3GTTA

Mouse sod1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
153
structure length
153
Chain Sequence
AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 42
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gttA00
2WYTA 1UXMA 2AQPA 1Z9NA 2Q2LA 4L05A 1MFMA 3CE1A 4A7GF 2Z7WA 3ECWA 3GTVA 2WZ0A 2C9SA 4U4IA 1F18A 2VR8A 2Z7UA 2WWOA 1Q0EA 4OH2A 1EQWA 2K4WA 2JCWA 1SDAB 2WKOA 1B4TA 1BZOA 3L9YA 1E9PA 3GZOA 1KMGA 1P1VA 1E9QA 1IBHA 4N3TA 1E9OA 1E9PB 1SXSA 2JLPA 4N3UA 3H2QA 1PTZA 1E9QB 5KBKA 3S0PA 1E9OB 2AEOA 1YAIA 4MCNA 1PZSA 1SXNA 1N18A 2WWNA 3ECVA 1SXAA 2ZKXA 3F7LA 3CQPA 3ECUA 2WZ6A 1SXBA 2VR6A 1EJ8A 2Z7ZA 1F1AA 2E47A 2E46A 1SRDA 1DO5A 1B4LA 1XSOA 3GZQA 4BCYA 1L3NA 3K91A 3GTTA 1OZUA 5KBLA 2GBTA 1CBJA 3LTVA 1COBA 1HL5A 2WYZA 3QQDA 1N19A 1OALA 2AQRA 1F1GA 2AQSA 1F1DA 3MNDA 3QQDB 1DSWA 3KM1A 4A7SA 5KBMA 1JCVA 2C9VA 3HOGA 2VR7A 4A7QA 1Z9PA 2AF2A 2C9UA 2ZKYA 1PU0A 2ZKWA 3KM2A 1IBFA 3KH3A 1SXCA 1OAJA 3HFFA 2GBVA 1CB4A 3PU7A 1XTLA 2APSA 3HW7A 1RK7A 2WZ5A 2AQNA 4FF9A 4B3EA 3MKGA 2WKOF 3RE0A 4A7GA 1XTMA 3SODB 1BA9A 2XJLA 2Z7YA 3GQFA 4A7VA 1TO5A 3GZPA 1S4IA 2SODB 4BD4A 2AQQA 1UXLA 3KH4A 2V0AA 3F7KA 4A7TA 3KBFA 1SPDA 1YAZA 3L9EA 1QUPA 1SXZA 1U3NA 3H2PA 1HL4A 2NNXA 4OJAA 2LU5A 5CU9A 4A7UA 1IBBA 1IBDA 1IB5A 1JK9A 1AZVA 2R27A 3KBEA 1SDYA 1YSOA 1OZTG 2AQTA 2GBUA 1JK9B 1ESOA 1FUNA 2ZOWA 1TO4A 1OEZW 3CQQA 4MCMA 4BCZA 2XJKA 1SOSA 3T5WA
chains in the Genus database with same CATH superfamily
4I5BA 1RZIB 4UTAL 1JZ8A 3SGKA 1HL8A 2GK2A 2QV4A 1JZJA 1LDPH 2NUTB 2X1PA 3AABA 4JGJA 5EORL 4NQDA 3U1SH 5F9JB 4PBDA 1L0XA 1N26A 1TETL 4MS6A 3JBG7 4HF5L 2XWJA 4OSUH 5BUPA 5JOFB 1E9QA 4GAYA 1DUZB 1OGAA 2DDQL 3HB3D 3UMTA 4X7SH 3D39E 2CRYA 1M71A 1TVHA 1LWJA 1YEKH 2BH0A 2TRHA 2VLJD 5MENA 5JHDA 4JFPB 1N9PA 3IT8D 4AIXA 3CQPA 1QSFA 2D73A 1ZV5A 4JFFA 1BAFL 5CIPA 5H35B 3BZFA 4AUYA 4XN9A 4HQQH 1ZA3B 3NQKA 4WCYH 5GGUB 3MRKB 4CJ0A 3X3FL 2QR0B 3U6RB 4GKZB 4X2UA 3O41A 1PPIA 3ZKXC 2XPZA 5E2JA 2I24N 5HDQH 1ND0A 5I6LA 2W60A 4XI5D 2RJMA 1H6UA 5I0VA 5F1NB 1GSKA 2D0GA 1IAKB 3EOAB 4Y1TA 4CGTA 1NWOA 3PWLA 3BAEL 3NFPA 4XBPA 2F5BH 2RAMA 2PO6C 2EINB 4DVRL 4PCSA 4P59H 3N55A 3OSKA 3QDJB 3QIUC 3H6JA 1QZ1A 3V4PL 4O2FA 1IGYB 3T0AA 2C34A 3HNTH 4YXKH 1CGSL 4DKEL 3ZDXF 4G7YL 3EGXB 4QRRE 2JJUA 5IROD 5TQ0H 1JZGA 3MXVH 2WSDA 4DK3A 2E9IA 3SDXA 1XL4A 1VZHA 1YUHA 1T2XA 1KEGL 2LGNA 3D05A 1FNEB 4KV5F 4XP6L 3VTMA 4UDTA 5C0AD 1J1OL 4UIKL 4XTRD 2OMNA 3QIBA 1IKNA 1P7QD 4HPOL 4TNVK 5A2JH 2GQHA 4I18A 1F41A 4GRWB 1W6LA 4Q0XL 4URTB 5F89A 3IEAA 5IP4A 4LEEA 1I3GL 4ONGH 1RJLB 2XUWA 1TNMA 2HTLC 1F8TH 1OVZA 1M3IA 1AZRA 2GJ6D 4QRUA 3AT9A 4PSRA 3VSQA 5EEXA 7PCYA 2W80C 5KJRH 3EOTH 1HOCB 4JCMA 3NPSB 4LCWD 1EO5A 2FO4B 1ZT1A 2IBBA 3ARXA 3VFNB 1ERNA 4G3YL 4PM1A 5AYUH 5HHPA 5D71L 1X9LA 4GQ9H 1K72A 3BVTA 5ERWA 5IUCA 3Q44A 2GSIB 3IB4A 1DBAH 3MV9D 5ALCL 2LVCA 4O02A 2XPGA 4K07A 5TE7L 3G6JB 1JGUL 1AO7E 3FTGA 5DHVB 3Q5OA 4GG6B 2C9SA 3UAJA 4ANWA 5JMRA 5ETUA 3U30C 2F19H 1ASOA 5F7UA 3C5SB 1JZDC 3EG9A 3WLBA 5IVZA 3TJPA 4OI7A 3CVHH 4HIHA 1A9EB 1AP2B 1PZAA 2ZCKL 5JR1H 3JUYA 1DL7H 1T1XA 3KVPA 1MAKA 2YXFA 2FBRA 5HJ3B 4CGUB 4ZQTA 3DROB 5EC1A 1A6VH 1AXSB 1U2CA 3F7LA 5HVWA 1NCAH 3RWEB 4YDVA 2IPTL 4XHJC 4YDIH 4P99A 3SDAA 2CD0A 3PHQA 4OLYL 1U93B 3OX8A 5F9DC 3WO4B 1PD1A 3OF6D 1D5MB 1PMYA 3JVGA 2X0WA 2IOIA 3NQIA 5F6IC 5GRVL 3Q2LA 3RIAF 1DQML 1YMMA 2X4QB 5HDLA 2VDNL 4N9OB 4TNFA 4PGBA 3FO2B 3MRGA 3TEXA 3IDIA 5AZ2H 1A02N 2HFFB 1LILA 3LKNA 5CJQL 1GSMA 2Z34A 3M45A 4K5PA 2XOTA 1ACCA 4HPHA 1NFIB 3WFZA 4A7QA 1PLGL 2X2IA 3S36L 5B3SB 3MUHL 2W5PA 2Z8VC 2DEYX 4ZUUA 3K4DA 4GKOA 3MBWB 3HG5A 3B8YA 4ODVH 4YL9A 4AQOA 1DBKL 1CDBA 3FKUS 3WUZA 5TDOA 2NY4D 3WJLA 1N5AA 5L6YL 1CDHA 3KYKL 1XCTB 2C1PA 1TJHH 2Y07H 3QCTH 4IK7A 1R5VA 3AT0A 3GTNA 4LPYA 3DRQB 5EIQA 5GGRA 4UTAH 4I2XE 4BQBA 4HHAA 3L3DA 5EORH 3RRQA 2YAMA 3QZOA 5EZLB 4JREC 2PUQT 2IWKA 2XICA 3RJQB 1TETH 4D0CA 2FJHB 3FT3A 4YHNB 1N6QL 4OZIE 4HF5H 5I1AA 2UY7A 3MI6A 3T0EC 2ARJQ 4M1DL 2DDQH 1XMEB 5I5IA 3RGHA 4GFTB 3V6OE 1X5HA 3MGTB 5DC0A 1S7XA 2KDGA 4Z9KB 3KPSB 4MA3A 3NCFB 2Z91B 1VADA 1BAFH 2BPBA 1DJIA 1OSZA 3HJEA 1AGBA 1ETB1 3K6DA 4M7LH 2AXJA 1Z7JA 2IOMA 2WD0A 5I26A 3X3FH 2OL3B 3ZDZE 2JI2A 3HG1B 3D12B 4E2OA 2VXTL 4GRLC 5EPMB 3RKDD 4A7GF 2VAAA 3VXOB 1T7WA 2ATAA 2QKIB 4PPTA 1Z9MA 3BAEH 2VDPB 3PQYB 4L2LA 4KRLB 2ICWB 4DVRH 2UV3A 1UHVA 2A74A 1HC1A 3V4PH 3FPXA 3HC4L 1AG0A 1SFDA 3KLQA 1CGSH 4DKEH 2C1OB 5DEGA 1KMGA 1OK0A 4G7YH 3BP4B 5IHLB 5JZ7C 4I0CC 2BIMA 4EIBA 3CSTA 3UYRL 4ECNA 3MRQA 4K23L 3A6OA 4ZMTA 1CYGA 4P5MA 1A4KB 2X1QA 1PZUB 2BVUA 4AL8C 1KEGH 4N8VA 4CN4A 3T6VA 5KOMC 5D7JD 4XP6H 4RWYL 5C0ND 1J1OH 5EU3B 4UIKH 1H9DA 4YHYC 1MREL 1K3IA 1VAHA 5EZPA 4EN2A 4QTHA 3ARDB 1L9NA 1D7FA 3BLKA 3EJZD 4L1BA 4QXVA 1CFNA 2QPEB 4Q0XH 5CMAA 2VRAA 2Y69B 2YD6A 1I3GH 3ULVF 1MI5B 4XNXL 3BAKA 5C0IA 4E41B 4PUBL 3K6NA 4W93A 1JCKA 2FIRT 2QGCA 3MROA 3L4YA 1WZMA 3KLDA 2GUOA 2B15A 1ET8A 3PL6A 4HWNA 1EJOL 3B7YA 5D1QD 3SKNB 3RYMA 1PZ2A 1L7IL 1OL0A 4J4PA 4LAJH 1ED3B 3RZWA 1LLAA 1NGXB 4N2OA 4BELD 3DETD 1Q4NX 3IDGB 2P26A 4AIEA 3X13A 4G3YH 5D71H 3TV8A 5K9OA 3EIFA 1YEDB 3PHOA 5D2NE 4WSJA 1QZNA 4AG4L 1QACA 4WI6A 1GGTA 4UNIA 5TE7H 3OC8A 4YJZL 3B1TA 1JGUH 5C07A 5ES4B 2YSSB 3I6LD 2HT3C 2BVQB 3GMPA 3LNIA 4MX7B 3CUPB 1DYZA 2MCAA 4U6HA 4MJ5A 1NCJA 3MCLL 2DQFB 3APDA 3STLA 3WFEL 2ZCKH 1CTOA 1CYXA 3OQ3B 4UBDC 3PG2A 2A6DA 3NPSC 3MV7E 3PAZA 3AS2A 3MRRB 3CGTA 1HKLL 4TQHA 1O7DC 4QHKJ 5H37H 4P4KB 5FXCH 2AABL 3IJSA 2BRQA 4PRHD 4OD1L 1QHOA 4FYTA 2DLIA 1X5FA 3CFKB 3VGGA 4G43B 2OX5A 4OLYH 3CQQA 5KZCB 4FTVA 4MBRA 4ADIA 1KIRB 3MOQA 2K3TA 4OD3L 4JY4B 5CGTA 3B83A 1WWWX 5IEHB 5SX4I 1DQMH 4IRZL 4OV6F 3AM8C 4U1SB 4Z7VB 3FQUB 2VDNH 1TLKA 1G9EA 3TH4T 3PXJA 4JAMA 1E6OL 5IFAL 1G4RA 4X5WA 4IKLA 5CNHA 4A55A 2HKHL 4YQXL 2JCWA 4HIJA 4LCYB 5CJQH 1OCWL 4XOCA 1DVFC 5F7HA 5INDB 4ZDHB 1PLGH 4K7PL 3NTCL 5C08E 3S36H 3DC0A 5HP5A 1QFPA 2PO6A 4TQIA 1ZWIA 2RR3A 3VFGL 1FIGL 4QHLB 2KLTA 2LR4A 1DBKH 2HJFB 1UD3A 1YEJH 5E1QA 3QIUA 3VFRA 5FUCC 1EZVY 4XPBL 5ESAB 1IBYA 3O4OC 2Y6SC 5L6YH 3WO4C 2GJZB 3KYKH 5GGSA 4WTZA 4KTYA 4G82A 3TEZA 5CILL 3QJZA 1CIDA 2K78A 4H8PA 3IGAB 2DTML 3EADA 5A16B 3UPRB 3ZDWA 3WV0A 3LXCA 4FYSA 4AE1A 3VD4A 3ILPA 5T5NG 1N6QH 3EZJB 3FQYA 1CFQB 4NQDE 4ODHL 1FNHA 4JN2B 5AFAA 5TQ2L 1VGKB 5I1DA 3LKSA 4M1DH 3FB6B 4XPGL 5D1XD 4E5XB 2WO2B 3L81A 2ZF8A 5E9DB 1NCDL 4PLNC 4HIXL 3AG2B 4DVBB 3UCQA 2FB4L 1B2YA 3LKRB 5GZOD 4QEGA 1OGAE 2EIZB 4HFUH 4NN6C 2A9CA 2NNAB 3FSWA 3MRFA 1A6WL 1NIDA 5MENE 5JHDE 1ML0A 3VXSB 4S1SH 4L1LA 1QSFE 5CR8A 3K6FA 4JFFE 1T1WA 5CEZL 1USQA 4NRYB 2VXTH 4NKMB 2HG0A 2Q86A 4FF9A 4JQXC 5DA4A 2WLLB 1SYSA 3MRMB 3RY6C 5CBEB 4ZS6D 5HGDA 3G5YA 4TOYL 1F2XK 2H1XA 5FGCB 3TU6A 1X44A 2CLRA 2N56A 2VERA 4KO5A 3FQ1A 1D5IL 1XAUA 4HOZA 3SE9L 5FF6A 1NBVL 4L29A 3HC4H 3PHSA 2OP4L 4NRXA 1QR1B 3PP3K 4KZ0A 2VN4A 2WBWB 4KRPB 3V0VA 1BLNB 4I8DA 3EBGA 1MLBB 3UYRH 4HJEA 3U36A 4K23H 4IIZA 3WMQA 4KK9D 1IVLA 1PX4A 2JJSC 3KCWA 4QHUB 5IBUB 1XF3B 1KYAA 2UZIL 1DO6A 2B9AA 3VXNB 3E1ZA 3BVNA 2R27A 4UILL 1YSOA 4ESKA 3ZL1A 1YNLL 3SPHA 5I6XC 3Q05A 2QKIC 4RWYH 2SEBB 1BIIA 1SN0A 2Z64C 2R69A 1MREH 1MY7A 1P7BA 3K71A 2CO6B 5FOJA 4IOFD 1FZKB 3QDGA 4E5XG 2I9LB 2BOBB 3H56A 1AAJA 4XNXH 3DV4A 4NIYE 5JLZA 4NN5B 4PUBH 1QFWI 4NO3B 4KKAC 4FEMA 3KPLA 3RIFF 3BUPA 1EJOH 4J3OC 5HGHB 2UWEA 5C0BA 1FVDA 1L7IH 4TV3A 1GTNA 4F2MA 3QWOB 2EABA 5JO5A 2WBJC 3FOLB 1H8SA 5D6DA 4J1UB 3VXRB 2VTFA 4Y4KB 3QQNA 4U05A 1TQBB 5L2KD 4AG4H 3ARDC 3B37A 4K8RD 4MCZA 5EOCL 4YSQA 2FQEA 3MNWB 3GS0A 4W9JC 2H1LM 1DJZA 4FNLH 4DO5A 1Y6KR 4X98A 4EZKA 3VFOA 4U1JA 2RACA 2WYIA 2ZCZA 2ZYSA 3EHBB 5C9JA 1DDTA 4P5RA 1IAIL 3MCLH 4UQ2B 1GC1C 3WFEH 3BCFA 5IBUG 5D7LA 1BFVL 3CSYB 2CQVA 3CZUB 1NKGA 1T21A 3P1VA 3QNYB 2O6EA 2PW1A 2JV6A 2QQLL 3QUMA 1HKLH 4LL4A 3DURA 3N43B 2WCSA 3VGBA 5DWUL 2AABH 4WEMB 1MVFA 1JF5A 2VMJA 3DX7A 4OD1H 4LSPH 3T0EA 4LLMB 5IQ9B 2DH3A 4AYSA 4TSBL 1CGYA 3FO9B 2DW5A 4ZUSA 4DCQA 1TZ8A 4U3SB 1MWAB 2WIMA 3W39B 1CL7H 2D2OA 4X7FC 5DGQA 2OTUA 1VIWA 4OD3H 3LQMA 1XGTA 4IRZH 3X12B 1IL1B 4P46C 3WTSA 2BZ7A 1A3ZA 3FCSA 2HT2D 4UM8A 1URZA 2EC9U 1ZHBB 5IFAH 1E6OH 4OCNC 4I3SL 3GQFA 4YQXH 1YMME 2HKHH 4GRLA 3S36X 4BD4A 2EYTA 3NK3A 2WNGA 5D7EA 4K7PH 3NTCH 4QDGA 3CPUA 3K8MA 1SPDA 5C0DB 3MJ7A 1FIGH 3D69B 5C0EB 2G5BB 4DIXA 4PJ8D 3GMOB 2AI0L 1TJIL 3TM6A 4XPBH 3SGEI 3GC3A 4FA8A 4JJ5B 3QXAA 3V4PB 4PY8J 1W15A 2EEXA 5CILH 3GKWH 2NNFA 2NR6D 2QTEA 4QTIL 5GS0D 2DTMH 4XP9L 5EO9A 2EECA 2WO4A 3BC9A 4IRSB 5SWSB 2WYTA 3CDYA 4YHPA 3EGDA 1N64H 1MFMA 2N0KA 1K3ZA 2DM3A 5F0JB 2EO7A 1B4JL 4OIFA 3K5RA 3AWGA 3BP6B 4ODHH 5AKSA 2H3KA 2A4ZA 3BT0A 3QCUL 4UM9D 5TQ2H 2J2ZB 4KMQA 4C83B 3OGOE 1GYVA 4M03A 4XPGH 4AM0A 4P2QD 5EV7A 4DEPB 4PWGA 1NCDH 2JB6B 1EEUA 3LH9A 4HIXH 4QHNB 2YO3A 2CUHA 4JKMA 3K0WA 3TPUA 5C0JB 1XIWC 4IBYA 3HC0A 1A6WH 2HN7A 1J8KA 3AQXA 1OLZA 2Y24A 1T4KB 3SQBB 1EAPB 4ZAKC 5CEZH 3NSFA 4AWJC 5KSBE 2IGFL 4OGQC 3EGSA 1F1AA 3RUGB 3KYOA 3WNKA 1M1XB 4EN3A 5CF3A 3I75B 3QXTA 4XVTL 4MLSA 4YPGA 1GRWA 1J0IA 4YH6A 4TOYH 1HDMB 5EC2A 2VABA 3UZQB 1Q72L 2DQUL 3CU7A 3GMRA 5E24E 2W38A 1D5IH 3SE9H 1GKOA 1QPKA 1NBVH 3HBPA 4LLVA 2DMKA 2OP4H 4U0RC 3D07A 1SHWA 2NY5L 3QNZB 3K3QA 2OCFD 3MNDA 3WHXA 1JYVA 3GXIA 3HOGA 4PY7B 1UB5A 4MD4A 1A5FL 1HSBA 2YD4A 2A3TA 2CNYA 3DJTA 4KUCF 3PDGA 4ZMAT 2P5EB 2UZIH 5K39A 5I1KL 3FHQA 2A5UA 4UILH 1ANUA 4BE6A 1CE6A 1YNLH 4ELDA 5IUSA 5DJAA 1TZIA 3FSVA 3Q8AA 3L95B 4L2YA 2WK2A 4M7LT 2XKNB 3SKOA 1YNTB 2R4RH 3RZCB 2R2HB 5BUGA 1UB6B 1KCRL 5DJYA 1JUFB 4HGWB 2HLFD 3ZE0F 3FT2A 2WMPA 4OZGB 1JZEA 1U58A 1HHIA 5F7KC 5GRZA 1I1AA 1CQYA 4MDRA 5JA9A 4HWZB 4KY2A 1GPOL 1T7ZA 2Q9OA 3QQ9D 1SZNA 1OAUL 4AZ8A 3AM8A 3RB5A 5K9KB 3REVA 1QI3A 1R4XA 3V4VA 3DBXA 1A1MA 1HTYA 4TXVB 2VDNB 4NX0A 3W37A 1DVFA 2VZ1A 4P05A 1NC2A 1YA5A 4ES8A 5EOCH 3SJVB 4LCCC 3WCYA 5BQ7B 4X6CF 4L3EA 2LLLA 4YDMA 5D7HA 5F0MB 2FK9A 2GJPA 4OZHA 4P5TC 3MNVB 4PYHA 4KMTL 3CWGA 2YRZA 3CTTA 3IDXL 5F9WB 4AW4A 3N0PB 3QAQA 4HCFA 2WXPA 5C07E 5EB9A 4BQ6A 1HQRA 3EF7A 5HYSA 4U1KB 2AJZA 4PJ5A 1IAIH 2Z7UA 5B7MA 5C3IA 2QJDA 1Z9SB 1DVZA 2P44B 4J3UA 5DA0B 1KIUB 2QQLH 4PW3A 5J1AA 1TEFA 3HE6D 2FJFA 3QYCA 1T0OA 4J3XA 3ARTA 1HQ4A 2VJXA 2WGNB 5E94B 5DWUH 3T65B 5D7IB 3EZ8A 3UABA 3QR0A 4TSBH 3N5AA 4OLZL 5GRYA 3OKEB 2A0LD 2W0FB 3TESA 3K6IA 3L7EA 3LKPA 3HFML 3QQ4A 3L6FB 5D2LA 4F3FB 1PJWA 3SQOL 2YGVA 4FTVE 2JJWA 2F74B 5EEWA 4GKSA 5ITFB 4XOBA 3WIHA 2IG2L 2D7PA 3C5ZB 4I3SH 4FFYL 3FSAA 4NKOB 3T09A 4QHKI 4J27A 4JQXA 2EIKB 4K7PX 4XNZB 5BZWB 3QQDA 4D94A 2BIPA 1WFIA 3GMMA 3RY6A 4EZLA 5KSAB 4KH2A 1F1GA 2RA1A 5FA3A 2XIBA 2JCCF 4ELMF 2CDFA 5K1VA 5HBBA 1G7HB 2VR7A 4G1EB 2N1TE 3FHEA 4W9ZA 2AI0H 1M6UA 1TJIH 2I69A 4FHBD 4XPAL 2ZOKA 5I71B 4P9HL 1FH5H 5FM8A 4UUJB 1GIGL 3O11B 1JSYA 2PCPB 3N50A 4X7CC 5I9QC 4QTIH 1GXEA 3NT0A 4W9IC 1KWGA 3PGDB 4YBQC 4PGCB 5EO1A 1OCZB 1WTGT 3L3JA 1RK7A 3R06B 3FB8A 4XP9H 4BINA 3NGBC 5K5YA 3QXUA 2X5PA 2ZG1A 3ULVL 5K93A 3DX9B 3AQDA 3HLKA 2X70B 1B4JH 4KDVA 1AG6A 4H40A 3QCUH 3NSJA 4HCGA 4M3KB 4NQUA 3BVUA 4DP9X 1AIFB 2SODB 1H3TA 4A1RA 3Q06A 1SJEA 2IOOA 3ORJA 1KY7A 2CXKA 1G0DA 2X9YA 4IKNA 4GAFB 3B9KC 5I1HL 5A2BA 3LZNA 1NM9A 3U46B 4RIRB 5D9SA 1S9YB 1WAAF 3NIDF 2AITA 3AROA 1BOGB 2IGFH 3QJOA 2VQTA 4IRSC 3N1FC 4XVTH 3LD8C 4LESA 4D9QE 5LXGL 4EDWL 2YMTA 3X17A 5C86A 3F7QA 1Q72H 4WQOA 2DQUH 5SV4A 3ZTDC 5JW5B 2X4RA 3QORC 2X1OA 5DFTA 4RNRA 5EF1A 3RY4A 1NICA 2XBDA 5BVJB 1DN2A 1WO2A 1KCUL 3N1GC 2NY5H 2XBTA 1EQWA 3PWPB 2VM9A 1Z3RA 4FFVC 4JO4L 2IH9A 4DQOL 2NXYD 5BO1H 4FFWD 3H9SA 1DP0A 1RJYA 5AUMB 4QT5A 1BD2B 5BQDA 2AK4E 1KTJA 1TITA 5I1KH 2ZZUT 4K71B 2E56A 3VXSD 4H8WL 4OGZA 2WZ6A 1CJYA 4G8GA 4ZO8A 2PW2B 3FAWA 2UZXB 1S7QB 4PJ7A 3DSNB 5A6IA 3TZVB 1G7JB 3TO4D 4G8AC 1B4LA 3ATEA 3F8UB 4N2EA 1ZLUH 3OPUA 3HI5L 1D5RA 2JE8A 3DK2A 5ANHA 4N20A 1ZHLA 2UXVA 3KPRB 3QDGE 3QJVB 2BW4A 4Z0XA 5J9PB 3O4LB 1A3RL 2Q8AL 1GPOH 3HNSL 2GY5A 4K3GA 3K46A 1NANI 1DQJA 2DYSB 1OAUH 4A7SA 2J7LA 3V0JA 2ARWA 4P46A 3A4AA 5EG6C 5IJVB 4AV5A 3KXFA 4X4ZA 5C0BE 4QRTB 3ZTJH 1XEDA 3BIBX 4F2ME 4HU8A 3D7PA 1ZSHA 1PU0A 3WLWD 1RZJL 3GJFK 2N7SA 1OW0C 2PYFA 2X4OB 3H3PH 3LRSB 4HWBA 1HHGB 4W9KC 4JCWA 2ZX9A 2Q7AA 4M6NL 1SUHA 4KMTH 5FKPA 2ESVA 2OTWB 3IDXH 3S34L 2APVA 4NCC1 3RWCB 5A2LH 1BHGA 3VB8A 4U6YB 2AXGB 4BXSV 1J8HD 1RJZA 2XJLA 1AS7A 3ARBB 3LCYA 4RMVA 3TBSB 3RPIB 5DQJB 3HR5A 4B5ZA 4OB5L 2OR8A 1DJWA 4BUGA 4IJ3C 3MUJA 5D7LE 3WS6C 2BNRD 3IWUA 4EZJA 4L8SA 2AERT 4ZZFA 4TPRH 1U8LA 1UWXH 1E5AA 2VZVA 3ZMNA 4JGNA 1OB1A 2FZ3A 3VXRD 1TTAA 4OLZH 3RX7A 3STBA 2QQNH 1BF5A 3HUJF 4O2EA 2KS0A 3T0EE 1TJMA 2EEBA 1KYOK 1CTNA 2FWSA 1F6AB 5A43C 4Q52A 5KYUB 3AREB 5F9WC 2Y0SA 1XIWA 3SQOH 5IVOA 3R18A 3TTSA 2EDDA 4PD4K 5A6LA 4TTDC 2BNQA 4QR7A 1F3RB 4ZAKA 3L3OB 2IG2H 4CC1A 3OKKB 1I8LA 2VZOA 5KG9A 3ARGD 2VITB 5KYXB 3BUBA 4FFYH 3GINA 1JE6A 3VXUB 3EHBD 4XMZA 7PAZA 3FQWB 3GHEL 2OQJB 1DUYA 1PY0A 1CD8A 3UG4A 3L54A 4Z7OB 2YARA 1P9MC 1MCWM 3VI4A 3CFIC 3H2QA 3ASOB 2CHDA 4N4YB 4NXSA 4F58L 2XXFA 4F15C 4P9HH 1GIGH 2DMCA 1U8CB 3DIDA 5HI3C 4RRPA 2IALA 1KSRA 4N6QA 2WKLA 2K8MA 3HPJB 3ULVH 4C59B 1J8SA 3C5ZC 1PSKL 5E6IC 2H6PB 1BZDA 3GK8L 1NAKL 2WLIA 2C4FU 2XNAB 1JN6A 4LBEA 4PJGA 1YLBB 3FTYA 2R15A 3LQZB 4NQEB 4BA8A 5L2JB 2ZF9A 3OKNA 3BW9B 2AQSA 2V2WB 4L8BA 5I1HH 4PY8I 1BVKB 3OGCB 3BSHA 1LEKB 5E8NB 4BK5C 4NCC2 5DC4B 3ZUCA 1A1NB 3PNWA 2C9UA 3HN8A 2R0ZL 3WKYA 3KBHE 3MCKB 4IRJD 5HI5D 2I85A 4A04A 4GEJA 4ZMVA 1TVBB 3WY1A 5LXGH 4EDWH 1PX3A 1C8QA 3JSSA 4QO1B 3FZUC 2ZX5A 3CVBA 3VJ6B 3VDBA 2XX0A 4YFLF 2DWDA 4LCUB 3CVHA 5SWSD 1XGPB 3OZLA 3ROLB 2YPLD 3MJ8A 1KCUH 4LCCA 5IWLC 1S7VA 2H9GA 3QFJB 4X0NA 3T08A 2EDTA 2RIKA 1BQKA 4NKDA 4P5TA 2IPKB 1EXGA 4JO4H 4WHYG 4DQOH 1TLMA 1QUNA 2R1XB 1K5NB 3P11L 3PREA 5TGBB 3UEQA 1PZ5A 4HAKA 4AQEB 5INCB 1CICC 3QXWA 4ZPVB 1BMGA 4AQAB 1S3KL 4H8WH 4A2HA 3TTYA 4Y19B 1D9KD 3UGXA 4XXCC 4M6ML 3QA3A 3UZEA 2V7NB 1CDIA 2JQZA 4Y9BA 3EYFB 2NOYA 5CP7A 1GZPB 4L1TA 1BX2A 3T1WA 3HI5H 2IWFA 3MYZA 5F0LB 2NTSP 2W91A 1QVOB 2J6EA 4Z3JA 3QB7C 5A3ID 2VJ8A 3BSZH 4D7BA 2X4TA 3SPIA 4ZMYA 1A3RH 3FMGL 2Q8AH 1DFXA 3HNSH 4IBQA 4G9DB 3VAEA 5DRZB 4HS3B 5B3JE 1JTTA 1ZD6A 5DTFB 3L9YA 2QLVB 4K71C 4PP2B 4WI8A 1YG9A 4N2HA 3P3YA 3C6LB 2P5ED 3QDAA 5DRNA 4D0BB 4Y89A 3PXLA 2QADB 1KT2B 3TZVC 3ZDXB 1QRNB 5AAPA 2JF1A 2DWYA 4DUVA 4M6NH 4X4YA 2W9EL 1SOQA 4GI8A 3RZCD 3S34H 4L3EE 1SNRA 5CWSB 3VWJD 2CM5A 4BSJA 4PJBF 4OZHE 3VG0L 4ATTA 5F88A 2FJUB 2NZ9D 4M1CC 2YRLA 4FJZA 5G4NA 3QYNA 2F8VA 2ORBL 1P4LB 3C9NA 3GSUB 3PDOA 4MMYB 5E7FA 2XN9B 3WNLA 3PUCA 1WE5A 3QVAA 4LSRL 5DJDA 4OB5H 2JJTC 2CDGB 3C8KB 4F93B 3HZ3A 3HI1A 2WVSA 3AXHA 1HCFX 4NO2A 2NX5B 3V79C 4LGRB 1E4KC 1MRDL 4F20A 3IJ9A 4KJPC 4POUB 4TULL 5LXVA 1VKXB 4ZUWB 3MRNB 1M6OA 2CAKA 3Q9QA 1JZ7A 3VD5A 5ISZD 3B9KA 2DWXA 3WAKA 1AE6H 4YNYB 1UH3A 5D2LE 3LYRA 6TAAA 4ODUB 3GMNA 4EVNA 5IMKA 5EBLB 4HJJL 4B9ZA 5I1EL 4TNVF 3B3BA 3G5ZB 3T04D 2EYSB 2MH4A 3T3MB 3GHEH 4G8EB 2Y4SA 3OLGA 3VRLF 4JY6A 4AEIL 3EH5B 4I0PA 2HUEA 3QORA 2RH0A 2GBAA 4RDQF 1I3UA 5EOTB 5G4MA 5KBNC 1LNUB 2C7UB 2EACA 1AHMA 2VO5A 4FNUA 5KVDL 4HFWB 1R3JB 3AS0A 3VQLA 4F58H 2AJ3B 3I6SA 1AHKA 1BXVA 4NZJA 4BH7A 1MCLA 3UTSA 4ZO7A 1UTDA 4NFCA 3AREC 2PCFB 3VD7A 5CU9A 4H20H 3V7AE 1ZTXE 1HXYA 4CVXA 2OLDA 4QKXB 4GG8A 4TUOB 5TH2A 1YY9D 1E8ZA 1A6ZA 3SYOA 4BSWB 4YSSA 1E2VA 4LVEA 2XIIA 5PCYA 4AVKA 1J05B 1PSKH 2OSXA 4ZPTB 3NFNB 4EI6A 5DJXB 1QLEL 3GK8H 4N26A 1NAKH 2G5RA 2K9FB 5HGAB 3FBQA 1DZ0A 1BP3B 3CC5A 2XYCA 2VLRA 2R29L 2YHGA 5KSAD 1C16B 4Q14A 1F4XL 3NJXA 3KVDD 5TDNB 4D8PA 4APXA 5HDBE 1NCIA 4MWFA 3MRJB 5D72L 2R0ZH 5I6PA 3VB9A 3LVTA 2WVTA 3VI3A 5DUJA 2IAMB 4DZ8A 4HG4J 3V6ZA 2O5YL 1FZOA 1JPFB 2OJEA 5TE6L 4XWOD 1JJUA 1UQSA 3DK0A 4KPHL 1D2OA 3ZBMA 2XWBB 4UMGA 5C3LD 3U79A 1YYML 4HZ1A 1VPOH 4AE0A 2JI3A 5TF0A 3ES6B 5H37A 3ARZA 1IGFH 4A2MA 3OZ9L 4KVCL 3SY6A 1NL0L 4Z7UB 5MEQB 1TQVA 1OSEA 3P11H 1IQDA 3TPKA 4IIQC 2XQYK 1SLVA 2Q20A 4N0CD 1PY9A 3IDMA 5DJ2A 1SDDB 1A1OA 1OP4A 1O5PA 1S3KH 3QEQA 1UUNA 4MNHB 4M6MH 1IM9A 2W9DL 4JFOA 2HTKC 4L4TD 1FO0L 3WS6A 2UXGA 4G8GE 4MA1B 4QRAA 4PJ7E 1C08B 4FADA 1IC0A 1UXSA 2Y7MA 2Y1ZA 4G83A 1V5JA 3CV5A 3GSVB 4QOKB 4BXVA 3DTXA 3IETB 3JT2A 2VN3A 1KJ2A 1XH3B 3CZEA 2UVFA 3FMGH 5GS1B 1WIOA 4NO0B 4QRFA 3Q6GL 1JWMB 4QRSA 4G59C 4OI8A 2FECI 2PABA 1HHJA 3PWPD 1JZ5A 3QRLA 5EZOL 4B5EA 1MCDA 3DHJA 3T77A 5CSZA 4BM7A 1BD2D 1NEUA 4KVNL 1I1CA 3V5HB 4Q6IC 4W81A 4HOXA 4YSUA 4F37F 4JFDB 1N6UA 2HA1A 3MLTA 3Q3GB 3CFJB 3ZTJG 3SE3C 1P9MA 1IFHL 4EZMA 5AW6B 4HH9A 2OW7A 2W9EH 1HIML 3SDCC 4N0UB 3VRJB 1WA1X 4F7PA 1MCOH 1YCSA 4GW5B 4LKCB 5I8EA 2VLKD 5D4HA 1RY7B 2Y1VA 3VG0H 4UQIM 3IXTA 3SKMA 3I3DA 4AITA 2Q3XA 2ESVE 1KDIA 1S9XB 2G2RB 1TF4A 2JXMA 3GSWA 3JTTB 3QZWG 2OKMA 3FW6A 5HD8D 5MHSD 2ORBH 3KPRD 3BWUF 3G5XB 1HSAA 2NY1C 3O4LD 4LSRH 5K69A 4AH2A 3VQ1C 2BVEA 5E6IA 2DYPB 2VLMD 5D7JC 2I27N 3SPVA 5C0NC 3Q2VA 1Q9LB 3MYJA 4OM0L 4PU2A 2ZOLB 2QPFA 3DX6A 4W68A 1E9OA 3P54A 4QJ3B 1MRDH 2R1YA 1KXHA 5C0FB 2ERJB 3QZPA 4TULH 1GCYA 1GZHC 4N9GB 2F61A 4M43L 3WFDL 3EJPA 1ZLWK 2MWCA 4F91B 4F8QA 1LO3L 4POYA 3CFBB 3GB7B 3KLSA 5EO0A 4QCIB 5E1AA 3GIVA 5EU5B 5C6PB 3M17B 4PRIA 4BK5A 5CBAB 1HI6A 4GQQA 2A9AA 2EDHA 3V2AR 1LP9F 2EKJA 1BREA 2PXYB 2VW4A 1PQZA 2BINA 1XF4B 5I1EH 2BNQE 5CKAA 3Q0HA 4RH4A 3ARBD 3L4ZA 2P8LB 3APNA 4FNPA 4AEIH 1UVQB 4Z78B 1T66D 3AY4C 4LDLB 1MCCA 1NIAA 4FGMA 2BVTA 1P5UB 3SKJL 5KVDH 3LN4A 3T6WA 1KXTB 1VEOA 4N6RB 4RMRA 2MKWA 5D5MA 3ATFA 3S3SA 1ONQA 4N2CA 1J5IA 2WTPA 3VI4E 1U8HB 5HI4C 4OQ1A 5HYIA 1HL9A 1PEWA 1UFGA 1B4RA 4DO4A 1CD1B 1D6VL 4FFTA 5DZJA 1JXJA 3WE6B 1V3JA 2WZPD 4JZOB 4YZFE 5AEAA 1CICA 2IMMA 5F7WC 3D9AL 3CZNA 3ECBB 3QARA 2VXQA 4DOHB 1LE9A 2ZAHA 12E8L 2C9AA 3RQ3A 5HHNB 3AW5A 3FQTB 5EF3A 1W72A 1ETJA 2YD7A 4MA7L 3SODB 2KL6A 4B53A 1R46A 4HGMA 3MBEB 3MR9B 4K15A 5JIPA 1RIUL 1P4IL 2R29H 1WV7T 4PJGE 1KGCD 3NJHA 1F4XH 4IW4C 2GI0A 3HZYB 4Y4HD 2BHYA 1LEIB 5EUOA 1B0WA 2BY3A 1XH0A 2ENQA 4FCAA 4KTEL 4L8DA 1D5ZB 2ATKB 2CXGA 4ZI8A 3A6CL 3WIAA 5D72H 4HHGA 2BC4B 2AK1L 2A6KB 5TK2A 3HMXL 2GTZA 1JXFA 3P30L 2CJ3A 1F2QA 1SY6A 2GTQA 4M5YL 2FH8A 2IH3A 3FC8A 2O5YH 3A47A 1G6RA 4AEHL 4M8QB 1DVXA 1FFTB 3JTBA 2HAZA 4X6DB 5TE6H 1E2WA 3O9WB 2D7OA 3RVVC 3DO7A 5DURD 4N1CA 5HYJB 1J1PL 4NQSB 4KPHH 2RTTA 4UTBL 5I5MA 2YK1L 3N6YA 4KX7A 5DHYB 4Z77B 1YYMH 6PAZA 3QUYB 1FJ1B 3MA7B 2O61A 2BW5A 3OZ9H 1YQ2A 4KVCH 2IXQA 4LNRB 2YZ1A 2ZAIA 1MHCB 3WEXA 1N7ML 2XU9A 5IROA 3P9MB 4OUUB 3BP5B 1W8OA 1E5BA 4UOW0 1WAPA 3X1GA 4ZO9A 4XAKE 2IAMC 1XXFC 4Y5YC 2XETA 1XF5A 2K6ZA 5T3ZE 2YEQA 1B0GB 1WHPA 3GT6A 2W9DH 4AYFA 4YUEL 1FO0H 2EIJB 3S2AA 3BOVA 4NC2B 4XGZA 4Z7QE 2QVFB 3L2NA 3TJEL 1TTFA 5C0AA 1QQDB 5D1XC 4UDUB 1P7QA 5IY5B 1XCQB 1E4KA 1SRDA 5E8EA 5F70A 5JXAL 5I1CL 5GZOC 1IKFL 1TZAA 1LK2B 1S7SB 3IJ7A 2LT9A 2EICA 1ZPLA 3GPEA 3KWXA 4NAQA 3B43A 2WIIA 2H6UA 3KLAB 4Z5RA 1S7RB 3Q6GH 2GJ6A 2Y7QA 4GRMB 5FO8A 4H8UA 4PRAA 1SJHB 4TVSa 4KU1A 5EZOH 1C5DA 2R0KL 1FLTX 1FZMA 1YN7B 5FX3A 2DQMA 2K9UA 2OSLB 3EYOA 1KPVB 2YBGA 1T5XB 4QRPB 3FQNB 3OR7A 6CGTA 4KVNH 3FSOA 4PR5B 4NC1E 1AJ7L 1B88A 3HLAB 1IFHH 3E6HA 4JFWA 2FJGB 2Q76A 1SBBA 3RWHB 1G0YR 1HIMH 3FCTB 4C4UA 3BXNA 4DEUA 1ACYL 1YN6A 2CU9A 1R24B 3ZO9A 1F11A 4WW2B 1AGCA 2IVFC 4KJWC 4OBSA 1WC7B 4KKLD 3VXTB 4P57B 3GF8A 4U3XA 3SBRA 1AXIB 5K9QI 3NIGF 3RBGA 1I4FA 4NQVA 4ZNEA 3NESA 4AY0A 1JPTL 5F6HJ 3BD5A 4OM0H 1JNJA 1JVLA 1GTFA 3RIKA 2BIOA 5CCGE 4KQ4L 1A21A 4S0HA 5FECB 2NCMA 4O00A 2WXMA 4M43H 2ZXEB 3WFDH 2ZAGA 3P4MA 1TZHB 2QADD 4ETQB 1FL3B 1CZ8L 4LMQI 4DP6X 2X05A 1A7NL 1ZLSL 4QXUL 2AQTA 2FTAA 2PP9A 4P9HC 4KK8D 5AW9B 2DI7A 4CNIA 1OQOA 3F5WA 1I1RA 4WGKA 4JS7A 3LNHA 4IBWA 4NZRL 3TVMB 4JRXB 1U8NA 1EXUB 3KLLA 3AU1B 3BIKB 4FFZL 3VG9B 5T33L 3ULVC 3HG0A 2B59B 1VCAA 1MFNA 1F4AA 3SKJH 1HH9B 2ERJC 4XNQB 2EXYD 2EH7L 3CBRA 4U6XA 1TYJA 1X6LA 5B39G 3P9LB 4HPYL 4LLYA 5D8JL 3KLHD 3CPLA 1CK0L 2YD5A 4NZ8A 1V3LA 2CH8A 4OLXL 3UTSE 1D6VH 2V7HB 2H32A 1E8YA 5L4IA 5GS2H 1IM3B 1GHFL 3A3YB 4H5SA 4IIQA 2GTWB 3TA4D 1JZ2A 4GLRI 4P23D 1UD4A 4U1LB 1JWSA 3D9AH 4JVPA 1S9WA 3ASNB 3VH8B 12E8H 4ZMLA 2BSSA 2HPTA 4AVJA 1CN4A 4WY7L 3FQRB 1ZSDA 1XCXA 1INQA 3CSGA 4MA7H 1F6LL 3K74B 5EN2B 1ACZA 1XB6A 1RIUH 1P4IH 3RI5F 4FQPA 2VLRE 4KTEH 3RWJB 4QF1A 3A6CH 1V7NL 2E8YA 4MJ6B 2A99A 3GSNL 2AK1H 5HJDA 4C58B 4MGXA 4HA1A 4U1IB 3P30H 2CR6A 2GJJA 4Y1AB 2HT2C 1KJ3H 4M5YH 4O5LL 3VI3E 2H45A 4RGOL 4AEHH 1JNNL 2X3AA 3WO3B 1WUNT 4IHOA 2Z35A 4JZNB 4F7MA 1J1PH 3LZRA 4Q6IA 4UTBH 3JV6A 2YK1H 3Q43A 5C8JA 1TU2B 4ZMWA 2ZE0A 2NDGA 4HIEA 3SE3A 3DVGB 5SX5H 5IFHL 3UTTB 2Z8WC 5GSRB 1EEYA 1CPUA 1RUAL 4WV1B 2BZDA 2P80A 3CDZA 2WHVA 3KYNA 3SDCA 3TBTB 5IV2A 4HZLA 1N7MH 4HMCA 1DN0A 5KYWB 3BP7A 3BKJL 4TLKA 3D3VD 1UZ6E 2JSFA 2VL5A 2VMFA 2V8MA 3G5WA 5G5DA 1EEZB 2FYYB 1PCSA 5BV7L 3PIQA 1UJ3C 5F7MC 5BS0B 3QW9A 2Z4QA 1AMXA 4GKNB 4WK0B 1SXZA 1OE3A 4PI2A 3EJCA 4YUEH 3QEQE 3TH3T 1LQSR 4G6FB 4X7DC 1UZ8A 4H1LA 5ESQB 2NNXA 2XWRA 5D7JA 3O9WC 1NCUA 3TJEH 4Y1SA 3BWZA 3HMWL 2AHIA 1FV1B 1YJDL 2RB8A 3NEOA 4W6WB 3H4HA 5JXAH 1MCSA 1T0NB 3X2QB 5I1CH 1WITA 3QUYC 4BH8A 5EBMA 1B0RB 3JTSA 2P8PB 4IEFA 5B38B 1C5BL 2QPDB 2HKFL 2BVOB 5FS5A 2I7SA 2VE6B 3IF1A 4B3VA 1THAA 5I0ZA 5JDSB 4LVOB 1JGDA 4G80A 2R0KH 3CCHA 1UCBL 2IPUG 4ORZC 3V9CA 2L7QA 3K7UA 4B27A 5CUSL 2O4EA 5AVUB 4JG0L 2XRAL 2YMXL 2Y9RT 2YA1A 2G0KA 1MF2L 4M93B 1OOAA 1XZ0A 4LHUA 2H4EA 3U9UB 3W38A 3U0PB 1I3RB 4RWHA 1DJXA 5EF0A 1R5WA 3AY4A 1AJ7H 1PZSA 2DOCA 3IFLL 5E5RB 1AKJB 4M00A 5FLUA 2ZYRA 3REWA 5AOKA 1E4XI 4EI5D 1ACYH 5T1KD 1IGIL 4BFBD 4J8RB 1CT8B 1JHLL 1XGQB 1ZJAA 4AJVA 1MFAL 4NKQB 1IGJB 2RCSL 3A4FA 5E00A 4G9FD 4QOKD 4OM1L 3QDHA 1RZQA 4NO0D 4YAQB 1JPTH 3ZL4L 3BO8B 1MJJA 4UZUA 4YBLC 1WD9A 4UOJA 4PLKD 3ULUD 3NJLA 2VISA 3D4ZA 1QLEB 5E2VL 3BAXA 1ADQA 4KQ4H 1QSEA 4PRHA 1EO8L 2F8IA 2HLFC 1AZZC 1BDYA 3GNML 5E0FA 3MNZA 3SOBL 2AFNA 4NP4L 3WE1A 1AFVL 1CZ8H 2CR0A 4JFDD 4NQTA 1P7KA 3GSRB 4IBZA 2KLSA 1A7NH 1ZLSH 4QXUH 3UAFA 3FQXB 3LN9A 3C5JB 4OCWL 2IIJA 5B38G 5BZDA 5A2CA 4D9RE 1R3LB 4LLWA 4PRIE 4BRJA 5LQBL 3FB5B 4NZRH 4IMLB 4L9LC 1GYAA 3RL1A 2JIXB 4LASL 3MKGA 3I3BA 4MVBD 4KZEL 1V05A 5T33H 4FFZH 3BUQA 4BHUI 2DH2A 2UY6B 2F54D 4W70A 4KTDH 1BF8A 5ESVB 2OXGB 4XMUA 5J13B 2EH7H 5IB5B 5FKAA 2NW3A 1M7XA 4HPYH 5D8JH 3LPFA 5LGJB 4BFJA 1CK0H 3VXMD 5D5ME 4A39A 4OLXH 5EOQL 1DEEA 1GS8A 2K7QA 2P5WB 5DSCA 1GHFH 5DJ6B 1OPGL 5JOEA 4A7UA 1UWEL 2Z0BA 1G7IA 3BRDA 4Y5YA 3CX5J 3F7VA 1F45A 1TO4A 2PXYD 3HE6C 5KTEL 4WY7H 3GXUB 2GB2A 3VGAC 5BRQA 1ECZA 2ZWYA 4EQ3A 2C3VA 1FL6A 1FO0B 4LPVA 5D1XA 1N8ZB 2V3DA 3N3EA 2G9HA 4WRLA 4R4BA 2J57A 2V6HA 5GZOA 3OKDA 4HKJB 2YA0A 2ZOOA 2X9WA 3QJQB 5IVNA 1V7NH 5EUOE 3QNXA 3GSNH 4UI2A 7CGTA 2BP8A 1AQMA 2WCGA 3ZQWA 4O5LH 2ARJB 4RGOH 4MJ4A 2PR4L 5KSBF 1JNNH 2OZ4A 3DX1A 5CLXA 2WQAA 5I2IB 4JRWA 4XC3L 1ZY9A 3CHQA 1ZLVK 3PWUB 4CL7A 1PGRB 2Z7ZA 2WQUA 3NDZE 2P24A 5FGSA 4GO8A 1I1YB 5CN2A 1UCTA 4ANKA 3CN0A 4RFNB 1J0YA 2HLAA 5IFHH 1CG9A 3I6GB 1XR9B 4AGQA 2WWKO 3L3KA 4PV1C 2H26A 1PAMA 1RUAH 4I0KA 1KG0B 4WTQA 5JOFA 1JPEA 2YUZA 1UT9A 2V5RA 4WO0A 2XWTB 3BKJH 3H6AA 3UXFA 4KK5C 3MLXL 3VFMA 4WUUB 5BV7H 5DQ9A 1CXHA 1EZVX 1NAMB 4NZFA 3CZSA 1WWCA 3DPBB 3DBSA 3U6RA 3L16A 2BNUA 4DP0X 3GGWB 3KPQB 4EUPG 3OKYA 2E9WA 1S7WA 2C9PA 3HMWH 3ZDYE 2LE9A 1FH2A 3VGHA 1Y07A 3GBEA 1T6WA 3H4FA 5C0AE 1M2VB 5HYJD 1IV8A 5E5LA 3PY9A 1C5BH 1KTLA 4X9HA 2FDBP 3MREB 1M7DB 2HKFH 3IRZA 4B41A 5MEOA 1OANA 2AW2A 1N59B 2GJ6E 1JF6A 1IC5L 1KB5L 1UCBH 3RVWD 4AQ1B 1AC0A 5CUSH 1OO2A 4R5VA 4JG0H 5F7DB 2YMXH 1MF2H 1A4JB 2YD0A 1FI8C 2X4PB 1F13A 5DMJB 1SHSA 1WBZA 1Z5LB 2YFOA 1TENA 2AEPL 3IFLH 3HI6L 4A68A 3CZGA 5L2KA 2FO1A 4O58L 2WOBA 3F83A 1NKRA 4E42B 3B8SA 4HBQA 2JQAA 1IGIH 2J8UF 3MV9E 2LAAA 2NXYC 1JHLH 3EAKA 4ERSL 5E6ZA 1MFAH 5BO0D 1YY8A 2YC1A 3SGDI 3BUDA 1KGJA 1BFOA 2RCSH 2VDRL 3TBWA 1PLCA 5EFIA 5FM5O 3TN0B 1UOKA 4LVOC 3US1A 3NCXA 1QAWA 1DDHA 4MCYA 3NSXA 4LDOB 1G1CA 1WZLA 4OM1H 4YFEA 3ZL4H 3RPBA 1YPZB 4PTTA 4ZO6A 3EFFB 4L4VD 3TCTA 3BSGA 3W11C 4AC4A 3R8QA 4ZNEE 2Z0UA 4I7ZC 2B7DT 4XCFL 3TO4C 5E2VH 1SDAB 1NH6A 4RFOL 2X89D 4BHUA 3FS9A 1A2YA 1EO8H 2IWGA 4J6IA 3Q2CA 3GNMH 2J21A 4QRPD 3RHWF 3ZQXA 1P84J 2FO4A 3SOBH 1XGRB 5DO2C 5E8PB 4NP4H 5IGXL 1AFVH 2EUVA 3NK4A 4RBPH 5GGVL 1YMHB 3B7SA 4PJXF 1Q94A 2BLFA 1B6DA 3ILQD 4OCWH 4OTXL 1KLFB 4FQQB 5KN5B 3HHRB 4GW1B 2UYLB 4QHPA 1HHHA 2B1AL 3MRCB 1UEYA 5LQBH 2J8OA 3SDDD 1KJMA 5BCAA 3VX1A 3S8WA 1YYCA 5F6HI 4X9YA 3TURA 1MIML 1CC3A 2GI7A 3C2SA 4LASH 4ZUVA 4KZEH 4ZYKB 5CGYC 3C5SA 4HUXB 5M94B 2F8OA 2D8KA 1XVSA 4IQHA 4JZJB 3ZKMC 1KUMA 4J8QA 5IB1B 4Y16B 5E8OB 5J4MA 3MCG1 1TMCB 1JP5A 2G0LA 1SHXA 2L7EA 2UUDH 4XNMA 4C4KO 1N19A 4PJ8A 3EYVA 4NOFA 4TUUA 4FAAB 5HPMA 4WI2A 2BS71 1W91A 1L9TA 4X0KB 1QMUA 5FDWB 4NZUL 3TYFB 5EOQH 3CVDA 1OPGH 3BSZA 1UWEH 4FXKC 4OFDA 1WCBB 4I9XA 3MJ9L 3WTYA 4ZK8A 3EO0A 1UJ3A 1JZIA 3IYLW 5IKCB 3MRDA 3MLRL 3WHE1 1INEL 5EU4B 5KTEH 4RETB 3BUIA 1RJCA 3HUJB 2ZPKL 2XTLA 4NDMA 5ICYB 2XFXA 3JWDL 1IRAY 5DJ8A 4UM9A 2NQDA 3C6SB 3QSKB 4JRXD 2YOAA 4P2QA 5BRZB 4JANB 3RE0A 1U33A 1NCOA 2H6OA 5FOBA 1VGEL 4BFIA 2BK8A 2J72A 1BVOA 5DUBA 1OE2A 1WGVA 1NFIA 5GJTL 1TO5A 3O8XB 2MKLC 1N8OE 2A83B 2R39A 3P0VL 1K8DA 3MBWA 4CMHC 2O30A 3ZQ9A 2VXSL 3ARQA 2VSMB 2WXRA 1SEBA 1ZVSB 2NNRA 2PR4H 2GSGB 4OGAD 3UBXB 5PAZA 4PTUB 3PWJA 3OKLA 5CZKA 4XC3H 3FT4A 5E23A 2D31B 3D4GA 1G7LA 2CPCA 2PP7A 2GIMA 3VCLB 2GCYA 2ZXAA 3BMWA 2IANB 4KROB 4QTFA 3P69A 5T1LB 1E50A 5K33A 3K1DA 5H94B 4DQAA 2E9BA 3QJRB 4X8XA 5DF0A 4DGVH 1CU4L 2BIHA 1HHKA 4HV8B 1ID2A 3VXPA 3VFPA 3MLXH 3FONB 4MMZB 4OW6A 3B4NA 4F33A 4NSKA 3SBPA 1A25A 2X6BA 1WJ3A 4HUVA 1MCEA 1QBLL 1NCHA 3PGFL 3RJOA 5I18L 3U4EB 4OZFH 3S0PA 1ZMYA 1MFCL 4MCNA 2OMXA 1ICTA 1M9SA 4HKBA 2H2PD 1T89A 1YDPA 2H41A 2XTJC 3AGWA 4UV7L 4ZTPL 3WNJA 2G75A 5B8CC 2EYRB 2CIKA 1PF3A 4GS7B 4PV9A 4LVNB 4F7CB 4M9OA 4HKZB 3BD4A 3S3JA 4WJ5A 2WINA 3BLPX 4Y2OA 3LNFA 4FQCL 4NCDA 2HMIC 4WNQA 5EBWB 5HI5C 2C1OA 1IC5H 1KB5H 4FDWA 5J3HD 3FTXA 3VDCA 3LJ3A 1ZA6B 3R8BB 1Z2KA 3DMMC 2WXHA 5D1QE 4FA7B 1DVTA 1UG9A 5FIEA 3UBXG 1T5WB 2AQRA 2OXHA 3MN8A 2XZQL 3B5TA 5BS0D 1EVUA 5HHOD 2AEPH 4MSWA 3FPYA 1U8QA 3HI6H 4MYPA 4Q9BA 1KGYE 4YHKH 1HOEA 3WI9A 3MMEB 3D50A 1URIA 2GAZB 1X5GA 4DSYA 2QL1A 4ERSH 2Q10A 4TYUA 5AW2B 2EDXA 1MSPA 5TDPA 2ZSWB 3I6LE 2VDRH 4RCAA 3E80A 2Z8RA 1OSYA 2C9XA 4JRYD 4F8PA 2NY0C 2AQNA 1N68A 3BN9D 5J1SC 1I7UA 2XX1A 1XH2A 2C3HA 2H7WA 3K6SA 4I4WB 1HH6A 1AGDA 5EU7C 2CJSA 2M26A 2HVKA 3HE6A 4XCFH 1M7IA 2XY1A 3ELQA 3AACA 3MO1B 4RFOH 2W07A 2NSMA 5C7ZA 1E67A 3TO2B 3JV4B 3TGXA 3VRIA 2YAHA 4MDIB 2XQBL 1LK3L 5B21A 5IGXH 1QSEE 4PRHE 5H2BB 1ODAA 5DR5H 4Z23A 4TVPD 1FRGL 4O2CB 5AB1A 4OTXH 2XZZA 5FO7A 2CLZA 3T3PF 3VFTA 4N22A 4CU8A 2B1AH 3NDYE 4HUUA 2BSCA 4LSTL 2E7LC 3GSNB 4RAUA 3QZBA 1MIMH 2Y7LA 1C7TA 2DS4A 2F9BT 1EIBA 1RU9L 3JWNC 1XFPA 1HEZA 4JB9L 4YXHL 1GCFA 3F00A 4NB7A 2VQ1A 2IGLA 2X1XR 2J12B 1RZ8B 1OP3H 3DXAA 2IH1B 4BKLA 5JORB 3A6BL 4XCNA 1EHXA 4QXTA 4WKZB 2VM4A 5LB1A 4AZUA 5C09D 3VWJC 4NZUH 3HHSB 4BSVA 5BXFA 1FSKB 3LS4L 3O0RH 4Q97A 2CGYA 4NUJB 1HFUA 3ZZSA 2QVTA 2ZWZA 4OV5B 3HG4A 4ZNCD 3MJ9H 2ITCB 1NGZB 3ECVA 1NCWL 3DGGA 3MLRH 4MJID 5BV7B 1F56A 4P48A 2ZPKH 5KAQF 1PNCA 3DTDA 3JWDH 1XSOA 3BPNB 3S6CA 5TF1L 1NGYB 2NZ1A 4Y16C 3MV8B 1KCLA 3KPTA 2L4OA 2IDQA 3LRMA 3IJEB 5AW3B 1HILA 1VGEH 3B2VL 1IGTB 3OJ2C 2YN5A 5F0PB 3DDFA 5D1XE 3PJLA 4KZDL 1CBJA 1ROCA 5GJTH 3S9DB 3P0VH 1P2CA 3K80A 4ODXB 4DNLA 2A6IB 4PGZA 1JGEB 4QLWA 3HAEH 4NKIL 3OXRB 4E0RB 2G3MA 4P07A 2VXSH 5MI0B 4V1DD 3BEWB 1W0WB 2JK5A 4FI6A 5AKVA 1QLFA 3QJHA 5I30L 3BZEB 4FEIA 1EFXA 4FG6D 5A16A 3UC2A 1SXCA 4O02L 4UOQA 2L7JA 1CB4A 4IGBD 1R3KB 5I17A 1NUFA 4LVHC 1JRHL 1RUPL 3W1ZA 2YOCA 1T1ZA 4L1DA 1NFDF 2YWYA 4JDZA 1CU4H 5DMKA 1U3YA 2H0FA 3LXBA 4HIIA 3U4BL 4FXTA 1S78D 4BCXA 4AUUA 4B9JA 3ABGA 4H13C 4PJFF 3ULSB 3EOBA 4G8IB 4A7VA 2FLRT 3BQUB 1LO2L 3PGFH 5E0QA 3PABB 5I18H 5I1GL 1H0DB 3MRBB 5IR1A 2O26U 5F7FA 3RDTB 1MFCH 1ZS8A 2P48B 4FABL 3RLSA 5I0WA 5IMLB 3NUKA 1XB3A 3L17A 4PYGA 3AQZA 3TO4A 3D39B 2HXAA 5AW0B 4L3CA 1THCA 3U0TA 3WDHA 1E43A 4UV7H 4ZTPH 5CBEA 3SD2A 1FORL 3OAZH 4HEMA 1BM7A 4X8JB 3ZYZA 3SYAA 5D1ZD 2WB1A 1NC4D 1PVHA 5GIRA 4FQCH 2E86A 4JLRB 2BP0A 2NY3B 3ZU8A 3RFZB 2Y1AA 1XDTT 1NMAL 4NRZB 1DVUA 3UIZA 1KY6A 2CHNA 1HN1A 1Q0EA 2EC9T 2BO0A 2AP2A 1BZ9A 3QUZD 4PWJA 2XZQH 4FQXD 3BEVB 5DT1L 4XOAA 4QJ5B 3S96A 1YEFL 1ZT4B 3KYMA 2UX6A 1JPGB 3OM3B 4DGWC 4AT6A 2Y5EA 4QI3A 2K45A 4HX1B 5L2KE 1J9RA 4GS7C 4DKAA 3LAFA 2ZXWB 3LZOA 3ZHNA 2W92A 4YDLC 4KNTA 3D85B 4X8CA 1ZGLP 4OZHF 1J8HA 3WFCL 1U95A 2PYEB 1NDMA 3B2MA 5KANI 2ZYHA 1XSIA 2DPKA 4RAHA 1WZ1L 5DZOA 2XKSA 4XZUA 4AK2A 5HGHA 1RVFL 2J4WL 4X6CA 2BNRA 2Q7YA 4DZBA 2KUTA 3KPNA 5IVXB 5JNYA 3WXVL 3WJJC 1MCPL 1N0LA 4F8LA 4XCYA 4JVWA 5CCHE 2XQBH 5CIPH 1LK3H 3DARA 4GOSA 5FYLD 3ZGIA 2CG9X 3F7YA 1W9XA 2BS9A 3AMLA 4K5LA 1FRGH 4ZFFA 2ED9A 5AOLA 5E5MB 4ONHA 1O6TA 1U8PB 3ARUA 4PGEA 3ZYOA 4LSTH 3QIWD 4MD5B 3GLAA 2CBPA 4K0OA 1AGFB 2BOCA 5FUZL 3HVDA 3ARGA 1LGVA 5GISL 3ARFB 1RU9H 2Y5TA 4AGOA 1U8IA 4JB9H 4R96A 4YXHH 1QFUL 5MP6L 4CMMA 4JPSA 4G8FA 5M7QA 3A6BH 1CLZL 2IEPA 4X6FA 1AO7B 3CFTA 4H8VA 4E9RA 1C5CL 3GZPA 3IMVA 3DV6B 4Y9GA 2Q87A 5KYYA 4X4XA 3LS4H 2NLJB 3NJKA 4LLMA 2WQSA 5E8DL 5HD8C 5JOPD 4NQCD 4PB0L 2E7CA 1WH0A 2KPWA 4U1NA 1NCWH 2OMWA 2AQ1A 1OTTD 2BWQA 4JUSA 4MMXC 4XX5A 4OIIL 3CFCL 3GD1C 2VN5A 1J1XL 4QAMB 2JCCA 4ELMA 5EU6A 2O1AA 4Y2LA 5TF1H 1WG3A 4LK4A 5IQNA 3KPPB 1PKOA 3DA0A 1JS4A 3S5LB 4MAYC 4JG1L 4OZFB 5ACZB 4B9YA 3FB7B 2A9NL 4KZDH 4P2QE 1CXFA 4AW7A 2P7TA 4PG9B 5IF0B 2FSDA 5ANMA 4C56D 1TJGL 4NBXB 3TV3L 3L2MA 3TT3H 2B8OT 4RA3A 2WQVA 3V0IA 1CVRA 3D69A 1FSKC 3HZKB 4IOIA 4NKIH 4OIBA 1J9CT 1U3HB 2WP3O 5LBSA 5HDBF 1E9PA 2E9GA 4JHWH 3F64A 2PF6A 4IRJA 3O3DB 5FGRA 1I3VA 4R3SA 5EEVA 1KZYA 4L0YA 5I30H 4A2GA 4NIKB 1FNGB 4PS3A 3DMMA 1E27A 1KB5B 4A66A 3IU4L 2KH2B 3ZKNC 5LDUA 1ITBB 2WWNA 5F71A 1T66C 4J28A 3W82A 3FO1B 1JRHH 1RUPH 3BPOB 3AITA 2YPLA 2C3XA 1EZSA 1JFQH 1X4XA 4PRNB 2Q6WA 4PRDB 4Q58C 4C83A 2YEZB 4GT0A 4JFTA 4XBEL 3U4BH 4WHTB 3ZVVA 4ADJA 1NPNA 3QUXB 1YRKA 3AXLB 4CADA 2JB6A 3OPZL 3B6SA 1SUJA 4I2XB 3ZR5A 4ZS7L 4P2OB 4QWWD 4RMTA 3S3DB 1E3FA 3BUTA 5MI0C 5CEYB 1NPJA 1LO2H 1ZXQA 5C0JA 3B56A 2BCKA 2VDRB 4WK4B 4YE0A 1MQKL 1L3WA 1MZZA 4OZIB 2KERA 5I1GH 1D9KA 5LNGA 4XE5B 4XXDB 5LDSA 4U3CA 4FABH 3PRZA 5FW7A 1WTLA 3ZYIA 1Z9PA 2W8CA 3I75A 1NZRA 5HJGA 1FORH 3S5LG 5CM1A 2TSAA 4OZFG 3NACL 3SZKC 1ORQA 2IQAA 3W57A 5FB8A 1G1OA 4GNKB 1VFOA 3ZDZB 1CFTA 1A7QL 1NPUA 5IFJA 2CHXA 2ZKMX 3WTVA 1FDLL 4FA6A 5IJBC 4FG4A 4P49A 4EPSA 3BQVA 1WEJL 2IWEA 3TIEA 1T22A 1NMAH 3B5GA 2Z7YA 2H3NA 4OKVB 2VSKB 4F7TB 2HH0L 1WIPA 2G2NA 3BPLB 3MFFB 2ICEC 5DT1H 1KBWA 3RGBA 3BYTA 1UT2A 1RPQA 4GUPB 4EKJA 1YEFH 2V0AA 4KOCA 1SHMA 3O3AB 2BXYA 5D70L 1EHKB 1NOFA 1SYVB 4KHTH 4NPYA 3TA3C 1JMZA 1PDKA 1FYTB 3GS4A 3VWJA 4WW1B 3BAIA 2WPGA 4I88A 3P77A 3PFQA 4XN2A 3WS3A 5A2KH 3TNNB 4LGSB 2ZNXA 2V33A 2W65B 1UEMA 4KI5D 5F1OB 1P4UA 3WFCH 3L3HA 4FLSA 2HWZL 4ZFZB 5AW7B 5TFSL 3KW7A 5JW4R 4RMWA 4WWKB 4PJCA 4NJAL 5E6SB 1J9SA 3RFZC 3U4KA 1WZ1H 1PBYA 3UROR 1FNLA 1UD5A 3L4WA 4IM8A 4L37A 5D6CB 1RVFH 2AEQL 2J4WH 3CFMA 4LLUB 4PWHA 2OW6A 3WXVH 1MCPH 3PJNA 4PWKA 2XWZA 4XN4A 4Y4FD 1DANT 2EJ1A 1KXQA 1Y0LA 4PJAA 3D6GA 2R9HC 3GSQB 2DIBA 2NYKA 1SEQL 3ZY7A 5CHNA 5FDYA 5ISZA 3VWKC 4LSDA 4S1RL 4X99A 1CR9L 1D6EA 1V3KA 3DLQR 2DLEA 4UANA 5LCVL 1P6AB 1P4BL 2AXFA 4TUKL 3T2OA 4F92B 3H7BB 4DP2X 1AD0A 5GISH 5LN8A 2EUXA 1TFHA 4U1MB 1I7TB 3W9DB 1QFUH 1D7CA 5MP6H 5I0DA 1AR2A 2YBRB 3SD5A 1CLZH 5MERB 2BDNL 3G3LA 4XH2A 1C5CH 2ZXBA 1I8IB 2W1NA 1QA9B 1OP5K 5E8DH 4PB0H 5B7EA 1GOGA 3VI4F 4YO0A 5HVHB 4OIAA 2LQRA 2V2TA 2GT9A 4PJDF 3KPOA 5IMOB 4B7IA 3MV7B 3DSFL 2QGDA 4MQ7B 4OZ4A 1E28B 4OIIH 3V5DB 3CFCH 3RILA 3LQAC 1J1XH 2R69L 1JNHA 4W9EC 4NNXB 4WU7B 2IC2A 3D34A 3QUKB 4YZFF 5DJCB 1TTUA 1DQQA 4PFEA 3IJHA 2R2CA 5BJTB 5CD3A 4JFYA 4JG1H 4GQPH 1HE7A 3E6FA 1EUTA 3T0WA 2A9NH 2E75C 4WU5A 4W9CC 3FFCD 4OFYD 5DI8B 3PV7A 1TJGH 3BWUC 3IDJB 1ECYA 2CO7B 4JO1L 3SHSA 3TV3H 1QI4A 3AWFA 4P2AA 3HE7B 4HUWB 3A22A 3EO9L 3I9PA 4JDEA 1W6WA 3SO5A 1LD9A 3IRPX 3WIFA 2BMKA 2NXZC 3WL9B 3O3UN 4RZKA 1XF2A 2VUOA 5C08B 3IU4H 4Q74A 4FLQA 1TQSA 2FATL 1M56B 1WCQA 1AZVA 4WO4B 2XG5B 4XO3A 5AKTA 1Z1WA 4CSSA 5KSVA 2R23B 3ZUNC 4XBEH 2CKBA 2NY6B 4JL1A 3WKQA 1RZPA 4OCLC 3C60D 1KPUB 5B1JA 4ZS7H 1ASPA 1U3HC 1C7SA 5BOPA 4I5BB 1MQKH 3QUML 1RV6X 2NPLX 4P23C 4ALAC 3JZ7A 4NQDB 4HULB 4U7MA 3EH3B 3ILDA 4L4TA 4AENA 3VXSE 2XWJB 2D2CC 2KQMA 3QJSB 3VNZA 1E9QB 4GAYB 3QDMD 1OGAB 3BPOC 3PAUA 4AUJA 1M71B 1RLBA 3K81A 2B5IC 3NACH 2X12A 5JHDB 4HEME 4MRCA 3O6KL 1QSFB 1A7QH 5CIPB 4JFFB 3TFKC 3QUXC 1KLGA 3BZFB 3OXSA 1FDLH 1LO5A 3O41B 1WEJH 4XMVA 3PWPA 1ND0B 4J3TA 4LLAA 2W60B 3S88L 9PCYA 1DBJL 3LRKA 3MOAL 3IXAA 1F00I 1BD2A 2HH0H 1OGTA 2MQ0A 5B4MC 3PWLB 2A1WL 3NFPB 3GDBA 4XBPB 4XMLL 2ADIA 1RPUA 1LL1A 4OCYL 5D4IA 3U7WL 4G1MA 4N5EC 1T7YA 3V6OC 4ZX3A 3DGCR 1FN4A 4O2FB 2HB0A 1G7JA 1WFMA 2GY7B 1BQHA 4BGDA 2VLKA 4MJHA 3QZMA 4P2RA 2HWZH 3KPRA 5TFSH 1CGVA 3SDXB 4E36A 2JB5L 5D93B 4AL8L 4JQIA 4LPUA 2HFTA 4NJAH 1FBIL 1J8HE 5I5JA 2B4CC 1YUHB 3SO3B 4MMXA 3WAJA 2OI9C 1IO4C 2AEQH 4F1SA 2NY3D 1GJUA 1GGYA 3MV01 3BPLC 4UDTB 3RNKB 4XCCL 3KGTA 1OQXA 3QIBB 3P4NA 4X6CE 2BNRE 3JXAA 2G2PA 4I18B 3L9RA 4MAYA 4PJBA 5F89B 4GO9A 1FNSL 1SEQH 3SKUD 1IAMA 3VXRE 2VM3A 4R7LA 3SEPA 3SY0A 3VACA 3FUDA 1GY1A 3TBVA 4IOSD 2CCWA 4QRUB 1CR9H 4S1RH 5LCVH 5LGHL 1P4BH 4TUKH 1MWOA 3B9EA 3UPAA 4M6OL 3ZRCC 3BGFB 3ARBA 1ZT1B 2EXWC 1UKSA 4F9LC 2OV0A 2PYED 1GY2A 4WFGD 1AR1B 5HHPB 3T6XA 4EBQL 1SLUA 2WXIA 4LEXL 5ERWB 5ACMA 1DJGA 2BDNH 4O02B 2XPGB 3IKCA 4APQC 3UEZA 3FTGB 1O9WA 1OWRM 1UM6L 5ETUB 1DQLL 4AGPA 4GO6B 5DVNA 3EG9B 4ZW5A 5IVZB 5HSFA 3DSFH 2D7NA 2OZNA 2WZPA 3OSVA 4HIHB 1E42A 3NCMA 4TNWK 5E6YA 2R69H 1T1XB 3IK2A 4IBSA 2D9CA 3GHPA 5EC1B 3L3OA 1HXMA 4Q8BA 5D2NC 2JCCE 4ELME 5EU6E 1JAEA 1MN4A 1TYRA 3MRHA 3GSOA 5JIKA 3UJIH 2RALA 4JQVC 3I74A 3FN0L 4YDVB 4HZAA 1RL1A 2QGEA 2JFCA 4OJEH 3ARYA 3SDAB 1AHWC 4F27A 5I16A 3PHQB 2WQRA 3ALXA 4JO1H 4Y4HA 3WEOA 3D2UA 2XTJE 3OX8B 2ATPA 2FIKA 3I9IA 5ANME 5E4EC 3EO9H 3PWNA 5KWYC 1G9ML 3NPZB 1U8MB 1OAKL 1YMMB 3V4VL 3ML9A 4R2GD 3OR6A 3I2CL 4PGBB 2MOGA 3MRGB 3IDYC 3IDIB 3LKNB 1N67A 3L3GB 3VI3F 1FVEA 3OKOA 2Q5BA 3G9AB 3W3BA 4YLQT 4M8VA 2J5WA 3VMNA 2ICEA 3OJDA 2FATH 4HVBA 2Q1EA 4ZUUB 3SOTA 4DW2L 1XTLA 1JWUA 2Y22A 4HMDA 2WXJA 5TDOB 5CLTA 2YPLE 3BJ91 1N5AB 2QPUA 2VDKB 4XOEA 3TA3A 4MFHA 4MS8D 2C1PB 4QY8A 5SX4H 1GA2A 2NDFA 1R5VB 4H7VA 4RGNC 4F1ZA 2EDJA 1NSNL 5GGRB 1GZQA 2EZ0C 2W88A 5E8NA 5EUKA 3QUMH 4ZMQA 3X1BA 4HHAB 1UZ6F 3L3DB 3ZZLA 2G9KA 4FHJA 3WOVA 4FC3E 2XLLA 5L9DL 4OJFH 1K4CA 1MFDL 1SVZA 4J6RL 4D0CB 1WBXA 4YIQA 3FT3B 2J8HA 3IMTA 1Q9WA 5I1AB 1ODUA 1G84A 1KB3A 2UY7B 4PMEA 3FUMA 3KBFA 3N1QC 1TVBA 5EU7E 3QWRA 2K0RA 3F6JA 2B0SL 3VFSA 5EEZA 4QRRA 3O6KH 4MA3B 5KS9A 5F7AA 1XGPA 1VADB 1T03L 3S3CB 1ETZA 2MEJB 3VWKA 3WIHL 3DVIA 1OSZB 5KSBB 1AGBB 5DYOA 2Y6TE 5DVLA 3UBHA 1J12A 2XQ0A 2Y36L 3S88H 1DBJH 3SGKC 1X9UA 4MXWL 2W59A 2VAAB 4L05A 1MH5A 3IPEA 4DN4L 4P2OD 1F4WL 1L0YA 2A1WH 3GTVA 1WDAA 5I8KH 4XMLH 2OCCB 4FERA 1OT2A 4OCYH 3HKZA 5KOVC 3U7WH 3NCEB 3JWNE 2P5EE 2A74B 1B90A 1XR8A 1ZTXL 2P43B 2QHLA 3O6FD 1R34A 2V3FA 3ENEA 3ULAB 2V7NA 1DQDL 4K55A 4ENEC 5D96C 3QCVL 5DEGB 3OG6B 1A6UH 1U91A 1R3IL 1KCSL 1SLWA 3LKQA 4HW6A 3SIKA 1KCBA 3MRQB 2PCYA 2EXTA 3DHPA 4P5MB 2JB5H 4LEBA 3ZT7A 4AL8H 1FBIH 4X42A 2FQGA 1RP8A 2V9RA 4QJ4B 4QRQA 4EJ1C 1QNIA 4HISA 4N8VB 4PJCE 4DO6A 3NJGA 3K91A 4XCCH 5IIEA 3KJ4B 2DB8A 2L8AA 1L0QA 4QTHB 5CMAB 3QBTB 1CFNB 3EDDA 4PJHF 1F58L 3MX0A 1GAFL 4H88L 3NCBB 1FNSH 2EIBA 1PEZA 3IAPA 2QQKL 2Y72A 4N24A 4X6EA 5C0IB 1KXQE 4PJAE 3EH1A 1VENA 4NFBA 2OMYB 4ZFGH 3MROB 2AC0A 1CDJA 2L04A 1J0ZA 5I75C 5ISZE 5LGHH 1MHHA 1Y7VA 1WZKA 2GUOB 3T6QC 3PL6B 2ZKYA 2JH2A 5CWSA 1FYTD 1BJMA 2I25N 5D93C 2MOVA 4M6OH 3HIZA 4AEFA 4D8OA 2ROXA 1IEHA 1H3PH 1TMQA 1K4DA 2ZCLL 3X13B 4OLWL 4WWKD 5K9OB 3KHOA 4LEXH 5JIMA 3KL0A 3RL2A 4I18C 2EADA 2IMNA 1P7HL 1ZK5A 5C07B 1LP9A 5C0CD 1UM6H 4NT6A 3VW3L 2FNBA 3V0AC 1DQLH 3GMPB 1CGXA 3EBAA 4NP9A 1GC1L 4JDTL 5D5MF 5CZRA 4U6HB 1IAOA 4MJ5B 3QEUA 3QHFL 3STLB 3CNKA 4PH8A 3EJYC 3VX0A 2MQCA 4P23A 2A6DB 2OFQA 3J27A 1OAXL 3G08A 1S8DA 4M02A 4PREA 4CN6A 4OD2B 4N8VG 1IBBA 3ZL2A 3OAYH 3C08H 1AR1C 3E9UA 3FH5A 4R97B 3IJSB 3ZHLA 4AJWA 4L18A 4GI9A 1JGLL 5KBDA 5CD5D 2NT0A 2OX5B 4Y5VA 4C54A 2XV6B 4CU7A 5F7NC 3IMBA 2CHZA 3ECWA 1JYNA 1T2JA 1G9MH 4HFWA 1UASA 1OAKH 3V4VH 2J20A 5GQBA 3ZKXB 3I2CH 3RVUC 1N12A 1Z5HA 4JAMB 4X5WB 4HIJB 4HDIA 1XO8A 2LV4A 4HWBL 3VTTA 4M3HA 2DLTA 4YHIA 4POZD 5I6NA 1YAIA 4ZPTA 2PO6B 1ZWIB 2IDTA 5T1DL 4DW2H 3NOIA 2K6WA 3VFRB 3SYQA 3QIUB 4R6UA 2E47A 4ZMNA 1LMIA 2ODHA 2X53A 5GGSB 1BZQK 1ZXKA 5IEKA 2ZICA 5AB9A 3D3VA 5F72S 2FCBA 1NSNH 4PVLA 2DQTL 4GUCA 3HE7D 1KYOJ 1T5KA 2FEDC 5L9DH 1S9KC 3AG1B 3CN4A 5I73C 1MFDH 4J6RH 4WENB 5FV1L 3ILPB 3MTXA 5FYKD 5GRVK 4OF8A 1RXLA 2VB5A 4PD4J 5CP3H 3RTQD 1RZFL 5I1DB 3LKSB 5IBLD 3DJRA 4L4TE 1CD9B 4H44C 4N8PA 3OBAA 3LY6A 3NSCA 3SGEH 3P3TA 3J7HA 4TKWA 4EOWL 5L8JB 4NQXB 1T03H 3NABL 4WI4A 3WJLC 3MRFB 1JL8A 1VACA 3WIHH 1HS6A 1VZGA 3QNFA 4MZIA 2XC8A 1T1WB 5LNEA 2GJRA 2Y36H 4PW4A 3TJHD 2NY6D 2X4SA 3VQ2C 3QZWA 4Z7UA 2Q86B 4MXWH 4OGAC 4MJ2A 4I1PA 4DN4H 3PWPE 1SYSB 3ZJAA 3AZUA 3OJVC 3CZFA 3G5YB 3DVFA 5HGDB 1A9BA 4FQJL 4F9LA 3C8HA 1BD2E 4KXBA 3T9WA 2CLRB 4GPVA 4N1EA 5GRUL 5FF6B 1RSFA 4WKXA 1ZTXH 4DKFL 4MNHA 4L29B 3N41B 1FG2A 3ETBJ 1DQDH 4EQ2A 4OCMC 3LRHA 3QCVH 4NRXB 1Q9KA 4EI5A 1KZQA 4APQA 3UJJL 2ZXCA 3HRPA 2W9LA 5T1KA 1KCSH 4ONGL 4UQCA 1F4YL 3V0VB 2Y7SA 1CFSA 1SMDA 3HCVA 4YHZL 5JPMC 1AKPA 3U36B 1C08A 4WTZG 3U30B 2VLKE 5EIIA 5FCUL 1IBDA 4K9JA 4P2RE 1JK9A 1MKFA 3CK0L 5DFVD 5DJZA 4O4YL 4GXUN 4G9FA 3EXJA 4JM0A 5MHSE 3BVNB 1KTDA 2F6AA 3KPRE 3HAEA 1Q1JL 2ZOWA 2ADGA 3D51A 2EVHA 1XF1A 3O4LE 4K4KA 3QHZL 2JTYA 3FN9A 1BIIB 2Q0ZX 4EO5A 5D2NA 2E76C 2VLME 2H2PC 4HJ0C 3K71B 2YEVB 1F58H 1GAFH 3QDGB 4H88H 4FNTA 1AHWA 3KDPB 3DV4B 2K4WA 3V5HA 3VFWA 5JLZB 1I82A 3QI9D 5T3XD 1DHKA 4J3OH 1IX2A 4XVUD 2XY2A 3KPLB 2JLPA 3LPPA 2M1KA 1IZKA 1AZNA 2UWEB 3RGVC 1DJSA 5C0BB 1FVDB 3N85L 4F2MB 4PVMA 3NZSA 5JO5B 1IC7L 1K9TA 3KEDA 2LABA 1NUDA 4OLWH 2BFGA 1RUKL 2F54A 4M9PA 5LLIC 4WZ9A 2FR4B 3N9GL 3QT2A 4HC1L 4IBTA 2MNUA 3QPQD 1NMBL 4OF6A 3VW3H 3VXMA 1X4ZA 3DYPA 5T3ZL 4P4RB 4X98B 3KS0J 3VFOB 1WUZA 4P3DA 4U1JB 4LLDA 1U8JA 2HVBA 4GBXD 5C9JB 1NTDA 3FFDB 3PL6C 4U6VL 3GB7A 1SJMA 3QHFH 4ORGA 5D7LB 4TQEL 4J4PC 1M9WA 4KH9A 4QNPE 1T21B 1QWUA 2MHAA 3VRLE 2PW1B 5ADOH 3QUMB 4NERA 3VE0A 4JREB 3U1PA 3DURB 4MNGA 3D25A 1V27A 2J6EL 3DX7B 1TR7A 1FGVH 1QPPA 3T0EB 5IHUL 1JGLH 3D4CA 4D0DA 3HW7A 4WTWA 1LWHA 4TNGA 4ODVL 4ZUTB 5ICZA 1JXGA 4ZUSB 4DCQB 5AKRA 1LO0L 4JMXA 1KGCE 1ZCRA 1JPST 2OTUB 15C8L 3IDNB 4G7QB 3X1EA 1XGTB 4JM2F 3RVXD 4IDJL 5IREA 4KMLB 3FCSB 4PV8A 4UM8B 9CGTA 4ZOEA 5I0XA 4GRLB 4K5MA 4HWBH 3TL5A 2EYTB 2J1KA 5J12C 3WE6A 5L4MA 3KPMA 3QR2A 5AD0A 4LRNL 4R97C 2AZAA 4N68A 1EANA 3MJ7B 5T1DH 5KJ7E 3WMSA 3ECBA 3BFWA 5GZND 1NDGB 3RA7L 32C2A 2CO3A 1ITCA 3FQTA 2AVGA 3KLKA 3D30A 3QXAB 2CK2A 1Q90A 3QC6X 4L0PB 2Z31C 1R19A 3SDAD 4HCRA 2DQTH 1VFBA 4M7LL 4NNYA 5EO9B 4YHPB 3EGDB 3M88A 1HNYA 1RK0A 3ESMA 3OAUL 2DM4A 5I28A 5FFOA 5CCKL 3FU7A 1IKOP 1RZFH 3QQ3A 4AM0B 1J18A 2ZUWA 1E4JA 4YHYB 3BDXA 3MOBL 2E6PA 2EE0A 1H19A 1LE5A 1OD9A 1FLRL 4EOWH 3TPUB 5FWRA 1CI5A 3NABH 4BZYA 5F7BA 3HC0B 3OVUB 2HN7B 5DURB 2VL4A 4WSKA 3QO0B 5KS9E 2KZ1B 3CFUA 1KIPA 2DKSA 1BXXA 1FAKT 3MA7A 4AXWA 5DZLA 3AU0A 3EGSB 3GBNL 4EN3B 3KYOB 4ZSOB 1NGWA 4YPGB 1PZDA 3C87A 4ZOCA 1FHNA 4FQJH 2VABB 5EC2B 5J5EA 3GMRB 4A37A 5GRUH 3VXQA 1VJSA 2F7IA 2YUWA 1E40A 4ZTEA 4DKFH 1IC4L 4LEOA 1L9OA 1Z0MA 4LLVB 2VMCA 3DRTA 3VXUD 2E4TA 3QAZC 3TXAA 3UJJH 4N2MA 5LGKA 1D5BA 4I3GA 4YHZH 3WHXB 1F4YH 1U4EA 1NCBH 3KDMA 5LG1A 1UB5B 4MD4B 2E8ZA 1HSBB 5FCUH 5AYTA 4Q9QL 5A2FA 3CK0H 4N0FA 4O4YH 4WJG3 5K39B 3S35L 2VXVL 2AKRA 3PU7A 1Q1JH 1CE6B 1R5IA 5FYJD 3QHZH 1Z9LA 1X7QA 5DJAB 4Z18A 1TZIB 4YLBA 2HFEA 4L4VA 3BVDB 4FD0A 4KRNA 3NZUA 1UD8A 2I07A 3Q7JA 5T1MA 4LQFL 2WKOF 2FBOJ 1PG7L 2X89A 3EFOA 5DJYB 5F93C 2B3IA 1FG9C 4XB3A 1S7TA 3FT2B 3QJFA 2WMPB 1C12A 4MQSB 5D1ZC 2PTVA 1U58B 1HHIB 1XXDC 5AVYB 5CKGA 5B39A 4A7TA 3T8XA 4B9PA 2KBGA 3IFPA 3CSBA 4AZ8B 5I24A 3SDDA 5HTSA 4KVPA 3N85H 1MFVA 3VO0A 1UWGL 1ILSA 1IC7H 3HS8A 3REVB 4YHML 3V4VB 3DBXB 1A1MB 1DSYA 1RUKH 1DVFB 3GO1L 4HJSA 1NC2B 4D2NA 3N9GH 5B1CA 4ZX4A 1A6AA 4BFEA 4L3EB 2E6JA 3DX0A 4HC1H 4Y2DD 4GAGL 2DBLL 4AMKL 4X9GA 1NMBH 4OZHB 1MVUB 2XWXA 2QKSA 5IZ7A 4ZODA 2JKNA 5CLYA 2XXGA 5T3ZH 5KUKA 3O4OB 4MQXC 4OF3A 4UU9A 4B96A 1LP9E 1HQRB 3BVWA 2WWOA 1NANH 3W56A 2RFXA 5HYSB 1P69B 2AJZB 3FTWA 3LKOA 4PJ5B 5E5UB 4U6VH 3LEVL 2FWOB 4TLTA 3VD9A 4E9VA 5TE4L 5HDWA 4TQEH 3WGUB 3S4SA 2NW2A 3F2LA 3HJ0A 2YAPA 5D6DC 5J1AB 3HBGA 4HAFA 4PN6A 5G2NA 2DL9A 2M8XA 4C8XA 1NMCB 4U33A