31 A;  1UG0 A;  4CYD A;  1H89 C;  5LHG A;  3H3Z A;  3OYB A;  2A6T A;  1LEA A;  1R49 A;  1RNL A;  1ETY A;  2CWE A;  3IV5 A;  2XF7 A;  3K4M A;  5E8G A;  1USS A;  4LG0 A;  2YUS A;  4XRM A;  2XDV A;  4IRG A;  2JQ7 A;  1YLF A;  2HKO A;  2LF8 A;  4XOP A;  5JVG F;  5F1R A;  1P4A A;  5BOX A;  2ZJP F;  4OMY A;  2JSC A;  2GQQ A;  2WV1 A;  4QPO A;  3MKZ A;  3GFL A;  3RZO J;  3ELK A;  4GCV A;  3R4K A;  3LSR A;  3PO2 J;  2GIZ A;  3I58 A;  4A2U A;  1FSE A;  2JA5 J;  3DEU A;  4ENJ A;  3ZQL A;  1Y0U A;  2HU9 A;  3GVA A;  5JI6 A;  4MLO A;  1QRY A;  5KNL A;  5KAI C;  4M3D A;  5DTD A;  4IRH A;  4CXF A;  1FT9 A;  1WJA A;  4U88 A;  2M7B A;  2HYF A;  5CVI A;  5B66 C;  1IRG A;  3ZMV A;  3QQA A;  4IX7 A;  1QPI A;  1WQ2 A;  3DTK A;  2DO7 A;  4KN7 X;  1Z21 A;  4BEH B;  2WAE A;  3J81 K;  2GOM A;  2LYC A;  2PMZ A;  1WH7 A;  5FKK A;  1U78 A;  1YOV B;  3TED A;  2YR2 A;  3Q9S A;  2HFH A;  2IJL A;  1GVD A;  3OYH A;  4QSH A;  4LK1 F;  4IEJ A;  4D1Q A;  1EJ9 A;  2KP6 A;  2ELK A;  4LIV A;  5FFZ A;  4CCJ A;  1TL8 A;  3DKY A;  3CUQ B;  3OY9 A;  3OSG A;  3ABT A;  1XX5 A;  3I55 I;  1N75 A;  2LF7 A;  2GAU A;  3HTU A;  2W84 A;  1K6O A;  2M45 A;  3ZMD A;  1Z77 A;  4WX9 A;  1EH7 A;  1TW2 A;  1LDJ A;  1GUU A;  4IL6 C;  4KDP A;  2M8E A;  4ZYA A;  3ZP5 A;  3KP2 A;  3W2A A;  1FZP B;  3CP2 A;  5ICF A;  3S32 A;  3DV8 A;  2LBF B;  3MKY B;  2EIJ H;  1WJD A;  1WPK A;  2ZO4 A;  4I76 A;  1A6I A;  1BIB A;  2A6H F;  3M9A A;  3F22 A;  5FO5 A;  1VI0 A;  2E19 A;  1MJ9 A;  3GTP J;  3MCZ A;  5J3L A;  3MZ8 A;  1X1P A;  5HS7 A;  3ZMU A;  3G6E I;  3IWZ A;  1UCR A;  5KK1 A;  2I8D A;  4CYC A;  3BG6 A;  3S16 J;  5K5O A;  1KON A;  3GTO J;  2HZD A;  4L5I A;  5GAH J;  1HKS A;  4AYB A;  3I59 B;  1T8I A;  4II2 A;  1TQM A;  2AS5 F;  1WFX A;  1BJZ A;  1ZR4 A;  1BI3 A;  1W7P D;  4BE2 A;  1JUS A;  1UB9 A;  3BZK A;  3P7N A;  3K9T A;  4WCG A;  1FSH A;  5HS9 A;  2DFH A;  2MA3 A;  2MFZ A;  1BM9 A;  5E17 F;  2LD5 A;  5H6Q A;  1U2W A;  4CUG A;  1WH5 A;  2ISY A;  1IAW A;  1XDS A;  5EGO A;  4HDU A;  5FLV A;  3J7A Y;  4OWR B;  2JRM A;  1Z9C A;  1Z6T A;  4LJZ F;  3LFU A;  3KP4 A;  4BY7 J;  4LK0 F;  4HRI A;  4AIJ A;  2UXN A;  3DPT A;  3EET A;  4NC6 A;  3L1P A;  2NNN A;  5IPA A;  4XKC A;  2KIF A;  2HVR A;  3ZPL A;  1TP4 A;  2E35 A;  1MNM C;  1OYI A;  3TGN A;  3TMO A;  2KMU A;  3TP0 A;  2JWT A;  3Q9V A;  4A69 C;  3E5Q A;  2QKL B;  3ZCO A;  5H6R A;  4LMY A;  2O3F A;  1G4D A;  2CMP A;  3SQN A;  2IGN A;  3HHG A;  2HS5 A;  2EIK H;  3WHC A;  5IT3 A;  3GLL A;  4F3Q A;  1NG7 A;  4HX4 A;  1IRZ A;  4YEL A;  3RYP A;  2FQ4 A;  4UVA A;  2DT7 B;  2V1D A;  2JRT A;  5K7Z A;  2LH9 A;  4XRF A;  3BP8 A;  3WU2 C;  3BG3 A;  1X3W B;  1P7I A;  3MD2 A;  2GXB A;  5L3B A;  5EYR A;  4CSW A;  2K86 A;  5BNG A;  4C3H J;  5HS8 A;  1BL0 A;  3FMS A;  2KIM A;  3PM1 A;  3CJN A;  4D7M A;  1FBU A;  2EA4 A;  1K83 J;  2DA7 A;  4JP0 A;  4CA0 A;  1IUY A;  1ON1 A;  3PJR A;  1KA8 A;  1T08 B;  1B4A A;  2CYY A;  3F8N A;  1LE8 A;  4F7Z A;  2H94 A;  5DD4 A;  5D5V B;  1E17 A;  5HDG A;  1FX7 A;  5C44 J;  2ZSI B;  3CJT B;  3HOW J;  4BNC A;  2ZME B;  3BG5 A;  3BDD A;  5AIP A;  3QP6 A;  3KZY A;  1VF9 A;  4P55 A;  5FKN A;  3JAM K;  3KET A;  1Z3Y A;  3DBH B;  2FOK A;  2EQR A;  1XMX A;  4QIW N;  2E1C A;  1MH4 A;  5B3S H;  2ZC2 A;  3KZZ A;  2R5Z B;  3LSJ A;  2XF5 A;  1RPW A;  4BKX A;  1HDP A;  1ZGJ A;  3F0C A;  1FBQ A;  2F5F A;  2FNA A;  3E5X A;  4D5C A;  1W1W E;  4XN0 A;  2ZBK A;  3JRI A;  1G8X A;  2FOW A;  4BYY A;  2PJR A;  3CES A;  5D5X B;  1R22 A;  1YYV A;  4EGY A;  2DI3 A;  1P4W A;  5L3F A;  2IT0 A;  2X6Y A;  2PFB A;  3TDZ C;  3A4C A;  3E6B A;  4A12 A;  1RC9 A;  2R0Q C;  5TGT A;  3QYB A;  3RYR A;  4JK1 X;  2MD0 A;  3CCS I;  2Q2E B;  4O5V A;  4GYI A;  2IBD A;  3VFZ A;  3E7L A;  1XMK A;  4I98 B;  1AU7 A;  3Q3S A;  1JHF A;  1IRF A;  3R60 A;  5IOY A;  1IV6 A;  3RKX A;  3D5S C;  3ML6 A;  1YJ9 I;  1RET A;  1K7A A;  3JRA A;  4LIT A;  5AIQ A;  5GP9 A;  5IP7 J;  3FKI J;  2F4M B;  2H1L A;  1MJA A;  4GDF A;  2WAF A;  4CZZ A;  3HGY A;  1PYV A;  3OWT A;  5FKO A;  4Y3O A;  3N4M A;  3W6K B;  3PIO F;  4L18 B;  1TZL A;  2XAQ A;  3E6C C;  1IN8 A;  3WG9 A;  3RKY A;  5IP9 J;  1U6G A;  1XS9 A;  3CMA I;  5DM6 F;  1W5S A;  4ASN A;  4XLP F;  2BHY A;  3CCJ I;  2Y0S A;  4UVB A;  2E36 A;  1H8A C;  5D8L B;  1I1S A;  4E6K G;  3FXM A;  2CW8 A;  1XSX A;  2KRH A;  4PK4 A;  3HC7 A;  2N8G A;  2BW3 B;  3TDU C;  4HX7 A;  4S05 A;  3ASN H;  3S1Q J;  1UHS A;  4X1E A;  1KQ9 A;  1Q1V A;  2XV4 S;  5ILV A;  2OUM A;  3QOE A;  3CTA A;  2YU3 A;  1Y8R B;  3HPG A;  3M1E A;  5FLM J;  4Q5S F;  4CCM A;  2VQH A;  4YIR X;  1GV2 A;  4NC8 A;  3M4O J;  4PUS A;  5LRR A;  2YX4 A;  4A3J J;  3GME A;  2JTV A;  4MIM A;  4IKF A;  2XHK A;  4PJJ A;  2FU4 A;  4UVC A;  4BH9 A;  2R5Z A;  3CQZ J;  4CO8 A;  2ZB9 A;  2L7Z A;  4RBO A;  1FMV A;  4H4K C;  2V9K A;  1FEX A;  3HSE A;  3H1C A;  3OYJ A;  1FYM A;  2MLK A;  2FBK A;  1ZR2 A;  1RR7 A;  4XR6 A;  4FE7 A;  2GWR A;  1DGR M;  1EKE A;  4FX4 A;  5KCM A;  5IY5 H;  5J4Y A;  2X51 A;  1MNE A;  4HF1 A;  3J7Y J;  1FY7 A;  4W1U A;  4C9Y A;  2LY9 A;  2QLZ A;  5DEQ A;  3BLY A;  3BJO A;  5FKL A;  3DPL C;  1I5Z A;  1LVA A;  4A0X A;  4RB1 A;  2Z99 A;  3G1M A;  1U5T B;  4KIT B;  2ECC A;  1KU7 A;  2VAS A;  4A93 J;  1KYZ A;  2HXI A;  3ROU A;  5HDN A;  3FIW A;  3V7S A;  1LEB A;  1Z0X A;  4LD5 A;  3L2C A;  3CJQ B;  2O7O A;  3L09 A;  2ELJ A;  1R4N B;  2DA1 A;  1EH8 A;  3S1R J;  2QYO A;  1Y1V J;  1Z67 A;  2CUF A;  4RAY A;  2OF7 A;  4A3K J;  4BAC A;  3P9C A;  3TO7 A;  1R1V A;  3R6S A;  3S8P A;  4HNT A;  3D5R C;  2RVC A;  2L9N A;  3DBR B;  3AAF A;  3A2K A;  1K6Y A;  2E71 A;  1TNS A;  1GV5 A;  2ICW G;  3HRT A;  2DOF A;  2NS7 A;  4KT5 C;  1LFB A;  4V2F A;  1YTY A;  4Y17 A;  1ZLJ A;  3EUH C;  3SZP A;  3NQO A;  2VPL A;  3K1M A;  1O7F A;  2BBY A;  3I4P A;  3BT9 A;  3QU3 A;  2HWV A;  2L7K A;  1P6R A;  5KHD A;  3OS1 A;  2H6C A;  3I4M J;  2VJ5 A;  1TW3 A;  1MW7 A;  1NTC A;  1SAU A;  4A6D A;  4IHV A;  3LA3 A;  4XL9 A;  1KU2 A;  3DEW A;  4HZF A;  1FOW A;  2ECB A;  3LOC A;  3Q5F A;  4CCO A;  1VQO I;  3UR3 C;  1I50 J;  4F92 B;  2LY1 A;  2HQA A;  3IP4 B;  2X6W A;  3CMY A;  4HNV A;  1RKT A;  3WU0 A;  4HLX A;  4H0E A;  4OMZ A;  2KQR A;  1G6N A;  5CKT A;  4HF2 A;  1VQ4 I;  1ZRD A;  1NK2 P;  1OFC X;  2IPQ X;  1N78 A;  2CFX A;  1WJB A;  2CW0 F;  3JRH A;  2E2H J;  4HNU A;  3V8L A;  4UUS A;  2OZU A;  3U1D A;  2CUJ A;  2JA2 A;  1SAN A;  5ILU A;  3L00 A;  2HEO A;  1X4O A;  2HDC A;  1X58 A;  5E20 A;  3R0J A;  4P5O A;  4EVI A;  4IJA A;  2VQG A;  3WTY C;  1P7J A;  1QA6 A;  4FIS A;  4GRI A;  4L9V A;  4Y7N J;  2DXI A;  4I2O A;  1T56 A;  5CQE A;  4YFK F;  1U9O A;  3OYA A;  3JRF A;  2VON A;  3S1M J;  4AU7 A;  2ZJ2 A;  3ZQF A;  1HDD C;  4XMY A;  3OYN A;  1OCZ H;  3QWL A;  1OIS A;  3LQR A;  1U0J A;  3F72 A;  2GBY A;  2XF6 A;  5E1Z B;  1BI1 A;  1BR1 A;  1TT0 A;  2M7A A;  3HRU A;  1YIT I;  3J80 Z;  3GX4 X;  3IKT A;  5FKM A;  4G6D A;  5LD2 C;  4CGZ A;  1DPR A;  1ZAO A;  2R5Y A;  4IOA F;  3QPS A;  3NAU A;  4GGG A;  1OCO H;  2L9S A;  5F04 A;  3V8K A;  2DK8 A;  2KKO A;  2DA5 A;  4KIB A;  3REO A;  2PQ8 A;  1L0O C;  2EJR A;  2FRH A;  1TNT A;  2MBF A;  1VQ6 I;  2ESN A;  3H36 A;  4RMN A;  1LPQ A;  1S8N A;  1HST A;  3H35 A;  4HAM A;  2R7D A;  3DWL E;  5D5U B;  3ZR8 X;  4M72 A;  2W24 A;  3M8J A;  2EV0 A;  1ZGA A;  4DQ2 A;  3JRD A;  1BR4 A;  4QPQ A;  3G1O A;  4BS9 A;  4OAY A;  1J9I A;  1P4X A;  3BTC A;  5L3D A;  5EG0 B;  3U9G A;  3LSK A;  3VYR B;  2XRN A;  3JTG A;  4J01 A;  2CJJ A;  1DQU A;  2M8G X;  3M1C A;  2FMY A;  2LKP A;  5EEH A;  1O57 A;  2VN2 A;  5F6F A;  2GLO A;  4RS8 A;  4OAZ A;  4ANJ A;  4S0H B;  1R5I D;  4RB2 C;  5FD6 A;  5JLX A;  1S3J A;  1IG7 A;  3CMM A;  4LLL A;  3ZMS A;  4G7H F;  4LG0 B;  5IYB J;  1F43 A;  3BRO A;  4BDZ A;  1CF7 B;  2EFN A;  1ZQ3 P;  4LLN A;  1R00 A;  1MMN A;  1T98 A;  3N97 A;  1T0F A;  1RUO A;  2V1U A;  2A69 F;  4Y13 A;  3L2Q A;  3VWB A;  2NOJ B;  4KIC A;  2BY0 A;  3PSF A;  4UUT A;  3CUQ C;  3B6C A;  3K1P A;  5FJ8 J;  4MQV A;  2VL8 A;  2KZV A;  1BN5 A;  5GTH C;  4A3I J;  2XUB A;  3A0B C;  4I99 C;  3CDL A;  3H3U A;  1OR7 C;  4IPA A;  3CCQ I;  4RLQ A;  1IXR C;  3MWM A;  4XKB A;  4BJT A;  3MVP A;  2ZSH B;  3FXO A;  5HDK A;  1W7P A;  3OR2 C;  1JUP A;  1WKM A;  2OQR A;  2DT6 A;  3U1K A;  5K1Y A;  3MQ0 A;  2LKS A;  1STZ A;  2EBI A;  1ZYR F;  1F5T A;  1ACI A;  1XG1 A;  2E1M B;  1V55 H;  2H1K A;  2MD5 A;  4KJZ A;  2XC7 A;  1IO2 A;  3CCY A;  4HQE A;  2QQA A;  5E1W A;  1TWF J;  4E70 A;  1WI9 A;  2EZK A;  1OJL A;  3F3X A;  4LB6 B;  2XGE A;  3SDG A;  1RES A;  2E34 A;  2DOA A;  2Y48 A;  3M3Y J;  2HOA A;  3ZXS A;  2LVS A;  5IYD J;  5L3G A;  3SZG A;  4N9I A;  4RB0 A;  3I56 I;  3ERE D;  5HLG A;  1AOY A;  1BW6 A;  5M5W J;  2XAS A;  2RN7 A;  5DUK A;  5LBQ A;  2X1E A;  5E8I A;  2XPW A;  3I9V 2;  1ETO A;  4IQ4 A;  3RJP A;  2J5P A;  2FML A;  3FK7 A; 
#chains in the Genus database with same CATH homology
 2L7M P;  5EGO A;  2NOG A;  5FLV A;  1HLV A;  5F27 A;  4ABZ A;  4XRS G;  5JLW A;  2FX0 A;  5IOZ A;  4JX6 A;  5F1J A;  4XK4 A;  1U8B A;  1Y1W J;  3JRB A;  4BY7 J;  2WAQ N;  4CYC B;  1PUF A;  4MFD A;  3GBG A;  3L1P A;  2NVQ J;  5IPA A;  5EG0 A;  5C4X J;  2EZI A;  1JUM A;  3BR1 A;  2E2I J;  2R93 J;  1MNM C;  1D5Y A;  1IJW C;  3TP0 A;  2JWT A;  1APL C;  2NS8 A;  4A69 C;  4C3J J;  5F0C A;  4B4C A;  3ZQI A;  3MKL A;  2O9L A;  5EGO B;  5F0F A;  3FK6 A;  2DMU A;  2CQQ A;  2JJ7 A;  2LK2 A;  3WHC A;  1FIA A;  1VFC A;  1BA5 A;  3JR9 A;  2HXO A;  4D5F A;  1R9T J;  2B63 J;  1IRZ A;  2FQ4 A;  2L0K A;  2LR8 A;  1PUF B;  1TWA J;  3ZQC A;  3HDD A;  3HOV J;  5K7Z A;  2PMZ N;  1IUF A;  3BG3 A;  1P7I A;  5EYR A;  5BNG A;  1BL0 A;  4C3H J;  3PM1 A;  2X48 A;  2X9D A;  4D7M A;  2MSY A;  1K83 J;  2NVY J;  2DA7 A;  2JA7 J;  1OCP A;  3HM5 A;  4JP0 A;  2HI3 A;  4MO7 A;  4AUX A;  1LE8 A;  4BXX J;  2E2J J;  2Y9Z A;  1SFO J;  4Y52 J;  2P81 A;  3RQI A;  1A5J A;  5C44 J;  1JKP C;  3HOW J;  3BR0 A;  3BG5 A;  3K2A A;  4LOC A;  1VF9 A;  5FKN A;  2W48 A;  4RDU A;  2G0E A;  3OSF A;  2EQR A;  4QIW N;  1MH4 A;  2R5Z B;  2XRL A;  4M3G A;  2DA3 A;  3LSJ A;  1B72 A;  1RPW A;  3G1L A;  4BKX A;  1HDP A;  3BR5 A;  3F0C A;  3BQY A;  2LFB A;  4D5C A;  4DZJ A;  2LKX A;  5IP6 A;  2LLK A;  4A3M J;  3RKQ A;  1AKH A;  3BTI A;  3VPR A;  4W97 A;  4EEF G;  1MSF C;  3JRI A;  4IHY A;  1LE8 B;  2HYJ A;  3S14 J;  1ETW A;  1T33 A;  5J1Y A;  2COB A;  2DMT A;  2R0Q C;  2DJN A;  4A3F J;  3TW7 A;  3JRG A;  2IBD A;  2XPV A;  2VKE A;  3E7L A;  1JT0 A;  1AU7 A;  3Q3S A;  1MBG A;  1X2N A;  2HDD A;  4A3B J;  5IOY A;  5M5Y J;  1I3Q J;  1B72 B;  1IV6 A;  3S17 J;  3S1N J;  2E1O A;  2Y2Z A;  2ID6 A;  1RET A;  2LTP A;  3ZQH A;  3LSP A;  3HOX J;  1AKH B;  3JRA A;  2MW8 A;  5GP9 A;  5IP7 J;  3MN2 A;  3FKI J;  3HGG A;  4M6V A;  1MSE C;  4FTH A;  3HGY A;  1XC5 A;  4GFB A;  5FKO A;  5J1U A;  1ZGW A;  2Y30 A;  2XB0 X;  2HOT A;  1WH5 A;  1G2H A;  1EF4 A;  3HKZ N;  3IH2 A;  1DU6 A;  5IP9 J;  3H0G J;  1JKR C;  1XS9 A;  2FD5 A;  1WGX A;  3IH4 A;  1H8A C;  2ME0 A;  5E3L A;  1TWH J;  4DYR A;  2N8G A;  3Q0V A;  5EF6 A;  3S1Q J;  1UHS A;  1JT6 A;  3QPL A;  4X1E A;  2YU9 J;  2DTZ A;  4NDL A;  1Q1V A;  4MFE A;  3BQZ A;  1NK3 P;  3H3V K;  4B3A A;  4D7N A;  5M5X J;  3O8G A;  2I10 A;  2L9R A;  3ZQG A;  5FLM J;  4C2M J;  4JX4 A;  2DA4 A;  2EZH A;  1GV2 A;  3M4O J;  3HEF A;  1E3O C;  1MBJ A;  2EH3 A;  1MH3 A;  2IEK A;  4A3J J;  1W0T A;  4MIM A;  5E3M A;  5DS9 A;  2R5Z A;  2DA2 A;  3A01 A;  3CQZ J;  1B8I A;  3C2B A;  3SFI A;  2ZB9 A;  2CQX A;  2L7Z A;  4RBO A;  1DU0 A;  1YRN A;  3S15 J;  1IDZ A;  1FEX A;  2Y9Y A;  2VUM J;  1ZR2 A;  1JGG A;  5E3N A;  1RR7 A;  3WHB A;  4FE7 A;  2XGD A;  2IAI A;  2MGQ A;  5F08 A;  1TWG J;  3FIS A;  1JJ8 C;  4FCY A;  2DMQ A;  5EZH A;  5M3F J;  2JN6 A;  4W1U A;  2LY9 A;  3RZD J;  5FKL A;  3GTQ J;  2DMN A;  1QVT A;  3G1M A;  3GTG J;  2CRG A;  3HOY J;  2ECC A;  4JX5 A;  4A3D J;  4JYK A;  1U9N A;  2XPU A;  4A93 J;  4A3G J;  2HXI A;  3A01 B;  5EZG A;  1B8I B;  3FIW A;  5C4J J;  1Z0X A;  3HOU J;  1YRN B;  1JJ6 C;  2NVX J;  1ETQ A;  2O7O A;  5HOD A;  2DA1 A;  3OIO A;  3HOZ J;  3S1R J;  3K7A J;  1Y1V J;  2CUF A;  4J19 A;  2AHQ A;  2OF7 A;  3BR3 A;  4A3K J;  3TW6 A;  1TC3 C;  2K9S A;  4BBS J;  1JKO C;  4IHW A;  4AYB N;  2JA6 J;  3NAR A;  1UMQ A;  1FTT A;  1POG A;  1HF0 A;  3GTK J;  3HBL A;  1GV5 A;  4V2F A;  2NS7 A;  1LFB A;  4X6A J;  1GDT A;  2GM4 A;  5EEA A;  4M3F A;  1S7E A;  1BW5 A;  1ZK8 A;  1ZTR A;  2L7F P;  3BT9 A;  2NVT J;  1ORK A;  2DA6 A;  3BR2 A;  3I4M J;  1GT0 C;  1NTC A;  4A3C J;  4IHV A;  3A03 A;  4XIC A;  3DEW A;  2M34 A;  2RAE A;  2Y0S N;  2ECB A;  3LOC A;  3ZOB A;  1HCR A;  2K9Q A;  2HOS A;  4G12 A;  2AO9 A;  1K61 A;  1I50 J;  2DMP A;  1UG2 A;  3HB9 A;  3CMY A;  1IC8 A;  4HNV A;  4BBR J;  1RKT A;  3PO3 J;  2EZL A;  1VND A;  1ETV A;  3O8H A;  3SJM A;  1ENH A;  1MBH A;  1IGN A;  1AHD P;  1NK2 P;  1OFC X;  4A3E J;  3BG9 A;  4AC0 A;  1QVU A;  3JRH A;  3A02 A;  5K7F A;  2TCT A;  2E2H J;  4UUS A;  2DN0 A;  1SAN A;  3JRC A;  1X58 A;  1W0U A;  1ITY A;  1P7J A;  3TP3 A;  4FIS A;  5GPC A;  2VKV A;  4Y7N J;  4DW6 A;  2XSD C;  1T56 A;  2VI6 A;  3JRF A;  1U9O A;  3S1M J;  5C3E J;  3ZQF A;  2D5V A;  3S2H J;  1HDD C;  4V2G A;  3Q0W A;  2WB1 N;  1LFU P;  5IYC J;  4B1R A;  2GBY A;  1I6H J;  5GPA A;  3JRE A;  2Y31 A;  1JTY A;  3OOU A;  1H89 C;  1ETK A;  5FKM A;  3UKG A;  2HQ5 A;  3B6A A;  1FIP A;  2R5Y A;  4UUS B;  3Q0U A;  1ETY A;  3QPS A;  3NAU A;  2R92 J;  3IV5 A;  5F04 A;  2MG4 A;  2QF7 A;  2DA5 A;  4XID A;  1FTZ A;  2YUS A;  4XRM A;  4DYC A;  1WCM J;  2XGC A;  1OCT C;  3RZO J;  2WV1 A;  2FJ1 A;  3LSR A;  2O8K A;  3PO2 J;  4QTR A;  3JRD A;  3LSG A;  2JA5 J;  3G1O A;  3IH3 A;  3W6V A;  3BTC A;  3ZQL A;  5EG0 B;  1IDY A;  4MLO A;  1QRY A;  3I4N J;  4M3D A;  5DTD A;  1CQT A;  2CJJ A;  2M8G X;  1O4X A;  4DZP A;  2R5Y B;  1WI3 A;  2XB5 A;  2GLO A;  1F36 A;  3QQA A;  4S0H B;  1QPI A;  1ETX A;  5JLX A;  1IG7 A;  5IYB J;  1F43 A;  1WH7 A;  5FKK A;  1U78 A;  3TED A;  1TWC J;  1ZQ3 P;  2K40 A;  2TRT A;  2ME6 A;  1GVD A;  3BR6 A;  4QSH A;  5E3O A;  4IEJ A;  3GTL J;  2ELK A;  4UUT A;  3BTL A;  3B6C A;  5FJ8 J;  3OSG A;  2CU7 A;  4A3I J;  4BY1 J;  2JA8 J;  2M9H A;  3CDL A;  3D1N I;  3GTJ J;  1FJL A;  4L5E A;  4DYQ A;  5K7H A;  3MVP A;  4IHX A;  1Z77 A;  1JKQ C;  1JUP A;  2ID3 A;  9ANT A;  2R7Z J;  1JTX A;  2CUE A;  1GUU A;  2EBI A;  3DCF A;  1ZKG A;  2X6O A;  2OPT A;  2M0C A;  1XG1 A;  4C3I J;  2JMW A;  2H1K A;  2QCO A;  1RKW A;  1WPK A;  3CCY A;  4I76 A;  1A6I A;  1H88 C;  1X2M A;  4A3L J;  1VI0 A;  2E19 A;  3GTP J;  1TWF J;  3LNQ A;  5J3L A;  2EZK A;  1OJL A;  3SDG A;  2XGE A;  1RES A;  4CYC A;  2KDZ A;  3S16 J;  3M3Y J;  2HOA A;  3GTO J;  5F0H A;  2LVS A;  2LP0 A;  1MBK A;  5EDN A;  5IYD J;  2KT0 A;  5J1R A;  1BW6 A;  5M3M J;  1BJZ A;  5M5W J;  3GTM J;  1ZR4 A;  1JUS A;  2YS9 A;  3S2D J;  4M3B A;  2XPW A;  2VPR A;  4M3E A;  1HOM A;  2JK3 A;  3BTJ A;  1ETO A;  4FE4 A;  4XRS A;  1MBE A;  2K9N A;  2H8R A;  2LD5 A;  1MBF A;  3FK7 A;  2M2E A;  4I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...