3GTTA

Mouse sod1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
153
structure length
153
Chain Sequence
AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 42
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gttA00
1SDYA 2Q2LA 1XTMA 4OJAA 1HL5A 1SXNA 1Z9PA 1E9QA 3MKGA 2XJLA 5KBLA 1F1DA 3GZOA 1FUNA 1SOSA 1EQWA 2Z7UA 1F1GA 1E9OA 3SODB 2AQSA 3CE1A 1IBFA 1OAJA 2VR8A 1CBJA 4OH2A 1SXAA 1PZSA 1XTLA 2GBTA 3ECVA 1UXLA 2AQTA 1OEZW 3QQDA 4A7GF 3ECWA 1TO5A 3F7KA 1U3NA 4U4IA 2Z7YA 1OZUA 4N3UA 4FF9A 3GQFA 5CU9A 1HL4A 3H2QA 3HW7A 1OALA 1AZVA 1E9QB 1S4IA 1DSWA 2GBVA 3K91A 2VR6A 3T5WA 1IBDA 2WZ5A 2WZ0A 1E9PB 3L9YA 1XSOA 2C9VA 3LTVA 1SPDA 1OZTG 2ZKWA 2ZKXA 4B3EA 1B4TA 1YAIA 1IBHA 1IB5A 1SXBA 1N19A 3F7LA 5KBMA 1SXSA 3KM1A 3HOGA 2ZKYA 2AQQA 4BCYA 3PU7A 1QUPA 1KMGA 4A7SA 1B4LA 1SRDA 1L3NA 3RE0A 4MCMA 1SDAB 1F18A 1CB4A 3KBEA 1BZOA 1TO4A 3KBFA 1YAZA 2WKOF 1SXZA 1Q0EA 2AF2A 4A7GA 4L05A 1E9OB 1PU0A 2WWOA 1RK7A 3QQDB 1IBBA 4A7UA 2Z7ZA 2JCWA 3H2PA 2AQPA 3GTTA 1UXMA 2R27A 3CQPA 4MCNA 2NNXA 1YSOA 3GZQA 3CQQA 1SXCA 1N18A 3HFFA 1DO5A 5KBKA 1JK9A 2SODB 3MNDA 4A7VA 3ECUA 2C9SA 2WZ6A 2C9UA 2Z7WA 1P1VA 2WYZA 1F1AA 1JCVA 2E46A 3S0PA 1COBA 2WKOA 2XJKA 2GBUA 1BA9A 4BCZA 2AQNA 1Z9NA 3GZPA 2AQRA 2WWNA 2VR7A 4A7QA 4A7TA 2AEOA 3GTVA 1ESOA 2V0AA 2WYTA 4BD4A 3KM2A 1MFMA 3L9EA 1EJ8A 3KH4A 2LU5A 4N3TA 2E47A 2K4WA 1JK9B 2JLPA 2ZOWA 3KH3A 2APSA 1E9PA 1PTZA
chains in the Genus database with same CATH superfamily
4KNUA 2R0WL 2P42B 5FYJH 2XJLA 4V2CB 4CRPA 3V0JA 2UYLA 1DUYB 1E90A 2IDUA 1EIBA 2C1PA 35C8H 4XP9L 5E8OA 1DO6A 3WEBA 1SY6H 4IRZL 2PXYA 3SEPA 2WO4A 3VG9B 5HPOA 4Z95H 1PQZB 1UACH 2RMNA 2VITA 1DQKA 3TV3L 4G70B 1KGJA 4N2KA 1EERB 1RUML 1PSKH 5CD5C 4IKNA 5E23A 5CBEB 4GUPA 1NCTA 3V0WH 5HYSA 3ARWA 4FEMA 4JRXD 3RHWK 4KUZH 4Y4FC 4HG4K 1L0YA 2OL3B 2WQSA 2W1NA 3HMWH 3SE8L 4IBWA 1A7BA 3ZN6A 4Q52A 1I1RA 1BZEA 1TTCA 3PGDA 4YO0A 5KYWB 2TSBA 3UG3A 1QSED 4E41E 3MACL 1NL0H 4TNFA 4GSDH 5A6LA 3NJGA 2ZWZA 2XWCA 3NIGE 5DUBA 1KXTA 4Y5XC 1UXWB 3T71A 4WY7H 12E8L 3LN9A 3MLSH 4BRJA 1OT4A 4XNQB 5C70A 3RILA 3WEMA 3T1WA 4JLRA 5MENB 4LOUD 5DRNA 5EO9A 1A7RH 4JO2L 1A4JB 2EO1A 2X42A 4Z7WB 2E27H 3HRPA 4B9GA 4R5XA 1FHNA 3Q13A 1ZLSH 4RMUA 1UH2A 4XPHH 1OGAA 2FZ3A 3GS4A 4PJCE 1QLFA 5CSBA 3VM7A 4N25A 2ZJSH 1U8OA 2VAAB 1KYAA 5G4OA 1LP9E 1ZHNA 1NIDA 4OD1L 1YY8A 1VF5C 4O02H 3PDOB 4FTVD 4BM7A 1DN0B 2BFGA 2EC9T 2C9UA 1IKOP 2IXQB 2G5BB 1P53A 1UA6L 3PHAA 3QORC 4X6BB 2FE0A 2OCCB 3NCCB 2VDPH 4LLWA 4U3HA 3VD7A 1FPTL 5E9AA 3W0WD 4U31A 4MDIA 3VXNA 5EFIA 1B0GB 1MW1A 2YZ1A 2WTOA 5DLMH 2A2QT 3FTXA 5M95B 1A9VA 4BBWA 3VACA 3A5VA 1JD7A 3HBPA 3WMSA 5JOEA 4KKRA 4BZYA 3DBXB 3Q5YA 4S1SH 2HMID 1Y6MR 3JV4B 2WLMA 1F4WH 4TVPL 3ROOA 4XBEL 2X41A 1JVKA 3I3BA 4G59C 3DDGA 4M48L 1JZ6A 2AK1L 1JGEB 4DNLA 2I5YH 4C56E 4ZMLA 5D8JH 3UACA 2OP4H 5J5EA 3L7EA 1G6RB 3HE6B 4V1DD 1LTXA 3S37H 4AL8H 4PGEB 3F8UB 3D2UB 3DXAB 4RX4D 4LBAA 3EG9B 3KLAB 4X6CE 4Y4HC 2J73A 5IF0A 4BZ2A 3HZVA 3WXVH 1U8JB 1EBPA 1QFOA 2I26N 2RJMA 3L3HA 2FJFB 4UM9A 1AGEA 3MUGA 3X3GH 4KK8D 4ESKA 3TBTB 2EDEA 1V7NH 1XTLA 1SEQL 3VB9A 2N0KA 4HWZA 1A1MA 4PUBL 3UADA 1IE5A 2Z4QA 3WE6B 1UZGA 2WUCH 5DVPA 1K8DB 3GI9H 2X4PB 1E40A 3US0A 5KS9F 1AIFA 1FG2A 1FZMA 2XFXA 1KTBA 3T8XB 1WFNA 4KU1A 2ED9A 2OFQA 3LZNA 1Q1JL 2Y36L 4O02A 5H2BA 1KDJA 5AKSA 3V6ZB 2ZOLB 4PJBF 5FCUH 3IB4A 2V9UA 1GHFL 1R47A 2ATKB 4LSQH 2J6EH 1JPFA 1DVFA 4NM8L 4JPKH 2UZIH 1WP6A 1B2WL 1U8MB 5BRZD 3U9UA 4ICWA 3MNZA 2DQHH 4OKDA 4L1BA 1CPUA 3HNSH 1AO7B 1UTDA 1R3LA 1UD3A 3NACL 1IEAB 3IMVA 5DRXA 3HZKB 1AD9B 1JGUL 4JY5L 3BRGC 3QNZB 1QYGL 3HFMH 3H0TB 1TO4A 3P0GB 3RJQB 3V52L 3HZMA 4P2QE 4YLQT 3CD4A 1HHKA 3O3EA 4BH8A 3NEEA 2VW4A 4YVUA 4ANUA 1TNNA 3BP7B 1OAXL 5CWSA 5ISZD 5T3ZD 4HUVB 4Z0BL 1Y6NR 3QEUA 1FLRL 1VEPA 3LMJH 3UYRH 2QDWA 2QR0A 4PJAA 4DO6A 1DE4A 5E2TL 2QHRH 4ZNCD 4HS3A 1BVLA 2ED8A 1DO5A 2FBJH 2R0LL 3PV6B 4F9PA 2VJXA 1QZ1A 4JMXA 4HC1L 2DIBA 2Z6FA 4N5UA 1KY7A 3UBHA 1KGUA 1BP3B 2QBWA 5CJQL 1NAMB 3V10A 3MJ8B 1Y6KR 3WFZA 4A04A 3KGRA 1D6VL 4YSAA 3VFUA 4H40A 3FN9A 3BAJA 5G2NA 4AGLA 4JJ5A 4FQQA 5DGQA 2AK4A 4FL4B 2MQGA 1YVLA 3CFUA 1VESA 2AQ1A 4AT6A 3Q06A 5E6IB 4DKEH 1QSEE 1X9RA 2JI2A 2WINA 1XGUB 2ZSWB 3KPRA 5CILL 2C3WA 4ZMQA 1JDDA 1W91A 4PRPD 5KVDL 3QXWA 3NAAL 4JKWA 4XC3L 2Y3NA 5DC2A 1DSFH 3J2PA 4XXDA 4YE4H 3VTAA 1JWUB 4XWOD 4PJ9A 1XF2B 4XPTL 4CJ0A 1P5UB 4YFEA 4TS6A 4OD2B 5C0FA 1X5IA 1AS8A 2C5DC 2OMTA 3AWEA 5F6HI 4DOHE 2E6JA 1DJZA 1QUNB 4XPFL 2OCJA 2X2UA 5IT2H 3TTSA 1JYWA 2D2CC 4MRBA 3CFNA 4WK4B 5B38A 1EHXA 1MHEB 3QIWC 2EQDA 5FUOL 1NMAH 2OSYA 2LABA 5CGYD 1PZDA 3IJYB 2QELA 4Z7UA 5ALBL 5IFJA 2FLBT 1NGQL 4R8WL 2WNKA 5KG9B 3AW5A 3NH7H 2CE6A 5FECA 1U8NA 2VN6A 5E4OA 4ZUSA 3LQAL 3HIZA 2EDNA 4OZHE 3WEOA 2NZ9C 3TJHD 4GO6B 4G8GA 3W39B 4N9GB 2YGPA 5GIRB 5AVWB 1HHHA 5JW4N 2BSTA 1WZMA 1PY0A 5EPMA 2A9AA 1P4LA 4PGDB 1TQBB 3MACH 1H9DA 1T4WA 5CBAA 1R5VB 4N86A 2J44A 3OJDB 1XMEB 3QULA 1R34A 1UOKA 3JWOL 4JRYB 1A3RL 3MJ9A 2AEWA 12E8H 3AT9A 1ORQA 4GKZB 1J1OL 1M9WA 4XO5A 4ANXA 4FLSA 1BAGA 2IDTA 1R9FA 5E9NA 1MCDA 3CZFB 2VMFA 3U9PH 1WIUA 1KG0A 2W0FB 3VRLE 1R3IL 3KS0J 3SE6A 4IU3B 5JA8B 1QUNA 5D5MA 4XHJD 5C09E 3RWDB 2Z91B 3RIFK 1MLCB 2HH0H 3LJ3A 1AE6L 2IF7A 4XPHL 2X4QA 3O9WD 1UXMA 4LPYA 2FO8A 4HKZA 3RGVB 4JPKL 4C83B 1ZGLB 4G43A 3NCWA 1RP9A 4HJJH 4XMUA 2D7OA 2VLJB 5BZXA 4L0ZA 2ADGA 5BS0E 5JHLL 5KBKA 3MNDA 4TSCL 3BAXA 2ZKHL 4TLTA 1A6TA 2PW2A 1T20B 5MHSE 1QLEB 1T7WA 2X6MA 2X38A 1NC2B 3HG1B 5DI8A 2K0RA 3MV9E 1BWWA 2XXFA 3UERA 4AENB 1AP2A 3HS0B 3KL0A 3PHQA 4HJ1A 3S34L 3UMNA 4IRSC 1TNMA 3WKPA 5CCKH 4AT6B 2ALWA 2AK4B 4KV5E 2DYPA 4P5KA 1FGVH 3WUWA 3MJ8A 1NAMA 1E8YA 3LPFA 4BFJA 2NY7L 5KS9A 4WWKD 1TPXB 2VMCA 2VRAA 3L5XL 3V0GA 2R0LH 2MPAH 5DJCB 1V3KA 4RFOH 1LDPH 5D7LA 4I9WE 5CJQH 1F6AB 2QR0B 4PJAB 1JHTA 4LLMA 1EQWA 2CZNA 3VUAA 5D6CB 3T04D 5IESL 2AQSA 1LEKB 1MZZA 2PCPB 4P5MB 3ZKMD 4Y9EA 5EH1A 1GMIA 5F7NC 3MUZ1 4L4JA 1EHAA 3MN8A 2FT8A 3LQMA 1CCZA 1OTTD 1I1CA 1K4DB 2QJDA 3U6RB 3APCA 4UANA 1R19A 5KVEL 2I27N 4HOMA 3UGXA 3VAEA 4YOKA 3F83A 3D51A 5IHUL 5KVDH 2E3VA 2IGTA 2PO6A 5FHBH 3B2VL 2HRPL 4NQCD 4N2MA 3DHMA 1OPGL 4GIPD 4FULA 1C5DB 1LWJA 1MRCL 1FNSL 1T2QH 4CSPA 3TA3D 1PLGL 2YARA 3LRHA 2ZUSA 4FEIA 4OZHF 1QFUL 3CVIL 3LXUX 3NJKA 2BRRL 4JDEA 3V6ZA 1JMZA 2VDNB 4O02B 1B2WH 2I32A 1N19A 3WLBB 4KKLC 4OGZA 4R9HA 1OAUH 5IKCB 2WHVA 4BQ6A 4RGMB 4CADA 1V3MA 1BGXL 1PZBA 2ZP8A 1W0YT 4OF8A 5MI0B 3F58L 4P4RB 4P5TA 1AJ7L 1OCCB 1K5WA 4BH7A 3BVNA 3IDNA 4QRUA 4X9YA 4TVPD 4HWZB 5FGBA 2AI0H 3C09B 3VRLF 1FRGH 4C56D 3ULUC 4J3SA 1UT9A 2OTUB 1TQBC 2I60L 4GMSL 2H1PH 3K4DA 2B9BA 2Z7ZA 4MMYA 2AGJL 1SHWA 3GSRB 4FLHA 3NZUA 4UTAL 1AGBA 3S37L 3ILQD 1NAML 3MBXL 5DRZB 4XNYH 2NW3A 1L9MA 4ZO8A 4K9JA 3TN0B 3US9A 1H8SA 1SOQA 1T3FB 1YCSA 2DDQL 1HXYA 2IPKA 1KELH 1OKEA 1Q38A 4O9HL 3QUGA 1ZGLP 2MHAA 4LP5A 2VISB 3L4TA 1Y0LA 4ENZA 1XXDC 4HZLA 2BS8A 3F7RA 4K3JH 2RIKA 4WZ9A 5J11B 1NC2D 2GIYA 3HG1D 2NX5D 3D69A 2ESVD 1OVZA 2HRLA 4OM0L 4K7FB 5FPIA 2NY1B 4QJ4B 4QRPD 4LLYA 3Q2LA 4AE1A 2WK2A 1OTSC 2ZXCA 4CBZA 2VLRD 2AITA 4MJHA 4H0HB 3FTGB 5C08B 4EDWH 3MV9B 2HPTA 1A25A 2FD6L 2DQHL 1E4XI 1I8MB 1ECZA 4YX2L 1JZHA 4OJAA 1LP9F 3L7FB 4YXKL 5I1KH 5L7XL 1BOGB 1W6LA 4XVJH 2B0SL 2XFGB 5GSVA 5IUSA 3OWRA 4ZOBA 5AYTA 1GJIA 1HQRB 1YQVL 3DV4A 3F58H 2BWQA 5DTFA 1WUNT 5CCKL 5JO5B 4Z7WA 1JPSH 1CF8H 1A4AA 4PJ9D 5LO7A 1A5FL 3KAAA 4H26B 2NT0A 4TL5A 4ONOA 2QHLA 2Z7YA 3IKCA 1UXWA 4S1RL 5BMFH 1W2KT 4ZUTB 1TJMA 3ARBC 7FABH 3VXSE 3OG4B 3L1OL 1ZRUA 3L3GB 2PW1B 4OIBA 2WZ0A 2AXGA 2FT7A 2XBDA 5DJ8A 2YQ3A 3U2SB 3LQAH 3L9RA 3WS6C 5AKRA 4GNKB 4MJ5B 2G4EA 5DJYB 5E95B 3R06A 3HMWL 4S11A 4ADJA 3VGBA 1X5MA 4RWYH 3GTNA 3EOAB 4NO5A 2N1TE 3MJ9L 4GUPB 2P5WB 1ZT4B 1HTYA 5AAMC 4YGVB 4JDZB 3GO1L 5BCAA 1U8QA 3QXTA 4N1HB 4PRHA 1KMGA 1PQZA 2DMGA 2Q76A 4L3FA 1QSFA 1IO4C 4UT9L 3FCSA 4POUB 2XDHA 4JUTA 2KUTA 5LNEA 3BKJH 2ZCHL 3O6FB 4YHKH 4DEPB 4HWEL 2C1PB 2BY3A 3ZSTA 3ZGHA 2Y1AA 4QNPF 1BG1A 1P7QA 3ETSA 3BISA 5SX5H 3NABH 2HH0L 4PJEF 1JYVA 2V2TB 2EUWA 3D06A 4G7RB 4ZW8A 1PZCA 1LQSR 2WXNA 4AX3A 2K70A 2KS0A 4IBQA 3IN0A 4P2QB 3NGBB 5IY5B 3G6JF 2F8OA 1H6EA 2WZAA 1YN7A 2WLIA 2YUZA 4S0TD 5IUCA 4Q56A 2XWBA 4HCFA 4R26L 3D0LA 2C3GA 2GTWA 3QDHA 3QXAB 5J0BA 4BK5C 2I07B 1L7IL 2FSEB 1CICD 2WMPA 5KYXA 2NY0B 1ZTXH 2AXHA 2XIIA 5GRVL 1IGFH 1WBXA 5ICXB 1FRGL 2ODHA 4DVRH 4PG9A 4JY4B 2YGQA 2UY7B 2OMZB 2WLNA 3MRCA 5D1QA 5DGRA 3WE1A 4DGUA 5DF0A 5FF6A 2X0WA 4K2UH 1HWGB 4I1PA 4KO9A 3ZUCA 1FI8C 2V5SA 4ELDA 5D1ZC 3DJSA 3DMMB 1JWMA 4M9OA 3D05A 4NNXA 2HMIC 2ICEC 3NPSB 4E2OA 1CFTA 4UOJA 3CHQA 2OMYB 1SM3H 1F3RB 2E9JA 2NX5B 1HSAA 3P77B 3GSQB 3QNYB 4B9PA 5EA0L 3FUIA 1USZA 4RGOH 3OLIA 3GSWA 2BVQA 1KELL 4YR6A 5IROD 3ZE0E 5H4ZA 5JHMA 2VLRB 5EOQL 5T1MB 1YNKH 5C0CE 3SDAC 3H54A 1F1DA 4DK6A 2NNCA 1HHJA 4OLVH 4L8BB 4X2UA 1JGDA 1G6VK 3IDYB 5IGXL 3OZLA 5DMGD 1MHHB 5BNXD 5AVUB 3Q6GL 4U1KB 4JFQB 1Q94A 4MHHG 4AGMA 2WJ5A 3T77A 2NUTB 3JWNH 5TK4A 1WBZB 2V2XA 4PWGA 1JRHH 4HX1B 1PLBA 5E6UB 1YNTB 2MNJB 5F6IB 3UC0H 4GBXD 1F58H 3RFZB 3L3OB 1LO0H 4Y2OA 3TWCL 1KTRL 5FEBA 2EACA 2CG9X 1TJHL 3NCYS 2W59A 4GP8B 4LVEA 4KXDA 4OUUA 4QRSA 3SDXF 4AJWA 2JKLA 2GY5A 4XNZC 3WFEH 1HQ4A 3KXFA 3MLXL 4PU2A 5AAPA 1AMXA 3ZL4L 1PLAA 2PWDA 5C6WH 3H2WA 4QRSB 2X6AA 4POYA 3AQXA 3KBPA 4A6YH 3DV6A 2CKBA 3TYGL 3L3OA 2D0HA 4R3SA 3FT4B 4YEFA 4W9FC 3FZUD 4GG6E 1GZPA 4H20H 2NUTA 3SDXB 1O7VA 1IC7H 2NPLX 2P5WD 1UWXH 1Q0EA 5DEGA 1YEHL 3GFUA 4UYQA 1EGJL 1QO3B 1JFQL 3D7PA 4PCYA 1ZSHA 4XB7A 5EU5B 4PRAA 3SDDD 4X6FB 3TNNB 3RWHB 2BSSB 2VOTA 4F37K 1SM3L 4PG2A 5T1MA 4F91B 1KIQA 1ACCA 1ZLVH 5DMIH 4K3DH 3V4VA 4OLZH 4GKNB 3V7AG 3QI9A 3O6FD 2OJZH 2YD0A 4Y4KA 1IAKA 1K6QL 4WV1C 2J55A 2NX5A 3P77A 2CBOA 3VFRB 2ADYA 2VYRE 2AXFB 1CFTB 3G6JE 4ZW6A 4OGYH 1AR1C 3K6SA 4XNMA 2BK8A 1JXJA 1QBLH 2JCCE 5E7BA 1G9MC 1RIVL 2Y7OA 2NW2B 2QQLH 2J2ZA 1XCTB 5D1ZA 3SPVB 2CO4A 4I18B 5IG7B 4ZSOB 1JE6A 1F11A 1I9JH 3IJEA 1CE1H 1XR9B 1WBXB 4UAHA 4MCYA 1DQTA 2FGZA 2W9EH 4FZEH 4H0GA 2DTML 2XQYK 4LPWA 4OLWL 1E5UI 1G1CA 4Z0XB 5E1AB 4PLOB 4W81A 3D0LB 1E5YA 4XTRC 1GGCL 2UZYA 5GXBB 1YN7B 4PRIA 4GP5B 4ONFL 5KSAD 3BUIA 3UJIH 1BZ9A 3RPBA 4JZOB 1A22B 4QRRD 5A2AA 4KH2A 5DHVA 4XN4A 2YHGA 1O6SB 3TS8A 2H3KA 3VQ2C 3SKJH 1MHCB 2CJUL 2Z7UA 3RVVC 4KMTH 4NP9A 4W6XB 1T6VN 4JGMA 3D8MA 4UNTA 1DSYA 2R0KL 5HJ3A 1CXEA 1DBBH 1Y7VA 3BDYL 4XN9A 1XL4A 1PD0A 5KJ7E 2HA1A 3GKZA 1ET8A 2C8NA 1LDSA 5MEOB 2WXIA 1XVSA 5CR8A 1RI8A 3P3TA 1QASA 3NN8A 5JPMB 4ODHH 2GUOA 3HBZA 4AXWB 1UD2A 2Q86A 3KPSB 5C6PB 1PZ5A 2PN5A 3EOAA 4KTEH 5CU5A 4U1HB 1SPDA 4KO6A 2F53E 2G75A 4HMEA 4N6RB 4S2SB 5HHOE 3JWDL 1U42A 2GKIA 2P24B 2WBJC 4PJ5A 1EEQA 2NNFA 1YAIA 3CFDA 4YBQD 2XKNA 3TOPA 2CDGB 1NC4A 4P2RA 4FAAB 2PW1A 2XN9D 5CSZB 5CN3A 5D5ME 4JJOA 1A7RL 1RJYB 2ZXQA 1B4JH 4JO2H 1MCSA 5E1HB 5CEZL 4ZUVB 3VFGL 4ZUTA 1RD6A 3CC5A 4W68A 3VU1A 5I0XA 3CFBA 2DM3A 2HJFB 1T1WB 3B9VA 4OLWH 4CSSA 5TD4A 1CLYH 1H15B 4K55A 1H3GA 5TPWL 1KXHA 2WXKA 3A3YB 1V7MH 4Y4HA 1GAFH 2G3MA 4KK9D 2EIMB 3DUHA 1XFPA 3DV4B 3MHZA 3ZDWA 4MQXC 5FYLH 5FUCC 3TT1H 3GIVB 3QG7H 1AXTL 3RZCD 3J8F7 5BO0D 3LKNA 5C97A 2LLLA 4M9PA 3ATBA 3OR7A 1E7VA 5JDSA 4GO8A 4ENED 2YGVA 2RBLA 3HAEG 1BPLB 1CGYA 3F7VA 3GK8L 5SWSB 4O4YH 2O6PA 3IRPX 4GOSA 3TEZA 1SQMA 3Q8AA 1OGPA 2B1HL 1UH4A 1MEXL 4CAGA 2P48B 2XZQL 1NDGB 3CHRA 3CSPA 3I50L 2E46A 3D69B 5C0NC 4MYWB 4U6YB 1EGJH 2VDLB 2VDQH 3S5LG 2VR7A 3QRGH 4JFXA 1XF3B 1ULVA 4ODHL 1ZS8A 4JM2C 3HLKA 3TBVB 4AKPA 4KITB 1JUFA 1UQSA 4HIEB 4P2OA 4HIXH 5IB2B 3LEXB 1EDQA 5B39G 4UUJB 4XI5D 4CSTA 3Q5OA 4KRNA 2E74C 3GJEA 4G8IA 4AC4A 1HXYB 1TT6A 2A1WL 3SBWA 4KDVA 4Q58C 4POZC 5J89A 2ED6A 2WKGA 4DW2L 4G7YH 1T66D 4FXTA 1I9IH 4YHZH 3MRBB 1RZKC 4RMSA 4H4NA 1QFWM 1CFSA 5EOTA 4YWGL 2XA8L 4PG2C 1J8HB 5SWZA 2YFOA 3WN6A 3NIFB 4UT9H 5KSAB 5FYJE 3VXSA 3KPRD 2MCG1 3T2QA 1WA1X 2X3AA 2WQXA 4FP8L 4XMPH 1U36A 3V4PB 3FQNA 4A7GF 4FA8A 3MLUL 4DGVH 4U4IA 1QBML 5IW6B 5HGBA 3VMOA 4S1QH 2X5PA 2Z64C 2X70B 1BCIA 3KPOA 4NENA 1BFOA 3B2VH 5T5FH 4ELMA 4Q97A 2YMTA 1VFAA 5IKCA 1KIPA 5I0DA 1FNSH 4PRNB 2R1WA 3MLRH 4ADIA 3ARFC 1K9TA 2JXMB 5DD0H 1MAML 4YPGB 3C5ZD 4I5BA 3H9SB 4HV8A 3WY4A 1IB5A 3ULVE 3GGWB 1OM3H 1C5DA 1O5PA 2VKXA 3AABA 4Z95L 5F8QC 3VNYA 4HIHA 1SJEA 4N6QA 4D2NA 4NKIH 3Q2CA 1JZ5A 4IRJB 4RBPH 4Y16C 1CS6A 5TE7H 1KV3A 3AG2B 4HQQL 4N90D 4XO8A 5IW3A 3RE0A 1HZHH 4FQLL 1S9VB 5GRYA 3ARBD 4AZUA 5JW3H 2LAAA 3O4LD 4F3FA 2WKOF 3MR9B 4O2CB 2PYEE 1WTLA 3MRMB 2V5YA 5B3NA 4YZFE 3JT0A 4QXGL 3GNML 3FTZA 3OKOA 5TDOA 5T3XD 2FH8A 4UTAH 1AOZA 1JWSA 2VC2H 1D9KD 3FN3A 3VA6A 1L9OA 1JHTB 1UT1A 4ZG1A 4DUXA 3RL2B 4F2ME 2NNXA 3IDMA 3F05A 3Q0HA 4GPVA 4NN5C 5KW9H 1FO0A 3C8KA 5HXMA 1MJ7H 2LVEA 1V3LA 1YEKL 5D7KE 2D03L 3WTUA 5DZOA 5FAAA 5DMJB 5M7QA 4G6MH 1JGLL 4TVPE 3KPLB 1DQIA 1L5GB 5GS2H 3CLFL 3UTSD 1IU1A 1MHPL 2X87A 5DURD 3RHWF 3V4UH 2NNAA 3VXUD 1HT6A 2ORBL 3FOMB 1T83C 3STZA 1YEWA 2H7WA 1T22B 2F5BL 1TJHH 2ZYIA 3CMOL 3GSXA 4MLIA 3O2WH 2WB7A 3O2VH 4X6EA 5EU6B 3LEYH 3OKMA 4JRLA 1PCXA 3GSUA 3L4YA 4LSTH 4PRPE 3ZKSD 2R2EA 4EIGB 4UQBA 3LSOB 5F93C 3SOBL 1LM8V 1P1ZA 3G6AA 4IS6A 2VR3A 5CSGA 2BHFA 3X11A 2CKBH 3TO4C 1TLKA 1PD1A 4ZNEA 4HKZB 4BFGA 2A77L 4K9EL 4Y4FA 3WFDL 4U6VH 2LLNA 5AZ2H 4ZFZB 1F1GA 2Z91A 4LKXA 4NO2A 2O6FA 3FO0L 1MIEL 1OSPL 5CMAB 3V5HA 5DJ6A 2HFEB 1TJIL 3OXRA 2DH2A 1UXLA 2OJEB 3IGUA 4NZTH 3NBNA 1JDCA 3HB3B 3SYQA 5KJ4A 4KC3B 1F42A 2A6JB 3BO8B 2AJUL 2VSMB 4N3UA 2C1OB 2OMNA 3BAKA 4N2HA 4OFVA 4EZMA 1P4LB 2CPUA 4X6DA 1NBVH 1CZ8L 1P4BH 4XVUD 4MZRA 2BSTB 2GSGB 2PWFA 1G9NL 1IGCL 2YKLH 1A4KA 2D03H 4LF3A 2IANB 2I7OA 1EDYA 1SN0A 1AKJB 4DEWA 2R29H 3L2LA 2EIDA 3KLSA 2BP0B 3S35L 4LCUB 3U4BH 3TT3L 3KE0A 4A1RA 4ERSL 2E7LA 4HYTB 2MQ0A 2DWEB 1M2OA 2DM2A 3A4AA 1Y07A 4PIRF 1LXMA 4R97C 4BHUA 3O2WL 3AS1A 3S3SA 4JFPB 5FA3B 4ZW5A 1QSEB 2L7UA 4F57L 3GMNB 1I1AC 5I17A 1IC4L 2R29A 5AOJA 4EUPA 5C0FB 3N44B 5JHBA 3B9KD 3X3FL 1KPRA 1KZQA 1I3VA 4E5XG 5B1JC 5F21B 2QKIC 4DQAA 3CSGA 1S7UB 1KN2H 3DRQA 1SNRA 4RQQA 4QNPE 4PJEE 4G6FB 4Q8BA 2DKSA 1K3IA 2CO6A 1E4KA 5AVXB 3VXOA 5BV7H 2ZUUA 5B8CC 4YHIA 1XGUA 3G9VA 1SEBA 2WINB 3CUPB 1IIIA 3WTXA 3FPYA 1XB6A 4X7TB 25C8L 2ZOUA 4MA3B 2B5IB 5I1GL 2B16A 2SEBA 3UXFA 5E1GA 2V9QA 2WWKO 4OM1H 5KVFE 4KTEL 2FNWA 3BHBA 4FXGC 3OC8A 5A16B 5LBSA 3KW7A 4GAGL 5E8DH 4ABUA 1XH3B 1O6VA 1JJUA 1Z5LA 5I5IA 4DQOH 3CDZB 4KJQD 5ESQB 3X1BA 5HBBA 4I13B 1Q9LA 5HDWA 3UTZB 2KH2B 1DE4B 2Q9OA 4YAQB 4Q2ZA 3ARDC 3BKYL 3QEUB 4JO4L 4JFHE 3DK2A 2HRGA 4BH8B 2EVJA 2VR8A 1JL8A 4JGJA 2B59A 3IDIB 3QUXD 4WK0B 4X7CC 4DGYH 1D6EA 3CMOH 1T5XA 3C6SA 4TSBH 1QBMH 3S3CB 3HZKA 2OA9A 1FCGA 3OTTA 5LGKA 1KNOB 1F58L 4AQ1C 5BS0D 4NZ8A 1F56A 1P6AB 1UATA 5CGTA 1U3HD 3BEVA 3M8OH 1E6JH 1F4XL 1U8MA 2EXYD 2OSLB 5JHDB 2D31B 4O4YL 1JPFB 3DO7A 3WFDH 4OZGE 2ZYRA 4PVMA 1YJDH 4M1GL 2DL9A 1IQWH 3IS0X 2HP4A 3QI9C 2P8LB 1F86A 1YEGH 1VFUA 3TYGH 2Q3AA 5E94A 4X4YA 3LNDA 3NDYE 2XN0A 5LXVA 2I60H 2A74A 4YSEA 1ZJBA 1ITBB 1TSRA 3LYRA 3Q01A 2B14A 3ES6A 3BRDA 5CJOH 1G9ML 1FORL 2GSIA 1AO7D 3NP3A 3ATAA 1P4BL 4J6IA 1QFPA 2FJFA 4UM9B 4JPWH 3QCTL 1ZOXA 4JDTH 2X1WL 3CXDH 2JELL 4GI8A 3X12B 4E0RA 1LE9A 2J8UE 4ABWA 3EG9A 4GXFA 1CK0H 3IPFA 3G6DH 1FZKA 4WEUD 3RZWA 3BJLA 5CLYA 1G6RA 2D9QB 5I1AA 4AZ8A 1AFVL 3TH4T 4OZIA 1NLBH 1MVUA 3O6FC 2Z0BA 3S96A 3U30C 1NTDA 3DIDA 3CLEH 1YEEL 3BUYB 4HGMA 2Y3AA 3QPXH 1KJ2L 3B56A 3WTVA 3MXVL 1MFDH 3DVNB 3QEQB 4D0BB 1I1AB 2Q0ZX 3NK4A 4JO1H 4NZFA 2AQRA 3IMUA 4MA7L 1I1FA 1B0GA 4F8TA 2C3HA 4UT6L 4JANA 3CZEA 4MTMA 2ZICA 5JHLA 3UGUA 3W9EB 3HG3A 4K3GA 2EXWC 1H6FA 4LLWB 3O8XB 4X6BA 1ZLVK 3S3JA 1VCBC 4F2FA 2XA3A 1I3GH 1FBIH 3NJXA 3FKUS 2B1AH 1LO3H 3SPCA 2HT4C 1ET7A 2VXVH 2A73A 3I3EA 1NFIA 2W80C 4UWQB 4G83A 4W9KC 1S7RA 4IIQB 1GIGL 4HW6A 1XF1A 3ARGB 3CDYA 4GAJL 5HYEA 3MUHL 5EZJA 1QRKA 4G5ZL 5F0JB 3LHPL 4BFRA 2YPKA 2H0EA 4GG8A 1XR8A 2VZSA 4FJYA 1MI5E 1QW9A 1X9QA 4DSYA 4NUGL 4ODSL 1EHLL 2AMGA 1T0PB 2A9ML 3E3QE 2WQUA 5EOCH 1JVOA 4HS8H 4LLUB 3ILEA 5I1JL 4I0PB 1T0OA 5DUBB 5INDA 3F5WA 2HKFH 3IAQA 4CVZA 3T6XA 1GYAA 4MS6A 1TETL 1PW3A 1RHHA 2VR6A 4NWTL 3BGFC 1DJYA 3QNXA 2DB8A 4YO0B 2W07A 3KPNB 4C4KO 4R7LA 1CFNB 2F7QA 1KC5L 3DTUB 1OAYH 2J8UA 3HI1A 1K3ZA 5T8IA 3VGAC 1NA8A 3QAZB 5I73B 3UJJH 1T5WA 3H3KA 1AKPA 5IV2A 3QUZA 4NAJA 3WCYA 1I7RB 3MRHA 4FG6C 4JN1H 3LRLA 3T3PF 3QDMD 4ZAKA 4Y16A 2PXYB 5A3ID 2BXZA 2ENQA 2VWEE 3RPIA 3UZEA 2WXLA 1JIBA 2F53A 3ABZA 3E9TA 3ILPA 2KHAA 3PFQA 5EBWB 3VDAA 3ISYA 4NKQB 3WN5A 3EOYG 4FFVC 4HJGA 1DUYA 3VMNA 3ZR6A 4LCCA 3NSJA 5LBGA 5F9DC 4IDLA 2P5WE 5ITFB 1ONQA 1LP9A 1S9XB 4J12A 1NEUA 3OKLB 4HWBL 2XKUA 1TVBA 3FT1A 3NFPA 4K94C 1B90A 3GWJA 2YGNA 3HE7B 4FFWD 5DFVD 5GPRA 4M6OH 5AB1A 1AJ7H 1HNFA 2H8PB 3LX9A 3T3PB 1RIUH 1MY7A 1C8QA 3BW9A 3M1CA 2MMXA 3ZK0A 3BCDA 1T6BX 2YD1A 3GPEA 4GLRH 4W9ZA 3ZMNA 4G80B 3IGFA 3GLAA 2J4WH 2V17L 1E28A 4ODBD 3JTTA 3T0BA 5J6GA 3INOA 4UOQA 4D94A 3U30B 3ALXA 4FNRA 1IGTB 4DP7X 4KTDL 5TDNB 2CJ3A 3DUSA 3V0VA 1UXSA 4ONHA 5FA4B 3B9KC 1MRDL 2YAHA 3AWFA 2RR3A 3VFPB 5FO8A 4JG9A 2JI3A 1GGTA 4U33A 2BJMH 4FOMA 1BM7A 3KGUA 5C0AA 4XPBH 1DVXA 1R5WA 3HRZC 2ADFH 2ZOWA 3QWRA 4JL1A 3RUGA 2PO6D 1T1XB 1PZ2A 3LZLA 1YEEH 1HHIB 3T6ZA 1A2YA 1W0WA 2L4OA 3VGFA 2AJXL 3R0NA 1K4CB 4ZXBD 1JSYA 2DICA 2TAAA 3CH1B 3QBTB 4JQIL 2J21A 5J1AB 3CE1A 1USQA 5I6XC 1TCMA 2A5UA 1L7TH 3DPBA 3UJTL 1QMUA 3MLTA 5D2NB 1O7DE 5BVPH 2JWYA 2D7TL 4HUUA 3N50A 3LPOA 5DT1L 4PJ8B 3FO2B 4HXBH 3L3KB 2FD6H 4K71C 3FQTA 4EJ1C 2AKRB 1NUNB 2J88H 4HH9B 3LAFA 1C8PA 5T5NG 5KVGE 2VLLB 3WFCL 1J9SA 3QYMA 5EU3B 3EO0B 5FLVA 4JQIA 3MYZA 2XY2A 4AYFA 4QRQA 3SCMD 2OMWB 2BLFA 1IE4A 1OGTA 3AQZA 3T4AA 1BX2B 2QV2A 4LCWA 1PYWA 3Q8BA 4KXAA 4RGNB 4YDJB 4CN6A 4BJLA 2G9KA 4U7SA 1XF4A 4LCYA 5EUKA 3TJPA 3MO1A 3F7LA 5LB1A 4Q9BA 3TA3B 4IMKA 1R3JA 1A64A 4AQOA 4FG6D 1KCRL 3HAEB 1TCRB 1TDQA 5C0IB 1S78D 5HJDA 1L3NA 2XWJA 4N9OB 4RWHA 3GI8H 5FWQA 3AAZA 3GDBA 1ZLUK 3QZLA 1M71B 3C60D 1KGCD 4I88A 5TF0A 1D5ZB 2VMEA 3D48R 4NP4H 2YOCA 3MZTA 1TTUA 2QADB 1JNHA 1OLLA 4NUMA 3VO0A 1EO7A 1JNHB 2WKLA 1PJ9A 4YN3A 2X7LA 1GSMA 4MNQD 4YMPA 4IGBA 5DVNA 2NY5H 4WW1B 1M71A 3T0VA 3HUJA 4N5EC 3KWWA 3CQPA 2EDWA 2XWJB 5ESVB 4F8PA 4ZZFA 3BOVA 4N26A 5GRUH 1T7ZA 4N90E 4RH4A 4L37A 1NAKH 2X6VA 4NI3A 1PY4A 1BVNP 4U0RC 4EKXA 4PJ7A 2B77A 4G9FD 3SKNA 1NEZA 3QUYC 4IBLT 2OULB 3DLQR 2J12B 4QRQB 3ZX1A 2HLAA 1WPCA 4MJIE 3UAJC 4TUKH 5EU3A 2VLLA 4DF9A 3QFJA 1E4XH 2RCSH 5AWNL 3JVGC 1XDTT 2W81C 4OIFA 1M7DA 1DQML 5IB4A 1FYTE 1PLGH 3SDAB 2NTSP 3BXNB 2FRGP 5EZIH 2UXFA 3WHE1 3D34A 4BE6A 1BYPA 1EHKB 5B39B 3PUUA 1R17A 2P8MA 3ZO9A 3MTXA 3TV8A 3VG0L 5HGAA 1TR7A 1RU9L 1GSKA 1DBML 1A7PH 4R26H 5J1AA 3RZCA 3J7HA 2Q6WB 3LN4B 2WLHA 2J72A 4JZJC 1A2YB 2X6BA 4CSZA 1DYZA 4R2GB 4LCCC 3CFKB 5JIQA 4C56A 4HUXB 3LHPH 1ET5A 1GYVA 5LGJA 1OAKH 1UB5B 1DQJA 1PSKL 3DURA 5IB5B 1DQJB 2CHWA 1UB5A 3OHXC 4XNZB 5T33L 4HZ1A 4PSPA 5CXPA 4BKLA 2DOCA 5JIHA 4HUXA 3CFKA 3FT9A 1RJLB 1UXSB 4ONHB 1BQSA 1MSPA 5FA4A 3UBXI 3X13A 5GISL 4XPBL 5D6DA 2MNWA 4HIJB 4RIRA 4BFIA 4DK5A 2CR6A 5J6GB 2O1AA 3FTUA 2DDQH 1E28B 3MRKB 5EC2B 4IOIB 1OZTG 2XZCH 1ADWA 2VSDA 1EO8L 4WU5A 4P2RE 3P9LB 3EFFA 4QIRA 5T1DH 5IMOA 5KBMA 1D2PA 4KNQA 4AGNA 3QFJB 4AW7A 1ZPUA 4BGLA 1JD9A 3HRZA 3K7UA 4JHAL 5DD5L 2KLRA 4LSRL 5IVXB 3AREC 3RA7H 4TRPH 1F18A 1NEZB 1Q0YH 1CB4A 3SKNB 5A6IA 2Q3XA 4FFZL 4B9CA 2NDFA 1S9YA 1RVFH 2F53B 1AR1B 2EXYC 1XSKA 1B6UA 4FNQA 4AM0A 3QXDB 4Y16B 2P1YA 3HTLX 4KKCC 3NCYP 4WK2B 2Y24A 1WH0A 4WFED 1WZ1L 2E9GA 4FHBD 2P45B 3I6LD 2IANE 1ASPA 1NEZG 2OX5A 5EORH 4PJIA 2F8IA 5ABZA 4R4BA 4WW1A 2YZ8A 1DJIA 3NZHL 2DQMA 4XXCA 2GJRA 3C87A 3IFLL 3D0AA 3PJLA 5BOPA 3T0EB 1JN6A 4WFGE 2F5AH 2N7BA 3IDXL 2J8UB 2ILLA 1F6FB 5FGCB 5EOCL 1UH3A 1KLGA 2KZ1B 2YUXA 5ILTH 4FI8A 1U8IA 4D7BA 4M61B 4Z5RB 4WI9A 1TCRA 3VFNB 4WEBH 3TURA 2DQEH 1CYXA 1YMMB 2ZG2A 4UNVA 2DYRB 4GUCA 2DKMA 4HG4J 1XF4B 5EUKB 3OPZL 1NGZA 4NQEA 5DMIL 1AQDB 2P5EA 4EI5C 4LKCA 1PYWB 4X5LA 2GT9A 1HH6A 1BX2A 3D50A 3QUZC 5E2VL 2J8UF 1MFBH 1OGTB 2RALA 4UZSA 4AYFB 2WIIB 3B7UX 2Y7MA 3BH9A 3IXTB 4GBXA 2WUBH 4GRLD 2GYSA 5E2WL 1MWAL 4DPRA 2EADA 1RIHL 2O6CA 2ROXA 3UPRB 3FQTB 4HUWA 3QG6A 2HFGL 3QQ9D 5DMKB 4IIQA 2Y6SD 1IFGA 1KYUA 5AOIA 3WKML 3WAJA 2EH7L 2HX7A 4E5XB 3D2TA 1FYTB 3UJTH 3HS8A 3DKHA 5D2NA 2W9DL 5DWUH 5E6YA 5JUEL 5HYIA 2HLFC 4IU2A 2Y36H 4DESA 2CCWA 5MERA 4OZIF 3NABL 2EDQA 2F54D 3T0DA 1GHFH 4JR9L 2VDQB 3BGMA 1UM4L 2EXTA 5DO2D 4LLAA 3ELAT 3SY0A 1F5WA 1OM3L 3LRSB 1QP1A 4K3HA 3QNFA 4YC2C 2XX0A 1CGXA 4UV4H 4BDVB 1A6UH 4NKIL 3MTRA 2VQ1B 4OZHB 2V7NA 3FFCA 1SYSA 3B7TA 3CFQA 3N0PB 1G7IB 4GEIA 3BSHA 4RGMC 1KLUA 3WEAA 3E2HB 4ODTH 3V0VB 1KB5H 1TTBA 4Q7DA 4JFUA 1K72A 3QHZL 4OZIB 2OYLA 2R0KH 3N1QC 5A7EA 3FFDB 4LCWD 3EXJA 3TF7C 1GS7A 2JSFA 4LVOC 4PWFA 1MOEA 3QIUB 4LU5H 5T5NF 4YBLB 3RGVD 4PWHA 2FQDA 4B97A 4KO5A 3OPZH 4F33B 3ZHLA 2UV3A 3BW9B 2QHRL 3RZCC 2KC0A 3FTVA 3V6OE 4MRCA 2C3VB 3KEDA 3QJQB 3FB6A 1D7FA 1WJ3A 3HE7A 5GZNA 3ZR5A 2YSTA 2CHZA 1TVBB 4XNUH 4MJ6B 4WHCA 1BLIA 5HI3C 4PIBA 3MNMA 4XX1G 4NNPH 4KK6C 1CL7H 1P5VB 4XZUA 4TLUA 4QF1A 4N2DA 2HLEB 5E94B 4PB0L 4HJGB 3U83A 4IQHA 2P8LA 4TF4A 1FVCA 3ILPB 5BRQA 4HOWA 1J5OL 5D4HA 3IGAB 2AK4D 4JHAH 1P4IH 5TPWH 4AQEA 1OPGH 3NIFE 5CLZA 3GSNL 2G2PA 4G9FA 2UVEA 3ILQC 3TT1L 3U1QA 1UCTA 4Z3GA 4GW1B 4I3RH 4S1QL 2QPEB 2DQTL 4KI1A 4P3CH 4PBVC 3SDDC 3OB8A 1TVHA 1AC6A 3K5SA 1J8RA 3P3RA 4L4TA 4U1LA 5CP3A 4D9QD 1I9RL 3TO4D 4EKJA 3PWPE 2NY3B 1MCCA 3IDJA 4WWNA 1UWXK 5C2BL 1FFOB 2XACC 4IBZA 2MQCA 3JV6B 2C7FA 2IALA 5FUZL 1OB1B 3D52A 4CVZB 4GKOA 5I18H 2D3VA 4I0PA 4R90H 4NO0B 5SX4I 2VDPB 1JMXA 1RKRA 3KPMA 3DO4A 4HIXL 5BJTB 2NT1A 2EIBA 3QQDA 1KN4H 2P49B 1TO5A 1XR8B 1YEIH 5H94B 2PPEA 3MV11 1L6PA 5EZJB 2OP4L 3U4KA 2CIKB 1S9WB 2IQ9L 4LEXH 3GBEA 2CK0L 5HJBA 3BAIA 1IT9L 1V8HA 2VL5A 3CZSA 1JBJA 2YJLA 5F3FA 5I5MA 4Y4HD 2XTSA 1QX1A 3C5ZC 3KCWA 1MQ8A 3VFVA 1TLMA 4K4KA 5CCGE 4PJCA 2H3NB 5E1IA 5TJWK 3PUCA 1XHHA 1J8SA 3PWUB 2WUCL 5CIPA 1UM6H 4N0UE 2GJ6B 4JANB 1I1FB 3S2AA 4L8SB 3HKZA 2X1OA 1JI1A 3QEQA 1GC1L 2GHWB 1W72A 3TBBA 1SDAB 1ZGLM 4LLDA 4FKKA 2CU9A 3OLDA 4FQXA 3QS3A 4Y9BA 5I17B 4J5VA 6FABL 3R7QA 2Z65C 3S96B 3GMNA 5CIPH 5FA3A 4LLDB 1KCKA 4D9RE 1CICA 4GH7B 4KROD 4X6DE 3BKMH 4PPTA 1ZA6A 2YBRB 2IAAC 4RA0C 2E6PA 1QNZH 4EQ2A 2XN2A 4L1TA 2CJUH 4BK8A 4WKZB 4QEGA 4ZW7A 4GUQA 5CZKA 5T1KD 2XQ0A 3ALPA 4LCUA 5CIPB 1TFHA 4BUQA 3U0WH 3SKUD 1R5IA 4OF3A 1MDTA 4UV7H 3BX7C 4L18A 3KYMA 2P43B 4MB5A 1E43A 4H1LG 1LQBC 4LB8A 4OSUL 1WVZA 3GRWA 4N2OA 1DQLL 3L5XH 1UJ3A 2WBWB 1UFGA 4M7ZB 5IM7B 5C8JA 1MDAA 1N12A 4FNLL 1LL1A 3BN3B 3CH8A 4U1SB 2A0LD 3WELA 5IR1B 1MJJB 3VXPA 1F13A 2CBMA 1OOAA 1TFPA 3WXVL 3A4FA 3GSOA 1RLWA 2TRYA 4HEPG 2OSLA 3KPMB 5G55A 1H5BB 2DJUA 1LNUB 3ECBA 1DBJL 5E0FA 3NIDB 3LZOA 2O5ZH 2D4DA 1FN4B 1T7VA 3LXCA 4IW4C 5I0ZA 4I3SL 1JZ2A 5D4QA 5D1ZD 1HH9B 4PS4H 4F80A 1EO5A 1XH2A 3VSQA 5BQDA 4FHJA 3VMPA 1BZQK 5FUCE 3X11B 1NKRA 3IDJB 1OEZW 5B7MA 2B8OT 4P07A 1WRFA 4OF7A 3QGVA 1PFOA 2XG5B 1MFVA 4JRXE 1S5IH 2J88L 4Q6KA 2N7AA 3SOBH 2Q8BL 4ODVH 1NWOA 4WJG3 3ZOAA 4Q2ZB 2Y07H 5JIKA 4CNIB 4YAQA 1H5BA 1C1EH 4XMVA 4EN3D 1CLZH 2FL5A 3FOMA 1BZDA 1X5FA 4HGKC 1GZHC 4JZNA 2NNAB 1NGPH 3ET9F 3BHBB 4AQEB 5KUKA 3V4PH 5I6MA 4ONGL 1FVCB 2H4EA 2AS5M 3VGEA 4NRXB 2ATPB 2W60B 4NT6B 3R1GH 1DFBL 1UJ3B 3EBAA 2QGEA 4JAMA 2KMWA 1GVIA 3J27A 3TO2A 3C5ZB 1S8DB 1R6VA 1QSFE 4QXTA 2VW7A 4Y88A 1WWCA 3VXOB 1RLBA 4DGIL 4XTRD 1HCYA 4OCXH 5LNGA 2CO7B 1IT9H 4KROC 4WI3A 3VGAB 1OD7A 3I9AA 4P2QD 5B7EA 5C0EA 2XVKA 2NY5L 4U1GB 5IHZB 4HEME 3NSCA 3IMSA 4ICXA 4CW1A 3EYUH 4RGNE 1CICB 2DQGL 1SJEB 3TEYA 2AQ2A 4PB0H 4NQED 4OQTL 1VCAA 4Z7VE 3BP5B 4XNAA 1KLUB 4EIZC 4FQXB 1G7IA 3HC3L 1UCBH 2V7NB 3EF4A 4I5BB 4YPGA 2DW5A 5E6IC 5B1BB 3P4NA 1JCVA 1EANA 3F85A 2CNYA 3D3VD 3DX6B 4JJHA 4U1IA 4YDLC 5I30L 1RZ7H 4L8SA 3OGCA 2WWNA 4PHZA 2EUVA 4O2EB 3S4SA 4Z7UE 3ZTEA 5IWLC 5MENA 5IHLB 5LGHH 4F5CA 1NBZB 1AY1L 3PWUA 2LTQB 3DK0A 1TZAA 4OCWL 1UWGH 2H3NA 4L8CB 1G94A 3DXAD 3A21A 1HX0A 1IGJA 4MD0A 2UZPA 2EEXA 3NRQA 1A4KB 3ULUL 1LLAA 3LPGA 3RI5K 3N3EA 5BV7L 2CBTA 1KB5L 5EU6D 1H8OA 3R18A 3WD5H 5KSAA 5DMKA 2MCPH 1S9WA 1PGRB 1MFAH 4UDUB 4BQCA 4YDNA 2Y06L 2C1OA 2ZXBA 1HZHL 4CC4C 4MA8L 5H94A 1X7QA 1P7BA 4GBXB 1VPOL 2ARWA 1NM9A 5BV7C 3QIWB 4GXUM 1H5BC 2K6ZA 4J3WA 3FQ2A 3F7KA 1NBYA 1E4HA 2HTLC 4NO0A 1OZUA 2MOGA 2GCYB 5AD0B 4ZFZA 4P2OB 1NC4D 1O9WA 4P2RD 1KZYA 1JRHI 3NT0A 1YMMA 3BLPX 4JFXB 2XY1A 3VFNA 3ZT6A 3JV6A 5EO1B 1V3JA 3MBEB 3ZQ9A 4DUWA 1F90H 3PGFH 5CJ5A 5C0CD 2C9VA 1MCEA 2DQGH 1N8ZB 3KL5A 3EH4B 2BZ7A 2IEPA 2GVYA 3L5JA 3OKMB 1ZMYA 4W9HC 4IBTA 3LDBC 5KVEH 1TVHB 2PTVA 1UM6L 3MNVB 2HT2C 5AVSB 1T22A 2H0PA 4QO1A 2OX5B 5CS7A 5AUMB 4ONFH 2A3TA 3IFOB 5ISZB 1RZFH 3O41B 4UQ2A 2C34A 1CFQA 3UMTA 3IGAA 4GEJA 3QIBC 5D1XC 6TAAA 3OQRA 3WIHA 2C9XA 4NO3B 3VFMA 2EIJB 4WW2A 3WBDA 4FERA 3MZGB 4IRSD 1YEFL 3V52H 2DAVA 3R19A 1BW8A 4MQSB 3WJMB 2WTRA 3BDYH 3GKWH 3FB6B 5CSZA 5CJXA 2C3VA 5IMOB 5C09B 3KWXA 3P9LA 1RUQL 2DLGA 3MNWA 2X1PA 3L4UA 3QFJE 2FWLB 3WFBL 3CZUB 5F72S 1YEIL 3Q44A 3D39E 3MJ6A 4R84A 1URLA 4MXVE 1RUKH 4YUEH 4LSPH 4OCSL 1JV5A 2AHIA 2R7EB 2CSPA 8PAZA 1JGVH 3P2BA 5JPMA 1NBVL 3CXDL 1VZHA 3RKDD 3LQZB 3T9WA 2XPGA 1L9PA 1BIIA 3K8LA 4BKLB 2VQ1A 2ATAA 3PP3K 4KX7A 5HJ3B 4GQZA 1HU8A 1FL5B 4BDVA 2APSA 2NRDA 3F7QA 3SY0B 1V27A 5I6PA 3UTSA 1VFAB 4FQXC 4EDXA 1CURA 2HTKD 3UPAA 5KJRL 3ZJAA 3KYKL 1CGSH 5D7JC 4JVUA 5DT1H 1QTYT 1P9MC 4JO1L 1BZ9B 2IBZY 1MG2C 3NIFF 4V2BA 1NCIA 4WSKA 1A4CA 1NMCB 5B4MC 3S9DB 3N40F 4BFKA 4BZ1H 2BVUA 2ZJSL 1T66C 4Z3JA 1MJUL 1RURH 3IU4L 43CAA 5EOTB 2VXVL 3SZKC 4MCYB 2OMXA 1P7QD 2COQA 1J5DA 4AUJA 4WV1B 4ZFFB 2OJ1A 1MKFA 4UT9A 3W57A 2OW6A 2WIIA 1QHQA 2XCMC 2P28B 4I18A 4MCZB 4YQXH 1GGUA 5E2UL 3ARDD 3I9GL 5C7ZA 3ML8A 4ZX3A 1HOCA 1UJTA 2J2ZB 1FO0L 2P5EB 2NW2A 1B0WA 1AQDA 1UZ6E 4JKNA 4UUJA 5D2NE 2XWDA 1EMTH 1JUFB 4HIEA 5J9PB 4PJ9C 4UQ3B 1HAWA 1XF3A 3QHZH 4NUGH 4ODSH 4OSUH 4KJWD 1EHLH 5FYKE 5ESVA 3V4VB 2NLJA 1U8IB 1IFHL 1JFHA 2WXGA 4Y2DD 5KEZA 4KTDH 1IX2A 3ARQA 1KLGB 1MW2A 4IGBB 4AIOA 2X7LB 3S8GB 1JPGB 1OCWL 2XV0A 3Q8EA 4JZJA 5FFLA 3H9YA 5B38G 4IBVA 4XOCA 1E9OB 3T0EA 4YWGH 4RX4A 4WI8A 5I28A 4RESB 5FDWB 5IBLD 2HUHA 3CVBA 2E75C 2OMUA 4LPCA 1DBJH 4TNGA 2PLTA 1GZPB 2NXZC 3HA0A 1Q9KB 2DJ4A 4LSSL 1IC1A 4B3VA 3E80A 4PS4L 4R3SB 1GTFA 2AJXH 3GJFK 4OCRL 4KK6D 2ZF9A 3FUJA 2X28A 3ECUA 1V10A 5SWZE 3SE4A 3GYRA 4NERA 4AYID 1S9YB 4LCYB 4HKJA 1OTSD 5A2KH 5L8KB 3O6KL 3BFWA 2ZCKL 2OAAA 1H15A 3HS9A 4CGUB 3II2A 4OF6A 3T6WA 3DI3B 5IVXA 2HJFA 5DS1A 4PTUA 5C09D 1FYHB 1HC1A 4Y5YC 5I66B 4EDWL 4OUUB 2EE0A 2QPSA 3MLWH 3TVMD 2JCCA 1ETB1 2QVKA 3WSQH 4OCWH 1AZBA 1PEZA 4HX1A 4TUUA 4F7PB 4HJ0C 1WWAX 3GHEH 3KH4A 4PWKA 2DPKA 1MLBB 4C4BA 1S7TA 3FZUC 3MLTB 3CFIC 2LAGB 3MRKA 5EC2A 1BAFH 3ZE0B 3ZU8A 5ID1B 3MLYL 1ZTXL 1XXFC 1IKFH 3N91A 1A5FH 2NDGA 4WUKH 2AVFA 3KGTA 1JHLH 3PP4H 1W0WB 3BVDB 3VFTA 5MEOA 2VZ3A 2XKSA 4PEEA 1HHIA 1BQHG 3ENEA 3GSWB 2F7PA 1WAAE 4ZOEA 5JXED 4XXWC 5T3XE 4OLYL 3S98A 3IVKB 1YEJH 3LPWA 1EXUA 1GPOH 2OV0A 3F6IA 4LSDA 5FO8B 5ICZA 1I82A 3BFQG 5L2JB 1MHCA 4UQCA 2FYYA 2XZCL 4BE5A 3H9SD 2Q6WA 2A4CA 1MFCL 2IH9A 1J1OH 2EINB 5T1LD 4PW3A 2F74B 4XVTL 5HGAB 1FVEA 3WUWG 3UTSE 3T3MB 2K45A 2FSEA 5KVGH 4TQPA 2DN7A 4G80A 5DHEA 4WGWB 1JV2B 5E1AA 2ZUVA 3L3OC 4LHUB 1E30A 3H9SE 4J2QA 1OT2A 4R7NA 4GP4B 2EABA 4P2QA 4X7EC 4G7QB 3RX8A 1F11B 4HP5A 3BZEA 1ONQB 4ZSOA 1AQHA 3S88L 2AERT 3BEWB 2E8YA 1SHXA 3FFCD 4M5ZH 5IJVB 1D9KB 4E9RA 5IQ7H 5TE6H 2VSCA 1NH6A 2JKNA 3T3MF 1P6FA 3M17B 3IMWA 1J0YA 3OM3B 5HDLA 3TCLB 3C5JB 3M1OA 4XNMB 2ZIDA 4D0CB 4K9EC 3ZDYB 3FDWA 5GRJH 3E6HA 3FSZA 3NUKA 4IGBD 3V9CA 5IV2B 1CR9L 2EIZB 2DL2A 3A6BH 4N2EA 3WLWC 4JDZA 2CBQA 2WXMA 4LASL 2NY4C 3UO1H 2FX7L 1ZKAA 4ZUUB 3V0HA 4N0UB 4F5CE 5ABDE 3OJMB 1WICA 3I6KA 1D5ZA 5DD1H 4XE0A 2MPVA 1O7SA 2ADIB 2HN7A 2W07B 3KPNA 3RJDA 3FH5A 3P4MB 3INUL 5EO0B 3EDDA 3T08A 1M6UA 2OKMA 2V5RA 1TU2B 5C08D 3BAEH 4C54A 4NWTH 1MF2H 1OK0A 1U8LB 2CKBB 4KRPC 3MO1B 1MFNA 3PGFL 4G11A 2EDFA 4QDGA 4YDJA 5FYJD 4HIQA 3T0EE 4AGPA 4X99B 1G9EA 2X9XA 3GLZA 3RIKA 2ZZUT 2J5LC 5IHUH 3Q2WA 4FQHA 3OF6A 5FGCE 4ZJ9A 1X4YA 2I9LB 3MOAL 4ZFGL 4KJPD 4F15B 5I2IA 4XMPL 4YBHA 2AKRA 3QO0B 3D0VA 1E4XL 3FO2A 1GGIH 4XMLH 5L88L 1I8MA 4PJ8A 3R8QA 4KQ4L 4RNRA 1DDTA 4K8RD 4OJYA 3TWCH 4DAGL 4OI9A 2A73B 4QRPE 4F1ZA 2ZUQC 4QMEA 2BOLA 1E5ZA 2VLRE 1U8HB 1NIBA 4DTGH 5LLIC 2PETA 4OF5A 3GXMA 4R7VA 5DD0L 1ES0B 4EZJA 1LVEA 4JEGB 1KY6A 2F58L 1ZY9A 4KHXH 3C60A 2VZOA 3ZZLA 1I1AA 2XRAL 3X1FA 2FATL 4N87A 4X8XA 3QNYA 1R5WB 2OMYA 2FJGA 5E51A 2MHAB 3JWNG 5BVJA 3V4VL 2E9WA 2O6DA 3DMMA 1CDJA 3VWJA 2AZUA 5DDHA 3MDJA 1J0IA 1DFBH 5AVRB 1TEYA 3SCMB 3NCJL 1AI1L 4AZ8B 4PG9B 5D1QB 1BQRA 3KS0H 2E9BA 3BSZH 2R4SL 3LXAA 5LCVL 1QR1A 1HKLL 2JNZA 2AC0A 1KFAH 1FZKB 5DRZA 4DP8X 4NWUL 1AGBB 5AW1B 3HLAB 3GSRA 1LE9B 3II3A 2GTWB 4AYSA 4R96A 2EYSB 1ZDQA 3C6LB 1OWWA 3HI6L 4QJ3B 3VD4A 3JVGA 4H1LB 4PRIE 5GRXG 3U9WA 1WEJL 3QHTC 2ZOTA 1NCOA 4CVUA 4PJ5E 3BDXA 4LL1A 3VFOA 5ITFA 2ZCLH 1MUJA 3WS6A 4LCCB 3KYKH 4X4YB 3TVMA 1BSIA 3WLBA 3GRBA 2QPDB 5EBWA 5AW6B 2CKNA 1BZ7B 2D3NA 5DVOA 2XOTA 2ZXDA 4KNSA 2VAJA 3MJWA 2F54E 5H35B 3VE0A 4ZPTB 4LBEB 4XHQA 1DBAL 2XQYG 5E5UB 4X5XA 3QUZB 5E6RB 4MBOA 4Z7VF 4XMXA 3ZDYE 4ZMXA 3AB0C 3O8XC 2CHXA 4H0IA 1RK1A 4P59L 4P5RA 4YDIH 2FO4B 3QZWA 2GJZB 3BPNB 2B39A 3MX0A 3HI1B 5ECGA 4HFWB 5I1IL 3ARXA 2F1EA 3N85L 1K4DA 3QA3B 3SYCA 3S35X 1D6EB 1KCUL 5F7DB 1JK9B 3IDIA 2YD8A 4HPHA 3QNXB 5K93A 5DJ8B 3B43A 5GGTH 3U2SA 1QG3A 2EVHA 4ZMVA 3L1OH 1DBBL 1I1YA 4Z7VB 4Y2DA 4KVCL 3CDFA 5INDB 3QUYD 2Q20A 4AYBA 3QRGL 4HIIB 5AW7B 3QHFL 4NZJA 1TPXC 3LNIA 4LLUA 3UAJD 5JXAH 1PZSA 4W6YB 3RAJL 4H26A 1SLWA 8FABB 5LG6A 2DQEL 2F15A 4Y5VA 1XH3A 5GGRY 3WHXA 1CN4A 2N01B 5I75B 5JO5A 4Y9CA 1QACA 4G7YL 4QLWA 3H2QA 1NKGA 1BOGA 5KSVA 1OTUD 3NJNA 3LH8A 4ZFOA 4OGXL 4UQDA 4BRVA 1HOEA 1NAKL 3V9EA 3CUPA 5H37H 1SEBB 1SY6A 5JHDE 1QFWL 1AYOA 4JFEE 4PW4A 1M7IB 2B08A 4ZZKA 1HDMB 3OVUB 1NC2A 3HG1A 1OP3K 3CFEA 3CGTA 2LU7A 2QVMA 3KGSA 2N56A 3NCMA 1X3DA 2J56A 1ZGLA 4BZ2H 1TTRA 2BVTA 2VISA 4KI5C 1SY6L 1TSHA 3DVIA 2E7MA 4GFXA 3X2QB 5D5MB 5C0AE 2B0SH 5E9DD 1VRSA 5ID0A 4ANVA 1DVYA 4RRPG 3P02A 4JFPA 1VEOA 4NC1C 4QHUA 2ICWI 2PP9A 5JA9A 2G0KA 5GGTL 4XCCL 3L5IA 4O58H 4WU7A 1U95B 2A9MH 2F53D 3QULB 4KAQH 3ESOA 4PGDA 4HFUL 3IJ9A 3Q5TA 2D0FA 1J10A 2BXYA 3O0RH 4XI5C 1HHHB 2GSIB 4N9GA 5GIRA 1WWWX 4LF3B 3NDZE 4P5TB 1U2YA 4LVHB 1KXQE 1A7QL 1OF2B 3MRRB 2A74B 1NIAA 1XZ0B 3GZPA 5DZVA 5BUGA 1Q1PA 4XCEA 4X6DB 1J12A 3ZE2F 3ZRCC 3QEQE 2WW8A 2CLZA 5JDJA 1KBKA 4GJTB 4O5LL 5IFJB 5KVDE 3TBYB 2CUHA 4MXVF 3SD2A 4AIZA 2XVLA 4WFGD 4L3EE 4DN4L 1MCJA 3C2AL 2Q8AL 5K9JH 5TQ2L 3EHBB 1S7SA 2PNDA 3SJVE 2ZPKL 3WTTA 1QSVA 2D31A 2VERN 3OXRB 4DO4A 5DJ6B 1J9CT 3B2PA 5CINL 2JJTA 5TTRA 2E4TA 3BEVB 2EE6A 3KHQA 1BQLL 4MNGB 1WUZA 2EE9A 4HS6B 2IOOA 3CXHK 2GI7A 1KNOA 4AK1A 4JG5A 1QQDA 2A6DB 1ED3B 4KMQA 3TCXA 4AKQA 4O02L 3WKYA 3U6RA 3CHOA 4IK6A 3DROA 5IJKC 1T5XB 3C6SB 4UT6A 4P59H 2B59B 3TBWB 4HALA 2Z31B 3BVUA 1E6JL 2WNWA 2QMJA 1EEZA 3DDFA 5EU6A 2J6EL 5EEVA 3GEWB 3O4OB 1WFJA 3W9DB 1UOLA 3B8SA 2UXTA 5E6IA 4KHTH 5DXWA 5DQDH 3STZB 1R0AH 4FQQB 2EJ1A 4MVBD 5DJCA 4MJ4A 5I8EA 4DETA 3LZFL 5CZVH 3HCVB 3VFUB 4MWFB 2BINA 5IW1A 3WXWL 4MWFA 4P5KB 4Z7WE 4CMHB 1THAA 2DYPB 3QZOA 1YO4A 2X2HA 5CJOL 5GS1C 3STLA 5I0VA 1JZ7A 4PSRA 4OLXL 5TF1L 2XTJB 1LK3H 1J88A 4OQ1A 1KGCE 2M26A 4HD9A 4TSAH 5CWSB 3PWVA 3MV01 3V7MA 4YHIB 4B7IA 4HUVA 1CL7I 1ETZB 1H3VA 1EEZB 3OKOB 3NRFA 1A9BB 3SDXE 1UUNA 2A9DA 4JGNA 3TBWA 3C6LC 4C4UA 5IHBA 2OM5A 2ERJC 4OBRA 4QHNA 4PCKA 3QNZA 4JW3A 4TPRL 4KUCF 4NXSA 2FEDD 4XCFH 1ED3A 5AW0B 2A6DA 1QQDB 5F70A 1MFUA 2UWEA 3CXHJ 3KMDA 2NY2B 3H3PL 5FYLL 3F7YB 5EDXA 2D0GA 3RWDA 4M7ZC 4L2LA 2X09A 4MA7H 4OGAC 4Q89A 1NZRA 2O5NA 3IFNL 4HLZH 1KG0B 3HEIB 3FU3A 2ATKA 4J2XA 2W8CA 5A2BA 4N5ED 5KWYC 2P52A 2WO3B 2WKOA 2R1WB 3P30L 1Z2KA 1E42A 4FMKA 1BOYA 2AABH 5TQ0L 1KIPB 1R5VA 1LEGB 5CBAB 1PZUB 3ORJA 4A37A 2CLZB 1LO4H 1RMFH 5D93C 5EPMB 5DA0B 1A14H 1XZ0A 3APMA 4KZCA 2X4PA 5AL8A 1ODUA 3MRRA 2CMRL 4CILA 5IW6A 2C3XA 1BGXH 2X4RA 4G3YL 2ENSA 2PCYA 4PJBE 2Y2YA 3NSDA 4TUOA 3TV3H 1F3DJ 4URKA 2JCCF 3T65A 2SODB 3U0WL 2JV6A 2EDHA 5GS3A 4PS7A 1J8HA 5SWZB 4B9FA 1CFSB 4LZKA 1IRAY 4AG4H 4ALAC 4HCRL 1ZVNA 1U95A 2HVBA 5ABAA 3EHBD 3QISA 3SODB 1MHEA 2BHZA 4YZWA 5KOMC 1PG7X 3V0FA 2OJEA 3Q05A 4FG4A 5F96L 2Z1KA 4G8IB 1GPOL 3DHUA 4IKJA 4AQ8C 2OMTB 3BYTA 3QJVB 1MAJA 3DBXA 3JQOB 1P5UA 2GIXA 4RGND 3DX9B 1C7SA 1DCLA 1EGJA 4G2AA 2JH2A 2EDJA 1XH0A 2ZX6A 1IBDA 1YHPA 3NG5A 4H25B 2EICA 4OGXH 5C7XL 4Y4KC 3GF8A 2HX9A 4IS6B 1AQMA 4A55A 3ABKB 4KJPC 4IRJD 3VTMA 3JSSA 4DUVA 2EIKB 5KVGL 3VGDA 4I3SH 5MEQA 2W0KA 1M7IA 1JG9A 4IJ3C 3HS0C 3PDOA 1FNAA 4PGJA 1T89A 1O9ZA 2P80A 1HL8A 2BW4A 3GSXB 3WY1A 4HK3J 4WNJA 3MPCA 4U1GC 3G04A 1PFCA 2P4AB 1NSNL 4N2CA 4Q9RH 2NCMA 2B4CL 2QV4A 2QTEA 4WO4D 5JDSB 4QWWC 4WTZG 1KTKE 6PCYA 2DYPD 2O5YH 3LCYA 4G71B 1ASOA 2I24N 1L5GA 1YEFH 3KPLA 4C58B 3VW3L 2OL3L 3BE1H 1CE6A 4GAYA 5K1VA 2VDMH 5EO9B 1PPIA 3ULUH 2IOIA 3PV6A 2EILB 1A0QL 1PL3A 1BFSA 5DMGC 5EZPA 3LPPA 1CIUA 2ZWSA 4X80L 3RL2A 3CFBB 4GMTH 4UI2A 1K2DB 5EZOH 1KXTB 5AOZA 2Y7LA 5AZEL 1JWSB 1JPTL 2KLSA 4NUQA 5A2JH 2YQ2A 4HJIA 1RJYA 4YL4A 3UO1L 4AJ0A 3GM0A 4I87A 2CDGA 2DQIL 2L04A 4PAZA 1EZUA 1HHKB 3B5GA 1DJGA 1AGFB 1G9MH 4KY1L 3MRMA 2ERJB 1FLRH 2AV7A 3LMJL 5T3ZE 4PJ5B 3VWKB 4F3FB 3RX9A 1J0HA 1S9VA 4XVOA 2XIBA 2VLJD 2DRUA 4UTBL 4U1HA 2NY2D 1I9IL 3S0PA 2VRKA 4FYSA 4XPGH 4QYOB 4HFWA 4XP4H 2WOYA 1AG0A 4N2NA 4IOSA 3ARRA 4IRJA 4AXWA 5B3SB 1FA4A 2FEEL 3QZWB 3VG9C 3FRPG 4PWIA 2A99A 3EYFB 2PWEA 3KPRE 3QO1B 2B5IC 2B4CC 5GHWL 3H9SA 4X5XB 4K23H 5HHNA 4ZPTA 2F7RA 4C8XA 3JBG7 4R4ND 1Z7JA 4B9IA 5J3HD 4ZDHA 5IB3B 4H1LH 2ZOLA 2CWRA 4WHTB 1OGAE 4FNPA 4PJHE 3D39B 1GZHA 4JKMA 1F45A 3EFOB 3QWQB 1G87A 4LDLB 1L0QA 3K6NA 1MJUH 3IU4H 1ACYH 5DHVB 4KQ4H 4APQB 5HGBB 2YWYA 3I75B 4L0YA 3WE6A 5ENWA 1Q9WA 5LVEA 1CLVA 5EF0A 4M03A 4Y5YB 1A1MB 4YK4B 2VUYA 3QVAA 2O72A 3L17A 3S36H 4DWHA 2X89D 3P3UA 1M4KA 3UTTE 4HXAH 5EMYA 3DI2B 5HHXL 1ORSB 3D2UA 4NEHB 4WW2F 3IDXH 4PGEA 3G7TA 1QR1B 4F92B 3MA7A 4LP4A 4OJCA 4MXQC 1JGEA 4LIQH 2XC8A 4LSUH 3V8CA 4FQ2L 5DHYA 2X3BA 1RUMH 5KSBA 5DDHB 4FA7B 4X4XB 1TTGA 5J57B 1BBDH 1UQSB 2QSVA 2LFEA 4PGCB 4UQ9A 2AXFA 1SJVA 4N0CD 1X5AA 4Y4KB 4YL9A 3QI9B 5KVEE 5EFIB 3VXRA 1N0XH 3AMLA 4AV0A 2XWXA 4KV5F 2BSSA 5LG1A 3C5SB 4KKBD 2G5BA 3UP6A 5FKAB 3MV8D 5F0MB 1EEYB 1WIPA 5KTEL 3PWPD 1ZLWH 5I5RA 4BWTA 1UZ8A 2WN2A 4I48A 3V5DA 5GZND 3QPXL 3B3BA 5IBTL 4XPAL 1R3IH 4OZ4A 1GGBH 3OR7B 3FL7A 4Y1SA 5J13B 5H8DA 5B1JA 3FT4A 3U6XS 5C9KA 5I2IB 3DV6B 1NFAA 4CC1A 1KEGH 4AKOA 5T5FL 3ULAB 4MB3A 2DWTA 4HCIA 2I25N 4TUKL 4DJMA 5I19L 1FVDA 3PPSA 4F37F 1QNIA 5DRNB 4LE8A 4G8FB 1RZ8A 2X6UA 1IM9B 3PL6A 4MDJB 3F12A 1RHFA 2VNCA 4KJYB 2PPAA 2YA2A 3SPHA 1U8LA 2YSSA 2DQDH 1TU2A 1OTTC 2XKNB 1SMAA 2EDTA 4M5YH 3QCUL 3B2MA 3PGDB 2N7SA 4WNQA 4X80H 3FRUA 3BSGA 4U1KA 4RRPA 5TFSL 2OL3A 3OJ2C 3KPSA 1HS6A 2NSXA 1JGDB 1EMTL 2D2OA 2GUOB 1I8LC 3NN8B 5CKGA 1OB0A 3OGOE 5IJCC 2EIZA 5E8DL 2VITB 4AVKA 4YR6B 5CJ8A 1NFKA 4LCIL 1OW0C 3TFKD 4L9DA 1HSAB 2YD2A 1BD2D 1B0RA 3HHMA 1QKZH 4KRLB 5JHDD 3C5JA 3NIGF 4OZFB 2YAEA 3ABLB 2VLME 4BXVA 1ILUA 1HL4A 2UYLB 5C6TL 1OP3H 3VRJA 1I8KA 3FN0L 4PUBH 2DQCH 4D9RD 2OMZA 3GLDA 3VGHA 3DJ9A 3HG4A 3QXVA 3PAVA 1TQUA 3U9PL 3I9PA 2A6IA 4UT7L 5KYUB 2PPDA 4LHUA 4PJCF 5FHBL 3UG5A 3S88H 1MCBA 5CEZE 2BVEA 1ZT7B 5KZCD 2IAMA 2FLRT 1NFDF 4Y7OC 3K5RA 2OR9H 1RZ7L 4MJ2A 4E9SA 5IMMA 3IJEB 1F6LL 1N5YL 3OKNB 2ROYA 4N0FA 5IG7A 1KT2A 2VH5H 4LHJB 3ZTJG 4TKWA 1AY1H 5BPPA 1I8KB 1TQCB 2DQDL 2OSWA 1YAZA 2EVFA 5FUZH 3H3BC 3GB7A 4PV8A 1B0RB 1TQVA 2XIDA 4YSQA 3VFRA 1IQDB 4BSVB 3PQYD 5I1LA 1G1KA 4GKNA 4HH8A 3WY3A 4JM4H 1JYNA 3SQOH 3CN2A 3MGOB 2XBZA 3OKKB 4I4WA 3BZDA 1XGZA 4JFEB 3VFTB 3MQIA 2H1PL 3TNNA 5F1NA 3BWAB 3PRZA 4JO3H 4ZK8A 1I1AD 3RDTA 2H47C 3V9FA 4N28A 1QEWB 2QQKH 5AALA 1KBPA 1BVZA 1N0XL 1S7TB 2FBJL 4OLYH 3SDXA 4LMQE 1IAIL 4WNQB 4J6RH 4WI4A 1NBQA 4OVUA 1J5IA 1KCLA 1GH7A 1JZGA 3SPGA 3SGEI 3DSNB 2VDKL 4J4PD 4M4PA 1UT2A 3ZE1B 3ZUNC 2X1QA 2QVIA 3WNPA 1VZGA 5CJBA 3HUJE 3F12B 5I66A 4ATWA 2Q1EA 1IM9A 2EDLA 2YS4A 2IG2H 3IKCB 2FEJA 3ARGD 3QUML 4L1DA 4ATTA 4K3JL 5KS9E 1A1OB 1UC6A 4TNVK 4G8FA 2WXQA 5HHMB 1GOFA 4IBYA 3WNOA 3WN5C 4DCQB 5D1XE 2AAVA 4NUJB 2W9DH 4BA0A 5JUEH 1FE8H 1KUMA 2JKTM 1KJ2A 3PXLA 4DPBX 3QQ3A 4JFTA 4JFSA 3L7FA 3MLWL 1Q9KA 4Q74A 4YSDA 1PX4A 2E76C 1OAJA 4M8UA 3W82A 1X4ZA 5FO7A 5FDWA 4JO8A 3KLHC 3MV9A 3D30A 1N0LB 5EEWA 3FTGA 5HTSA 2EH8L 3WJLC 3WDHA 1LJMA 2B3IA 1MHHA 3CLWA 4Z3FA 5EEUA 5F8RC 5FKAA 1OY3B 2VLKE 3REVB 3KXFE 4JZJB 2JLLA 2F61A 4L8BA 3SDDA 1HHJB 1JNNH 4LLYB 1VKXB 4RFEA 3H6JA 4PJ8C 2XZQH 4W6WB 1CF8L 3ZGIA 2BVQB 4MKMA 4YFLI 4M7LH 1URZA 3N5AA 2WXRA 1KJMA 1AI1H 3OBAA 4LIQL 4IDJL 4A68A 1OT1A 4NHUA 4NNXB 4WHDA 5HYJE 3NZSA 2CM6A 2Y5QA 4MNGE 4F7KA 3QCTH 5E8PB 1ERNA 3D07A 4NJAH 3WTSA 5DHYB 5KSBB 2PXYD 1KTJA 5DQJA 4AUUA 3MRCB 3ARDB 3TN0A 4JY4A 2FGWL 5CUSH 2ZXWB 1NLDH 2VZ1A 3LEVH 4KDWA 2X9ZA 5F7KC 3VH8B 5EIVA 1ORSA 4KROB 1A6AA 4Z7WF 5I1EH 3QXAA 5GS0H 2JMRA 4NC0B 1FIGL 1EUUA 2OJZL 2OTUA 3WS3A 3GZKA 3BPLC 4JKPL 3B9DA 3NJIA 4P0DA 4RVBA 4PRID 4Y5YA 4PVLA 4NLHA 4OZGF 5KSBF 1AZNA 4A2LA 5AW3B 3I75A 6PAZA 3BT0A 1DLFL 1NUDA 4Y5VC 2BIHA 3KJ6H 2V2TA 4CADB 4EDXB 2GJJA 3GBDA 4A7VA 2MJWA 1CD0A 4IOSD 3EFOA 1UG9A 1UHVA 3MCYA 3O6FA 1FL5A 4JDEB 3L5WB 4HCGA 4J28A 4J3BA 4YJZL 4HHAB 4Z7AA 1W72L 4XVUC 1ZHKB 4OI8A 3CBKB 4NQCE 3OAYK 1BYNA 2Q76B 4DTGL 2XPGB 4PREA 4QRAA 1U8QB 3EYFA 3TU6A 2XV3A 1J1PH 3T0XA 1ZT4A 2P5WA 2PO6B 1SBSL 1TZ8A 2R7EA 5E2UH 3Q6FA 3U36A 2X53A 4Q0XL 3ECQA 3QJSB 3NFSH 4TOYL 5E6ID 4MJIB 2F19H 2H3XC 4NBYB 2QFPA 3R06B 3U79A 3VWKA 1B3JA 3PREA 1CFVL 5JQIB 3RVWC 1X44A 4S1RH 3ATEA 1JK8A 1XCWA 4KPHL 4MB4A 2B2XL 4BFBD 2PCPA 4P5MA 4NN7C 2P3YA 3L3GA 5HDRA 4PJIF 2X89A 1WD8A 3NSXA 4I85A 5EBMA 4NZDA 4GFTB 1DUZA 3A6OA 1FF5A 3WGUB 1F6AA 3OKEA 1PX8A 2GQHA 1QI3A 3BPOB 5HHMD 5DFTA 2J8OA 3E8VA 3EZ8A 1SJHA 3MGTB 1QEXA 4IKIA 4AV4A 1MF2L 5DSCB 5KW9L 3RVXD 2C9QA 4PJDA 2OTWB 4OV6F 1S9KC 4GT0A 3MOQA 5KS9B 1HQRA 5DTFB 3P9WB 5LNDA 4YHML 1YPZA 1KSRA 1WAPA 4KY2A 5C2UB 1Q8MA 3BQVA 2G5UA 5AUMA 2E7BA 3L08A 4Z18A 4E42B 4PJBB 3TLRA 4LLVB 5L88H 5C08A 3PHQB 3VFGH 4LAQL 3ZYZA 3GS0A 1N2RB 2F5BH 3E8UH 3FUNA 3GS7A 3LDBB 4BFNA 4YXLL 1AOHA 2QSTA 3BZ4A 5C92A 3D9AL 3ZYIA 1DQVA 4F8QA 4QRRA 4MDRA 5MEQB 1AGDA 1FFPA 5JOPE 4K7FA 2GY7B 2V3DA 3HBGA 2CIIB 2V6HA 2ADGB 2EH8H 2YOAA 1A6PA 4LK4A 3W5NA 5DFWH 4H25A 4CDHA 4UIMA 2JIXD 1N5YH 5DWPA 1WBYA 3BP4B 3UAFA 5IFHH 4HD5A 4J8RA 3KZ8A 2OCFD 4CMHC 5BOZG 4O58L 2IPKB 1PMYA 2OL3H 5JZ7D 3HJEA 1KCUH 4X9FA 2BNUB 2JCWA 3H42L 2MCAA 1A6VL 1WGVA 1WF5A 2NW3B 4FQXD 1RFDH 1X7QB 4JCMA 5AG8A 4AVIA 1R3KB 5FO9A 4QRTB 1X5LA 1NPNA 3OB0H 4NWUH 2WXOA 4OZGA 2VERA 4Z1PA 2GFBA 2FAUA 2DEYX 2FK9A 4G8GB 3IDNB 4QRUB 3W39A 4BH7B 4HF5L 3SDAD 2AK4E 3RB7A 4NQVA 3GBMH 4L8CA 1I75A 3SSGA 1RZKL 2FCBA 4PS8A 4N85A 1GCFA 4OFIA 4P5SA 1LEGA 5BZDB 2QQLL 3W2DL 4QHLA 5IGXH 4LDEB 3LV3B 3KM2A 4Q6YA 4UOZA 1CI5A 3DX6A 4P2CG 3M6DA 4U1IB 5B38B 2YN3A 3VD9A 3CMGA 3L13A 3P4NB 2R15A 2WBXA 2IDCA 2ZP0T 1I7UA 3SQBB 4D9QE 1BM3L 2PR9A 3BIBX 3S2CA 2LOEA 3L6FA 1BEXA 2YQBA 1E9QA 3F7YA 3GMLB 3QIWD 5B3JE 5IEKB 4AUYA 2UWEB 3B7RL 1GGCH 4CW1B 4CDGC 3BVXA 4N2BA 4K94L 2NY3C 3B6SA 4LCWE 4ZW3A 3UC2A 1LE5A 1J1XH 5FWRA 2VCOA 4J3OD 1CQKA 3LNEA 4PY8J 2KKQA 2RH0A 5F6HJ 4H8WH 4L3EB 4GUOA 1C1EL 5F1OB 3UBGA 4PB9L 3ETTA 4APXA 5D6CA 4ZMZA 3K71B 5GRJL 3KXFD 3KPRB 1SJMA 4LLMB 5G4NA 5DEFB 1CD1B 3QORA 4QXTB 5I16B 3QFDB 5F3HB 3C5ZA 3VI4B 3U1SH 1BVKB 5K5YA 2ZKMX 4NP4L 4JAMB 1OD9A 2FR4A 5FC9A 4ILDA 1O7DC 2QL1A 2BFVL 4TMPA 1B4TA 4PI2A 1N6VA 2PTUA 5FGRA 2QKSA 4HPOL 1C5BH 3JXAA 1XT5A 2WGXA 1OE1A 2M2DA 4AQ8A 3QZNA 1U2CA 4LGSB 3BLBA 5DVKA 4PMEA 4DEPC 2IDSA 3VFSB 4DGIH 2FL5B 3LXBA 5D96C 4GAGH 1BVLB 3KLLA 4H88L 3QIUC 3MCKB 4HGWB 1CXKA 4JK0D 3KWUA 3W9DA 2X4OB 2VDNH 4B5EA 1PNDA 1S2EA 1D2OA 4O5LH 4PD4J 3VI4F 1EZLA 3M88A 4TPRH 2ICES 5I6OA 2YEQA 5FOBA 4LRNH 4G9FE 2XG5A 2ZUXA 2BVPA 3DVFA 5D1QD 3O3EB 1IGIH 4L05A 4MAUH 4DH2A 4E9QA 3SPIA 1M1XA 5AOLA 5L0QC 4A2MA 4AVJA 4JG1L 1M9SA 2N1KA 4ORGA 3T4YB 5I1HL 3KCPA 5LBSL 4KGLA 4C83A 3IFNH 2OBGA 5DRXB 1HH9A 3W11C 5DHDA 1IEAA 1DQMH 4OGAD 2R2HB 5I9QB 4LT7A 4MNGA 3ECBB 3BMVA 3FB8A 2Z7WA 4GRLA 3T2NL 1DVFB 3K8MA 4FNTA 2WYZA 4JG0L 3MUJA 1KIRB 4JQVA 1T83A 1ORQB 4GKZA 3VYPA 4YQXL 2XZAH 4AOFA 4PGBB 4PLKC 3OJDA 2GTZB 3I02A 1JI2A 1OW0A 5I26A 3TBYA 1RZIA 3JV5A 3T8XA 4A7QA 1NBCA 5DURB 1AIFB 2BCMA 1YUHB 3D2UD 3H1ZA 1Y1DA 3KYMB 1JXKA 3LS5L 3JTSB 4J3OF 4M56A 1R5IB 4XXCC 4EI0A 2PWHA 5K1NA 4XO9A 3WXWH 1U30A 3AT0A 1RZJH 3O0RL 3ZE0F 4U3CA 5F71A 5FECB 4MSWA 1GYWA 1KN4L 3WKNA 5JQ6L 5GGQL 3Q43A 1U8JA 4YHOH 4QTHA 3IJYA 3PFUA 1TEFA 1CYGA 3ZZSA 1OLZA 2D7NA 3MBWB 4WU7B 4XR8C 2YBRA 5AFAA 3L7EB 3K3QA 3JWDH 4MD4B 4QHUB 2ZYHA 1RZJC 2FHFA 3O3AB