3GTPJ

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3gtpJ00
1ZGWA 2FD5A 3BR5A 3IH2A 3S1MJ 5K7HA 1UG2A 1TWCJ 2W48A 3RZDJ 2XPUA 3BR3A 3ZQGA 1CQTA 4NDLA 1U8BA 2WV1A 3H0GJ 5DS9A 3JRGA 1Z0XA 2MSYA 3BTJA 5F0HA 1JT0A 4MIMA 2P81A 5J3LA 5E3NA 2DA3A 1ZQ3P 4GFBA 1MH3A 1JTXA 2CUEA 4B3AA 2R5YA 1BA5A 3IV5A 4FE4A 2XPVA 2LR8A 1FTTA 4IHYA 4IHVA 3G1MA 2HOSA 3Q0WA 1IDYA 2XRLA 2YS9A 2DN0A 3PM1A 1PUFB 2M9HA 4M6VA 1Z77A 4IHXA 2M0CA 2E19A 1T56A 1K83J 3WHCA 5BNGA 4A69C 2NS8A 3BG3A 4XRSA 3NARA 2R0QC 2R5ZB 4A3BJ 1VFCA 4FTHA 4S0HB 2ID6A 3IH3A 2DA7A 1E3OC 3MKLA 2VI6A 1ORKA 2Y2ZA 3HOXJ 5M5WJ 3HOUJ 2N8GA 4W1UA 2MGQA 2DA1A 1IV6A 4BY7J 2NS7A 1JGGA 2O8KA 4UUSA 1MBJA 3LSGA 3Q0VA 3S14J 3OIOA 4MO7A 3S2DJ 5C4JJ 4Y52J 5J1RA 4W97A 5IOZA 2ME6A 5IP9J 4A3LJ 4XRMA 4D7NA 2YUSA 2AHQA 5EGOA 2CQXA 4CYCB 2LVSA 3GTPJ 5F27A 4BBRJ 5M5YJ 2I10A 2HOTA 3LSJA 4QTRA 4X6AJ 3BG5A 2Y9YA 3HB9A 2XPWA 4M3DA 1AKHB 4IHWA 1OJLA 3TW6A 1SANA 2NVYJ 2Y31A 4JX5A 1IDZA 2ECBA 4I76A 2D5VA 3OSFA 2GBYA 1MBKA 1R9TJ 1AHDP 2NVTJ 3O8GA 3HEFA 5EG0A 1F43A 1TWAJ 2DA5A 2JA8J 1ZK8A 3PO2J 3DCFA 5K7FA 2LY9A 4A3JJ 1IGNA 1UHSA 3TEDA 1JT6A 4BBSJ 4IEJA 3W6VA 1JUPA 2WB1N 3I4NJ 4RBOA 4A3IJ 3TW7A 3JRIA 2EBIA 1BJZA 3E7LA 1Q1VA 2GLOA 5IYCJ 3S2HJ 1JKRC 3HGYA 2XGDA 4DW6A 2ECCA 1JUSA 2GM4A 1TWHJ 3S17J 1O4XA 1OCTC 2COBA 4M3EA 3CDLA 1LE8A 4JX6A 3GTKJ 2FQ4A 2XGCA 3BR0A 5E3LA 1BL0A 4A3CJ 2LD5A 1BW5A 2IEKA 2R7ZJ 3G1OA 5EYRA 3BR1A 3BR6A 3FISA 1H88C 1X2MA 2L7FP 2M34A 2EZHA 1HF0A 4QSHA 2CQQA 3JR9A 2LFBA 2NVXJ 1JJ8C 3JRBA 3OSGA 4MLOA 3ZQLA 2G0EA 4A3GJ 2K9SA 5F0FA 2TCTA 1GV5A 2JA5J 1RKTA 1OCPA 3A02A 4X1EA 5EZHA 4QIWN 1B8IB 2AO9A 1LFBA 5C44J 1QVUA 3JRDA 1FEXA 3DEWA 2EH3A 3LNQA 2CU7A 3B6AA 3ZOBA 1MNMC 5IYBJ 1RPWA 1Y1VJ 2YU9J 3TP3A 1ITYA 4DYQA 1DU0A 1MH4A 4M3FA 3S16J 1MBEA 1ETQA 3FIWA 5J1UA 1GDTA 2JK3A 2XSDC 1GT0C 1ETWA 5FJ8J 1GV2A 4UUSB 2H1KA 1HOMA 3GBGA 3L1PA 5E3OA 1ETOA 1HDDC 1W0TA 1VI0A 3QPSA 3F0CA 2O7OA 1EF4A 4JX4A 3FKIJ 2Y9ZA 2MW8A 4C3IJ 5EGOB 4BXXJ 1APLC 1IC8A 1YRNA 3HDDA 2X6OA 1WH5A 2EZLA 1HDPA 5C3EJ 3K2AA 3C2BA 2QF7A 2E1OA 4UUTA 9ANTA 1X2NA 2LK2A 2HXIA 1TC3C 1LFUP 2HDDA 3HGGA 5FKNA 3NAUA 4DYRA 2PMZN 3ZQIA 4FE7A 2JN6A 1BW6A 4M3GA 3HOVJ 1U78A 2HI3A 3S15J 4MFDA 3S1QJ 2DA2A 4BKXA 1JKPC 2RAEA 5EG0B 3B6CA 5FKMA 2ELKA 3WHBA 1RR7A 2FX0A 1IRZA 3FK6A 2DMUA 5FKLA 3H3VK 5EEAA 4I6ZA 1MSFC 2WAQN 3CQZJ 2ID3A 1AKHA 1ZR4A 1ETXA 2JJ7A 3A01B 5IP6A 4RDUA 3HOZJ 4V2GA 1ZKGA 1QRYA 3ZQFA 1H8AC 3GTMJ 5GPCA 2QCOA 3GTOJ 3ZQHA 1WPKA 1B72A 1JTYA 3BR2A 5DTDA 3MVPA 1XS9A 1QVTA 4C3HJ 4BY1J 2IAIA 4AC0A 4A3EJ 1GVDA 1IJWC 2LTPA 2MG4A 2OPTA 4A3KJ 1XC5A 2LLKA 1IG7A 2LKXA 4LOCA 2CJJA 2O9LA 2LP0A 1G2HA 4C3JJ 4B4CA 2L9RA 2EZIA 4V2FA 4JYKA 4C2MJ 4Y7NJ 3ZQCA 3HOWJ 2ME0A 5M3FJ 1DU6A 4XICA 4J19A 5F04A 5FKKA 3FK7A 5K7ZA 1GUUA 2KT0A 5J1YA 2VKVA 3LSRA 3TP0A 4B1RA 4XRSG 2TRTA 2K9NA 2R5YB 3Q3SA 3BG9A 2R93J 3LSPA 1MBGA 4DZPA 2E2IJ 3K7AJ 1IUFA 1ZR2A 2K9QA 4A3FJ 1RESA 2IBDA 1MBHA 5F0CA 1SFOJ 3S1NJ 2VUMJ 3S1RJ 3JREA 2XB5A 5FLMJ 5GP9A 4A3MJ 2EQRA 3SDGA 3M4OJ 1H89C 2VKEA 3RKQA 2HYJA 3JRAA 1ZTRA 1FIAA 3GTQJ 3RZOJ 2DJNA 3BTLA 1ETVA 5M5XJ 2H8RA 1T33A 1TWGJ 4M3BA 1RETA 4AUXA 3JRFA 1PUFA 5IP7J 5FKOA 4ABZA 1U9OA 3LOCA 3CMYA 3HKZN 1U9NA 1B8IA 2L7MP 1A6IA 2R92J 1RKWA 4JP0A 2DMQA 2E2HJ 1UMQA 1QPIA 2R5ZA 2DA4A 5HODA 2M2EA 5IYDJ 3BQZA 5JLXA 4FCYA 1JUMA 2E2JJ 2XGEA 5C4XJ 4A3DJ 1ETYA 1WH7A 2L7ZA 5F08A 3UKGA 1YRNB 3IH4A 1I6HJ 4MFEA 4DZJA 3O8HA 1FIPA 1I3QJ 1OFCX 3JRHA 4HNVA 2DMPA 3HOYJ 2ZB9A 2XB0X 1JKQC 5FLVA 1D5YA 2EZKA 4EEFG 3RQIA 3MN2A 3SJMA 2DMTA 3GTLJ 5EDNA 1HLVA 2HQ5A 3CCYA 1JKOC 2JA7J 5EZGA 5IPAA 4CYCA 1F36A 2JWTA 2DMNA 1WGXA 3Q0UA 3BT9A 2DA6A 4XK4A 3VPRA 3SFIA 1ENHA 1VNDA 3I4MJ 2NVQJ 4XIDA 2OF7A 4DYCA 1MBFA 1JJ6C 1NK2P 2Y0SN 2Y30A 4G12A 1TWFJ 1S7EA 1ETKA 2NOGA 2X48A 4L5EA 2KDZA 1AU7A 3G1LA 1MSEC 2VPRA 4D5CA 4D7MA 3HBLA 2JMWA 1B72B 3GTGJ 2M8GX 5EF6A 3GTJJ 3HM5A 1FJLA 5JLWA 3A01A 1NTCA 1WI3A 2L0KA 2JA6J 2B63J 3QPLA 1FTZA 3PO3J 1XG1A 2HXOA 2X9DA 2CUFA 1A5JA 3D1NI 2DTZA 1LE8B 1POGA 2HOAA 1P7JA 3BTIA 3BTCA 3OOUA 1W0UA 4A93J 1K61A 1HCRA 1VF9A 5GPAA 1I50J 5IOYA 4D5FA 3M3YJ 3A03A 1Y1WJ 1X58A 5E3MA 2FJ1A 1WCMJ 5M3MJ 4AYBN 2K40A 3BQYA 1P7IA 5F1JA 3JRCA 1NK3P 2CRGA 3QQAA 4FISA
chains in the Genus database with same CATH superfamily
1W4MA 2EWNA 3OL4A 4CH7A 1KU2A 4FETA 2ZC2A 1IV8A 1IXSB 4OOIA 4Z6YA 2IS6A 2VONA 5LRSA 1YJ9I 2IA1A 1R71A 3KYDB 1IN8A 2VASA 5KCMA 3F72A 4E7ZA 1S72I 2CV2A 2VKHA 3I3LA 4BJ6C 1I5ZA 5DUIA 4GYGA 3B02A 5E8GA 3ZMTA 3TO7A 2KRFA 2DA3A 2HFHA 2DFHA 4B3AA 2AXTC 3CC4I 4FE4A 3SYTA 2Z3YA 3GMEA 4UHTA 3K70C 3X2QH 4U7DA 1QBJA 3MZ8A 4EGYA 2QQAA 1FLIA 1IDYA 2DN0A 3PM1A 4R8HA 5CJ9A 2PJRB 1J7KA 4M6VA 1Z77A 3DU6A 4E7JA 2M0CA 5BPIA 3J7AY 1RUOA 3F8FA 1FZPB 4E7SA 5BNGA 4ZTJA 1T8IA 1REPC 2NS8A 3IHUA 2ELHA 4XRSA 3NARA 3FBIB 2R5ZB 4A3BJ 3V7SA 1LEAA 3H3UA 1ZELA 3I54A 2ISYA 3QODA 1IXCA 3MKLA 1Y8QB 5FFXA 2QQ9A 1TQMA 2L02A 2Y2ZA 2N8GA 1MNDA 4BY7J 2VL8A 3S14J 1MBJA 4MO7A 2OUMA 3PL8A 2L3DA 4I02A 3IRRA 2X6WA 1H9TA 2VN2A 1ZG3A 1YJWI 4D7NA 4EMSA 2AHQA 3DXJF 1UHWA 2ISZA 2XRNA 4I0AA 2LH9A 1VQ9I 4U0WA 4RGUA 4BBRJ 3NWSA 5M5YJ 4MTDA 3PSFA 5LGNA 5TRDA 1IRXA 2E71A 2YX4A 4CZZA 4YFKF 3HB9A 2Y9YA 2XPWA 4FX4A 4M3DA 3CCMI 4E7HA 5A2QK 4IHWA 4F93B 1VQ4I 4CUGA 3W2VA 5HLHA 1ZREA 1BR1A 1P6RA 1YITI 4IHTA 2Z2SB 5F6FA 2STTA 1YHQI 3MZHA 2R7WA 1WJCA 2CFXA 1R9TJ 1AHDP 2NVTJ 3HEFA 2M1BA 3HRSA 1TWAJ 5EG0A 2CFOA 2DA5A 2JSPA 2P6TA 3K4LA 2VE8A 2K3FA 1O7FA 4OAZA 4HV6A 5L3DA 2PMZA 4A3JJ 1IGNA 1Z6TA 5DUKA 4YIRX 3AL0B 5HDKA 3I55I 4BBSJ 3DFGA 2BVMA 4Q47A 1PJRA 3I4NJ 1X1BA 2EB7A 2BW3B 3E0JB 1DDNA 1KONA 3EUHA 2E5ZA 1MW7A 3I9V2 2FE3A 1KU7A 5EEHA 3MFKA 1Q1HA 3HSEA 2K27A 2GLOA 5IYCJ 1Z21A 1QZZA 3HGYA 2EIKH 3G3ZA 1XMAA 3RKXA 1SEUA 4XM3A 4DOZA 3TOAA 2VQHA 2GM4A 4NQWA 3S17J 4LFUA 3R6SA 3GTKJ 2XGCA 3LFKA 3BR0A 4A3CJ 2Y0MA 1XSXA 4BHBA 3TL4X 3FXOA 3SXYA 4F52A 4GGGA 4L9TA 3OMYA 5EYRA 4XORA 3BR6A 4P55A 5ICEA 4H4KC 4A2UA 1VQ5I 1X2MA 3E5UA 3I53A 2EZHA 1FWZA 2IGNA 3K70D 3E3VA 1BC8C 2LFBA 1FP2A 4L0ZB 4V19K 1FC3A 5AONA 1A6QA 4HEA2 4MLOA 1NG6A 2G0EA 2CWEA 1OMIA 5D6FA 5J40A 5KNLA 1BI3A 2K9SA 3KP3A 3S32A 2CSOA 2MD5A 4X1EA 5CVRA 3J7YJ 3DPUA 1TLHB 1Z3XA 4IXAA 2FXAA 4Y3OA 1V4RA 5C44J 3JRDA 3CO6C 2TDXA 3ELKA 4ZDOA 4YFNF 2ZSIB 2E1MB 2IGMA 4KIFA 1TNTA 5IYBJ 1RPWA 2YU9J 3ECHA 3TP3A 4DYQA 1DU0A 4O6JA 1MH4A 4U0VA 3OWTA 2VOOA 3FIWA 2JK3A 2XSDC 4RAGA 3SEZA 4F3QA 4XOTA 2K7LA 3K4MA 3TGNA 3L2QA 2W7NA 1HKSA 2IPQX 2NYXA 1WHUA 2BGCA 3IC7A 2ADUA 1D0XA 5E3OA 2DO7A 1HDDC 3QPSA 1EF4A 3F0CA 1LUJB 4JX4A 1G8XA 3FKIJ 3EQLF 4BJ5C 3SHFA 4C3IJ 4AVPA 1XPXA 4BXXJ 3PNYA 1V5GA 1YRNA 3HDDA 1RIOH 1WH5A 2DCEA 4IZZA 5JVGF 2PN6A 3K2AA 4UVCA 3C2BA 9ANTA 1SMTA 1TTYA 2LK2A 3KFWX 3M8FA 1FNNA 4RB3C 1LFUP 3HC7A 3CCUI 4XLFA 4CICA 3IKTA 5E1ZB 3ABUA 1W7PA 2HQAA 4D1QA 3HOVJ 1OYYA 3QWLA 4CYDA 2FF4A 3ZR8X 3S15J 4BAYA 3F8BA 2RAEA 4CXFA 1R6RA 5HLTA 2A05A 5EG0B 2E7WA 2W00A 1OYWA 1XMKA 3B6CA 3P9KA 2ELKA 5FKMA 1JHFA 1RR7A 5GAGJ 2FX0A 2GIZA 5FKLA 2NRAC 3VDXA 3H3VK 5EEAA 1XGMA 5D4SA 4BQOA 5L3FA 4XLEA 2JJ7A 2KKOA 1HSTA 4G8XA 4EJVA 5HNHA 1E3HA 1V54H 3I59A 4BGDA 1D1BA 3HOZJ 3FMSA 1FX7A 4LB5A 3WTZA 2M0MA 1P4XA 1YFHA 4IHSA 2E35A 3I64A 4IPAA 2QCOA 1R49A 3GTOJ 3W3CA 3CMEI 1ZLKA 4IKFA 1R1UA 1JTYA 3UR3C 1K6YA 4MQVA 2XAUA 2L9NA 2NAZA 3OOPA 4XLNF 2YSRA 1QVTA 3VYUB 2Z33A 1G59A 4A3EJ 1GVDA 1NHAA 3OL3A 4NQWB 2IS2A 4B44A 1CF7A 2E34A 4PSXA 2KJCA 3DV8A 3LAPA 2D1HA 4XR6A 3ECOA 3GLXA 1QGPA 4IF4A 4FT8A 2O9LA 2FBIA 2LP0A 4ZC3A 2F48A 1QA6A 2QQ8A 3DQVC 2R7SA 1N25A 1K4SA 2A5WA 4JYKA 3ZQCA 1W5TA 3L09A 2ME0A 3WODF 1ZRFA 4HYEA 2RREA 1PVEA 5L3CA 1GUUA 4UV9A 3FWEA 3GLLA 2YPRA 3QPTA 3HSRA 4B1RA 4XRSG 3VFZA 4XLAA 4P9UA 3OYIA 1BJAA 4DBRA 1ZN2A 1OKRA 1E17A 3ZMVA 3SZGA 4X0GA 2EV5A 3GXOA 1MBGA 3D5SC 5GAHJ 5BPDA 3VYSB 3CC2I 1FT9A 4BEHA 2F5EA 4BYYA 1ZR2A 4A3FJ 1RESA 1E2XA 1MBHA 5F0CA 3S1NJ 2OQGA 4C2TA 2ZNYA 1FY7A 4E7IA 3S1RJ 2R7UA 1LKXA 5FLMJ 2K85A 2VXZA 3RYRA 3SQNA 2V9VA 1VZ0A 3GYHX 5HNFA 3OYHA 3MZYA 1H89C 2Y69H 2VKEA 4F55A 1EV7A 4NC6A 1B9NA 1ON2A 2CW0F 2KIMA 2KRCA 1ETVA 1FBUA 5M5XJ 1YTYA 2DOEA 3KLNA 1PUFA 4AU7A 1DP7P 3KE2A 4Y13A 3TOBA 4M6YA 4ABZA 2VC0A 2ZJPF 4HX4A 1UMQA 4ZYAA 1B1BA 2GXGA 1K79A 2R7OA 2M2EA 2ZXHA 4ZJZA 5HODA 2M45A 2JTVA 3BQZA 5JLXA 4FCYA 2E2JJ 2XGEA 1E0EA 4A3DJ 3NRVA 2VQGA 3UKGA 2O5RA 3IH4A 1YRNB 1WJBA 1WVRA 4LG3A 5J4VA 3O8HA 2COMA 3JRHA 3WE3A 2VBWA 4HNVA 2LOOA 1T08B 3CP8A 1Z6RA 4G6TB 1S6LA 2HKOA 5HLIA 4A12A 1FOKA 2JPBA 1ZRCA 3HOTA 1JKQC 5FLVA 1WJDA 3I0TA 1IN4A 3HUGB 2E36A 2JVGA 4I2OA 1S9HA 1F1ZA 3MN2A 5ED4A 3CCRI 3SJMA 1HXDA 2L4MA 1W7PB 3EYYA 3H5RA 4DGWB 3CCYA 2KIQA 1MMNA 1RR8C 1F36A 2X1DA 3N4MA 4HDVA 4L18B 2CUJA 3DTKA 5HS7A 3GX4X 4P9FA 4A0YA 2K9MA 5E20A 2G7HA 5D5XB 2NOJB 1Z7UA 2WY7Q 4IQJA 3E1SA 3CESA 3SFIA 2DYSH 5J6XA 3RQ4A 2H1LA 3BOQA 4ON0A 2IA0A 3HRMA 1TT5B 4HF1A 5E1WA 1A36A 3I59B 5B1AH 1KYZA 4ZH4F 4KNYA 3ABMH 1ETKA 2GXBA 1I6XA 2NS0A 4WXCA 3HRUA 1S5LC 4LLGF 1AWCA 1AU7A 2W4SA 3WU2C 3R0AA 2VPRA 4IJAA 4XONA 3P9CA 3TDUC 1VTNC 3ZPLA 5JHFA 2KIUA 3H1CA 1OCCH 1LDDA 3GUDA 3GTJJ 2OCCH 3TO9A 5KAIC 5D5UB 2CUZA 3LFUA 1FMWA 1X1DA 3BCAA 3HPHA 3J81Z 1FTZA 2BY2A 4PGGA 4LLNA 2V1UA 1D0ZA 2KZVA 4E7KA 3DLAA 1D1AA 3DKWA 2KMUA 3BTCA 3TO6A 5GADJ 1D0YA 4IOAF 1HKQA 2IS4A 3WTSC 4UB6C 1HCRA 5GPAA 4EJOA 1C0WA 1BI2A 4HBLA 3GZ6A 3RPQA 2DFEA 5HLGA 3F22A 1X58A 1IZ1A 4B8XA 1BBYA 3OYGA 3MD2A 3K1NA 4AYBN 1P7IA 1X4PA 4G94A 3JRCA 3OYDA 1NK3P 3IP4B 4WX9A 4DJAA 2EFWA 3JSOA 4FISA 2FQ3A 5FD6A 5BMZA 1ZGWA 2R3SA 3OS0A 2EFPA 2QSHX 1VQLI 1DQUA 2HQRA 2KFDA 2ZMEC 4EM1A 2DT7B 3BY6A 1TWCJ 3RZDJ 2Q2EA 2FOWA 1SD4A 3ZQGA 1UHMA 1CQTA 1TW3A 3Q9SA 3OR2C 4BEHB 1T95A 4HSRA 3JRGA 2MSYA 1S8NA 2F2EA 2M8EA 1J2XA 5B5EC 4FQGA 5F0HA 4ENKA 3GFLA 2LDUA 3PFIA 4YIFA 1MH3A 2DFIA 2W57A 4XKWA 3CUQC 4YEJA 1Z3YA 1BI0A 3FDYA 4ZDLA 2ZO4A 2HVRA 4HQEA 3DKYA 3RDIA 3Q0WA 2XRLA 3S93A 1PUFB 3BZ6A 4BXFA 4II2A 4XBFA 1T56A 1K83J 3EETA 3PUFA 2QGUA 5H20A 3WHCA 3L2UA 2F5VA 3ERED 1LEBA 4B43A 1T38A 1PDNC 5IT9Z 2ID6A 2JT1A 5LEJA 3ML6A 2PLYA 4PFOA 1WI9A 2YU3A 4U87A 2BXYA 3HOXJ 3HOUJ 3KX2A 3JTHA 4W1UA 2MGQA 1X3ZB 5F1RA 2W1OA 1IV6A 2GIVA 1JGGA 1FSEA 3EUKL 2DTRA 4UUSA 3LSGA 1D1CA 3PJRA 1TQIA 2LF8A 1ZAOA 3GVAA 1FYLA 3S2DJ 4PZJA 2KISA 3K4BA 5IOZA 3ZQ7A 2IVMA 3IWFA 2MC4A 5EGOA 2CQXA 2OTLI 3LSMA 4NNJA 2X1CA 2HOTA 4C30A 1GVJA 2A3SA 2VT2A 2D1VA 2MLKA 2LRDA 4A5NA 3WTVC 3E6DA 5KAFC 2W84A 3QU3A 4AWXB 3KP4A 1MMGA 2WAEA 2XAHA 5D8LB 1SANA 3KP5A 2A6HF 3CF2A 1XDSA 1IDZA 2F5DA 3V8LA 1KA8A 4ZDPA 2ZCWA 2D5VA 5CQGA 2L9VA 3V7CA 1MBKA 1J09A 5DD4A 1F43A 5FFZA 5FGMA 4HV5A 3HIFA 5FLXZ 2CQKA 4XLPF 2Q1ZB 3ZMDA 3AG3H 4PJMA 5ILVA 2OJED 5K7FA 1UHSA 3FHZA 5CLSA 2NVUB 4IEJA 3FXQA 4ENMA 3K4CA 3S2WA 4YRVA 4RBOA 1OLTA 3IKVA 3DBLB 4E6KG 1EJ9A 1U5TC 2EBIA 5DEQA 3L9FA 5ERIA 1BJZA 3ZRGA 4A6EA 3C7JA 3GFJA 2IGOA 1JKRC 3CCVI 2VB6A 3HXLA 2EFNA 2XGDA 5DCMA 1O3RA 1R36A 4DW6A 3QPHA 4BE2A 2A68F 2ZJ2A 3DTEA 3LSKA 1UZCA 5GTHC 1HKTA 1O4XA 4I0BA 3TBIA 4M3EA 2H6BA 1TZLA 1Y39A 3DWLE 1LE8A 1FBQA 4JX6A 3RKYA 3PQJA 3U2RA 5CQEA 2B0LA 3W2WA 4YFXF 2Q2EB 5E17F 1OCRH 2XF7A 2RGVA 3H9QA 1FMVA 2P8TA 1QO0D 2EV6A 3ZP5A 2RNJA 2CMPA 3DP7A 1LFPA 1W1WE 2HZDA 2XHKA 4PJ0C 3ZGKA 3DEEA 2ZXIA 5GTIC 2NVXJ 1XCBA 2UV1A 3JRBA 3OSGA 3I56I 2QBYA 2ACJA 4IX7A 2WC2A 3E5XA 3KLOA 2FNPA 1R23A 2TCTA 1L0OC 4HOBA 1GV5A 5F0FA 1MZBA 2JA5J 2DK8A 2XAFA 3A02A 1MD0A 1WJFA 3MEXA 1X1PA 3JSPA 2AO9A 1IAWA 2B9SA 1VQ8I 3D0SA 5BQTA 1QVUA 1SVLA 3LSIA 1KU3A 5ICCA 3BG6A 3F8MA 2M30A 2FBHA 1AA7A 2MD0A 2GOMA 3AKZA 4XKCA 1TQPA 2MYSA 3N97A 2DPUA 1YW8A 3H0DA 4UV8A 1PP7U 2K86A 2OAZA 1ETWA 2M7BA 2OCEA 3T8TA 1G6NA 2FA5A 3KEQA 4GYIA 1EH8A 4UUSB 2H1KA 3WTUC 4HF0A 3L1PA 1IF1A 4GRIA 4WXHA 1VI0A 5L3EA 5EEGA 4XN3A 5D5WB 4Y33A 1X3WB 5EGOB 3ESWB 4IRGA 4BQNA 3PIOF 1IC8A 1STZA 1SFUA 2CO5A 1T98A 1LVKA 4ENNA 4OIRF 2IA2A 3HYIA 3M1EA 1SFEA 2HXIA 3A4CA 2EIMH 3U1DA 5LHIA 2V1XA 3HGGA 5DV5A 3NAUA 5FKNA 1BOAA 1XDUA 2DOFA 3BJ6A 3FMRA 1ZG5A 2QWWA 2R7TA 4II3A 4N4OB 4RS8A 3OYFA 2JN6A 1BW6A 4M3GA 3OYEA 1U78A 1MMDA 1MNEA 5LHHA 2ZXJA 1D3YA 1BC7C 1LNWA 2H09A 3H92A 3MCZA 4BKXA 1M1EB 1JKPC 1V3FA 2HVSA 3L2VA 1IO2A 4OIPF 4MEYF 3WHBA 3P9IA 4UXNA 3FK6A 2DMUA 1B59A 2STWA 2VQCA 4D9JA 2L2OA 1QZYA 2CGPA 2CV0A 1T0FC 4KDPA 3CQZJ 1AKHA 4CZCA 1ETXA 3E97A 3A01B 2VBYA 2K5CA 1EH7A 4V2GA 1ZKGA 2OTJI 3ZQFA 3ISPA 2JVHA 3GTMJ 2EPFA 2BBYA 2XAJA 4ESBA 2HS5A 4NC7A 2BV6A 1T39A 1B72A 5ICGA 3R61A 5DTDA 3F6OA 1TL8A 3MVPA 1I1GA 4BS9A 3FX3A 2FEZA 4ZYEA 1KGSA 2GOXB 5CVIA 2JZYA 2DT5A 3KZYA 2LTPA 2OPTA 1GXQA 3G4SI 3SEQA 2LLKA 4AVZA 3J81K 1HBXG 4LOCA 2R7FA 1G2HA 2AXLA 4QPOA 4B4CA 4GCVA 2L9RA 3C1DA 2HYGD 4XLHA 2E5NA 1IUYA 2PQ8A 2M87A 1U6GA 3PSIA 2DBBA 3KETA 4C2MJ 3CF5F 2XKOA 1K6OA 1DU6A 2X0LA 2QA4I 3QU6A 4ZYHA 4XKBA 3DEUA 1VQMI 3FK7A 5K7ZA 3J7ZI 1GXPA 2KT0A 1R5HA 2VKVA 4G6DA 1LB2A 3ZMUA 4ZYGA 2WB1A 1OQYA 3O6BB 2XGXA 4LMYA 3Q3SA 2QBYB 1WWXA 1LPQA 3JTGA 3LSPA 1SAUA 4HNUA 3OV8A 2E2IJ 3JAMZ 4B47A 3OYJA 3DPLC 1W5SA 4YIIA 4E70A 4LD5A 2L5QA 2MH9A 2K9QA 2LNBA 1LQ1A 1PYVA 2A6EF 2IBDA 1QHGA 4AYBA 2V26A 2BZTA 2VQLA 1ZH5A 2CYYA 4BQQA 2XB5A 3I71A 2M4KA 5GP9A 1IRFA 3T5XA 2QKLB 2K4BA 1B4AA 3M4OJ 2HYJA 1XTAA 2PBIA 3GTQJ 3RZOJ 2DJNA 1TBXA 3G73A 4XKVA 2A69F 4GXOA 4AUXA 3QYBA 4RGSA 2B7EA 1U9OA 1OPCA 1XGNA 5LLQA 1R4MB 1H9GA 1YYVA 4NHJA 3KP7A 1B8IA 1A6IA 2R92J 5KK1A 3LSHA 2I5UA 2LKSA 2VJIA 3S3OA 4CCNA 3ZN1A 1QPIA 2DA4A 5IYDJ 4QLCU 4L5IA 1JUMA 5C4XJ 3I5UA 5IT9K 1WH7A 2CG4A 2L7ZA 2VJ5A 3PQKA 3AL0C 4ZZLA 2BOLA 4QWQA 1YOVB 1KYWA 4LLLA 4BH9A 3HOYJ 2AS5F 1N78A 3OIPA 1D5YA 3H5NA 2ZMEA 5TJJA 4EEFG 3RQIA 5JI6A 2KZGA 1FYMA 3GTLJ 4RM3A 5EDNA 4BHPA 2JA7J 5FRMA 1HC8A 5CVJA 4CYCA 4UVAA 2JWTA 3G71I 1WGXA 3AAFA 2MC3A 4EATA 2DA6A 4ESJA 4PJNA 2Z1DA 2K4JA 2Z5UA 1RI7A 3I4MJ 3OYKA 3ASOH 3CUQA 4XIDA 2OF7A 1YO5C 1KU9A 1MBFA 2LY1A 4Z2YA 2Y0SN 4I01A 2FU4A 2HEOA 2Y30A 3FM5A 1Y8RB 4G12A 2IS1A 5HVQC 2O03A 4AM3A 1SMYF 4U7BA 4O5VA 3I4PA 4LB6B 4EJWA 2O0YA 1MDMA 2NOGA 4L5EA 4HRIA 4HQMA 3WGGA 3OYBA 4XSXF 4WWCA 1MSEC 1OCZH 3VODA 1NH3A 3WTYC 2WWYA 3CJNA 3K9TA 2JMWA 1B72B 5FLXK 4O3MA 3VEPA 5EF6A 2FOKA 1VQNI 1FJLA 2L0KA 1EH6A 3P5JA 3QPLA 3GFIA 6PAXA 3D1NI 4DBQA 3MAJA 2DTZA 1O7LA 1POGA 2HOAA 5LEKA 1P7JA 3BTIA 4LGWA 3OOUA 3KYCB 1W0UA 4N9HA 1LDJA 4IL6C 3F6VA 1RNLA 2HQNA 1I50J 4F92B 1D5VA 2WAQA 2OD5A 2HYFA 3K0LA 3B73A 4U88A 5B1BH 1VQ7I 4R1HA 5M3MJ 2K40A 5F1JA 2ETHA 1Y0NA 2CRGA 5HOOA 4M73A 2BEOA 1ACIA 2FD5A 4PJLA 5HDNA 2DT6A 3HHGA 1WJEA 3WU0A 1WSUA 2HPMA 1YX3A 1WZ2A 4NDLA 1B6AA 1U8BA 1ZLJA 1Z0XA 2V6CA 2PX9A 4KIGA 1J5YA 1SVMA 3E6CC 1JT0A 3CJTB 4MIMA 1UAAA 5J4YA 2UWMA 5E3NA 3UNGC 1ZQ3P 1JTXA 4HLYA 2R5YA 1BA5A 1U0JA 2PMUA 4P96A 3IV5A 2CV1A 4LK0F 2XPVA 2KL4A 3RKWA 1OYIA 2LR8A 2V9KA 3D5RC 4S05A 4IHVA 2HOSA 5EJCA 4CA0A 4UNOA 2YS9A 1QU3A 3COAC 2M9HA 4JBAA 1N75A 4MGRA 3C18A 4IHXA 1GLNA 1FPQA 2E19A 5D4RA 4I09A 2UUZA 4M72A 1U5TA 5JFRA 4A69C 3BG3A 4OIQF 2QUFA 2VXDA 2QSFX 1VFCA 3RYPA 2KIFA 3A2KA 3IH3A 2DA7A 3ZMZA 1YW9A 2VI6A 5M5WJ 3M8JA 2HWVA 4CCMA 2DA1A 3S3MA 4OWRB 1LDKB 2NS7A 4A0XA 3OIOA 1YI2I 4Y52J 5J1RA 3V7RA 5D8KB 2ME6A 5IP9J 4A3LJ 3RSNA 4XRMA 4MQ9F 3GZNB 1G4DA 3VYTB 2W25A 4CYCB 3ABLH 3HPGA 4ITVA 4OINF 3GTPJ 2XROA 3SDBA 3QRFF 1YW7A 4JK1X 4LIVA 4QTRA 1YX5A 3HKZA 4CGZA 3CC7I 2XSJC 1OJLA 2QVOA 1IN5A 2CH0A 3OYMA 3TW6A 2ZJRF 4L5JA 2NVYJ 4BE0A 4H0EA 4FX0A 4I76A 2M5WA 3NQOA 2GBYA 3DLLF 3OSFA 3JW4A 4L0YB 3SZPA 5E8IA 2MBFA 1MDMB 1F4KA 4XQFA 5L3GA 2EFQA 4KITB 2W24A 1XD7A 1BOBA 2G9WA 1UCRA 2HTSA 3K4NA 4RGRA 3DCFA 3MMYB 4MNUA 1CGPA 2P6SA 2HVQA 4Y4RA 4MHGA 4AD9A 4KMUX 3LA2A 4RLFA 3KPHA 2R7DA 1R1VA 4HAMA 2CW8A 3W6VA 5DM7F 5ILSA 1JUPA 2HOEA 3DKXA 1CF7B 2WB1N 2E1NA 4A3IJ 3TW7A 2H6CA 1BR4A 2JRTA 3JRIA 3IWZA 5K5RA 1YG2A 4CCOA 3E7LA 3DTIA 4EVIA 1KQ0A 4IQ4A 3HSFA 1YIJI 2RDPA 2ECCA 1O57A 1B9MA 1TWHJ 2CS3A 3TQNA 1OCTC 5FROA 2COBA 1HW2A 3PFYA 3ASNH 3CDLA 4KT5C 2ZNZA 1P92A 2FQ4A 3M07A 1JI8A 5ILUA 1BW5A 2F5FA 5F64A 2HGCA 2J5OA 2R7ZJ 2V79A 2HU9A 2VJ4A 3ZCOA 1RC9A 3RCOA 1BIBA 2Q8KA 5AIPA 1QZEA 3H9JA 2V7FA 1EKEA 4QSHA 1S7AA 2CQQA 1IRGA 2XASA 1F9NA 4A0ZA 1T0FA 2O8XA 1ON1A 4A3GJ 2LSOA 4PCQA 4F91B 4M9SA 3CCJI 1JGSA 5HS9A 1BN5A 2I8DA 3OIQA 1RKTA 3JAMK 3O2PE 3W6JB 3KZIC 4QIWN 2Z9OA 3FBNB 1U5TB 2VOPA 1LFBA 1Z05A 4XSZF 5ICFA 3DEWA 2EH3A 1MNMC 3B6AA 2CU7A 2V4JC 3CD6I 1MKMA 1LVAA 1Y1VJ 2M7AA 1WQ2A 1HW5A 1TW2A 2ELJA 2JPCA 3GWZA 4IRHA 1Z91A 2HDCA 2AQFA 4IRIA 1GDTA 3BG7A 3J80Z 2ICWG 1VQPI 3FZVA 2EJRA 2IJLA 5AIQA 1HOMA 2HNHA 3F21A 4L9NA 2DK5A 2ZFWA 3AG4H 3ZMSA 5KHDA 1HA8A 3ONQA 2X6OA 2EZLA 4Q48A 5C3EJ 4L9VA 3WU1B 2QF7A 2E1OA 4UUTA 2KPMA 4Q4ZF 2E7XA 2O3FA 3K1MA 1TC3C 1P4AA 3LSTA 4EJTA 2P0WA 3BCBA 1WFXA 2RC4A 3U9GA 4FE7A 4BNCA 4C2UA 4CHUA 3H35A 5K1YA 1R4NB 2ZKZA 1A35A 1PP8F 3J7AO 1S7OA 2LKPA 3ZN0A 2DA2A 1UELB 5HDGA 3E6BA 2L9SA 1I27A 5TGTA 2V1DA 1IRZA 2XIGA 1R22A 3HOSA 1G3YA 4I6ZA 1T2KA 2WAQN 4NBQA 3WTTC 1ZR4A 4KN4X 4RAZA 1FYKA 5IP6A 3M1CA 3GZ5A 1NG7A 3FXLA 4FASD 3OYLA 3REOA 4R79A 3WGHA 2F4OB 3ZQHA 5TISC 1WPKA 4JQFA 3KEOA 4ZYDA 3MWMA 4BACA 3BR2A 1WRJA 2Y0SA 1D8JA 2MA3A 4C3HJ 4B48A 1IJWC 5JHUA 2M3AA 2MG4A 4BHCA 5FO5A 3L7WA 2LKXA 2BW3A 1HW1A 1UJ8A 4LG0A 3BP8A 2JRMA 2YX7A 4RB2C 1I3AA 2NNYA 4ASNA 4DQ2A 4Y7NJ 1FP1D 2OZ6A 2VKDA 2LYCA 3HOWJ 2WTEA 5M3FJ 4XICA 4DIQA 4EM2A 4J19A 1DPRA 1QHHD 5FKKA 2VE9A 1RRJA 3ABKH 5CPRB 4TV7A 3LSRA 2EA2A 4KUMA 3LQRA 2TRTA 4ZZDA 2GXAA 3RIRA 4ETSA 1SFKA 2ZFUA 2R93J 3ZXSA 3QP5A 2DDBA 1O3TA 1IUFA 3OYAA 4MTEA 3QYEA 2UXNA 3TDZC 3TMOA 3OS2A 2QZ8A 1H0MA 3BPXA 3F3XA 3V42A 3H5AA 4PDKA 1SFOJ 1SVOA 2JSCA 3Q9VA 3PNVA 4Y15A 3OYCA 2VUMJ 4NUBA 3JREA 3MQ0A 4PJJA 1YIOA 3S8PA 3OR1C 2EQRA 4P1WA 3SDGA 3JCUC 3RKQA 3JRAA 2XKPA 1FIAA 2KLOA 2P5LC 3BTLA 2XVCA 1IXRC 4LK1F 4P5OA 2R7RA 2H8RA 2XC7A 3JRFA 2WA0A 4C9YA 4G6QA 4KJZA 4KN7X 5IP7J 2X4HA 5FKOA 3LOCA 3CMYA 3HKZN 2FRHA 3CJRB 1J0RA 4LJZF 1JXSA 2L7MP 4JP0A 1WKMA 2DMQA 3KIOA 4PSWA 4A6DA 2E2HJ 1Y0UA 5JR3A 3BJOA 3CTAA 4QPQA 3AG2H 1ERDA 1V55H 3FKJA 1ODDA 1TNSA 5F08A 1G3TA 4MEXF 1FIPA 1OFCX 2L54A 5BOXA 2P4WA 1IN7A 2R7QA 1JHHA 1BI1A 2DMPA 2C6YA 2ZB9A 2EZKA 3H36A 4HF2A 4XN0A 5D5VB 2VC1A 4KFCA 2VBZA 2DMTA 1HLVA 1JKOC 2HZTA 4Y17A 5EZGA 4CDGA 1ZG1A 1GHCA 4UY8I 1OR7C 2E60A 1XSVA 2DW4A 3Q0UA 5B3SH 5BS6A 3Q5FA 4I98B 1LJ9A 4XK4A 1KQ9A 3HHHA 5J8CA 2DI3A 4XRFA 5E1XA 1ENHA 3IUOA 4LIUA 1VNDA 1P9QC 3AFHA 1R7JA 4DYCA 2VT3A 1JJ6C 1L3LA 3U21A 1XB4A 4PUSA 2OZUA 4XOPA 2QKMB 1S7EA 2VBXA 2H8WA 2P5VA 2DQRA 3ZQQA 3IRQA 2IP2A 1UFMA 2A6TA 2X48A 2WY8Q 4BXUA 3BC8A 4D5CA 4D7MA 2LF7A 3H3ZA 3HBLA 4G9YA 4HSTA 2BHYA 3KP6A 3WG9A 4E7LA 4EM0B 2KRHA 1XN7A 2F4IA 1S29A 3CMMA 5DCMB 4B3XA 1N77A 4CO8A 1WI3A 3MKYB 2JA6J 4AIJA 2B63J 2PMHA 4RB1A 3PO3J 1XG1A 2HXOA 2X9DA 1Y6IA 3CUOA 1A5JA 2XDVA 3VSLA 4UUVA 1LE8B 4LG0B 2PI0A 1YS7A 3LL7A 1VQ6I 4K2EA 1I39A 2IXSA 4BU2A 4JOMA 1K61A 3LA3A 1R5GA 1VF9A 4ZTFA 4S04A 3IL2A 4D5FA 3A03A 3K4JA 4FHTA 1Y1WJ 3FM3A 3KZZA 1G3WA 3P7NA 5DCFA 4WCGA 3HJEA 5E3MA 2FJ1A 4HLXA 1K78A 2FMLA 3K6GA 1QNTA 3QQAA 5LHGA 5CKTA 1P4WA 1ZYRF 1G3SA 1OISA 4ENJA 4NB5A 3BR5A 3HZJA 3IH2A 3T8RA 3S1MJ 5K7HA 3DBRB 1UG2A 1ZARA 3CCSI 2W48A 2XPUA 4RLQA 3BR3A 2UZKA 2CQ7A 3BZCA 2HR3A 5E79C 1FOWA 2WV1A 5J47A 2CW7A 2HDWA 3H0GJ 3W6KB 5DS9A 4BDZA 3RPUD 2O61A 3M7GA 2Q0OA 2V9PA 3V8KA 3BTJA 3WG7H 3CCEI 4YELA 4AIDA 2DOAA 3V8JA 2P81A 5J3LA 1TT0A 4F7ZA 3G6EI 4GFBA 2CUEA 2X51A 3BPVA 1UG0A 1X3UA 1R1TA 2OC6A 1FTTA 1ZHFA 3FXRA 4IHYA 3G1MA 2EV0A 4HDUA 2EA4A 3F8CA 2FNAA 1U8RA 1ULYA 1YS6A 5DM6F 4EGZA 3HG9A 3VB2A 1X1CA 1V5FA 2KJBA 2R0QC 5CVUA 2RV8A 4FTHA 3S3NA 2DU9A 4S0HB 2V6EA 1IN6A 1SD5A 2M4GA 4RMNA 4M71A 1DGRM 4HW0A 2BHZA 1E3OC 3BDDA 1ORKA 3LAJA 3NEUA 1FOXA 3CCLI 3J80K 2O8KA 3K10A 3Q0VA 5C4JJ 2F4MB 5DYMA 4W97A 2PEXA 3PNTA 4KIBA 4CSWA 2YUSA 4PFPA 2EK5A 2HTJA 2LVSA 4CCLA 2OA4A 1FOYA 5F27A 2I10A 4KICA 1FBSA 1ONVA 3LSJA 3D5LA 4BDYA 1DPUA 3F23A 3M8EA 3BG5A 2QQBA 4X6AJ 2PFBA 1DGWY 1TP4A 3HUGA 1AKHB 1WJAA 1DUXC 1QPMA 3SZTA 3FMQA 5L3BA 2QEXI 2Y31A 4JX5A 2ECBA 2G7UA 4XLCA 3L2RA 2DQLA 2LMDA 4GDFA 3RI4A 2OU2A 3O8GA 4IOCF 4CCKA 1V5EA 5H6QA 1YLFA 3R0JA 2JA8J 2R7VA 5DD8A 3HTUA 1ZK8A 2QYOA 3PO2J 2HPIA 2ZSHB 1A04A 1XCVA 2LY9A 1K7AA 1KQ8A 2EFOA 3TEDA 1JT6A 2XF6A 1O3QA 4IO9F 3BLYA 5LFAA 5GAEJ 2BY3A 1U3EM 4U0YA 2RN7A 5K5OA 2BXZA 4OAYA 2FUG2 2X6YA 2MABA 3QOPA 4E4HA 5D6EA 2K9LA 2E1MC 1Q1VA 3S2HJ 4HX8A 3EUAA 1E3PA 3QP6A 5LBQA 3EPZA 2D2WA 3MKZA 3CMAI 1JUSA 3L2CA 2VIXA 1K78B 3CDHA 2AQEA 1SFXA 3EDPA 1S3JA 2O6GE 3HRTA 4HPQA 5FB2A 1W36C 4ESFA 2A5YB 3FHNA 2ZJQF 2DJIA 4KMFA 2XAQA 1BL0A 5DDGA 5E3LA 1JE8A 2DLLA 2V1NA 3DPTA 2LD5A 2IRFG 3KEYA 2IEKA 2DAOA 4KISA 3N05A 3G1OA 3WTWC 3BR1A 2ZBKA 3HL2A 3FISA 1H88C 3BROA 1J75A 2H27A 2L7FP 2M34A 2WAFA 1J59A 1HF0A 1WJ5A 3JR9A 4AIKA 2LBFA 4RA2A 5LD2C 1JJ8C 1XGSA 4WF2A 1QQIA 2A61A 2DDAA 3ZQLA 2ESHA 3GO5A 4M6XA 3AG1H 4N0BA 2X1EA 1OCPA 2GA1A 2DYRH 5EZHA 4RAFA 3CLOA 1SD6A 1B8IB 2QM3A 1DP3A 4M9XA 2Z99A 1YJNI 1FEXA 2KHMA 2MFZA 2RQPA 3LNQA 3ZOBA 4BQAA 2FMYA 2OBPA 1ITYA 2KQRA 4PK4A 1VQKI 2P7VB 4M3FA 3BWGA 3S16J 1SAXA 1MBEA 1ETQA 2W82A 3A0HC 1T6SA 2MH2A 5J1UA 2VLAA 1GT0C 3HTSB 3V4GA 4G7HF 5IT3A 5FJ8J 4HG2A 4BL0B 3EUHC 1GV2A 1P2FA 3QOEA 2ZMEB 3GBGA 4Q5SF 1A31A 3LA7A 1ETOA 1MJAA 4D0PA 5CYVA 1W0TA 2O7OA 3L00A 2Y9ZA 2MW8A 2RNGA 3ULQB 3DF8A 1APLC 2L7KA 3U1KA 2W85A 1HDPA 1HSJA 3T1BA 3QYFA 5H2FC 3FXUA 1X2NA 3IAS2 2A07F 2QLZA 5H6RA 4N4NB 2Y48A 4J00A 4GO1A 2KP6A 5A2QZ 1MJ9A 2HDDA 2K3PA 3CUQB 4DYRA 3FF5A 2PMZN 2IW5A 3ZQIA 4B09A 2JA2A 2DPDA 2DODA 3ABTA 1USSA 2HI3A 3GW2A 3OYNA 2PJPA 3C3WA 4MFDA 3S1QJ 1MJBA 3FXMA 2GAUA 4ANJA 4EJUA 3CO7C 4N9IA 3DBHB 1X4OA 3K2ZA 1MSFC 3C2HA 3L2WA 5K5QA 2Z16A 3E5QA 3F8NA 2BVLA 4LITA 3RPUA 5J8FA 2ID3A 1XX5A 3WE2A 2LG4A 4EQQA 4RDUA 5CVVA 3OY9A 3PIPF 3W2AA 2WV0A 2DFFA 1RUNA 1QRYA 1Z67A 4UVBA 1H8AC 1ZGAA 5GPCA 4G7ZF 2NXNB 3RTRA 3KYLA 1W36D 2WBMA 2XV4S 2XUBA 4BE1A 4RM2A 1XS9A 1MMSA 1XGOA 4BY1J 1I1SA 2IAIA 4L9JA 2PG4A 5FD5A 4AC0A 2NNNA 1SC7A 5FRNA 3NWTA 4A3KJ 1XC5A 3OS1A 1IG7A 3MKWB 3GFMA 4AIHA 4OIOF 1YQAA 4CCJA 2CJJA 1XMXA 2OQRA 4C3JJ 4OU0A 4NC8A 2ESNA 2EZIA 4G7OF 2RKHA 4WK8F 2K02A 3A1YA 5LGUA 3G2BA 1O3SA 3LMMA 4V2FA 3EYIA 4KYWA 3GF2A 4IVNA 1OCOH 1OR7A 3ERMA 1EA3A 1BIAA 5F04A 3WTXC 3K69A 2LBFB 2EINH 2KDOA 5J1YA 2ZXWH 1XSDA 3TP0A 4RGXA 4HX7A 1BM9A 1ZRDA 2K9NA 2R5YB 1SD7A 3BG9A 5LGTA 5LRRA 1D8KA 5KVRA 4DZPA 3K7AJ 1VQOI 2GQQA 2CQNA 5IY5H 2BE5F 2L01A 1Z7LA 5E18F 2P7CB 4DNCA 1FSHA 2LY2A 2QENA 4I7HA 4HNTA 1MMAA 3LQQA 4KA4A 3TKYA 4A3MJ 2JUCA 2D45A 1ZTRA 2EIJH 3GEZA 2X6XA 2FSWA 2LREA 2J5PA 3VOEA 2H94A 1T33A 1TWGJ 3R60A 1RETA 4M3BA 2XF5A 2PJRA 1AOYA 2DXIA 1U9NA 1X19A 2GWRA 1RKWA 3VYRB 3K4KA 1UB9A 2JQ7A 2VPLA 3RJPA 2R5ZA 1MIJA 3CDIA 1PUEE 2R4GA 3I58A 3KP2A 4OMZA 3KCCA 4M9ZA 1ETYA 1I6HJ 4MFEA 2QSGX 4DZJA 1I3QJ 2L4AA 1RZ4A 3BJAA 3WGIA 1BR2A 2E1CA 2XB0X 2RQQA 4M74A 3CJQB 3CCQI 3ROUA 2BY0A 5B66C 3FXKA 1R58A 4YG2F 2HKXA 3VWBA 5JVTA 4HA8A 2HQ5A 1Z9CA 5IPAA 2Y75A 2DMNA 2IT0A 4HZFA 3BT9A 1R00A 4UB8C 1W5CC 4OMYA 2F6CA 3VPRA 2OV7A 3CLQA 3SFZA 1X1AA 1K4TA 4J01A 2NVQJ 2BYVE 4BUPA 1U2WA 1NK2P 1HQCA 4I99C 4XNFA 1TWFJ 3GCMA 4XL9A 2GA2A 3LWFA 2VODA 3R4KA 4PGHA 3CZ6A 2P5KA 2KDZA 3G1LA 3A0BC 4XMYA 3C2GA 3T0YA 3K1PA 2EILH 3GTGJ 1R5ID 3FXJA 2M8GX 2LC2A 3CP2A 3HM5A 5JLWA 3A01A 2R7XA 1NTCA 2IGKA 2JUGA 2XAGA 1USTA 1YE9A 2CUFA 2VJJA 4A5MA 1ZGJA 5HS8A 4RAYA 3F9KA 2FBKA 2GZWA 1F5TA 2X85A 3H9GA 3PUBA 4A93J 3QAHA 3E6MA 4KT6A 4BJTA 1Y56A 5IOYA 3M3YJ 4RB0A 1IW7F 4WXDA 2F5CA 3IAM2 1MGTA 3O3KA 2MLGA 1Z1DA 3DU5A 3M9AA 1WCMJ 2RVCA 1KZHA 3BQYA 1J9IA 1W7PD 2BY1A 2UXXA 4EV0A 2YR2A 3VSKA 3BZKA 2WADA
chains in the Genus database with same CATH topology
1ZGWA 2FD5A 3BR5A 3IH2A 3S1MJ 5K7HA 1UG2A 1TWCJ 2W48A 3RZDJ 2XPUA 3BR3A 3ZQGA 1CQTA 4NDLA 1U8BA 2WV1A 3H0GJ 5DS9A 3JRGA 1Z0XA 2MSYA 3BTJA 5F0HA 1JT0A 4MIMA 2P81A 5J3LA 5E3NA 2DA3A 1ZQ3P 4GFBA 1MH3A 1JTXA 2CUEA 4B3AA 2R5YA 1BA5A 3IV5A 4FE4A 2XPVA 2LR8A 1FTTA 4IHYA 4IHVA 3G1MA 2HOSA 3Q0WA 1IDYA 2XRLA 2YS9A 2DN0A 3PM1A 1PUFB 2M9HA 4M6VA 1Z77A 4IHXA 2M0CA 2E19A 1T56A 1K83J 3WHCA 5BNGA 4A69C 2NS8A 3BG3A 4XRSA 3NARA 2R0QC 2R5ZB 4A3BJ 1VFCA 4FTHA 4S0HB 2ID6A 3IH3A 2DA7A 1E3OC 3MKLA 2VI6A 1ORKA 2Y2ZA 3HOXJ 5M5WJ 3HOUJ 2N8GA 4W1UA 2MGQA 2DA1A 1IV6A 4BY7J 2NS7A 1JGGA 2O8KA 4UUSA 1MBJA 3LSGA 3Q0VA 3S14J 3OIOA 4MO7A 3S2DJ 5C4JJ 4Y52J 5J1RA 4W97A 5IOZA 2ME6A 5IP9J 4A3LJ 4XRMA 4D7NA 2YUSA 2AHQA 5EGOA 2CQXA 4CYCB 2LVSA 3GTPJ 5F27A 4BBRJ 5M5YJ 2I10A 2HOTA 3LSJA 4QTRA 4X6AJ 3BG5A 2Y9YA 3HB9A 2XPWA 4M3DA 1AKHB 4IHWA 1OJLA 3TW6A 1SANA 2NVYJ 2Y31A 4JX5A 1IDZA 2ECBA 4I76A 2D5VA 3OSFA 2GBYA 1MBKA 1R9TJ 1AHDP 2NVTJ 3O8GA 3HEFA 5EG0A 1F43A 1TWAJ 2DA5A 2JA8J 1ZK8A 3PO2J 3DCFA 5K7FA 2LY9A 4A3JJ 1IGNA 1UHSA 3TEDA 1JT6A 4BBSJ 4IEJA 3W6VA 1JUPA 2WB1N 3I4NJ 4RBOA 4A3IJ 3TW7A 3JRIA 2EBIA 1BJZA 3E7LA 1Q1VA 2GLOA 5IYCJ 3S2HJ 1JKRC 3HGYA 2XGDA 4DW6A 2ECCA 1JUSA 2GM4A 1TWHJ 3S17J 1O4XA 1OCTC 2COBA 4M3EA 3CDLA 1LE8A 4JX6A 3GTKJ 2FQ4A 2XGCA 3BR0A 5E3LA 1BL0A 4A3CJ 2LD5A 1BW5A 2IEKA 2R7ZJ 3G1OA 5EYRA 3BR1A 3BR6A 3FISA 1H88C 1X2MA 2L7FP 2M34A 2EZHA 1HF0A 4QSHA 2CQQA 3JR9A 2LFBA 2NVXJ 1JJ8C 3JRBA 3OSGA 4MLOA 3ZQLA 2G0EA 4A3GJ 2K9SA 5F0FA 2TCTA 1GV5A 2JA5J 1RKTA 1OCPA 3A02A 4X1EA 5EZHA 4QIWN 1B8IB 2AO9A 1LFBA 5C44J 1QVUA 3JRDA 1FEXA 3DEWA 2EH3A 3LNQA 2CU7A 3B6AA 3ZOBA 1MNMC 5IYBJ 1RPWA 1Y1VJ 2YU9J 3TP3A 1ITYA 4DYQA 1DU0A 1MH4A 4M3FA 3S16J 1MBEA 1ETQA 3FIWA 5J1UA 1GDTA 2JK3A 2XSDC 1GT0C 1ETWA 5FJ8J 1GV2A 4UUSB 2H1KA 1HOMA 3GBGA 3L1PA 5E3OA 1ETOA 1HDDC 1W0TA 1VI0A 3QPSA 3F0CA 2O7OA 1EF4A 4JX4A 3FKIJ 2Y9ZA 2MW8A 4C3IJ 5EGOB 4BXXJ 1APLC 1IC8A 1YRNA 3HDDA 2X6OA 1WH5A 2EZLA 1HDPA 5C3EJ 3K2AA 3C2BA 2QF7A 2E1OA 4UUTA 9ANTA 1X2NA 2LK2A 2HXIA 1TC3C 1LFUP 2HDDA 3HGGA 5FKNA 3NAUA 4DYRA 2PMZN 3ZQIA 4FE7A 2JN6A 1BW6A 4M3GA 3HOVJ 1U78A 2HI3A 3S15J 4MFDA 3S1QJ 2DA2A 4BKXA 1JKPC 2RAEA 5EG0B 3B6CA 5FKMA 2ELKA 3WHBA 1RR7A 2FX0A 1IRZA 3FK6A 2DMUA 5FKLA 3H3VK 5EEAA 4I6ZA 1MSFC 2WAQN 3CQZJ 2ID3A 1AKHA 1ZR4A 1ETXA 2JJ7A 3A01B 5IP6A 4RDUA 3HOZJ 4V2GA 1ZKGA 1QRYA 3ZQFA 1H8AC 3GTMJ 5GPCA 2QCOA 3GTOJ 3ZQHA 1WPKA 1B72A 1JTYA 3BR2A 5DTDA 3MVPA 1XS9A 1QVTA 4C3HJ 4BY1J 2IAIA 4AC0A 4A3EJ 1GVDA 1IJWC 2LTPA 2MG4A 2OPTA 4A3KJ 1XC5A 2LLKA 1IG7A 2LKXA 4LOCA 2CJJA 2O9LA 2LP0A 1G2HA 4C3JJ 4B4CA 2L9RA 2EZIA 4V2FA 4JYKA 4C2MJ 4Y7NJ 3ZQCA 3HOWJ 2ME0A 5M3FJ 1DU6A 4XICA 4J19A 5F04A 5FKKA 3FK7A 5K7ZA 1GUUA 2KT0A 5J1YA 2VKVA 3LSRA 3TP0A 4B1RA 4XRSG 2TRTA 2K9NA 2R5YB 3Q3SA 3BG9A 2R93J 3LSPA 1MBGA 4DZPA 2E2IJ 3K7AJ 1IUFA 1ZR2A 2K9QA 4A3FJ 1RESA 2IBDA 1MBHA 5F0CA 1SFOJ 3S1NJ 2VUMJ 3S1RJ 3JREA 2XB5A 5FLMJ 5GP9A 4A3MJ 2EQRA 3SDGA 3M4OJ 1H89C 2VKEA 3RKQA 2HYJA 3JRAA 1ZTRA 1FIAA 3GTQJ 3RZOJ 2DJNA 3BTLA 1ETVA 5M5XJ 2H8RA 1T33A 1TWGJ 4M3BA 1RETA 4AUXA 3JRFA 1PUFA 5IP7J 5FKOA 4ABZA 1U9OA 3LOCA 3CMYA 3HKZN 1U9NA 1B8IA 2L7MP 1A6IA 2R92J 1RKWA 4JP0A 2DMQA 2E2HJ 1UMQA 1QPIA 2R5ZA 2DA4A 5HODA 2M2EA 5IYDJ 3BQZA 5JLXA 4FCYA 1JUMA 2E2JJ 2XGEA 5C4XJ 4A3DJ 1ETYA 1WH7A 2L7ZA 5F08A 3UKGA 1YRNB 3IH4A 1I6HJ 4MFEA 4DZJA 3O8HA 1FIPA 1I3QJ 1OFCX 3JRHA 4HNVA 2DMPA 3HOYJ 2ZB9A 2XB0X 1JKQC 5FLVA 1D5YA 2EZKA 4EEFG 3RQIA 3MN2A 3SJMA 2DMTA 3GTLJ 5EDNA 1HLVA 2HQ5A 3CCYA 1JKOC 2JA7J 5EZGA 5IPAA 4CYCA 1F36A 2JWTA 2DMNA 1WGXA 3Q0UA 3BT9A 2DA6A 4XK4A 3VPRA 3SFIA 1ENHA 1VNDA 3I4MJ 2NVQJ 4XIDA 2OF7A 4DYCA 1MBFA 1JJ6C 1NK2P 2Y0SN 2Y30A 4G12A 1TWFJ 1S7EA 1ETKA 2NOGA 2X48A 4L5EA 2KDZA 1AU7A 3G1LA 1MSEC 2VPRA 4D5CA 4D7MA 3HBLA 2JMWA 1B72B 3GTGJ 2M8GX 5EF6A 3GTJJ 3HM5A 1FJLA 5JLWA 3A01A 1NTCA 1WI3A 2L0KA 2JA6J 2B63J 3QPLA 1FTZA 3PO3J 1XG1A 2HXOA 2X9DA 2CUFA 1A5JA 3D1NI 2DTZA 1LE8B 1POGA 2HOAA 1P7JA 3BTIA 3BTCA 3OOUA 1W0UA 4A93J 1K61A 1HCRA 1VF9A 5GPAA 1I50J 5IOYA 4D5FA 3M3YJ 3A03A 1Y1WJ 1X58A 5E3MA 2FJ1A 1WCMJ 5M3MJ 4AYBN 2K40A 3BQYA 1P7IA 5F1JA 3JRCA 1NK3P 2CRGA 3QQAA 4FISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGW A;  2FD5 A;  3BR5 A;  3IH2 A;  3S1M J;  5K7H A;  1UG2 A;  1TWC J;  2W48 A;  3RZD J;  2XPU A;  3BR3 A;  3ZQG A;  1CQT A;  4NDL A;  1U8B A;  2WV1 A;  3H0G J;  5DS9 A;  3JRG A;  1Z0X A;  2MSY A;  3BTJ A;  5F0H A;  1JT0 A;  4MIM A;  2P81 A;  5J3L A;  5E3N A;  2DA3 A;  1ZQ3 P;  4GFB A;  1MH3 A;  1JTX A;  2CUE A;  4B3A A;  2R5Y A;  1BA5 A;  3IV5 A;  4FE4 A;  2XPV A;  2LR8 A;  1FTT A;  4IHY A;  4IHV A;  3G1M A;  2HOS A;  3Q0W A;  1IDY A;  2XRL A;  2YS9 A;  2DN0 A;  3PM1 A;  1PUF B;  2M9H A;  4M6V A;  1Z77 A;  4IHX A;  2M0C A;  2E19 A;  1T56 A;  1K83 J;  3WHC A;  5BNG A;  4A69 C;  2NS8 A;  3BG3 A;  4XRS A;  3NAR A;  2R0Q C;  2R5Z B;  4A3B J;  1VFC A;  4FTH A;  4S0H B;  2ID6 A;  3IH3 A;  2DA7 A;  1E3O C;  3MKL A;  2VI6 A;  1ORK A;  2Y2Z A;  3HOX J;  5M5W J;  3HOU J;  2N8G A;  4W1U A;  2MGQ A;  2DA1 A;  1IV6 A;  4BY7 J;  2NS7 A;  1JGG A;  2O8K A;  4UUS A;  1MBJ A;  3LSG A;  3Q0V A;  3S14 J;  3OIO A;  4MO7 A;  3S2D J;  5C4J J;  4Y52 J;  5J1R A;  4W97 A;  5IOZ A;  2ME6 A;  5IP9 J;  4A3L J;  4XRM A;  4D7N A;  2YUS A;  2AHQ A;  5EGO A;  2CQX A;  4CYC B;  2LVS A;  3GTP J;  5F27 A;  4BBR J;  5M5Y J;  2I10 A;  2HOT A;  3LSJ A;  4QTR A;  4X6A J;  3BG5 A;  2Y9Y A;  3HB9 A;  2XPW A;  4M3D A;  1AKH B;  4IHW A;  1OJL A;  3TW6 A;  1SAN A;  2NVY J;  2Y31 A;  4JX5 A;  1IDZ A;  2ECB A;  4I76 A;  2D5V A;  3OSF A;  2GBY A;  1MBK A;  1R9T J;  1AHD P;  2NVT J;  3O8G A;  3HEF A;  5EG0 A;  1F43 A;  1TWA J;  2DA5 A;  2JA8 J;  1ZK8 A;  3PO2 J;  3DCF A;  5K7F A;  2LY9 A;  4A3J J;  1IGN A;  1UHS A;  3TED A;  1JT6 A;  4BBS J;  4IEJ A;  3W6V A;  1JUP A;  2WB1 N;  3I4N J;  4RBO A;  4A3I J;  3TW7 A;  3JRI A;  2EBI A;  1BJZ A;  3E7L A;  1Q1V A;  2GLO A;  5IYC J;  3S2H J;  1JKR C;  3HGY A;  2XGD A;  4DW6 A;  2ECC A;  1JUS A;  2GM4 A;  1TWH J;  3S17 J;  1O4X A;  1OCT C;  2COB A;  4M3E A;  3CDL A;  1LE8 A;  4JX6 A;  3GTK J;  2FQ4 A;  2XGC A;  3BR0 A;  5E3L A;  1BL0 A;  4A3C J;  2LD5 A;  1BW5 A;  2IEK A;  2R7Z J;  3G1O A;  5EYR A;  3BR1 A;  3BR6 A;  3FIS A;  1H88 C;  1X2M A;  2L7F P;  2M34 A;  2EZH A;  1HF0 A;  4QSH A;  2CQQ A;  3JR9 A;  2LFB A;  2NVX J;  1JJ8 C;  3JRB A;  3OSG A;  4MLO A;  3ZQL A;  2G0E A;  4A3G J;  2K9S A;  5F0F A;  2TCT A;  1GV5 A;  2JA5 J;  1RKT A;  1OCP A;  3A02 A;  4X1E A;  5EZH A;  4QIW N;  1B8I B;  2AO9 A;  1LFB A;  5C44 J;  1QVU A;  3JRD A;  1FEX A;  3DEW A;  2EH3 A;  3LNQ A;  2CU7 A;  3B6A A;  3ZOB A;  1MNM C;  5IYB J;  1RPW A;  1Y1V J;  2YU9 J;  3TP3 A;  1ITY A;  4DYQ A;  1DU0 A;  1MH4 A;  4M3F A;  3S16 J;  1MBE A;  1ETQ A;  3FIW A;  5J1U A;  1GDT A;  2JK3 A;  2XSD C;  1GT0 C;  1ETW A;  5FJ8 J;  1GV2 A;  4UUS B;  2H1K A;  1HOM A;  3GBG A;  3L1P A;  5E3O A;  1ETO A;  1HDD C;  1W0T A;  1VI0 A;  3QPS A;  3F0C A;  2O7O A;  1EF4 A;  4JX4 A;  3FKI J;  2Y9Z A;  2MW8 A;  4C3I J;  5EGO B;  4BXX J;  1APL C;  1IC8 A;  1YRN A;  3HDD A;  2X6O A;  1WH5 A;  2EZL A;  1HDP A;  5C3E J;  3K2A A;  3C2B A;  2QF7 A;  2E1O A;  4UUT A;  9ANT A;  1X2N A;  2LK2 A;  2HXI A;  1TC3 C;  1LFU P;  2HDD A;  3HGG A;  5FKN A;  3NAU A;  4DYR A;  2PMZ N;  3ZQI A;  4FE7 A;  2JN6 A;  1BW6 A;  4M3G A;  3HOV J;  1U78 A;  2HI3 A;  3S15 J;  4MFD A;  3S1Q J;  2DA2 A;  4BKX A;  1JKP C;  2RAE A;  5EG0 B;  3B6C A;  5FKM A;  2ELK A;  3WHB A;  1RR7 A;  2FX0 A;  1IRZ A;  3FK6 A;  2DMU A;  5FKL A;  3H3V K;  5EEA A;  4I6Z A;  1MSF C;  2WAQ N;  3CQZ J;  2ID3 A;  1AKH A;  1ZR4 A;  1ETX A;  2JJ7 A;  3A01 B;  5IP6 A;  4RDU A;  3HOZ J;  4V2G A;  1ZKG A;  1QRY A;  3ZQF A;  1H8A C;  3GTM J;  5GPC A;  2QCO A;  3GTO J;  3ZQH A;  1WPK A;  1B72 A;  1JTY A;  3BR2 A;  5DTD A;  3MVP A;  1XS9 A;  1QVT A;  4C3H J;  4BY1 J;  2IAI A;  4AC0 A;  4A3E J;  1GVD A;  1IJW C;  2LTP A;  2MG4 A;  2OPT A;  4A3K J;  1XC5 A;  2LLK A;  1IG7 A;  2LKX A;  4LOC A;  2CJJ A;  2O9L A;  2LP0 A;  1G2H A;  4C3J J;  4B4C A;  2L9R A;  2EZI A;  4V2F A;  4JYK A;  4C2M J;  4Y7N J;  3ZQC A;  3HOW J;  2ME0 A;  5M3F J;  1DU6 A;  4XIC A;  4J19 A;  5F04 A;  5FKK A;  3FK7 A;  5K7Z A;  1GUU A;  2KT0 A;  5J1Y A;  2VKV A;  3LSR A;  3TP0 A;  4B1R A;  4XRS G;  2TRT A;  2K9N A;  2R5Y B;  3Q3S A;  3BG9 A;  2R93 J;  3LSP A;  1MBG A;  4DZP A;  2E2I J;  3K7A J;  1IUF A;  1ZR2 A;  2K9Q A;  4A3F J;  1RES A;  2IBD A;  1MBH A;  5F0C A;  1SFO J;  3S1N J;  2VUM J;  3S1R J;  3JRE A;  2XB5 A;  5FLM J;  5GP9 A;  4A3M J;  2EQR A;  3SDG A;  3M4O J;  1H89 C;  2VKE A;  3RKQ A;  2HYJ A;  3JRA A;  1ZTR A;  1FIA A;  3GTQ J;  3RZO J;  2DJN A;  3BTL A;  1ETV A;  5M5X J;  2H8R A;  1T33 A;  1TWG J;  4M3B A;  1RET A;  4AUX A;  3JRF A;  1PUF A;  5IP7 J;  5FKO A;  4ABZ A;  1U9O A;  3LOC A;  3CMY A;  3HKZ N;  1U9N A;  1B8I A;  2L7M P;  1A6I A;  2R92 J;  1RKW A;  4JP0 A;  2DMQ A;  2E2H J;  1UMQ A;  1QPI A;  2R5Z A;  2DA4 A;  5HOD A;  2M2E A;  5IYD J;  3BQZ A;  5JLX A;  4FCY A;  1JUM A;  2E2J J;  2XGE A;  5C4X J;  4A3D J;  1ETY A;  1WH7 A;  2L7Z A;  5F08 A;  3UKG A;  1YRN B;  3IH4 A;  1I6H J;  4MFE A;  4DZJ A;  3O8H A;  1FIP A;  1I3Q J;  1OFC X;  3JRH A;  4HNV A;  2DMP A;  3HOY J;  2ZB9 A;  2XB0 X;  1JKQ C;  5FLV A;  1D5Y A;  2EZK A;  4EEF G;  3RQI A;  3MN2 A;  3SJM A;  2DMT A;  3GTL J;  5EDN A;  1HLV A;  2HQ5 A;  3CCY A;  1JKO C;  2JA7 J;  5EZG A;  5IPA A;  4CYC A;  1F36 A;  2JWT A;  2DMN A;  1WGX A;  3Q0U A;  3BT9 A;  2DA6 A;  4XK4 A;  3VPR A;  3SFI A;  1ENH A;  1VND A;  3I4M J;  2NVQ J;  4XID A;  2OF7 A;  4DYC A;  1MBF A;  1JJ6 C;  1NK2 P;  2Y0S N;  2Y30 A;  4G12 A;  1TWF J;  1S7E A;  1ETK A;  2NOG A;  2X48 A;  4L5E A;  2KDZ A;  1AU7 A;  3G1L A;  1MSE C;  2VPR A;  4D5C A;  4D7M A;  3HBL A;  2JMW A;  1B72 B;  3GTG J;  2M8G X;  5EF6 A;  3GTJ J;  3HM5 A;  1FJL A;  5JLW A;  3A01 A;  1NTC A;  1WI3 A;  2L0K A;  2JA6 J;  2B63 J;  3QPL A;  1FTZ A;  3PO3 J;  1XG1 A;  2HXO A;  2X9D A;  2CUF A;  1A5J A;  3D1N I;  2DTZ A;  1LE8 B;  1POG A;  2HOA A;  1P7J A;  3BTI A;  3BTC A;  3OOU A;  1W0U A;  4A93 J;  1K61 A;  1HCR A;  1VF9 A;  5GPA A;  1I50 J;  5IOY A;  4D5F A;  3M3Y J;  3A03 A;  1Y1W J;  1X58 A;  5E3M A;  2FJ1 A;  1WCM J;  5M3M J;  4AYB N;  2K40 A;  3BQY A;  1P7I A;  5F1J A;  3JRC A;  1NK3 P;  2CRG A;  3QQA A;  4FIS A; 
#chains in the Genus database with same CATH topology
 1W4M A;  2EWN A;  3OL4 A;  4CH7 A;  1KU2 A;  4FET A;  2ZC2 A;  1IV8 A;  1IXS B;  4OOI A;  4Z6Y A;  2IS6 A;  2VON A;  5LRS A;  1YJ9 I;  2IA1 A;  1R71 A;  3KYD B;  1IN8 A;  2VAS A;  5KCM A;  3F72 A;  4E7Z A;  1S72 I;  2CV2 A;  2VKH A;  3I3L A;  4BJ6 C;  1I5Z A;  5DUI A;  4GYG A;  3B02 A;  5E8G A;  3ZMT A;  3TO7 A;  2KRF A;  2DA3 A;  2HFH A;  2DFH A;  4B3A A;  2AXT C;  3CC4 I;  4FE4 A;  3SYT A;  2Z3Y A;  3GME A;  4UHT A;  3K70 C;  3X2Q H;  4U7D A;  1QBJ A;  3MZ8 A;  4EGY A;  2QQA A;  1FLI A;  1IDY A;  2DN0 A;  3PM1 A;  4R8H A;  5CJ9 A;  2PJR B;  1J7K A;  4M6V A;  1Z77 A;  3DU6 A;  4E7J A;  2M0C A;  5BPI A;  3J7A Y;  1RUO A;  3F8F A;  1FZP B;  4E7S A;  5BNG A;  4ZTJ A;  1T8I A;  1REP C;  2NS8 A;  3IHU A;  2ELH A;  4XRS A;  3NAR A;  3FBI B;  2R5Z B;  4A3B J;  3V7S A;  1LEA A;  3H3U A;  1ZEL A;  3I54 A;  2ISY A;  3QOD A;  1IXC A;  3MKL A;  1Y8Q B;  5FFX A;  2QQ9 A;  1TQM A;  2L02 A;  2Y2Z A;  2N8G A;  1MND A;  4BY7 J;  2VL8 A;  3S14 J;  1MBJ A;  4MO7 A;  2OUM A;  3PL8 A;  2L3D A;  4I02 A;  3IRR A;  2X6W A;  1H9T A;  2VN2 A;  1ZG3 A;  1YJW I;  4D7N A;  4EMS A;  2AHQ A;  3DXJ F;  1UHW A;  2ISZ A;  2XRN A;  4I0A A;  2LH9 A;  1VQ9 I;  4U0W A;  4RGU A;  4BBR J;  3NWS A;  5M5Y J;  4MTD A;  3PSF A;  5LGN A;  5TRD A;  1IRX A;  2E71 A;  2YX4 A;  4CZZ A;  4YFK F;  3HB9 A;  2Y9Y A;  2XPW A;  4FX4 A;  4M3D A;  3CCM I;  4E7H A;  5A2Q K;  4IHW A;  4F93 B;  1VQ4 I;  4CUG A;  3W2V A;  5HLH A;  1ZRE A;  1BR1 A;  1P6R A;  1YIT I;  4IHT A;  2Z2S B;  5F6F A;  2STT A;  1YHQ I;  3MZH A;  2R7W A;  1WJC A;  2CFX A;  1R9T J;  1AHD P;  2NVT J;  3HEF A;  2M1B A;  3HRS A;  1TWA J;  5EG0 A;  2CFO A;  2DA5 A;  2JSP A;  2P6T A;  3K4L A;  2VE8 A;  2K3F A;  1O7F A;  4OAZ A;  4HV6 A;  5L3D A;  2PMZ A;  4A3J J;  1IGN A;  1Z6T A;  5DUK A;  4YIR X;  3AL0 B;  5HDK A;  3I55 I;  4BBS J;  3DFG A;  2BVM A;  4Q47 A;  1PJR A;  3I4N J;  1X1B A;  2EB7 A;  2BW3 B;  3E0J B;  1DDN A;  1KON A;  3EUH A;  2E5Z A;  1MW7 A;  3I9V 2;  2FE3 A;  1KU7 A;  5EEH A;  3MFK A;  1Q1H A;  3HSE A;  2K27 A;  2GLO A;  5IYC J;  1Z21 A;  1QZZ A;  3HGY A;  2EIK H;  3G3Z A;  1XMA A;  3RKX A;  1SEU A;  4XM3 A;  4DOZ A;  3TOA A;  2VQH A;  2GM4 A;  4NQW A;  3S17 J;  4LFU A;  3R6S A;  3GTK J;  2XGC A;  3LFK A;  3BR0 A;  4A3C J;  2Y0M A;  1XSX A;  4BHB A;  3TL4 X;  3FXO A;  3SXY A;  4F52 A;  4GGG A;  4L9T A;  3OMY A;  5EYR A;  4XOR A;  3BR6 A;  4P55 A;  5ICE A;  4H4K C;  4A2U A;  1VQ5 I;  1X2M A;  3E5U A;  3I53 A;  2EZH A;  1FWZ A;  2IGN A;  3K70 D;  3E3V A;  1BC8 C;  2LFB A;  1FP2 A;  4L0Z B;  4V19 K;  1FC3 A;  5AON A;  1A6Q A;  4HEA 2;  4MLO A;  1NG6 A;  2G0E A;  2CWE A;  1OMI A;  5D6F A;  5J40 A;  5KNL A;  1BI3 A;  2K9S A;  3KP3 A;  3S32 A;  2CSO A;  2MD5 A;  4X1E A;  5CVR A;  3J7Y J;  3DPU A;  1TLH B;  1Z3X A;  4IXA A;  2FXA A;  4Y3O A;  1V4R A;  5C44 J;  3JRD A;  3CO6 C;  2TDX A;  3ELK A;  4ZDO A;  4YFN F;  2ZSI B;  2E1M B;  2IGM A;  4KIF A;  1TNT A;  5IYB J;  1RPW A;  2YU9 J;  3ECH A;  3TP3 A;  4DYQ A;  1DU0 A;  4O6J A;  1MH4 A;  4U0V A;  3OWT A;  2VOO A;  3FIW A;  2JK3 A;  2XSD C;  4RAG A;  3SEZ A;  4F3Q A;  4XOT A;  2K7L A;  3K4M A;  3TGN A;  3L2Q A;  2W7N A;  1HKS A;  2IPQ X;  2NYX A;  1WHU A;  2BGC A;  3IC7 A;  2ADU A;  1D0X A;  5E3O A;  2DO7 A;  1HDD C;  3QPS A;  1EF4 A;  3F0C A;  1LUJ B;  4JX4 A;  1G8X A;  3FKI J;  3EQL F;  4BJ5 C;  3SHF A;  4C3I J;  4AVP A;  1XPX A;  4BXX J;  3PNY A;  1V5G A;  1YRN A;  3HDD A;  1RIO H;  1WH5 A;  2DCE A;  4IZZ A;  5JVG F;  2PN6 A;  3K2A A;  4UVC A;  3C2B A;  9ANT A;  1SMT A;  1TTY A;  2LK2 A;  3KFW X;  3M8F A;  1FNN A;  4RB3 C;  1LFU P;  3HC7 A;  3CCU I;  4XLF A;  4CIC A;  3IKT A;  5E1Z B;  3ABU A;  1W7P A;  2HQA A;  4D1Q A;  3HOV J;  1OYY A;  3QWL A;  4CYD A;  2FF4 A;  3ZR8 X;  3S15 J;  4BAY A;  3F8B A;  2RAE A;  4CXF A;  1R6R A;  5HLT A;  2A05 A;  5EG0 B;  2E7W A;  2W00 A;  1OYW A;  1XMK A;  3B6C A;  3P9K A;  2ELK A;  5FKM A;  1JHF A;  1RR7 A;  5GAG J;  2FX0 A;  2GIZ A;  5FKL A;  2NRA C;  3VDX A;  3H3V K;  5EEA A;  1XGM A;  5D4S A;  4BQO A;  5L3F A;  4XLE A;  2JJ7 A;  2KKO A;  1HST A;  4G8X A;  4EJV A;  5HNH A;  1E3H A;  1V54 H;  3I59 A;  4BGD A;  1D1B A;  3HOZ J;  3FMS A;  1FX7 A;  4LB5 A;  3WTZ A;  2M0M A;  1P4X A;  1YFH A;  4IHS A;  2E35 A;  3I64 A;  4IPA A;  2QCO A;  1R49 A;  3GTO J;  3W3C A;  3CME I;  1ZLK A;  4IKF A;  1R1U A;  1JTY A;  3UR3 C;  1K6Y A;  4MQV A;  2XAU A;  2L9N A;  2NAZ A;  3OOP A;  4XLN F;  2YSR A;  1QVT A;  3VYU B;  2Z33 A;  1G59 A;  4A3E J;  1GVD A;  1NHA A;  3OL3 A;  4NQW B;  2IS2 A;  4B44 A;  1CF7 A;  2E34 A;  4PSX A;  2KJC A;  3DV8 A;  3LAP A;  2D1H A;  4XR6 A;  3ECO A;  3GLX A;  1QGP A;  4IF4 A;  4FT8 A;  2O9L A;  2FBI A;  2LP0 A;  4ZC3 A;  2F48 A;  1QA6 A;  2QQ8 A;  3DQV C;  2R7S A;  1N25 A;  1K4S A;  2A5W A;  4JYK A;  3ZQC A;  1W5T A;  3L09 A;  2ME0 A;  3WOD F;  1ZRF A;  4HYE A;  2RRE A;  1PVE A;  5L3C A;  1GUU A;  4UV9 A;  3FWE A;  3GLL A;  2YPR A;  3QPT A;  3HSR A;  4B1R A;  4XRS G;  3VFZ A;  4XLA A;  4P9U A;  3OYI A;  1BJA A;  4DBR A;  1ZN2 A;  1OKR A;  1E17 A;  3ZMV A;  3SZG A;  4X0G A;  2EV5 A;  3GXO A;  1MBG A;  3D5S C;  5GAH J;  5BPD A;  3VYS B;  3CC2 I;  1FT9 A;  4BEH A;  2F5E A;  4BYY A;  1ZR2 A;  4A3F J;  1RES A;  1E2X A;  1MBH A;  5F0C A;  3S1N J;  2OQG A;  4C2T A;  2ZNY A;  1FY7 A;  4E7I A;  3S1R J;  2R7U A;  1LKX A;  5FLM J;  2K85 A;  2VXZ A;  3RYR A;  3SQN A;  2V9V A;  1VZ0 A;  3GYH X;  5HNF A;  3OYH A;  3MZY A;  1H89 C;  2Y69 H;  2VKE A;  4F55 A;  1EV7 A;  4NC6 A;  1B9N A;  1ON2 A;  2CW0 F;  2KIM A;  2KRC A;  1ETV A;  1FBU A;  5M5X J;  1YTY A;  2DOE A;  3KLN A;  1PUF A;  4AU7 A;  1DP7 P;  3KE2 A;  4Y13 A;  3TOB A;  4M6Y A;  4ABZ A;  2VC0 A;  2ZJP F;  4HX4 A;  1UMQ A;  4ZYA A;  1B1B A;  2GXG A;  1K79 A;  2R7O A;  2M2E A;  2ZXH A;  4ZJZ A;  5HOD A;  2M45 A;  2JTV A;  3BQZ A;  5JLX A;  4FCY A;  2E2J J;  2XGE A;  1E0E A;  4A3D J;  3NRV A;  2VQG A;  3UKG A;  2O5R A;  3IH4 A;  1YRN B;  1WJB A;  1WVR A;  4LG3 A;  5J4V A;  3O8H A;  2COM A;  3JRH A;  3WE3 A;  2VBW A;  4HNV A;  2LOO A;  1T08 B;  3CP8 A;  1Z6R A;  4G6T B;  1S6L A;  2HKO A;  5HLI A;  4A12 A;  1FOK A;  2JPB A;  1ZRC A;  3HOT A;  1JKQ C;  5FLV A;  1WJD A;  3I0T A;  1IN4 A;  3HUG B;  2E36 A;  2JVG A;  4I2O A;  1S9H A;  1F1Z A;  3MN2 A;  5ED4 A;  3CCR I;  3SJM A;  1HXD A;  2L4M A;  1W7P B;  3EYY A;  3H5R A;  4DGW B;  3CCY A;  2KIQ A;  1MMN A;  1RR8 C;  1F36 A;  2X1D A;  3N4M A;  4HDV A;  4L18 B;  2CUJ A;  3DTK A;  5HS7 A;  3GX4 X;  4P9F A;  4A0Y A;  2K9M A;  5E20 A;  2G7H A;  5D5X B;  2NOJ B;  1Z7U A;  2WY7 Q;  4IQJ A;  3E1S A;  3CES A;  3SFI A;  2DYS H;  5J6X A;  3RQ4 A;  2H1L A;  3BOQ A;  4ON0 A;  2IA0 A;  3HRM A;  1TT5 B;  4HF1 A;  5E1W A;  1A36 A;  3I59 B;  5B1A H;  1KYZ A;  4ZH4 F;  4KNY A;  3ABM H;  1ETK A;  2GXB A;  1I6X A;  2NS0 A;  4WXC A;  3HRU A;  1S5L C;  4LLG F;  1AWC A;  1AU7 A;  2W4S A;  3WU2 C;  3R0A A;  2VPR A;  4IJA A;  4XON A;  3P9C A;  3TDU C;  1VTN C;  3ZPL A;  5JHF A;  2KIU A;  3H1C A;  1OCC H;  1LDD A;  3GUD A;  3GTJ J;  2OCC H;  3TO9 A;  5KAI C;  5D5U B;  2CUZ A;  3LFU A;  1FMW A;  1X1D A;  3BCA A;  3HPH A;  3J81 Z;  1FTZ A;  2BY2 A;  4PGG A;  4LLN A;  2V1U A;  1D0Z A;  2KZV A;  4E7K A;  3DLA A;  1D1A A;  3DKW A;  2KMU A;  3BTC A;  3TO6 A;  5GAD J;  1D0Y A;  4IOA F;  1HKQ A;  2IS4 A;  3WTS C;  4UB6 C;  1HCR A;  5GPA A;  4EJO A;  1C0W A;  1BI2 A;  4HBL A;  3GZ6 A;  3RPQ A;  2DFE A;  5HLG A;  3F22 A;  1X58 A;  1IZ1 A;  4B8X A;  1BBY A;  3OYG A;  3MD2 A;  3K1N A;  4AYB N;  1P7I A;  1X4P A;  4G94 A;  3JRC A;  3OYD A;  1NK3 P;  3IP4 B;  4WX9 A;  4DJA A;  2EFW A;  3JSO A;  4FIS A;  2FQ3 A;  5FD6 A;  5BMZ A;  1ZGW A;  2R3S A;  3OS0 A;  2EFP A;  2QSH X;  1VQL I;  1DQU A;  2HQR A;  2KFD A;  2ZME C;  4EM1 A;  2DT7 B;  3BY6 A;  1TWC J;  3RZD J;  2Q2E A;  2FOW A;  1SD4 A;  3ZQG A;  1UHM A;  1CQT A;  1TW3 A;  3Q9S A;  3OR2 C;  4BEH B;  1T95 A;  4HSR A;  3JRG A;  2MSY A;  1S8N A;  2F2E A;  2M8E A;  1J2X A;  5B5E C;  4FQG A;  5F0H A;  4ENK A;  3GFL A;  2LDU A;  3PFI A;  4YIF A;  1MH3 A;  2DFI A;  2W57 A;  4XKW A;  3CUQ C;  4YEJ A;  1Z3Y A;  1BI0 A;  3FDY A;  4ZDL A;  2ZO4 A;  2HVR A;  4HQE A;  3DKY A;  3RDI A;  3Q0W A;  2XRL A;  3S93 A;  1PUF B;  3BZ6 A;  4BXF A;  4II2 A;  4XBF A;  1T56 A;  1K83 J;  3EET A;  3PUF A;  2QGU A;  5H20 A;  3WHC A;  3L2U A;  2F5V A;  3ERE D;  1LEB A;  4B43 A;  1T38 A;  1PDN C;  5IT9 Z;  2ID6 A;  2JT1 A;  5LEJ A;  3ML6 A;  2PLY A;  4PFO A;  1WI9 A;  2YU3 A;  4U87 A;  2BXY A;  3HOX J;  3HOU J;  3KX2 A;  3JTH A;  4W1U A;  2MGQ A;  1X3Z B;  5F1R A;  2W1O A;  1IV6 A;  2GIV A;  1JGG A;  1FSE A;  3EUK L;  2DTR A;  4UUS A;  3LSG A;  1D1C A;  3PJR A;  1TQI A;  2LF8 A;  1ZAO A;  3GVA A;  1FYL A;  3S2D J;  4PZJ A;  2KIS A;  3K4B A;  5IOZ A;  3ZQ7 A;  2IVM A;  3IWF A;  2MC4 A;  5EGO A;  2CQX A;  2OTL I;  3LSM A;  4NNJ A;  2X1C A;  2HOT A;  4C30 A;  1GVJ A;  2A3S A;  2VT2 A;  2D1V A;  2MLK A;  2LRD A;  4A5N A;  3WTV C;  3E6D A;  5KAF C;  2W84 A;  3QU3 A;  4AWX B;  3KP4 A;  1MMG A;  2WAE A;  2XAH A;  5D8L B;  1SAN A;  3KP5 A;  2A6H F;  3CF2 A;  1XDS A;  1IDZ A;  2F5D A;  3V8L A;  1KA8 A;  4ZDP A;  2ZCW A;  2D5V A;  5CQG A;  2L9V A;  3V7C A;  1MBK A;  1J09 A;  5DD4 A;  1F43 A;  5FFZ A;  5FGM A;  4HV5 A;  3HIF A;  5FLX Z;  2CQK A;  4XLP F;  2Q1Z B;  3ZMD A;  3AG3 H;  4PJM A;  5ILV A;  2OJE D;  5K7F A;  1UHS A;  3FHZ A;  5CLS A;  2NVU B;  4IEJ A;  3FXQ A;  4ENM A;  3K4C A;  3S2W A;  4YRV A;  4RBO A;  1OLT A;  3IKV A;  3DBL B;  4E6K G;  1EJ9 A;  1U5T C;  2EBI A;  5DEQ A;  3L9F A;  5ERI A;  1BJZ A;  3ZRG A;  4A6E A;  3C7J A;  3GFJ A;  2IGO A;  1JKR C;  3CCV I;  2VB6 A;  3HXL A;  2EFN A;  2XGD A;  5DCM A;  1O3R A;  1R36 A;  4DW6 A;  3QPH A;  4BE2 A;  2A68 F;  2ZJ2 A;  3DTE A;  3LSK A;  1UZC A;  5GTH C;  1HKT A;  1O4X A;  4I0B A;  3TBI A;  4M3E A;  2H6B A;  1TZL A;  1Y39 A;  3DWL E;  1LE8 A;  1FBQ A;  4JX6 A;  3RKY A;  3PQJ A;  3U2R A;  5CQE A;  2B0L A;  3W2W A;  4YFX F;  2Q2E B;  5E17 F;  1OCR H;  2XF7 A;  2RGV A;  3H9Q A;  1FMV A;  2P8T A;  1QO0 D;  2EV6 A;  3ZP5 A;  2RNJ A;  2CMP A;  3DP7 A;  1LFP A;  1W1W E;  2HZD A;  2XHK A;  4PJ0 C;  3ZGK A;  3DEE A;  2ZXI A;  5GTI C;  2NVX J;  1XCB A;  2UV1 A;  3JRB A;  3OSG A;  3I56 I;  2QBY A;  2ACJ A;  4IX7 A;  2WC2 A;  3E5X A;  3KLO A;  2FNP A;  1R23 A;  2TCT A;  1L0O C;  4HOB A;  1GV5 A;  5F0F A;  1MZB A;  2JA5 J;  2DK8 A;  2XAF A;  3A02 A;  1MD0 A;  1WJF A;  3MEX A;  1X1P A;  3JSP A;  2AO9 A;  1IAW A;  2B9S A;  1VQ8 I;  3D0S A;  5BQT A;  1QVU A;  1SVL A;  3LSI A;  1KU3 A;  5ICC A;  3BG6 A;  3F8M A;  2M30 A;  2FBH A;  1AA7 A;  2MD0 A;  2GOM A;  3AKZ A;  4XKC A;  1TQP A;  2MYS A;  3N97 A;  2DPU A;  1YW8 A;  3H0D A;  4UV8 A;  1PP7 U;  2K86 A;  2OAZ A;  1ETW A;  2M7B A;  2OCE A;  3T8T A;  1G6N A;  2FA5 A;  3KEQ A;  4GYI A;  1EH8 A;  4UUS B;  2H1K A;  3WTU C;  4HF0 A;  3L1P A;  1IF1 A;  4GRI A;  4WXH A;  1VI0 A;  5L3E A;  5EEG A;  4XN3 A;  5D5W B;  4Y33 A;  1X3W B;  5EGO B;  3ESW B;  4IRG A;  4BQN A;  3PIO F;  1IC8 A;  1STZ A;  1SFU A;  2CO5 A;  1T98 A;  1LVK A;  4ENN A;  4OIR F;  2IA2 A;  3HYI A;  3M1E A;  1SFE A;  2HXI A;  3A4C A;  2EIM H;  3U1D A;  5LHI A;  2V1X A;  3HGG A;  5DV5 A;  3NAU A;  5FKN A;  1BOA A;  1XDU A;  2DOF A;  3BJ6 A;  3FMR A;  1ZG5 A;  2QWW A;  2R7T A;  4II3 A;  4N4O B;  4RS8 A;  3OYF A;  2JN6 A;  1BW6 A;  4M3G A;  3OYE A;  1U78 A;  1MMD A;  1MNE A;  5LHH A;  2ZXJ A;  1D3Y A;  1BC7 C;  1LNW A;  2H09 A;  3H92 A;  3MCZ A;  4BKX A;  1M1E B;  1JKP C;  1V3F A;  2HVS A;  3L2V A;  1IO2 A;  4OIP F;  4MEY F;  3WHB A;  3P9I A;  4UXN A;  3FK6 A;  2DMU A;  1B59 A;  2STW A;  2VQC A;  4D9J A;  2L2O A;  1QZY A;  2CGP A;  2CV0 A;  1T0F C;  4KDP A;  3CQZ J;  1AKH A;  4CZC A;  1ETX A;  3E97 A;  3A01 B;  2VBY A;  2K5C A;  1EH7 A;  4V2G A;  1ZKG A;  2OTJ I;  3ZQF A;  3ISP A;  2JVH A;  3GTM J;  2EPF A;  2BBY A;  2XAJ A;  4ESB A;  2HS5 A;  4NC7 A;  2BV6 A;  1T39 A;  1B72 A;  5ICG A;  3R61 A;  5DTD A;  3F6O A;  1TL8 A;  3MVP A;  1I1G A;  4BS9 A;  3FX3 A;  2FEZ A;  4ZYE A;  1KGS A;  2GOX B;  5CVI A;  2JZY A;  2DT5 A;  3KZY A;  2LTP A;  2OPT A;  1GXQ A;  3G4S I;  3SEQ A;  2LLK A;  4AVZ A;  3J81 K;  1HBX G;  4LOC A;  2R7F A;  1G2H A;  2AXL A;  4QPO A;  4B4C A;  4GCV A;  2L9R A;  3C1D A;  2HYG D;  4XLH A;  2E5N A;  1IUY A;  2PQ8 A;  2M87 A;  1U6G A;  3PSI A;  2DBB A;  3KET A;  4C2M J;  3CF5 F;  2XKO A;  1K6O A;  1DU6 A;  2X0L A;  2QA4 I;  3QU6 A;  4ZYH A;  4XKB A;  3DEU A;  1VQM I;  3FK7 A;  5K7Z A;  3J7Z I;  1GXP A;  2KT0 A;  1R5H A;  2VKV A;  4G6D A;  1LB2 A;  3ZMU A;  4ZYG A;  2WB1 A;  1OQY A;  3O6B B;  2XGX A;  4LMY A;  3Q3S A;  2QBY B;  1WWX A;  1LPQ A;  3JTG A;  3LSP A;  1SAU A;  4HNU A;  3OV8 A;  2E2I J;  3JAM Z;  4B47 A;  3OYJ A;  3DPL C;  1W5S A;  4YII A;  4E70 A;  4LD5 A;  2L5Q A;  2MH9 A;  2K9Q A;  2LNB A;  1LQ1 A;  1PYV A;  2A6E F;  2IBD A;  1QHG A;  4AYB A;  2V26 A;  2BZT A;  2VQL A;  1ZH5 A;  2CYY A;  4BQQ A;  2XB5 A;  3I71 A;  2M4K A;  5GP9 A;  1IRF A;  3T5X A;  2QKL B;  2K4B A;  1B4A A;  3M4O J;  2HYJ A;  1XTA A;  2PBI A;  3GTQ J;  3RZO J;  2DJN A;  1TBX A;  3G73 A;  4XKV A;  2A69 F;  4GXO A;  4AUX A;  3QYB A;  4RGS A;  2B7E A;  1U9O A;  1OPC A;  1XGN A;  5LLQ A;  1R4M B;  1H9G A;  1YYV A;  4NHJ A;  3KP7 A;  1B8I A;  1A6I A;  2R92 J;  5KK1 A;  3LSH A;  2I5U A;  2LKS A;  2VJI A;  3S3O A;  4CCN A;  3ZN1 A;  1QPI A;  2DA4 A;  5IYD J;  4QLC U;  4L5I A;  1JUM A;  5C4X J;  3I5U A;  5IT9 K;  1WH7 A;  2CG4 A;  2L7Z A;  2VJ5 A;  3PQK A;  3AL0 C;  4ZZL A;  2BOL A;  4QWQ A;  1YOV B;  1KYW A;  4LLL A;  4BH9 A;  3HOY J;  2AS5 F;  1N78 A;  3OIP A;  1D5Y A;  3H5N A;  2ZME A;  5TJJ A;  4EEF G;  3RQI A;  5JI6 A;  2KZG A;  1FYM A;  3GTL J;  4RM3 A;  5EDN A;  4BHP A;  2JA7 J;  5FRM A;  1HC8 A;  5CVJ A;  4CYC A;  4UVA A;  2JWT A;  3G71 I;  1WGX A;  3AAF A;  2MC3 A;  4EAT A;  2DA6 A;  4ESJ A;  4PJN A;  2Z1D A;  2K4J A;  2Z5U A;  1RI7 A;  3I4M J;  3OYK A;  3ASO H;  3CUQ A;  4XID A;  2OF7 A;  1YO5 C;  1KU9 A;  1MBF A;  2LY1 A;  4Z2Y A;  2Y0S N;  4I01 A;  2FU4 A;  2HEO A;  2Y30 A;  3FM5 A;  1Y8R B;  4G12 A;  2IS1 A;  5HVQ C;  2O03 A;  4AM3 A;  1SMY F;  4U7B A;  4O5V A;  3I4P A;  4LB6 B;  4EJW A;  2O0Y A;  1MDM A;  2NOG A;  4L5E A;  4HRI A;  4HQM A;  3WGG A;  3OYB A;  4XSX F;  4WWC A;  1MSE C;  1OCZ H;  3VOD A;  1NH3 A;  3WTY C;  2WWY A;  3CJN A;  3K9T A;  2JMW A;  1B72 B;  5FLX K;  4O3M A;  3VEP A;  5EF6 A;  2FOK A;  1VQN I;  1FJL A;  2L0K A;  1EH6 A;  3P5J A;  3QPL A;  3GFI A;  6PAX A;  3D1N I;  4DBQ A;  3MAJ A;  2DTZ A;  1O7L A;  1POG A;  2HOA A;  5LEK A;  1P7J A;  3BTI A;  4LGW A;  3OOU A;  3KYC B;  1W0U A;  4N9H A;  1LDJ A;  4IL6 C;  3F6V A;  1RNL A;  2HQN A;  1I50 J;  4F92 B;  1D5V A;  2WAQ A;  2OD5 A;  2HYF A;  3K0L A;  3B73 A;  4U88 A;  5B1B H;  1VQ7 I;  4R1H A;  5M3M J;  2K40 A;  5F1J A;  2ETH A;  1Y0N A;  2CRG A;  5HOO A;  4M73 A;  2BEO A;  1ACI A;  2FD5 A;  4PJL A;  5HDN A;  2DT6 A;  3HHG A;  1WJE A;  3WU0 A;  1WSU A;  2HPM A;  1YX3 A;  1WZ2 A;  4NDL A;  1B6A A;  1U8B A;  1ZLJ A;  1Z0X A;  2V6C A;  2PX9 A;  4KIG A;  1J5Y A;  1SVM A;  3E6C C;  1JT0 A;  3CJT B;  4MIM A;  1UAA A;  5J4Y A;  2UWM A;  5E3N A;  3UNG C;  1ZQ3 P;  1JTX A;  4HLY A;  2R5Y A;  1BA5 A;  1U0J A;  2PMU A;  4P96 A;  3IV5 A;  2CV1 A;  4LK0 F;  2XPV A;  2KL4 A;  3RKW A;  1OYI A;  2LR8 A;  2V9K A;  3D5R C;  4S05 A;  4IHV A;  2HOS A;  5EJC A;  4CA0 A;  4UNO A;  2YS9 A;  1QU3 A;  3COA C;  2M9H A;  4JBA A;  1N75 A;  4MGR A;  3C18 A;  4IHX A;  1GLN A;  1FPQ A;  2E19 A;  5D4R A;  4I09 A;  2UUZ A;  4M72 A;  1U5T A;  5JFR A;  4A69 C;  3BG3 A;  4OIQ F;  2QUF A;  2VXD A;  2QSF X;  1VFC A;  3RYP A;  2KIF A;  3A2K A;  3IH3 A;  2DA7 A;  3ZMZ A;  1YW9 A;  2VI6 A;  5M5W J;  3M8J A;  2HWV A;  4CCM A;  2DA1 A;  3S3M A;  4OWR B;  1LDK B;  2NS7 A;  4A0X A;  3OIO A;  1YI2 I;  4Y52 J;  5J1R A;  3V7R A;  5D8K B;  2ME6 A;  5IP9 J;  4A3L J;  3RSN A;  4XRM A;  4MQ9 F;  3GZN B;  1G4D A;  3VYT B;  2W25 A;  4CYC B;  3ABL H;  3HPG A;  4ITV A;  4OIN F;  3GTP J;  2XRO A;  3SDB A;  3QRF F;  1YW7 A;  4JK1 X;  4LIV A;  4QTR A;  1YX5 A;  3HKZ A;  4CGZ A;  3CC7 I;  2XSJ C;  1OJL A;  2QVO A;  1IN5 A;  2CH0 A;  3OYM A;  3TW6 A;  2ZJR F;  4L5J A;  2NVY J;  4BE0 A;  4H0E A;  4FX0 A;  4I76 A;  2M5W A;  3NQO A;  2GBY A;  3DLL F;  3OSF A;  3JW4 A;  4L0Y B;  3SZP A;  5E8I A;  2MBF A;  1MDM B;  1F4K A;  4XQF A;  5L3G A;  2EFQ A;  4KIT B;  2W24 A;  1XD7 A;  1BOB A;  2G9W A;  1UCR A;  2HTS A;  3K4N A;  4RGR A;  3DCF A;  3MMY B;  4MNU A;  1CGP A;  2P6S A;  2HVQ A;  4Y4R A;  4MHG A;  4AD9 A;  4KMU X;  3LA2 A;  4RLF A;  3KPH A;  2R7D A;  1R1V A;  4HAM A;  2CW8 A;  3W6V A;  5DM7 F;  5ILS A;  1JUP A;  2HOE A;  3DKX A;  1CF7 B;  2WB1 N;  2E1N A;  4A3I J;  3TW7 A;  2H6C A;  1BR4 A;  2JRT A;  3JRI A;  3IWZ A;  5K5R A;  1YG2 A;  4CCO A;  3E7L A;  3DTI A;  4EVI A;  1KQ0 A;  4IQ4 A;  3HSF A;  1YIJ I;  2RDP A;  2ECC A;  1O57 A;  1B9M A;  1TWH J;  2CS3 A;  3TQN A;  1OCT C;  5FRO A;  2COB A;  1HW2 A;  3PFY A;  3ASN H;  3CDL A;  4KT5 C;  2ZNZ A;  1P92 A;  2FQ4 A;  3M07 A;  1JI8 A;  5ILU A;  1BW5 A;  2F5F A;  5F64 A;  2HGC A;  2J5O A;  2R7Z J;  2V79 A;  2HU9 A;  2VJ4 A;  3ZCO A;  1RC9 A;  3RCO A;  1BIB A;  2Q8K A;  5AIP A;  1QZE A;  3H9J A;  2V7F A;  1EKE A;  4QSH A;  1S7A A;  2CQQ A;  1IRG A;  2XAS A;  1F9N A;  4A0Z A;  1T0F A;  2O8X A;  1ON1 A;  4A3G J;  2LSO A;  4PCQ A;  4F91 B;  4M9S A;  3CCJ I;  1JGS A;  5HS9 A;  1BN5 A;  2I8D A;  3OIQ A;  1RKT A;  3JAM K;  3O2P E;  3W6J B;  3KZI C;  4QIW N;  2Z9O A;  3FBN B;  1U5T B;  2VOP A;  1LFB A;  1Z05 A;  4XSZ F;  5ICF A;  3DEW A;  2EH3 A;  1MNM C;  3B6A A;  2CU7 A;  2V4J C;  3CD6 I;  1MKM A;  1LVA A;  1Y1V J;  2M7A A;  1WQ2 A;  1HW5 A;  1TW2 A;  2ELJ A;  2JPC A;  3GWZ A;  4IRH A;  1Z91 A;  2HDC A;  2AQF A;  4IRI A;  1GDT A;  3BG7 A;  3J80 Z;  2ICW G;  1VQP I;  3FZV A;  2EJR A;  2IJL A;  5AIQ A;  1HOM A;  2HNH A;  3F21 A;  4L9N A;  2DK5 A;  2ZFW A;  3AG4 H;  3ZMS A;  5KHD A;  1HA8 A;  3ONQ A;  2X6O A;  2EZL A;  4Q48 A;  5C3E J;  4L9V A;  3WU1 B;  2QF7 A;  2E1O A;  4UUT A;  2KPM A;  4Q4Z F;  2E7X A;  2O3F A;  3K1M A;  1TC3 C;  1P4A A;  3LST A;  4EJT A;  2P0W A;  3BCB A;  1WFX A;  2RC4 A;  3U9G A;  4FE7 A;  4BNC A;  4C2U A;  4CHU A;  3H35 A;  5K1Y A;  1R4N B;  2ZKZ A;  1A35 A;  1PP8 F;  3J7A O;  1S7O A;  2LKP A;  3ZN0 A;  2DA2 A;  1UEL B;  5HDG A;  3E6B A;  2L9S A;  1I27 A;  5TGT A;  2V1D A;  1IRZ A;  2XIG A;  1R22 A;  3HOS A;  1G3Y A;  4I6Z A;  1T2K A;  2WAQ N;  4NBQ A;  3WTT C;  1ZR4 A;  4KN4 X;  4RAZ A;  1FYK A;  5IP6 A;  3M1C A;  3GZ5 A;  1NG7 A;  3FXL A;  4FAS D;  3OYL A;  3REO A;  4R79 A;  3WGH A;  2F4O B;  3ZQH A;  5TIS C;  1WPK A;  4JQF A;  3KEO A;  4ZYD A;  3MWM A;  4BAC A;  3BR2 A;  1WRJ A;  2Y0S A;  1D8J A;  2MA3 A;  4C3H J;  4B48 A;  1IJW C;  5JHU A;  2M3A A;  2MG4 A;  4BHC A;  5FO5 A;  3L7W A;  2LKX A;  2BW3 A;  1HW1 A;  1UJ8 A;  4LG0 A;  3BP8 A;  2JRM A;  2YX7 A;  4RB2 C;  1I3A A;  2NNY A;  4ASN A;  4DQ2 A;  4Y7N J;  1FP1 D;  2OZ6 A;  2VKD A;  2LYC A;  3HOW J;  2WTE A;  5M3F J;  4XIC A;  4DIQ A;  4EM2 A;  4J19 A;  1DPR A;  1QHH D;  5FKK A;  2VE9 A;  1RRJ A;  3ABK H;  5CPR B;  4TV7 A;  3LSR A;  2EA2 A;  4KUM A;  3LQR A;  2TRT A;  4ZZD A;  2GXA A;  3RIR A;  4ETS A;  1SFK A;  2ZFU A;  2R93 J;  3ZXS A;  3QP5 A;  2DDB A;  1O3T A;  1IUF A;  3OYA A;  4MTE A;  3QYE A;  2UXN A;  3TDZ C;  3TMO A;  3OS2 A;  2QZ8 A;  1H0M A;  3BPX A;  3F3X A;  3V42 A;  3H5A A;  4PDK A;  1SFO J;  1SVO A;  2JSC A;  3Q9V A;  3PNV A;  4Y15 A;  3OYC A;  2VUM J;  4NUB A;  3JRE A;  3MQ0 A;  4PJJ A;  1YIO A;  3S8P A;  3OR1 C;  2EQR A;  4P1W A;  3SDG A;  3JCU C;  3RKQ A;  3JRA A;  2XKP A;  1FIA A;  2KLO A;  2P5L C;  3BTL A;  2XVC A;  1IXR C;  4LK1 F;  4P5O A;  2R7R A;  2H8R A;  2XC7 A;  3JRF A;  2WA0 A;  4C9Y A;  4G6Q A;  4KJZ A;  4KN7 X;  5IP7 J;  2X4H A;  5FKO A;  3LOC A;  3CMY A;  3HKZ N;  2FRH A;  3CJR B;  1J0R A;  4LJZ F;  1JXS A;  2L7M P;  4JP0 A;  1WKM A;  2DMQ A;  3KIO A;  4PSW A;  4A6D A;  2E2H J;  1Y0U A;  5JR3 A;  3BJO A;  3CTA A;  4QPQ A;  3AG2 H;  1ERD A;  1V55 H;  3FKJ A;  1ODD A;  1TNS A;  5F08 A;  1G3T A;  4MEX F;  1FIP A;  1OFC X;  2L54 A;  5BOX A;  2P4W A;  1IN7 A;  2R7Q A;  1JHH A;  1BI1 A;  2DMP A;  2C6Y A;  2ZB9 A;  2EZK A;  3H36 A;  4HF2 A;  4XN0 A;  5D5V B;  2VC1 A;  4KFC A;  2VBZ A;  2DMT A;  1HLV A;  1JKO C;  2HZT A;  4Y17 A;  5EZG A;  4CDG A;  1ZG1 A;  1GHC A;  4UY8 I;  1OR7 C;  2E60 A;  1XSV A;  2DW4 A;  3Q0U A;  5B3S H;  5BS6 A;  3Q5F A;  4I98 B;  1LJ9 A;  4XK4 A;  1KQ9 A;  3HHH A;  5J8C A;  2DI3 A;  4XRF A;  5E1X A;  1ENH A;  3IUO A;  4LIU A;  1VND A;  1P9Q C;  3AFH A;  1R7J A;  4DYC A;  2VT3 A;  1JJ6 C;  1L3L A;  3U21 A;  1XB4 A;  4PUS A;  2OZU A;  4XOP A;  2QKM B;  1S7E A;  2VBX A;  2H8W A;  2P5V A;  2DQR A;  3ZQQ A;  3IRQ A;  2IP2 A;  1UFM A;  2A6T A;  2X48 A;  2WY8 Q;  4BXU A;  3BC8 A;  4D5C A;  4D7M A;  2LF7 A;  3H3Z A;  3HBL A;  4G9Y A;  4HST A;  2BHY A;  3KP6 A;  3WG9 A;  4E7L A;  4EM0 B;  2KRH A;  1XN7 A;  2F4I A;  1S29 A;  3CMM A;  5DCM B;  4B3X A;  1N77 A;  4CO8 A;  1WI3 A;  3MKY B;  2JA6 J;  4AIJ A;  2B63 J;  2PMH A;  4RB1 A;  3PO3 J;  1XG1 A;  2HXO A;  2X9D A;  1Y6I A;  3CUO A;  1A5J A;  2XDV A;  3VSL A;  4UUV A;  1LE8 B;  4LG0 B;  2PI0 A;  1YS7 A;  3LL7 A;  1VQ6 I;  4K2E A;  1I39 A;  2IXS A;  4BU2 A;  4JOM A;  1K61 A;  3LA3 A;  1R5G A;  1VF9 A;  4ZTF A;  4S04 A;  3IL2 A;  4D5F A;  3A03 A;  3K4J A;  4FHT A;  1Y1W J;  3FM3 A;  3KZZ A;  1G3W A;  3P7N A;  5DCF A;  4WCG A;  3HJE A;  5E3M A;  2FJ1 A;  4HLX A;  1K78 A;  2FML A;  3K6G A;  1QNT A;  3QQA A;  5LHG A;  5CKT A;  1P4W A;  1ZYR F;  1G3S A;  1OIS A;  4ENJ A;  4NB5 A;  3BR5 A;  3HZJ A;  3IH2 A;  3T8R A;  3S1M J;  5K7H A;  3DBR B;  1UG2 A;  1ZAR A;  3CCS I;  2W48 A;  2XPU A;  4RLQ A;  3BR3 A;  2UZK A;  2CQ7 A;  3BZC A;  2HR3 A;  5E79 C;  1FOW A;  2WV1 A;  5J47 A;  2CW7 A;  2HDW A;  3H0G J;  3W6K B;  5DS9 A;  4BDZ A;  3RPU D;  2O61 A;  3M7G A;  2Q0O A;  2V9P A;  3V8K A;  3BTJ A;  3WG7 H;  3CCE I;  4YEL A;  4AID A;  2DOA A;  3V8J A;  2P81 A;  5J3L A;  1TT0 A;  4F7Z A;  3G6E I;  4GFB A;  2CUE A;  2X51 A;  3BPV A;  1UG0 A;  1X3U A;  1R1T A;  2OC6 A;  1FTT A;  1ZHF A;  3FXR A;  4IHY A;  3G1M A;  2EV0 A;  4HDU A;  2EA4 A;  3F8C A;  2FNA A;  1U8R A;  1ULY A;  1YS6 A;  5DM6 F;  4EGZ A;  3HG9 A;  3VB2 A;  1X1C A;  1V5F A;  2KJB A;  2R0Q C;  5CVU A;  2RV8 A;  4FTH A;  3S3N A;  2DU9 A;  4S0H B;  2V6E A;  1IN6 A;  1SD5 A;  2M4G A;  4RMN A;  4M71 A;  1DGR M;  4HW0 A;  2BHZ A;  1E3O C;  3BDD A;  1ORK A;  3LAJ A;  3NEU A;  1FOX A;  3CCL I;  3J80 K;  2O8K A;  3K10 A;  3Q0V A;  5C4J J;  2F4M B;  5DYM A;  4W97 A;  2PEX A;  3PNT A;  4KIB A;  4CSW A;  2YUS A;  4PFP A;  2EK5 A;  2HTJ A;  2LVS A;  4CCL A;  2OA4 A;  1FOY A;  5F27 A;  2I10 A;  4KIC A;  1FBS A;  1ONV A;  3LSJ A;  3D5L A;  4BDY A;  1DPU A;  3F23 A;  3M8E A;  3BG5 A;  2QQB A;  4X6A J;  2PFB A;  1DGW Y;  1TP4 A;  3HUG A;  1AKH B;  1WJA A;  1DUX C;  1QPM A;  3SZT A;  3FMQ A;  5L3B A;  2QEX I;  2Y31 A;  4JX5 A;  2ECB A;  2G7U A;  4XLC A;  3L2R A;  2DQL A;  2LMD A;  4GDF A;  3RI4 A;  2OU2 A;  3O8G A;  4IOC F;  4CCK A;  1V5E A;  5H6Q A;  1YLF A;  3R0J A;  2JA8 J;  2R7V A;  5DD8 A;  3HTU A;  1ZK8 A;  2QYO A;  3PO2 J;  2HPI A;  2ZSH B;  1A04 A;  1XCV A;  2LY9 A;  1K7A A;  1KQ8 A;  2EFO A;  3TED A;  1JT6 A;  2XF6 A;  1O3Q A;  4IO9 F;  3BLY A;  5LFA A;  5GAE J;  2BY3 A;  1U3E M;  4U0Y A;  2RN7 A;  5K5O A;  2BXZ A;  4OAY A;  2FUG 2;  2X6Y A;  2MAB A;  3QOP A;  4E4H A;  5D6E A;  2K9L A;  2E1M C;  1Q1V A;  3S2H J;  4HX8 A;  3EUA A;  1E3P A;  3QP6 A;  5LBQ A;  3EPZ A;  2D2W A;  3MKZ A;  3CMA I;  1JUS A;  3L2C A;  2VIX A;  1K78 B;  3CDH A;  2AQE A;  1SFX A;  3EDP A;  1S3J A;  2O6G E;  3HRT A;  4HPQ A;  5FB2 A;  1W36 C;  4ESF A;  2A5Y B;  3FHN A;  2ZJQ F;  2DJI A;  4KMF A;  2XAQ A;  1BL0 A;  5DDG A;  5E3L A;  1JE8 A;  2DLL A;  2V1N A;  3DPT A;  2LD5 A;  2IRF G;  3KEY A;  2IEK A;  2DAO A;  4KIS A;  3N05 A;  3G1O A;  3WTW C;  3BR1 A;  2ZBK A;  3HL2 A;  3FIS A;  1H88 C;  3BRO A;  1J75 A;  2H27 A;  2L7F P;  2M34 A;  2WAF A;  1J59 A;  1HF0 A;  1WJ5 A;  3JR9 A;  4AIK A;  2LBF A;  4RA2 A;  5LD2 C;  1JJ8 C;  1XGS A;  4WF2 A;  1QQI A;  2A61 A;  2DDA A;  3ZQL A;  2ESH A;  3GO5 A;  4M6X A;  3AG1 H;  4N0B A;  2X1E A;  1OCP A;  2GA1 A;  2DYR H;  5EZH A;  4RAF A;  3CLO A;  1SD6 A;  1B8I B;  2QM3 A;  1DP3 A;  4M9X A;  2Z99 A;  1YJN I;  1FEX A;  2KHM A;  2MFZ A;  2RQP A;  3LNQ A;  3ZOB A;  4BQA A;  2FMY A;  2OBP A;  1ITY A;  2KQR A;  4PK4 A;  1VQK I;  2P7V B;  4M3F A;  3BWG A;  3S16 J;  1SAX A;  1MBE A;  1ETQ A;  2W82 A;  3A0H C;  1T6S A;  2MH2 A;  5J1U A;  2VLA A;  1GT0 C;  3HTS B;  3V4G A;  4G7H F;  5IT3 A;  5FJ8 J;  4HG2 A;  4BL0 B;  3EUH C;  1GV2 A;  1P2F A;  3QOE A;  2ZME B;  3GBG A;  4Q5S F;  1A31 A;  3LA7 A;  1ETO A;  1MJA A;  4D0P A;  5CYV A;  1W0T A;  2O7O A;  3L00 A;  2Y9Z A;  2MW8 A;  2RNG A;  3ULQ B;  3DF8 A;  1APL C;  2L7K A;  3U1K A;  2W85 A;  1HDP A;  1HSJ A;  3T1B A;  3QYF A;  5H2F C;  3FXU A;  1X2N A;  3IAS 2;  2A07 F;  2QLZ A;  5H6R A;  4N4N B;  2Y48 A;  4J00 A;  4GO1 A;  2KP6 A;  5A2Q Z;  1MJ9 A;  2HDD A;  2K3P A;  3CUQ B;  4DYR A;  3FF5 A;  2PMZ N;  2IW5 A;  3ZQI A;  4B09 A;  2JA2 A;  2DPD A;  2DOD A;  3ABT A;  1USS A;  2HI3 A;  3GW2 A;  3OYN A;  2PJP A;  3C3W A;  4MFD A;  3S1Q J;  1MJB A;  3FXM A;  2GAU A;  4ANJ A;  4EJU A;  3CO7 C;  4N9I A;  3DBH B;  1X4O A;  3K2Z A;  1MSF C;  3C2H A;  3L2W A;  5K5Q A;  2Z16 A;  3E5Q A;  3F8N A;  2BVL A;  4LIT A;  3RPU A;  5J8F A;  2ID3 A;  1XX5 A;  3WE2 A;  2LG4 A;  4EQQ A;  4RDU A;  5CVV A;  3OY9 A;  3PIP F;  3W2A A;  2WV0 A;  2DFF A;  1RUN A;  1QRY A;  1Z67 A;  4UVB A;  1H8A C;  1ZGA A;  5GPC A;  4G7Z F;  2NXN B;  3RTR A;  3KYL A;  1W36 D;  2WBM A;  2XV4 S;  2XUB A;  4BE1 A;  4RM2 A;  1XS9 A;  1MMS A;  1XGO A;  4BY1 J;  1I1S A;  2IAI A;  4L9J A;  2PG4 A;  5FD5 A;  4AC0 A;  2NNN A;  1SC7 A;  5FRN A;  3NWT A;  4A3K J;  1XC5 A;  3OS1 A;  1IG7 A;  3MKW B;  3GFM A;  4AIH A;  4OIO F;  1YQA A;  4CCJ A;  2CJJ A;  1XMX A;  2OQR A;  4C3J J;  4OU0 A;  4NC8 A;  2ESN A;  2EZI A;  4G7O F;  2RKH A;  4WK8 F;  2K02 A;  3A1Y A;  5LGU A;  3G2B A;  1O3S A;  3LMM A;  4V2F A;  3EYI A;  4KYW A;  3GF2 A;  4IVN A;  1OCO H;  1OR7 A;  3ERM A;  1EA3 A;  1BIA A;  5F04 A;  3WTX C;  3K69 A;  2LBF B;  2EIN H;  2KDO A;  5J1Y A;  2ZXW H;  1XSD A;  3TP0 A;  4RGX A;  4HX7 A;  1BM9 A;  1ZRD A;  2K9N A;  2R5Y B;  1SD7 A;  3BG9 A;  5LGT A;  5LRR A;  1D8K A;  5KVR A;  4DZP A;  3K7A J;  1VQO I;  2GQQ A;  2CQN A;  5IY5 H;  2BE5 F;  2L01 A;  1Z7L A;  5E18 F;  2P7C B;  4DNC A;  1FSH A;  2LY2 A;  2QEN A;  4I7H A;  4HNT A;  1MMA A;  3LQQ A;  4KA4 A;  3TKY A;  4A3M J;  2JUC A;  2D45 A;  1ZTR A;  2EIJ H;  3GEZ A;  2X6X A;  2FSW A;  2LRE A;  2J5P A;  3VOE A;  2H94 A;  1T33 A;  1TWG J;  3R60 A;  1RET A;  4M3B A;  2XF5 A;  2PJR A;  1AOY A;  2DXI A;  1U9N A;  1X19 A;  2GWR A;  1RKW A;  3VYR B;  3K4K A;  1UB9 A;  2JQ7 A;  2VPL A;  3RJP A;  2R5Z A;  1MIJ A;  3CDI A;  1PUE E;  2R4G A;  3I58 A;  3KP2 A;  4OMZ A;  3KCC A;  4M9Z A;  1ETY A;  1I6H J;  4MFE A;  2QSG X;  4DZJ A;  1I3Q J;  2L4A A;  1RZ4 A;  3BJA A;  3WGI A;  1BR2 A;  2E1C A;  2XB0 X;  2RQQ A;  4M74 A;  3CJQ B;  3CCQ I;  3ROU A;  2BY0 A;  5B66 C;  3FXK A;  1R58 A;  4YG2 F;  2HKX A;  3VWB A;  5JVT A;  4HA8 A;  2HQ5 A;  1Z9C A;  5IPA A;  2Y75 A;  2DMN A;  2IT0 A;  4HZF A;  3BT9 A;  1R00 A;  4UB8 C;  1W5C C;  4OMY A;  2F6C A;  3VPR A;  2OV7 A;  3CLQ A;  3SFZ A;  1X1A A;  1K4T A;  4J01 A;  2NVQ J;  2BYV E;  4BUP A;  1U2W A;  1NK2 P;  1HQC A;  4I99 C;  4XNF A;  1TWF J;  3GCM A;  4XL9 A;  2GA2 A;  3LWF A;  2VOD A;  3R4K A;  4PGH A;  3CZ6 A;  2P5K A;  2KDZ A;  3G1L A;  3A0B C;  4XMY A;  3C2G A;  3T0Y A;  3K1P A;  2EIL H;  3GTG J;  1R5I D;  3FXJ A;  2M8G X;  2LC2 A;  3CP2 A;  3HM5 A;  5JLW A;  3A01 A;  2R7X A;  1NTC A;  2IGK A;  2JUG A;  2XAG A;  1UST A;  1YE9 A;  2CUF A;  2VJJ A;  4A5M A;  1ZGJ A;  5HS8 A;  4RAY A;  3F9K A;  2FBK A;  2GZW A;  1F5T A;  2X85 A;  3H9G A;  3PUB A;  4A93 J;  3QAH A;  3E6M A;  4KT6 A;  4BJT A;  1Y56 A;  5IOY A;  3M3Y J;  4RB0 A;  1IW7 F;  4WXD A;  2F5C A;  3IAM 2;  1MGT A;  3O3K A;  2MLG A;  1Z1D A;  3DU5 A;  3M9A A;  1WCM J;  2RVC A;  1KZH A;  3BQY A;  1J9I A;  1W7P D;  2BY1 A;  2UXX A;  4EV0 A;  2YR2 A;  3VSK A;  3BZK A;  2WAD A; 
#chains in the Genus database with same CATH homology
 1ZGW A;  2FD5 A;  3BR5 A;  3IH2 A;  3S1M J;  5K7H A;  1UG2 A;  1TWC J;  2W48 A;  3RZD J;  2XPU A;  3BR3 A;  3ZQG A;  1CQT A;  4NDL A;  1U8B A;  2WV1 A;  3H0G J;  5DS9 A;  3JRG A;  1Z0X A;  2MSY A;  3BTJ A;  5F0H A;  1JT0 A;  4MIM A;  2P81 A;  5J3L A;  5E3N A;  2DA3 A;  1ZQ3 P;  4GFB A;  1MH3 A;  1JTX A;  2CUE A;  4B3A A;  2R5Y A;  1BA5 A;  3IV5 A;  4FE4 A;  2XPV A;  2LR8 A;  1FTT A;  4IHY A;  4IHV A;  3G1M A;  2HOS A;  3Q0W A;  1IDY A;  2XRL A;  2YS9 A;  2DN0 A;  3PM1 A;  1PUF B;  2M9H A;  4M6V A;  1Z77 A;  4IHX A;  2M0C A;  2E19 A;  1T56 A;  1K83 J;  3WHC A;  5BNG A;  4A69 C;  2NS8 A;  3BG3 A;  4XRS A;  3NAR A;  2R0Q C;  2R5Z B;  4A3B J;  1VFC A;  4FTH A;  4S0H B;  2ID6 A;  3IH3 A;  2DA7 A;  1E3O C;  3MKL A;  2VI6 A;  1ORK A;  2Y2Z A;  3HOX J;  5M5W J;  3HOU J;  2N8G A;  4W1U A;  2MGQ A;  2DA1 A;  1IV6 A;  4BY7 J;  2NS7 A;  1JGG A;  2O8K A;  4UUS A;  1MBJ A;  3LSG A;  3Q0V A;  3S14 J;  3OIO A;  4MO7 A;  3S2D J;  5C4J J;  4Y52 J;  5J1R A;  4W97 A;  5IOZ A;  2ME6 A;  5IP9 J;  4A3L J;  4XRM A;  4D7N A;  2YUS A;  2AHQ A;  5EGO A;  2CQX A;  4CYC B;  2LVS A;  3GTP J;  5F27 A;  4BBR J;  5M5Y J;  2I10 A;  2HOT A;  3LSJ A;  4QTR A;  4X6A J;  3BG5 A;  2Y9Y A;  3HB9 A;  2XPW A;  4M3D A;  1AKH B;  4IHW A;  1OJL A;  3TW6 A;  1SAN A;  2NVY J;  2Y31 A;  4JX5 A;  1IDZ A;  2ECB A;  4I76 A;  2D5V A;  3OSF A;  2GBY A;  1MBK A;  1R9T J;  1AHD P;  2NVT J;  3O8G A;  3HEF A;  5EG0 A;  1F43 A;  1TWA J;  2DA5 A;  2JA8 J;  1ZK8 A;  3PO2 J;  3DCF A;  5K7F A;  2LY9 A;  4A3J J;  1IGN A;  1UHS A;  3TED A;  1JT6 A;  4BBS J;  4IEJ A;  3W6V A;  1JUP A;  2WB1 N;  3I4N J;  4RBO A;  4A3I J;  3TW7 A;  3JRI A;  2EBI A;  1BJZ A;  3E7L A;  1Q1V A;  2GLO A;  5IYC J;  3S2H J;  1JKR C;  3HGY A;  2XGD A;  4DW6 A;  2ECC A;  1JUS A;  2GM4 A;  1TWH J;  3S17 J;  1O4X A;  1OCT C;  2COB A;  4M3E A;  3CDL A;  1LE8 A;  4JX6 A;  3GTK J;  2FQ4 A;  2XGC A;  3BR0 A;  5E3L A;  1BL0 A;  4A3C J;  2LD5 A;  1BW5 A;  2IEK A;  2R7Z J;  3G1O A;  5EYR A;  3BR1 A;  3BR6 A;  3FIS A;  1H88 C;  1X2M A;  2L7F P;  2M34 A;  2EZH A;  1HF0 A;  4QSH A;  2CQQ A;  3JR9 A;  2LFB A;  2NVX J;  1JJ8 C;  3JRB A;  3OSG A;  4MLO A;  3ZQL A;  2G0E A;  4A3G J;  2K9S A;  5F0F A;  2TCT A;  1GV5 A;  2JA5 J;  1RKT A;  1OCP A;  3A02 A;  4X1E A;  5EZH A;  4QIW N;  1B8I B;  2AO9 A;  1LFB A;  5C44 J;  1QVU A;  3JRD A;  1FEX A;  3DEW A;  2EH3 A;  3LNQ A;  2CU7 A;  3B6A A;  3ZOB A;  1MNM C;  5IYB J;  1RPW A;  1Y1V J;  2YU9 J;  3TP3 A;  1ITY A;  4DYQ A;  1DU0 A;  1MH4 A;  4M3F A;  3S16 J;  1MBE A;  1ETQ A;  3FIW A;  5J1U A;  1GDT A;  2JK3 A;  2XSD C;  1GT0 C;  1ETW A;  5FJ8 J;  1GV2 A;  4UUS B;  2H1K A;  1HOM A;  3GBG A;  3L1P A;  5E3O A;  1ETO A;  1HDD C;  1W0T A;  1VI0 A;  3QPS A;  3F0C A;  2O7O A;  1EF4 A;  4JX4 A;  3FKI J;  2Y9Z A;  2MW8 A;  4C3I J;  5EGO B;  4BXX J;  1APL C;  1IC8 A;  1YRN A;  3HDD A;  2X6O A;  1WH5 A;  2EZL A;  1HDP A;  5C3E J;  3K2A A;  3C2B A;  2QF7 A;  2E1O A;  4UUT A;  9ANT A;  1X2N A;  2LK2 A;  2HXI A;  1TC3 C;  1LFU P;  2HDD A;  3HGG A;  5FKN A;  3NAU A;  4DYR A;  2PMZ N;  3ZQI A;  4FE7 A;  2JN6 A;  1BW6 A;  4M3G A;  3HOV J;  1U78 A;  2HI3 A;  3S15 J;  4MFD A;  3S1Q J;  2DA2 A;  4BKX A;  1JKP C;  2RAE A;  5EG0 B;  3B6C A;  5FKM A;  2ELK A;  3WHB A;  1RR7 A;  2FX0 A;  1IRZ A;  3FK6 A;  2DMU A;  5FKL A;  3H3V K;  5EEA A;  4I6Z A;  1MSF C;  2WAQ N;  3CQZ J;  2ID3 A;  1AKH A;  1ZR4 A;  1ETX A;  2JJ7 A;  3A01 B;  5IP6 A;  4RDU A;  3HOZ J;  4V2G A;  1ZKG A;  1QRY A;  3ZQF A;  1H8A C;  3GTM J;  5GPC A;  2QCO A;  3GTO J;  3ZQH A;  1WPK A;  1B72 A;  1JTY A;  3BR2 A;  5DTD A;  3MVP A;  1XS9 A;  1QVT A;  4C3H J;  4BY1 J;  2IAI A;  4AC0 A;  4A3E J;  1GVD A;  1IJW C;  2LTP A;  2MG4 A;  2OPT A;  4A3K J;  1XC5 A;  2LLK A;  1IG7 A;  2LKX A;  4LOC A;  2CJJ A;  2O9L A;  2LP0 A;  1G2H A;  4C3J J;  4B4C A;  2L9R A;  2EZI A;  4V2F A;  4JYK A;  4C2M J;  4Y7N J;  3ZQC A;  3HOW J;  2ME0 A;  5M3F J;  1DU6 A;  4XIC A;  4J19 A;  5F04 A;  5FKK A;  3FK7 A;  5K7Z A;  1GUU A;  2KT0 A;  5J1Y A;  2VKV A;  3LSR A;  3TP0 A;  4B1R A;  4XRS G;  2TRT A;  2K9N A;  2R5Y B;  3Q3S A;  3BG9 A;  2R93 J;  3LSP A;  1MBG A;  4DZP A;  2E2I J;  3K7A J;  1IUF A;  1ZR2 A;  2K9Q A;  4A3F J;  1RES A;  2IBD A;  1MBH A;  5F0C A;  1SFO J;  3S1N J;  2VUM J;  3S1R J;  3JRE A;  2XB5 A;  5FLM J;  5GP9 A;  4A3M J;  2EQR A;  3SDG A;  3M4O J;  1H89 C;  2VKE A;  3RKQ A;  2HYJ A;  3JRA A;  1ZTR A;  1FIA A;  3GTQ J;  3RZO J;  2DJN A;  3BTL A;  1ETV A;  5M5X J;  2H8R A;  1T33 A;  1TWG J;  4M3B A;  1RET A;  4AUX A;  3JRF A;  1PUF A;  5IP7 J;  5FKO A;  4ABZ A;  1U9O A;  3LOC A;  3CMY A;  3HKZ N;  1U9N A;  1B8I A;  2L7M P;  1A6I A;  2R92 J;  1RKW A;  4JP0 A;  2DMQ A;  2E2H J;  1UMQ A;  1QPI A;  2R5Z A;  2DA4 A;  5HOD A;  2M2E A;  5IYD J;  3BQZ A;  5JLX A;  4FCY A;  1JUM A;  2E2J J;  2XGE A;  5C4X J;  4A3D J;  1ETY A;  1WH7 A;  2L7Z A;  5F08 A;  3UKG A;  1YRN B;  3IH4 A;  1I6H J;  4MFE A;  4DZJ A;  3O8H A;  1FIP A;  1I3Q J;  1OFC X;  3JRH A;  4HNV A;  2DMP A;  3HOY J;  2ZB9 A;  2XB0 X;  1JKQ C;  5FLV A;  1D5Y A;  2EZK A;  4EEF G;  3RQI A;  3MN2 A;  3SJM A;  2DMT A;  3GTL J;  5EDN A;  1HLV A;  2HQ5 A;  3CCY A;  1JKO C;  2JA7 J;  5EZG A;  5IPA A;  4CYC A;  1F36 A;  2JWT A;  2DMN A;  1WGX A;  3Q0U A;  3BT9 A;  2DA6 A;  4XK4 A;  3VPR A;  3SFI A;  1ENH A;  1VND A;  3I4M J;  2NVQ J;  4XID A;  2OF7 A;  4DYC A;  1MBF A;  1JJ6 C;  1NK2 P;  2Y0S N;  2Y30 A;  4G12 A;  1TWF J;  1S7E A;  1ETK A;  2NOG A;  2X48 A;  4L5E A;  2KDZ A;  1AU7 A;  3G1L A;  1MSE C;  2VPR A;  4D5C A;  4D7M A;  3HBL A;  2JMW A;  1B72 B;  3GTG J;  2M8G X;  5EF6 A;  3GTJ J;  3HM5 A;  1FJL A;  5JLW A;  3A01 A;  1NTC A;  1WI3 A;  2L0K A;  2JA6 J;  2B63 J;  3QPL A;  1FTZ A;  3PO3 J;  1XG1 A;  2HXO A;  2X9D A;  2CUF A;  1A5J A;  3D1N I;  2DTZ A;  1LE8 B;  1POG A;  2HOA A;  1P7J A;  3BTI A;  3BTC A;  3OOU A;  1W0U A;  4A93 J;  1K61 A;  1HCR A;  1VF9 A;  5GPA A;  1I50 J;  5IOY A;  4D5F A;  3M3Y J;  3A03 A;  1Y1W J;  1X58 A;  5E3M A;  2FJ1 A;  1WCM J;  5M3M J;  4AYB N;  2K40 A;  3BQY A;  1P7I A;  5F1J A;  3JRC A;  1NK3 P;  2CRG A;  3QQA A;  4FIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...