3GTVA

Human-mouse sod1 chimera
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
molecule keywords Superoxide dismutase [Cu-Zn]
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 38
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gtvA00
1OEZW 5KBLA 1SDAB 4A7VA 1IBFA 1YSOA 3MNDA 4BD4A 2GBVA 1FUNA 1Z9NA 2APSA 4OH2A 1OZTG 4A7UA 1E9OA 2C9UA 2XJKA 1QUPA 2R27A 2WKOA 2WYTA 1F1GA 2AQTA 2AQNA 1UXLA 3PU7A 2AEOA 1SXNA 1YAIA 1XTLA 2WZ0A 2WWOA 3S0PA 1ESOA 2WWNA 1SRDA 4BCZA 2AQRA 1IBDA 1HL4A 3CE1A 4L05A 1N18A 2VR8A 3KM1A 1XSOA 3H2PA 4N3TA 1IB5A 3KBEA 1TO5A 3KH4A 1XTMA 2E47A 2VR7A 4BCYA 1AZVA 5KBKA 3GZPA 3K91A 1Q0EA 2Z7ZA 2AQPA 1Z9PA 1OZUA 1YAZA 1JK9B 3F7KA 3HW7A 4U4IA 4A7TA 1E9PB 3CQPA 1E9QB 3GZOA 3H2QA 3GQFA 2C9SA 3QQDA 5CU9A 1PTZA 2WZ5A 1OALA 2LU5A 4MCNA 2VR6A 2V0AA 1JCVA 2Q2LA 1S4IA 3KM2A 1BA9A 3MKGA 1KMGA 3GTVA 1SDYA 3GTTA 1F1AA 4FF9A 4A7QA 3KH3A 1B4LA 4A7GF 1F1DA 2AQQA 3CQQA 1U3NA 1UXMA 4A7GA 3KBFA 2ZKWA 2AF2A 3T5WA 3GZQA 1PZSA 2WZ6A 1COBA 3L9YA 1SXBA 4N3UA 2WYZA 1HL5A 1PU0A 1EJ8A 3ECWA 1SXAA 2E46A 1E9OB 1IBHA 3LTVA 1TO4A 4A7SA 1B4TA 1SPDA 3RE0A 1OAJA 3F7LA 1SOSA 2AQSA 1MFMA 3QQDB 4OJAA 1CB4A 2C9VA 1JK9A 1L3NA 2GBTA 1E9PA 1E9QA 1SXCA 1BZOA 1CBJA 2JCWA 2ZKXA 2ZKYA 2WKOF 3ECVA 1SXSA 2Z7WA 1P1VA 2NNXA 5KBMA 4B3EA 1IBBA 3L9EA 2JLPA 3SODB 1RK7A 1EQWA 2GBUA 2K4WA 1DO5A 3ECUA 1SXZA 3HFFA 1N19A 4MCMA 2XJLA 1F18A 3HOGA 2SODB 2Z7YA 2Z7UA 2ZOWA 1DSWA
chains in the Genus database with same CATH superfamily
2F08A 5T3XE 2BY1A 4MYPA 1BLIA 2HT2D 3C6SA 3EHBB 4IMLA 3D3VE 3TBYB 5F70A 3OBAA 1WIPA 3DDGA 5FGBA 2PXYB 3WD5L 5DVOA 1AZRA 2LHAA 4ZS7H 4Z23A 2ZXWB 5EEYA 4OCWL 3E8VA 3ZT5A 1Q9LA 1EANA 4K9JA 1IBDA 2ATKA 4L37B 2VERN 3LNHA 3VFVB 2VZ1A 1TEGA 3I85A 2WXIA 1OAXL 4OZFH 1IEBA 4P5TC 3AROA 4MMYB 5DXWA 5CEXB 5I71C 3TV3L 3HE6B 1ND0B 4XP5L 1BYNA 1FYTA 1C12A 1DVFA 1HWHB 3OKOA 3OPZL 5AQ0A 4XRCB 2B0SH 4TVUA 5J6SA 2OXGA 5A2LH 1MAKA 3H4HA 3WY2A 4NYLA 4GS7B 1ZLSH 4KJPC 3EF4A 3UTSB 5JLZA 1JHKL 2NX5D 5IGXL 1FZOB 2A6DB 4M48L 2JELL 1NC2D 2PWHA 4F57L 3LB6C 3W37A 4JG0H 4FQ2H 1DQJA 3O8XA 3ARGC 3AY2A 4G43B 2I5YL 2JJTA 3GRWH 1P84K 4YIQA 1ACCA 3IGAA 2CIKA 3PNWB 4JR9L 3UTZB 3QXAA 2IAND 3SE4A 1F3RB 2CUAA 1UQSA 3VQ1C 3F64A 4RMRA 1HQRA 4EUPA 3Q1SL 6FABH 5B38A 2GJ6B 3CFKB 1G7LB 1P4BL 3NPSB 3O6FB 4P2RE 4CMHC 2P43B 4DKAA 2VL5B 5F7EH 3QNXB 1BM3H 3IKKA 3HUJA 2IOOA 3ESOA 1KN2H 3RPIB 4JPWL 2GW5A 2NNFA 3DX7B 4NQVB 2PR4L 4RRPA 1IIKA 3WKQA 2NY5L 4UM8B 5FO7B 5EU7E 5J11B 3FH5A 5KW9L 2V8LA 2NY6D 4Z6AT 4JPVL 4CVXA 4DN3L 4NC1E 1RIUL 5T1LB 2FSEA 3AQZA 1U8NA 2ITEA 3QA3B 4PJHA 5FUZL 3MACL 4EI6A 1EJOH 2ILLA 1E28B 2L8AA 1BZ8A 2UVFA 3TEZA 2AVGA 4Z7NB 4NQSA 2IBGA 4RZKA 2XZQH 3O3EA 1XGQB 2V33A 4Z0BL 2QSQA 1UYWH 3TURA 3L13A 3UEQA 2HT3D 1JRHL 3GBMH 3EUDA 1E4JA 1HE7A 3VE0A 3B83A 3RWIB 2HJLA 3LX9A 1HDMA 2NYYC 4Y5VB 5EU5A 2WIIB 2WCPA 5EBMB 1JN6B 3LRSA 1MCKA 3A67L 2X4RA 4D7PA 4F58H 1KIPA 1RH8A 2DIEA 4A2EA 8FABA 1CYGA 3NA9L 1PD6A 5EBGA 1R0AL 1MCPH 2DLIA 1XQ4A 3MV9E 3FOLA 1GZPB 3RZCA 4AYSA 4OD3L 1ZSDA 1TVHB 1E8WA 3TU6A 2FNWA 3FUEA 1CGWA 1RULL 3VH8A 1C16A 3FSVA 3V4LA 4JJ5B 4GKNA 2W59A 3CHQA 2X1WL 5TH2B 3LKRA 1IGJA 2GIXA 1LMKA 1E8ZA 3RVVD 3MBWA 1G7IB 4XX5A 3VSQA 1SN5A 2BHYA 1GIGH 2FATH 2VABA 2VLJD 5F1IB 5C0GB 3MYZA 1S9VA 1OWWA 4RWYL 1FL6A 5ANMA 2CLRB 2C3HA 4YSRA 4OZGF 4JFDE 4AQ8A 5F2FA 4LRNL 3MX0B 2P49B 1E9PB 3CQPA 4YHZH 4G6KH 3QHFH 4F91B 2KLSA 3QQNA 1FFPB 4LEEA 3QUZB 2JB5H 3SKNB 4AEFA 4KZ0A 5D1XA 5AYUH 3T08A 2EJ1A 3EFOB 4FNSA 2DQUL 4RAVB 1BG9A 4MLSA 3H8NA 4PCKA 2H2PC 1M71A 2A6KA 5FM5O 3D48R 4XOAA 3V0FA 3FUDA 3MCKB 5B7MA 2ICWI 4CDGC 5MENB 1T1WB 1YA5A 5HJ3A 1IO4C 1EEZA 2EUVA 2DOCA 1CE1L 2O5NA 4NUGL 4ZD3H 4WCYL 4G8FA 4OZGE 4J8RB 4YAQA 5KVEH 3BAWA 2AJ3A 3QIBA 4M4PA 3JWNH 3MCG1 3L7FB 4WIQA 5CLXA 4QO1A 3MCLH 4F37F 4FNUA 5LXVA 1UA7A 2IOMA 3LV3A 2CG9X 4NN7B 1B0WA 4PJAE 1J12A 3SPVB 3DDFA 1R3JB 4Y19D 3C60B 3CFDA 1GKOA 5DZJA 4LF3A 3TA4D 3BT2H 3PS6A 4L48A 4LB8A 2VITA 2B1AL 3F5WA 3RTQC 4OM1L 4HP5A 2DWDB 1E4WL 2X7LB 4PMFA 3HLKA 1SXSA 1EGJH 1NAKH 2FJSA 2E9IA 2J21A 5DMIL 4N2HA 3O3AA 4PAZA 4YSPA 1LO2H 5AVYB 4BZ1A 5J1AA 2DDQL 4GW5A 3HAEB 5C0DB 2P45B 1N59B 1U8HA 1CI3M 1CICD 2GIMA 2VXVL 4K8RH 4ZS6C 3FT4A 3NZHL 4R6UA 4P3DA 1VPOL 4G6FB 4KJWD 5ALCH 3SE8L 4J8QA 3WEAA 4F8QA 3MLZL 4Z0XB 5DJDA 3SY0A 1ZHKB 3BMVA 3CFJB 1QSFB 2EILB 3SJVE 3MRPB 4JGJA 4O02H 2FSDA 5MHSD 1QFUH 4GKSA 3QVAA 2YAFA 2W07B 5E8OA 4FQ1H 2FCBA 3DBSA 3DO7B 1LHZA 2BCKA 5CR1A 4ZXBC 3QZNA 3BDXA 1Q94B 2FECL 5FGSA 4XCYA 2F53B 1S7VA 2VN7A 3FF8A 2XIDA 3WLWC 1ZKAA 4GQ9H 4Z7OB 2PUQT 3GK8H 4GRLD 3NIDF 3ME0B 4HAFA 1RVFH 4P23B 4Y4FD 4X5RA 3ZMNA 4L4TA 4JDEB 2YBGA 3SPCA 1GOHA 3OLDA 2EEXA 1EK3A 2QADC 5HYJA 3IFNL 1HQ4A 3V0DA 3ZK0A 1Q38A 2LOEA 5A2IH 3ULUH 3WN5A 3K1DA 4HCIA 5AOIA 4FYSA 2PP7A 4TQHA 1F97A 3AS2A 3P73B 3UL4A 4Y2OA 1LMIA 1YY9C 4N0FA 3ZU8A 4BFOA 4NGHH 2H32A 1ZLVK 1UWXH 5LCVA 4TNFA 3K5SA 5E1AB 5KYUA 2W0KA 3KXFB 5HHQA 3FSWA 1D5XB 1M05A 3HG1B 3NIDE 3P1VA 2DJMA 3D18B 2G2RA 4MVBC 3UBXI 1UHVA 1JV5B 4X6FA 4P3CL 2Z4QA 5EZJB 4Z8FH 2CUHA 4L5FH 2AF2A 4FTDA 1TZAA 4Z95H 5GJTL 4HUNB 1G9ML 5HHNA 4M93B 3U0TA 1DYZA 2I9TB 2CBTA 1AGBA 3HKFA 3ESMA 4R96A 1MHPL 4MAUL 2VM3A 1PZ3A 2XKNA 4CADB 3AXLB 1W91A 2C3WA 2RACA 2A9MH 2XN9A 5DWUL 3HMWL 2IFFL 1T0MB 4O9HL 5EN3A 4P2QA 2F61A 3CU1A 1W0VB 2Y7LA 2F54B 3MRFA 4U1NB 4R2GD 2C9VA 1BFOB 4GSDL 3ALXA 3EO9L 3QEQD 4XCEB 2G0KA 4N1EA 4EUPG 2VZVA 2YUWA 1BYOA 5B38G 1FZMB 1OGPA 4ZFGH 3ZT7A 5T3XL 3N85H 3I2CL 4RFOH 4UTAA 1NAML 5D1ZD 4PJ8A 2ZPKL 4HA1A 4JG5A 3WTVA 5BCAA 1DBAH 1M3IA 4HPOL 4GG8B 1P7BA 2H2SC 1ZJAA 5C0FB 2VN4A 3FONB 4N2LA 3VFMA 4RRPG 5E6ZA 1Z9SA 4FFZA 5DC9B 4P5KA 3S5YA 3T9WA 3RZCC 4AUYA 4NO2B 4P9HC 5GXBB 1FNAA 5AZ2L 3W56A 1KJ3H 1YSOA 3U1SL 4AQOA 3QDMB 1E65A 3WXVL 1J9RA 4AOFA 2VLKA 4K2UH 1IM9D 3UJIL 5DR5H 3HA0A 5I1HH 3GPSA 5K9OB 1NBYB 3GXNA 1E9OA 4TUJB 2NY1D 1AGEA 3WGVB 5I1DA 1TITA 3I84A 3POCA 4FEIA 3K71B 1ADWA 4GW5B 5A7BA 4L8DA 4OV6F 1QD0A 4MNQD 3BUQA 4NUMA 3TBBA 2D31A 3MREB 3QDGE 4U2YA 4UIMB 4CUCA 5BOJA 1KTRL 4K23L 4XN2A 4YOKA 1J5CA 1FH2A 3KBPA 4KO9A 4RNRB 4DKTA 4HDIB 4X7SL 1NBZA 3X1BA 2HFTA 2WNWA 3MV8A 3EOAB 1KLGA 3T4AB 1NLDH 3JTBA 3G7TA 2ZUUA 3FB6B 5D1XC 2I25N 1MF2H 3MNMA 3W5MA 3QRLA 4OFDA 4AEIL 4YXKL 4LU5L 1TMQA 3MQIA 4OV5A 1A9BB 1KTKE 4HGWB 4XBEH 4XVJH 2V4LA 4XCNB 5GZND 4B9CA 3KGSA 4A2DA 3VH8G 3ULUD 1R46A 3D85B 1VEOA 4ELMA 2XWTA 3FCUB 4OLEA 4Q6IB 5CGYC 1QA9A 5LGHH 1G7PA 3H9HA 5IMMB 1XSIA 1XMWA 2MCMA 3BN3B 2I07A 3HTLX 4V2CB 4E5XB 2VLRD 5TDPA 5DEZA 1S7QB 3NABL 3TH3T 2J55A 4NP4H 4MYWB 4WNSA 3BIAX 4WGKA 1HCVA 2GSGA 4IS6B 3TP4A 2CKBH 3QZPA 5TDNB 3CXFA 1GW6A 2JKRM 3KGRA 4MAYD 3VM5A 1JDCA 3AUWB 1LO5A 3BWUF 4FADA 3L3DA 3L9YA 4L9LC 1KBWA 2CJUL 1FLRL 4LCUA 3GS4A 3ZKXB 4ZMVA 4KVNL 1N5YH 2OMZA 4YE0A 4JANB 4YO0A 1J8KA 4NT6B 5DMYA 1M9SA 3KPPA 2Y7QB 4UT9H 5E6YA 1KUMA 4H0LC 2BW5A 3Q5OA 5CBAB 2NW2A 4P4RA 2Q86A 3I6LD 1WUZA 2X4OB 1NKGA 4HZ1A 3JUYA 4MMZA 4ERSH 2ITCB 3IDUA 2WMPA 4XXWC 2VIRA 5G5DB 2EZ0D 2F7IA 3MU3A 3RWCB 2WVUA 3GXPA 1CN4A 4PJCF 3TONA 5D72L 3ZL4H 3UTSE 5GGTA 1IM3D 4Y9CA 4AMXA 1YPZA 3BI9X 4P5RA 2RGSA 4JFHD 1AI1L 2Q1EA 2Q8BL 1W16A 4ETQA 5CP7A 1E5ZA 2R1XB 4I4WA 4NQED 3B43A 3D39D 2PABA 5EF0A 2V5SA 5IZ7A 4IBTA 1UZ8B 3IM1A 2LW3A 2AJVH 3OG6B 1OSYA 1RU9H 2IWGA 2PETA 3RYMA 1IZKA 2NX5A 4S1SL 3V6ZB 1IGFL 4HOMA 1NC2A 4PJBA 1KYAA 1Z0NA 4ANKA 3GIZH 1IFRA 4WKXA 1S78D 3QUMB 4W9LC 5C86A 5CD5C 1WAAA 5E8EA 3UTTB 3H9SB 2IANA 2Y22A 4GMSH 4IMKA 1ZVSB 3FUFA 4NQCB 1GYAA 1FFOB 4JQVA 5L88L 4LL4A 2XVKA 3L2MA 1U93A 5DJ6B 1MLCB 3K6NA 3CDZA 1X5FA 3EADA 1JGEA 2XFXA 3LN9A 1H6TA 4P4KD 4UDUB 2BC4B 2IF7A 2XQBH 1XL6A 4G71B 5MP6L 1M42A 1KEGH 2CCWA 5CJQL 4FABL 1AZVA 1J1XH 3HE7D 5JPNB 3OC5A 1RL1A 4JG9A 4PV8A 5EC2B 4HUWB 4PJ9D 5AWNL 1B2WH 5C2BL 1NGXA 3OJ2C 2LFGA 2XBDA 1MRDL 2GTZB 2JCCF 2KPNA 1NJ9B 5D2NA 3F7VB 2Y23A 3AACA 4WZ9A 2GTWA 2AITA 3MROA 2Z91B 5SX4I 4A67A 1S6NA 3B3BA 2ZD0A 3RJQB 2ZX8A 4H2AA 2AW2A 3OL2A 4ONOA 5F8RC 1NSNH 4APQC 3L3OA 1J5HA 1JPGA 5F9WC 4N8PA 4HX1A 5CMAB 4LSTL 1F1AA 4WSJA 2YJLA 1KXHA 1PL3A 1J0YA 4BEIA 6PAZA 2FEJA 5TPWH 4AKQA 3IPFA 3PGDA 1XO8A 3NIFB 2VDKL 1S2EA 2G5BB 4NXKA 4QDGA 5TE4L 3F2LA 3PAUA 5BVPL 2EO1A 2VWEE 4JHVA 1NCNA 1BDYA 1TLKA 3H6JA 3LPGA 3MJ8A 2JCCE 3FCGA 3FUIA 4KQ3L 2BINA 2OULB 4FXKA 3SDAC 4PJ8C 5TJWK 3OKKB 3JZ7A 5ECGA 5ISZB 4LBEB 4UBDD 3NJGA 2Z93A 1BF8A 3FO9B 1FNSH 2RQEA 2JKXA 3QW9A 3J27A 3HCVB 5HD8D 1UTDA 2HVBA 4OZFA 2CO7A 4XMTA 1RZJC 2VLJA 2WBKA 3ZKND 1T1ZB 3P9LB 4F3FB 3VXNB 2Z3FA 5CCGE 1NCAL 3UGEA 2ZIDA 1DQDL 1HHKB 1Y1UA 2CHZA 5E2VH 1KCRH 5DD1L 1MCOL 5MENE 4BUGA 1GY1A 3U9PL 1I4FA 1M7UA 5B1AB 3B8SA 4KVCH 1BAGA 2YWZA 43C9A 4D0BB 5I1CH 3TM6A 5B7FA 3FT1A 2OR9L 4MCYA 5C8JB 4UQ2B 4Y5XA 4R0LA 2YS4A 5CNHA 3MBXL 3NIGB 2Y7SA 2BNRB 3P0VH 4PG9B 2AQ1A 3P3TA 5DF0A 3OXSB 2PYEB 4KFMA 3T3PB 1MVUB 5BRPA 4MJJA 5DMJB 3MLYL 5T8IA 4DSYA 3VVVA 4KH2A 1NFIA 4OTXL 2ZF9A 1WRFA 3VJ6A 3QULB 1ZVNA 5KG9A 3CPUA 4IOFD 4DTGH 3FFCB 1GYUA 5BO1L 4LSPL 5C7XH 5GZOC 5H35A 4AW7A 3X17A 1F45A 2OKMA 4W6XB 1AQDB 4Q74A 5DTFA 4DZBB 3AB0C 4Y19A 3KPMA 5IROA 5HSFA 4KI1A 4A1RA 2AQPA 3SYAA 1NDGB 1MW1A 5IB2B 3DI3B 4Z7OF 3CAFA 4HC1A 3DX9A 4E42A 5IB5A 1WFMA 3U0PB 5CLTA 4HK3J 3ULVL 4RA0C 4HJUA 1RUPH 3H7BA 2WP3T 5AOZA 4NPKA 3S98A 4XBPA 3DK0A 1QSFE 3GSOB 1A4BA 3MV11 3QDJB 3MJ7B 4PJ7B 4LHUA 1U4EA 4PW4A 5H8DA 1ZS8B 2QSTA 2GSMB 4AIEA 3D4CA 1Z9OA 3BQUB 5DS1A 5DSCA 3V4PA 5BRZB 1A7QH 4IYKA 5DD3L 4BK5C 3G6AA 1BMWA 2FH8A 4U1HB 3CVHA 4URTB 1TJGL 2F53E 2LVCA 3EJZD 4FNLL 3MUY1 4MMZC 5KANI 3I75B 2D7NA 4CSSA 3HB3B 4Z7OE 5HVFB 2DQTL 4FQCH 4EPSA 2DEWX 1TFHA 5KSVA 1UKTA 3U30C 3LB6D 4YDJA 1YVLA 5SWSA 3EIFA 3S34H 2BIIA 4NZUL 1U8IB 2XC8A 2E27L 3LDBB 1N8OE 2VO5A 4GOSA 3FU5A 3K2MC 3VI4A 2CUMA 4EJ1C 3GMLA 3IDGA 4LLDB 2QVFB 3A6CL 4LASH 2JIXD 1UT9A 5CSZA 2ZWZA 3CBJB 3BEVA 4Y4FA 5ESQA 3DOSB 3UO1H 5JR1L 2VXSL 1G6RL 3HG1E 3B9KD 5C09B 2GK0B 2GT9A 3L4UA 3BH8B 1T4KB 12E8H 3PXHA 4Q9RH 4MB4A 4XNYL 1JD7A 2GBAA 4UF7C 1XEUA 5T1KB 1PW3A 1KGCD 7FABL 3GSXA 1SMDA 2AQTA 3GKWL 4ZTOH 1CFQB 2ZOKA 4HSAC 4QF1B 3S97C 4M4RA 3K46A 5JMRA 3DV6B 3R4RA 1FFNA 5DC0A 3KLHD 1LO3H 4YC2B 4XCFL 3QWNA 4WI8A 4WEEA 1WBZB 1AQKL 2F54E 3IGUA 4HJ0C 4BFIB 1VDGA 1IZJA 2K3TA 4J3SA 1WZLA 1GS7A 1LK3H 3VRIA 2VXUH 2XWBA 4BYHA 5I16A 5AVWB 4ATTA 2D7PA 2FZ3A 4TSCL 3OC8A 1N9PA 4OZIA 3IJYA 4ZO6A 3UTPD 4U1MB 1QLFA 4APXB 2FHCA 3MRMA 2DBLL 3OKEB 4YHYC 5DQJB 2KKQA 2H3NB 3STZA 4HGKC 1FNFA 2O5ZL 4NO0B 1ASOA 1SFHA 1Z66A 1GTFA 2HTKD 1EGJA 1IKNC 1N4XL 2HN7A 1DO6A 1ZJBA 4IMLB 2OP4H 2CR3A 1SBBA 5D1ZA 5DQDH 5EZPA 2OQJA 2UXVA 3JT0A 1SF3A 4KO6A 1WPCA 1XCXA 1BVZA 1MFAL 3WO4B 4M7LL 5BS0B 4YFDB 4BE6A 4LEXH 1Q9LB 2ATPB 4EIBA 2Z0BA 3Q9PA 3ZDZF 1DBKH 1BD2D 2ARJQ 4RX4D 2WQAA 4ZQTA 1L7IL 1NMAH 2P44B 3CQQA 3LN5A 4RAUB 4DP4X 3VTAA 1IM9A 3UADA 1IEBB 4DCQB 4KPHH 1U8MA 2YPLA 3NFNA 4AZ8A 1MI5D 2AJSL 2B3RA 1FNHA 5ECJE 1FYTB 1C12B 5FDWA 1DVFB 3OKOB 4MNQA 1QRNB 4JDTL 2A74B 3KJ4B 5GISL 3TJHC 4B41A 2OXGB 3MV7B 2AQSA 2GAZB 3MLXH 1TIUA 2J4WL 2ZCLL 1MCCA 3JYBA 4NYLB 4K9EC 2D03L 3B6SB 3MUGA 5JLZB 4LP8A 4L4VD 2XV3A 1YDPB 4X2UA 4KI5D 1NFDA 4ZPVB 1PEZA 3IMVA 1CFBA 4XTRD 1SDDA 2L4OA 5BJTA 4R0LC 4YSOA 3X14A 1TVDA 3O8XB 4OF0A 5KN5A 1P6FA 4PJFA 3NSJA 4KGLA 4FTVD 4Y1SA 4YIQB 3IGAB 2CIKB 4MTMA 1I3RB 1EAQA 3JWOL 2WXGA 5GZNA 5ITBH 1SJMA 3VXPA 2CLVB 2CO6A 2NXYC 1SYSA 4EUPB 4GW4A 1IARB 4N2AA 5I5MA 3MRDA 5B38B 3DMMD 5DJCB 2WOYA 4B53A 3RTQD 4HWBH 4QRUA 4HG4K 2ZCKL 2ZP9A 1D5ZB 1I8AA 3F04A 2QSVA 3M7OA 4H1LH 4Q52A 5A2CA 1NBQA 4OZFG 3SDDA 2XTJC 3EOTH 3VNZA 2VLRA 3FULA 3D4YA 3A0OA 3IXAB 5A43C 3K72A 3QG7H 2N3JA 4MKMA 1NCDL 5E99H 3FRPA 3MO1A 5BXFA 4MAYA 1A14L 2IFGA 4P9HH 1U8NB 1OTSD 4PJHB 4LZKA 2Q3AA 3K0WA 4JG1L 1TJMA 1I1AC 3IDYB 3HG4A 1XB8A 5GGSA 3GSRB 3DRQA 4G8IA 4G7YH 1QABA 2X44D 1AGFB 4XPFL 4BKLA 3QJTB 3GB7A 4NQSB 1U95A 1LE9B 3PL6D 4X7FC 4ANUA 3O3EB 4KKRA 4NKOB 4L1BA 1FG2A 1E90A 1X5ZA 3MA9H 1B90A 2HFFB 2A77H 3FFDA 4B97A 1CC3A 2D3VA 5HDRA 3VE0B 1UB6A 2EYRA 1DEEA 2CMRL 2MRYA 4ZXBD 4CAGA 2HJLB 1YMMD 4ONGH 1JCKA 2QPSA 3BN9C 3IFLL 3ERXA 1IM3A 3O9WC 1LO4H 4N2DA 1FHGA 3F6LA 2X4RB 1KIPB 2VM9A 8FABB 3S88L 3P3RA 4L1HA 3AVEA 4Z77A 2R15A 2BOCA 3D39A 3UTTE 1XH3B 2N7AA 3BVXA 3B9EA 3FOLB 1JCVA 5BZZA 3ZO9A 4WJ5B 4NQCE 4XC3L 5G4OA 1ZSDB 3RNQA 1J1OH 3E6HA 5FCUL 3B4NA 3DHPA 1C16B 1KFAL 1PG7W 1THCA 3EGXA 3L3HB 4GO9A 3K8MA 4HALA 3W9EA 5ICYA 5F7NC 4EXPX 3NCXA 3D4GA 4PB9H 2VDMB 1YY9D 3ETTA 3H53A 5A3ID 3QUXD 4JREC 3ML8A 1EVUA 1S8DB 5BV7H 2ICWJ 2KI6A 2R0ZH 1S9VB 1FL6B 5ANMB 1MNNA 1JHTA 4LHUG 4DETA 1JMZA 5GRVK 2E46A 2V17L 3HNTH 1SMAA 1ZHBB 2G4GA 4MVBD 1FVEA 4LCCA 4V1DB 1U4FA 5HYSG 5AW5B 3SOBH 1XH0A 1NINA 4U1LA 3U7YH 2P8LA 4JRLA 3QP3A 1T5XA 5KWYC 4MRBA 3WGUB 5HI5C 1NDMA 1A5FH 1SEQH 1GS8A 4KO7A 4UZSA 4KTEH 2EEDA 4L3FA 1M71B 4UUJA 5MEPA 2A6KB 5IBTL 1UJTA 4O58H 5HJ3B 2CBOA 1BLNA 4PJ9A 4JZJC 1KEMH 3LS5H 2VLMD 4OF7A 1XXDC 3BVVA 4JRYB 1RUML 1UD2A 1XF2A 3NIFE 2J8OA 4NWTL 1YQVL 5DK0A 3WIFA 2YARA 4C55A 4KHTH 4YAQB 3ZE1F 3IN0A 4I88A 2VSDA 3QIBB 4XE0A 4XB3A 3IB4A 4PJGA 1ET8A 1ZHNB 2AEPL 3L5WA 1ZANH 4PHZA 2ZQKA 15C8H 3LV3B 4YWGL 2NXZD 3CVIH 4X6EA 3Q13A 4RDQF 3UBGA 3WI9A 3NZUA 4U1KA 2BM3A 4R7DA 5ISZE 1WYJA 2VITB 5E4IA 4MGXA 2DQDL 3NIGF 5KOVC 4A38A 2OMXA 2Y4SA 3HBQA 4P2CG 3NFPA 3O3AB 3OQ3B 2YUZA 1HXYA 5IBLD 1C08A 5J1AB 2VB5A 4NQTA 4WWNA 4GUOA 5F21B 1UKQA 1EJFA 1N18A 1OAKH 2NY2C 2ZKHH 3DXAD 4TQEL 4UT9A 1JYXA 1BW8A 1X5HA 2BOLA 2B2XL 4OB5H 3FT4B 2X09A 1EVTC 1RQ5A 1L9MA 1LK2B 3BKML 4P3DB 4F93B 4A2LA 4BZ2H 1RZKL 1SJHA 5K39A 1CPUA 4H8WC 3SY0B 2VTFA 4ZI8A 4R7XA 3VG9B 1TZIB 2X40A 5CO1A 2OCJA 3NIGE 5JHMA 1U9KA 3CZKA 4NERA 1F58L 1DUZB 1F4HA 1W72A 2K0RA 1LXMA 2OR7A 2Q20A 3FRUA 2IDTA 2PYEE 3MNWA 2WBJD 3T3PE 3IMUA 2CO3A 4ODWA 3AS3A 3CZJA 2P80D 3GTVA 4HCRA 1UM4H 4OQTL 4AXWA 4I3SH 3BSHA 5I6XC 3KHOA 1HEZA 1B0GA 2FJFB 2PW1A 1SLWA 1J05B 2XBZA 4PJ7F 3ETBJ 2WLNA 4I1RA 4WW2F 3ZLQC 3SGKC 2TAAA 2OSYA 3QQ4A 3SBRA 3ZZSA 4L4TB 2Q8AL 5HI4C 1WEJL 5FV2A 3UP6A 4OF6A 3LNIA 1GGYA 1YEGL 4GO6B 1DCEA 3SE9L 3TZVB 3TVMD 3VG0L 5HYJB 4K7PH 1HQ4B 2BRRH 2VUYA 3T0EB 5KS9F 3G08A 3WN5B 1RLBA 1TETH 5LBSA 4Y2OB 2DMKA 2ZCHL 2EE3A 4G80A 5IQOA 1CT8A 3TIEA 3FT9A 5D7LB 1Q8MA 5DA4A 4LCIH 4X5QA 2XV6B 3QDJE 4Z7UA 5IWLA 4PJ7E 2G2RB 3VQLA 1TNMA 5GGRY 3SDDC 4N90E 4X6FB 4K71B 2VMDA 2Z4QB 3M86A 3CSGA 5BRZE 1Z6JT 4PS4L 3DPDA 4LARH 3O2WL 3JV4A 2YZ8A 1MCRA 4WFGD 1KOAA 3NJFA 4RZCA 1FLTX 2ITDB 1JOIA 5TQ2L 3NJMA 4MLIA 2XN9B 3RIAK 2GKIA 2HUHA 4MSWB 3PP3H 1EHAA 3FSZA 4M62H 1CDHA 3MRFB 3MLTA 4ZFOA 4NZ8A 4XMKH 2KDGA 1DBMH 1J8SA 2IEPA 1GGIH 1MFVA 2X4SB 3KJ6H 5BQ7A 3ZRFC 5JZ7D 4KX9A 5KVDE 2MQ0A 5J0BA 1F3DJ 1SJEA 1KDJA 5C0CD 1FF5A 1HL8A 2YD4A 3ES6B 3IE9A 5I6OA 3HMXL 4MA1C 4S2SB 3LXCA 5F7MC 1N67A 3BSZA 1CTMA 5I0VA 4MNHB 4LP4A 1I1FA 3CDCA 1XBDA 5CSGA 5BQDA 4G8GE 1JXKA 4XN9A 3VFMB 1OTUD 1ZTXL 1A6UH 3GSQA 4ZUVA 4DNLA 3FRPG 4M5YH 3WELA 1EFXB 1GC1C 3EYVA 2Z7ZA 3JVFC 4JQIH 4MA7L 4F7MA 1XD0A 3G5YA 3F7KA 1T5WA 3LZFL 3WTSA 5D7IF 2VLKB 4Z3IA 1OSZA 1UH3A 2WVTA 5E8DL 3EJQA 3RVUD 1QZ1A 2EDKA 3F58H 4OVUA 1AGEB 5I1DB 2F8XC 4NZRL 3WFCL 4L8DB 1BOYA 4W9FC 1WBYB 3MRNA 2Y1VA 3MZTA 1VACA 4HKZA 1T66D 4AVJA 1FPTH 4F8PA 3A4AA 2CHXA 2X3AA 4KV5E 1UVQA 4R8WL 4OF3A 4L1LA 4LCCC 2NT1A 4LSQL 4I5BB 1J0KA 4YMPA 3V6OE 3MRQB 3JV6A 4R3SA 5HDOA 1NBZB 3QH3A 1KLGB 5CBEA 2A9AA 3MDJA 3VGFA 4DHLA 1E5CA 2IGFH 4KY1H 1COBA 1BQLH 1NGPL 1NBVL 1QNIA 1WDAA 3ABLB 4GH7B 1FCGA 5D7IE 4ZOCA 1KYDA 4IRZL 2OMYB 1SXAA 4UI2A 4WJKB 3B37A 1T5KA 4O5LH 4OSUH 3Q5YA 4ELMB 4QHUA 3JWDC 4H5SB 5GJSH 2XWTB 3MODH 5I5IA 1UB5A 4MZ3A 4LLAA 3HI6H 3W57A 2IAMC 4M02A 3RWGB 3FUNA 5DVKA 1HZLA 5DURB 3F12B 5E2WL 5EB9A 4AITA 2J8HA 3KYAA 1BQ5A 4AJYV 5BS0E 4HKXB 4OFKA 2D9QB 4JN1L 1RFDL 3L45A 2R56H 4P0DA 4XNZC 1AZBA 5IJDC 2DWSA 4JDZB 5E24E 5GS1A 4AYEC 3L3DB 1TQBB 1EHLH 3VXQA 5F3BA 1KT2A 1G7JB 4LCUB 1N3NA 1JI1A 4BHUI 1U8OB 1NUFA 1RZ8B 4X7TB 4F8TA 3BGMB 3QUYC 1V7ML 4WK4B 5JW4N 1PZ2A 3O6KH 4U6HA 1FYTE 1AR2A 1A4KA 5HYFA 1QRNE 1LEKA 3PGCB 5EDSA 3MV7E 2VIRB 3SD2A 4NM8H 3PLYA 3VFTA 1PF3A 4IOSA 1UXLA 3FTGB 1MI5A 3Q44A 2Q7NA 3B9VA 3V6FA 1TLMA 4P46C 1Q72L 4I0PC 2FGWL 3T3MF 1SRDA 4DT2A 4LCWB 1A7OH 2FBJH 4YDLC 5I1GL 1JUFA 5EUKB 4Z76B 3IXTB 3GIVA 4I4WB 2ZUXA 3S7GA 3QUML 4E41D 4HK0B 4HJJL 3ASNB 3GZKA 4M8RA 4NO5A 4FA6A 2UXGA 4PIRF 4YDIH 1NQBA 3OMNB 4XN4A 4NZFA 3MRJA 2VMFA 2NX5B 3RY5A 3MMEA 1NC2B 2HRLA 4PJBB 3TBTB 1F4YL 2XHNA 3Q8CA 4CKVX 5MI0B 5IFHL 3V9CA 2FEEL 3IAGC 2FE0A 5BW7C 4FTVA 3K2UH 3OZ9L 3EH3B 1MCJA 2IANB 2LABA 3WJJA 5JHDE 3FQUA 4AGPA 2AK4A 4NQDD 5AW2B 3F83A 1FVCA 1U93B 2OJZL 3DMMA 5FM8A 1RIHL 4GKZA 4RGMC 3TPKA 5D6DC 1KMGA 1XGUB 2XZZA 3CDZB 4WKZA 4YZFE 1V3LA 5E8PB 2EKJA 3Q8FA 1JGEB 2D3LA 2VZOA 3LPFA 4PJHE 2Z1PA 5CS7A 2AV7B 3GLEA 4M1CC 4PJXA 5EZIH 1QWHA 2WLKA 3H55A 1VKXA 2ZXEB 1H6UA 2X2YA 5AUMA 4JVUA 4N9GB 1QR4A 3P30H 3EBHA 4QTIH 1Z3GL 1U3HD 3S3CB 4P48A 2XETA 3IYLW 2NY6B 2BVYA 4PV8B 5IWLC 4XP9L 1NGXB 4MJID 3HZKA 1ECZA 2AJZB 3OLIA 1OCRB 1T89A 1VCAA 4JFFD 3PDGA 3WYRA 1NCJA 5D2NB 1TDQA 2R51A 4LSRH 1CFSB 1J18A 2GTWB 2P5EA 1RERA 1WJ3A 3PL6A 5D7KE 4NLHA 4YDNA 1RZGA 3L3OB 5E95B 1JPGB 4F2FA 1NIFA 4WO4C 1J7VR 4ZFFA 2DD8H 4MFHA 3I50H 3N0PB 1HAUA 1HCFX 2HH0L 4KK9C 1AHKA 2H1LM 3TYFB 1O9ZA 3D9AH 2XN2A 4NN6B 3NTCL 1ETB1 2VR5A 2YA0A 5I8KL 3ECBB 4X4XA 1A6AA 3NEOA 4CSTA 4FGMA 3ARRA 2XU9A 1BVNP 4JY5H 1K5WA 2QQLL 4FXKB 2X38A 3S5LA 1T20A 3VFGH 4ZG1A 5K9JL 3OSVA 5D70L 3PXLA 1C1EH 5FUCE 3QPXL 3N42F 2GJJA 3KGUA 4WTXA 3BKCL 2QR0B 1OZTG 3H54A 2O93L 1ZLWH 4V1DE 1UENA 5EULV 4JKLA 4R4FL 4N5UA 3QXWA 3BXNA 5DHEA 3GUTA 2PPEA 3LH8A 3QUXA 4X9GA 4OZFB 2CO7B 1WA1X 3EO1B 3SHSA 2VLJB 1XTLA 2WC7A 4RMBA 5JORA 4PJIF 5EO9A 3KWWA 2YOCA 5HHXL 4JKKA 5DGQA 1FGVH 2OSXA 4PD4K 3SDCA 4MNGE 4KDTC 3MXWH 2YD7A 5ADPH 2EVFA 3DX2A 4K07A 1I4FB 4MWFA 2FHFA 5I74C 4JRYE 3ORJA 3QJRB 3R1GH 4MCYB 2WW8A 5GS0C 4Y5XB 2P42B 1CTNA 4DP8X 1T1XA 1VLXA 4Q89A 4A7TA 1I7RA 1YEWA 3M6DA 4LIQE 3TN0C 5E9DA 5FOJA 3MJ9H 4PJIE 2B4CH 4HHAA 2VQUA 5AZEL 4ZODA 4OCNC 4ES9A 4XP6H 1NFIB 4NUJA 5FWQA 3LZQA 4IBQA 3VJ6B 2GK2A 4A2HA 5KG9B 4KKLD 4JKNA 4PG2A 4HWBA 5DZAA 4PTUB 4X4YA 4IJ3C 35C8H 4JFOA 3UROR 4J3OH 1HHHB 4POZC 5BVJA 4HS8H 1LQBC 3BRFA 4QGTA 4GNKB 1HCYA 4GMTH 2WZ6A 3P4NA 4Y19B 3HRZA 1U8KB 4H0IA 1YRKA 2FD6H 4FMKA 3CGTA 4ISVB 4DJMA 4J6RH 3DETC 3FQWB 2YQGA 1U36A 5IB5B 4E42B 4TUOA 3ARBD 2WLMA 3LEXB 4H0HB 1JSYA 4GG6A 3BPLC 3VUAA 4JBSA 4M6NH 4FFVC 5CN1A 1JNHB 1LP9F 1IC4L 2Q3XA 3DPBA 3WY4A 2Q6WA 3PE9A 4HW6A 3DXAA 4R7VA 3IU4H 1CICB 1KCBA 4HZLA 3WBDA 1A7NL 1U92B 1MFNA 5ABZA 2HA1A 1KCKA 1F6AA 5DSCB 4JKPL 4OLUH 3OZLA 1KTBA 2IDQA 7CGTA 3DX8A 1CXLA 3G6AB 1EDYA 4K94L 1KG0A 1QW8A 4GAFB 3GM0A 5F9OH 3HFMH 1YZZA 1B4JH 5KVDL 2IDUA 5FKPA 1UZGA 2H1XA 3RG1C 1DBBH 3D05A 3JVGC 4AGLA 1UD4A 1I7UB 2W80C 1ETZA 1K5NA 4YDJB 5B1JC 4N2OA 1EWHA 2OV0A 2WBJA 4L4TE 4HPYH 5DJ8A 5TFSL 3V0VA 2AS5M 1LP9E 3L2NA 2P5WE 1Q9KA 2P80A 4YHMH 4HIJB 1EXHA 4W9IC 4QY8A 3T0EE 2MPAH 3QC6X 4BFJA 4ODTH 1CWVA 3FU9A 1CU4H 4TQ8A 4GRLB 2OXHB 3WNJA 3TCLB 1DVQA 2KBGA 3CSPA 3BEVB 4Y4FB 4ZJ9A 4QRQA 2R69L 5ESQB 5D7LE 1RURL 1SF5A 5H37H 5FHBL 2HKAA 3TVMA 4X6DA 4FFYA 3PP4L 1NIDA 4QT5A 3VMPA 3SPHA 3N44B 1FC1A 3LOWA 2ZXCA 4O2CB 1SNRA 2W0PA 4BM7A 3P11H 3QJFA 1XTMA 4GY4A 3T2PA 2UY6A 2PWDA 1E5UI 3GSXB 2F74A 3OQRA 4LAQL 1L9SA 4QXTB 4TUKH 3U7WH 1S5IL 1UD6A 2ZOKB 3ULSA 3WIHH 4YSEA 1JK9B 5I73B 3K0YA 3QIUC 4RISH 4DW2H 4C4BA 2NYKA 3AGVA 3FBKA 5B39A 2DMCA 4FFWC 2XN9E 2B5IC 5CILL 5IQLA 4DPRA 4XP4H 5MEOA 4XOEA 1YNTF 2AP2A 3K1KC 1A6VH 2Q2LA 3KM2A 2QMKA 1FSKB 4H8WH 4QRTA 1GZHA 2Z8RA 3VRIB 3GI8H 3L9BA 4MMXC 1Z7JA 1DLFH 1J1PL 1F3DH 1QWUA 1T04A 4TNEA 3IJYB 4J3OD 1M2OA 4PIBA 2GCYA 4R2GB 3EZJB 2V7HA 3MRMB 4ORGA 4AEHL 1ZV9A 2ADFH 3QEQB 4J5VA 2ZG1A 4X7DC 1J87A 1A4JA 4HYTB 3UABA 4NQQA 3GBNH 3PWLA 4N8CH 2HN7B 2FX9H 3QJSB 1V8HA 2DKMA 2EDXA 2YO3A 4UOQA 5D1ZB 4I18C 2OQJB 1I8LC 4FQXA 3TFKC 2VLKE 5DEJA 3QDHA 5K9KB 2X6CA 4GRMA 2BJMH 4WFEE 1OP9A 3VSVA 1MW0A 4CN1A 1YEJL 4R83A 2NY7L 2DI9A 3VGAC 3GNML 1OAZH 2FECI 2HWZH 2XUWA 5HYEA 1N6QL 5F7FA 1IE5A 1JFQL 4M9PA 1GYVA 2BVOA 1I9IH 5TDOA 5CINL 1IM9B 3VXOA 4PVLA 3MUUA 5E6IC 1U8MB 3ZUCA 1OAUH 3S8WA 2FYVA 2NY1B 3R06A 1F18A 2YLKA 4YN3A 5FDWB 4ZMXA 1XH1A 4MNQB 1J9SA 5B1CA 3TT1L 5AKSA 1OE2A 5IW1B 1RK1B 2EP6A 3LEVL 3P4OB 1BZQK 2JKNA 3KYOA 1QNZH 4OUUA 3W81A 4N4YB 2RA1A 2V2TA 3NAAH 4E9VA 4I3RL 4UU9A 1JFHA 1A21A 1GKEA 3EJSA 3OAZH 4WV1A 4GJTB 4P06A 4M29A 1MCDA 5BJTB 1JGVH 3JZYA 3HZVA 1AP2A 4PWGA 1CFTB 1HSBA 5KN5B 1PCXA 1IQWL 3L4TA 3K6FA 3ZL1A 4ONFL 3CVBA 2O5XL 4OCXH 1MY5A 4MJ4A 5T5FA 4WLCA 3S5LG 2VDOH 4LXFA 1SYSB 4PP1D 3ARDC 1XF3B 2QEJA 2W91A 5D7SH 2X1PA 3IK2A 4QRUB 3QJOA 2J2ZB 1A0QL 4L2LA 5L6YL 4QHKI 3IVKA 1TT6A 3UZEC 4IGBD 5CGMA 2D73A 4PG2C 1BQSA 3VFSB 2VLRB 5I76A 5D96C 2CZNA 5ACZA 2XV0A 2CKNA 1PLBA 3PCYA 1GPOH 3ZMEA 1R33A 2WZ5A 3SCMC 5BXFB 4MAYB 4LOFA 4F33A 3AG1B 2D7OA 5CZRA 2J88L 4AQ1B 2J6EL 3WNPA 3ARXA 3D34A 4NUQA 5GGSB 3DRQB 4G8IB 4CVUA 3HNVL 5HVWA 2G3ZA 2Y1AA 3GB7B 4J2XA 3QJHA 2P1YA 3U4BH 3ARZA 4LCWE 2DQGL 1OB0A 4P5SA 4XWGH 3LH2L 5E70A 5E94B 1FG2B 5EUOB 3V5DA 4R5XA 1O6SA 2Y0SA 4N6QA 3FFDB 2Q76B 3WFEL 1VGEL 1K6QH 3PFQA 5D93B 2EYRB 4NKQB 5D5MF 2F7PA 2FJHA 3LCYA 2NX5E 2IALB 2VOTA 2OJEA 5DRXA 3RJDA 2R59A 3V7AE 4CMMB 1I8KA 4NM4H 1F86A 4Y0GA 1DJHA 4Z77B 1WAAE 5CCHE 4NQEB 2BOCB 3D39B 4WEUD 1IEAA 1RSYA 2VDML 2BSSB 5EZLA 4IBVA 4NLAA 4EI0A 2IANE 4NO3B 5BMFL 3RNQB 4EIZC 4S1QH 1AD9A 3EGXB 3W9EB 5ICYB 3L3GB 1A1MB 4JQIA 3STLA 3LPOA 4FXGA 1BF5A 1CR9L 1N12A 1VFUA 4GB9A 3QE5A 2IMMA 3PWPE 1CTOA 5C0BD 4QRFA 4OFIA 5SX4H 4C83B 2Z31C 4GINA 4NQDA 1JHTB 1NCBH 2J7LA 4XNXH 4BH7B 5IOPA 2ZOLA 4ABVA 1FVEB 1PFOA 2ODIA 4S1RL 5ICXA 3TA3C 4PYHA 4MXWL 2YKLL 4QXGL 2P8LB 1NDTA 1O7VA 4P4KB 3SO3B 3DVNA 2XJKA 5F0MB 4Q6YA 2GQHA 3TGXA 1NDMB 5LQBL 4P2RD 1FNGA 1U3HA 4PJEA 5JW4M 2YGQA 3HE7B 1MHHB 1LGVA 4UAOC 2P46B 1ZE3C 1BLNB 2QTEA 3OR6B 4PJ9B 3CBKB 3AY4A 2G3XA 4MJIA 1WH0A 2WANA 2VW7A 3QO1A 4LIQL 1AS8A 2ETWA 1JZHA 1PX3A 4JFFA 5F8QC 1ITCA 1XF2B 4W68A 5DK0B 4Y4HC 5DEFB 3V4VH 5C0EB 5JQ6L 5IESL 4FA7B 4LSSH 1ZV2A 5I1JH 1AQMA 3N43B 4MS8C 3EJTA 3MJGX 2UXFA 4XMZA 3L5XL 4W9ZA 3RDTD 2WWKT 5CIPH 2NCMA 2P7TB 4ODUA 3N9GH 5C70A 3L5WB 4WENB 3AUVA 3UGUA 5F7LB 1E9QB 5JXAH 2VXTH 2VUOA 4X6EB 2YMXL 3IBEA 2Y24A 4WRLA 4QJ3B 1I3GH 1A1NB 1VCBC 3T0XA 4YHKL 2C1OA 1QTYT 3GI9H 5F7HA 2ITFA 1HINH 4RGNC 3EJUA 2OMXB 2LAAA 3CTTA 4P2YA 2CK2A 3NFPB 5LHDA 3SBWA 1TG8A 4RQQA 3FQ2A 3CVDA 4PGDA 3WE6A 2NCEA 5LBGA 4PRHE 5I1IH 4FQXC 1UACH 3E8UL 5B39G 2JMRA 3RP1A 4HF5L 2CXKA 3ILQD 3QPKA 3GSUB 3MV9D 4DVRL 4EIUA 1F2XK 4LVNB 5IFJA 5K39B 2D3NA 1ZLVH 3HS0C 3OKDA 2BOBA 4I2XA 5FF6A 5KVFH 3MYJA 3PXJA 4KAQL 3VWJC 3S37L 4F7EB 2CALA 3P77A 2EDLA 3T1WA 1TPXB 1DDTA 2HLFD 1LJMA 3U1QA 1IJNA 3MNWB 1JBJA 2QL1A 5CM1A 4ODWB 2G2PA 4Y5YA 3ARFD 5DS8A 4RIRA 2OSWA 5JDJA 3CDGA 4N2KA 2D2OA 4U6VL 2Z9TA 1H9DA 1NMBH 4XWOC 1HEZB 3NCEB 1B0GB 1KB5H 1NUGA 3U6RB 4XO4A 3ZHKA 5C07A 4HEPA 4UNIA 3NSYA 1KB9K 1OGAA 3ISRA 2DQJH 2X42A 3AG2B 5EPMB 5ES4B 3QISA 3TWCL 3MCYA 3QQ4B 4JUSA 2WYIA 3W0WA 5EIIA 1R24A 2ZUSA 5LCVL 1GXEA 1ZV5A 2G75A 1A1OA 4CDHA 4Y19E 1M2VA 5DD6A 4DEPC 1DN0A 3UPAA 3G08B 4A7VA 3L4YA 2VM4A 4GSQA 2GBVA 5FLUA 1D2OA 2E4TA 2NDFA 5LAPA 5INDA 1CT8B 4G7QB 2FWSA 3BZ4A 2IWFA 2NPLX 1PX8A 3QAZB 4DO6A 1VFBA 3LXBA 1MLBA 1N6VA 3CLFH 3PWVB 2A5UA 5C97A 3IDIB 3ABMB 2WZPD 5TF1H 5B22A 5DJYA 4XNQB 1NLBH 2YXVA 3H2WA 4ZAKC 1F4XH 4DWHA 3DUSA 4C58B 5AOLA 4EZKA 4JO2H 3DBXA 4M9OA 3JV4B 1JVOA 1H0DA 4PRPB 4TL5A 3VQ2C 2HX7A 1K85A 1PY0A 1RP9A 3X3GL 3LPWA 3N44F 3EYUL 5M7QA 1H5BC 4UQDA 2FLBT 5EOCJ 4KUZL 3LQZB 3MLTB 3THMH 2YR3A 2CJTA 4TULH 4XPBL 2B1OA 1UM6H 5EFIA 4LMQE 1NOLA 1CZ8H 3SDYL 5GS0H 3S35L 4K15A 5DZNA 4FFZL 2W9DL 3N2JA 3GMNB 3KYMA 4R84A 5DFVD 1E8XA 4KBPA 2DJ4A 2H41A 4Q0XL 1I1FB 2QSCH 5FYJH 4FQPA 2XSKA 1FIGL 2DQEL 5D71L 4K3JL 3SJVD 2ZKWA 3K4DA 4PYGA 4DGYH 1WCBA 1I9JL 4ZOAA 3GSQB 2MQCA 1XR8A 4ZUVB 3GO1H 4JRWA 3VD3A 1M7DA 3EYVB 4QRRA 2JIXB 4F7MB 3MN8A 1RHHA 5D7JC 5DEGA 5I26A 4AIXA 4F1SA 4HUXB 8PAZA 4M6MH 4CRPA 1OSZB 4JM2F 4LPXA 3B9KB 4U1JA 2CGZA 1DQLH 4K7FA 4FXTA 1N0LB 3C6EA 3RVWD 4Z3EA 1P6WA 1VACB 4LLQA 3I6GA 1SHXA 4CSPA 3KYKL 4ONHA 1FNEA 2XWJA 3LHPL 1WFOA 4F7CB 4R3SB 4X9IA 5KVEE 2XWRA 1N7MH 3FPYA 5CBEB 4FJYA 3JWNE 2XV2A 1DJSA 2P26A 1U2CA 3HI5L 2VDLH 5IF0A 1L6ZA 4GI9A 1I9RL 4LCYA 1EO8H 3QEQE 1V54B 1V10A 1ZXKA 4HKJB 1QPPA 2H7WA 2R0LH 3AY4C 1MJJA 2WXLA 2HRGA 1DQKA 5IHLB 1PLGH 4FEMA 4MDIA 4WI6A 3MLRH 3VWKA 1INQA 1LLAA 5DQ9B 3O2VL 3K80A 2M83A 3F6IA 1R1CA 3B5GA 4HH9B 3BJ91 2WYHA 3T2NH 4WW1A 1PZ5A 2FQFA 5FGCB 3FB7A 1UWYA 3IJ9A 3IJ7A 4WO0A 2EXSA 4LEOA 3FH8A 1RZQA 4IHOA 4OR1A 4H8UA 1JNNH 4TYUA 1TQTA 1FDLL 2JKJA 2B9BA 1EHNA 1H3PH 1RD6A 5GS1B 2IH3A 4XN1A 3VXQB 1IU1A 1KT2B 1CBVL 1AIFA 5AW7B 3QIWD 4P5MA 3Q01A 2WK2A 3TCTA 1CF1A 4UT7L 1T0NA 1XGRA 4R90L 4KK5C 4DO5A 3VXTA 2H6PA 4O51A 4J23A 1KCVL 1JF5A 1BD2B 3P2DA 1MOEA 3E6FA 2XA8H 3UAFA 4XMPL 3IDJA 2WXFA 5LDUA 4LDOB 1ZWIB 3ZHLA 2WLJA 4OLWH 2QVIA 2IH8A 3FO0L 1MI5B 4AE1A 5GRUL 3GF8A 3MRRA 4DQOL 5JPMC 4L3ED 3TBSB 2VN5A 5KAQG 4HS3B 1B3IA 3VFNB 1MFCH 1JUFB 1ZVHA 2JLLA 3QNZA 3GIVB 4R4BA 2YPKA 4N8VB 3V8CA 4OW6A 5FYJD 1AZCA 4JO3L 5CU5A 1CD8A 3NK3A 5FX3A 3MNZA 1J5OH 2BFVL 2QQNH 2XYBA 4OUOA 3NEEA 4L4VB 3ULUE 3MMEB 1UM5L 4GXVH 1NICA 1BCIA 4W9CC 2QPEB 3DARA 4L2YA 1NGZB 2CNYA 1UCTA 4G3YH 4X42A 1BM7A 1IC7L 1QBMH 1KV3A 4FTVB 2XZCL 5EUOF 5H37A 2X4QA 2L04A 1R5IA 5IB1A 3TYGL 3FQUB 1N10A 1FVCB 4GLRH 4IKIA 1ZGLB 2X4NA 4JO1L 1OAQL 2NY5C 4WKZB 1CXEA 1MJ8H 5AAMA 3B5TA 4L5FE 3CXHJ 3RTQB 3DETD 3WE1A 5ITFA 2OZ4A 4IGBA 1IGCL 3D50A 4PJXB 1IGMH 1WWWX 1BVOA 1H9VA 5FS5A 3SPIA 1VKXB 3T8VA 1UA6H 2P9RA 5DRZA 2XYCA 3EFDL 4TTDC 2EYTB 2B16A 3I6LE 4YVNA 5EUOE 4S0HA 4W4OA 1RZ7L 3ZDXF 4E9RA 4IRSC 2A83A 2ZWKA 2K6ZA 1IILE 1KXTA 5ILTL 5EF1A 4YFEA 3H4FA 4A7UA 4HEPG 1NAMA 2WXHA 3PL6B 5F7YC 3X12A 5B8CA 2J5WA 2CDEB 5AW6B 4MBRA 4JFHE 1RLWA 3D3VA 3V0GA 5KBNC 4NQEE 5SV4A 3D39E 5EIIG 1HX0A 1M4KA 3D1MC 1ECYA 4GPVA 4ZFFB 2NUTA 1B0RA 5DU7A 4ZXBB 1YMMB 3RIFK 2WPGA 5DHDA 5IVZB 5EF2A 4ZS7L 1XMEB 5HGDA 3GJEA 2XLLA 5IHZA 3CDYA 5A2BA 3FU7A 4UM9D 3IAQA 4NNYA 5JW3H 4FJ6A 5T33H 1KF9B 4RSVA 4Y9FA 3P4MA 2Y69B 5DVPA 3UIZA 1T20B 2DMGA 1UJ3A 2QADB 4PI0A 5FFGA 4JY6A 3BDBA 3L3KA 3FTWA 5CAYB 1GR7A 4MJ5A 1PEWA 3BXNB 3GUTB 3FTSA 4FYTA 5KSUA 1EIBA 3QUXB 1HHJA 1MFBH 2R2CA 2I26N 5EO9B 3KWWB 5I8CB 1CMOA 4FI8A 1ZLSL 1AJ7H 4G42B 4NC0B 3KAAA 1AOHA 4DERA 1F1DA 1IBZA 1RIVH 2WWMD 4JG0L 4Q9CA 2ADIB 3QAQA 4FQ2L 4GFTB 4JRXD 4P9MH 4M43H 4QRPD 5C9JA 1GGTA 4XXDA 3MC0A 4KY2A 5F1OB 5F7UA 4UZGA 4XNMA 3GJFH 5ABAA 4P2RA 6FABL 1U58A 4LNRA 4XN5A 1WTLA 4AE0A 2MWCA 4PMEA 5DYOB 1R3LA 4PLJD 5GSVA 4N2EA 3SE3A 4ZW5A 4E2OA 4ZX4A 4KWUA 5DO8A 5F7EL 1KXQE 2M26A 4YDKH 1BM3L 2A9NH 4LK4A 1EEQA 4HHAB 1KN2L 4NUJB 2ZT9C 1OLLA 1CDYA 3MGTB 2FWLB 2PKDA 3UP1A 5IOKA 3VD0A 2APVA 4U7SA 4LRIA 4U1IB 4JFOB 4H1LB 1NIAA 1RK0A 4DFHA 5JIIA 2WZAA 4AENA 1QX1A 3SKOA 2VSKB 2VQTA 3QYMA 2NXZB 1G1YA 5KSBB 1SXZA 2XPYA 3BUDA 3BPOB 1G7QB 3P4NB 3UO8B 2KUTA 3PV7A 1J0HA 2XZQL 5J1TC 2NR6A 4PU2A 1UYWL 2D3JA 2ZWYA 1MWOA 3BWSA 4AL8C 4Y7OC 1U42A 4TUOB 1E4KC 1U0QA 3ZHNA 4GG6B 1N2RA 3RNKA 5L8LB 3KEHA 2X4UB 3GBML 1HS6A 4PQXA 3DPBB 1RZFL 2L0DA 2Q6WB 5C0AD 2E7LC 1LYQA 3DXAB 2DWTA 2VDRH 2X3CA 1XCTA 2WV3A 4HZLB 2IADA 4HIEA 4XOBA 2YJQA 3L54A 3FTYA 3P40A 2UYLA 3RX5A 3MV9A 3VB9A 1MCPL 3DX8B 4QAMB 1DANT 4QMEA 3AQDA 4HJGB 2YN5A 4HD9A 1TTRA 2UVEA 4JZNB 4N24A 4A68A 1BXVA 4EI5D 4A04A 4NAMA 5FKPB 4RFNB 3U83A 4JHUA 3SDXF 5E4EC 1ETZB 1K5NB 3T77A 4CNIA 1CYWA 2WBJB 3V0VB 5DJ8B 2JWYA 2RALA 3IDNA 1Q9KB 3DROB 3ARFA 4QY8B 4DN4H 2PTUA 1TZHB 1GIGL 5E03A 5D6CA 1OTTD 3GHBH 3VXUE 1FE8H 1YYMH 2EIEA 3MOBH 1Q9OB 4WNQB 2YUVA 4YLQT 3RHWF 4YHZL 2AFNA 4G6KL 1GY2A 4QRQB 3QHFL 2CRMA 4KQ4H 2OL3H 2E5EA 3LN4A 4LGRB 4M5ZH 5AAPA 5LDSA 5BV7B 5ACMA 3V0JA 4KZEH 4U6XB 3TVMB 1H3VA 3DIVA 2BSED 3GM8A 5AYUL 2CBPA 3RX7A 5K9QG 4MA8H 1BOGA 3FSAA 3U25A 3DWTA 5DHVH 4BXVA 5CGTA 1NGQH 4GBXC 4WVRA 1KFGA 5EBWB 2H26A 3QJFB 4Q2ZA 1ZGLM 4NKMB 2YEZA 3PY9A 1OCCB 2IDSA 2NY3D 3CHOA 5DD0H 2OAAA 3BSGA 1DSFH 2F9BT 3VRLF 1PU0A 3CSYB 4L9LB 1E6JH 3C60D 4FNQA 4OZGA 4PRPE 3ULSB 4ZD3L 1G9MC 3BKYH 2DJUA 3FJTA 3DRTA 1J10A 1TO4A 2GJZA 1TQUA 1B4TA 4J4PC 2WZPA 3BZFA 3DGGB 2SEBB 4WI7A 1IVTA 5KVEL 2X2HA 2HJFB 1SOSA 1T0PB 2PTTA 1CB4A 1SY6H 4HGMA 2R1WA 5BPPA 1AHWC 3MCLL 3CHRA 2AI0L 2BP3A 3E2HB 5EOCH 3V4VA 3WFBH 1KY7A 1I8MB 1YMHA 1N5AB 4FMFA 3RY6A 4JCWA 5TD4A 1EERB 3BT2L 1P5UC 2BWDA 1T04B 3VRLE 3DVFA 3SY6A 4Y4KC 1EGJL 4KHXH 5DLMH 5DUBA 2QGDA 2GCYB 2OYMA 4IBWA 1TCMA 2V7HB 1IAIM 1LO2L 1MCHA 2A1WH 5C0CB 2BIPA 5F72S 3CFBA 1VERA 4OLZH 3C08H 2AEQH 3UZVA 3PWLB 4B60A 2ZNXA 1QFWM 2ZUQC 3OSKA 4ELKA 4ZQKA 4Q56A 2APSA 4QWWC 5ALCL 2ZNWA 2DB8A 2QPDB 1AXTL 4M8VA 3SJVA 5TQ0H 4JCMA 1WIOA 2Z31D 4HULB 4P57A 5IVOA 3PAZA 1E50A 1VZGA 2D9CA 4H7VA 3BKJL 1QFUL 2E7BA 5FUOH 1Y0LA 2VDPH 3FUHA 3LQMA 4DAGH 3EO0B 4DGUA 5AYTA 8CGTA 1HK6A 4WUUD 2UXTA 3M7FB 5AYQA 3VXOB 1BQHB 1NGYA 2WTPA 5FEBA 4W81A 4Q4EA 3R06B 5J9PA 5DJAA 3TTSA 4GQ9L 2G3MA 3GK8L 1L5GB 3CPLA 1ET7A 1J88A 2HKFH 2Q3ZA 3FUJA 4FHBD 2WO2B 2ZONA 4OUUB 1F90H 3DX1A 4R7LA 4QHKJ 4UU9B 2FB4H 1XF1A 2XI9A 4RA3A 3CHXA 4PM1A 4WV1B 3ULUL 3RIKA 2PW2A 1GCYA 3VXSB 1S7RA 4KRNA 3HZVB 1AP2B 3LS4L 1HSBB 1MRFH 1OARH 2DWYA 2WNXA 1SDYA 5F9WB 3EFFB 2F6AA 3AT8A 4NGHL 3GHEL 1NCWH 2OI9C 3G6JF 5HTSA 1XAUA 1XF4A 4WWKC 1WSST 2W38A 5HYQA 4G70B 5F89A 1JI2A 3FN0H 4J3WA 4OFYD 2DMHA 4O00A 4Z8FL 3NJVA 2BVQA 3IVKB 4L5FL 5D1QD 2JV6A 7PAZA 4Z95L 1F42A 2F1EA 4NC1C 4BE5A 5CZVH 4BRJA 4GEIA 3PWJB 4POUB 4XMUA 1E0OB 3SDAB 3REWB 2VJXA 2WP3O 4M6AA 4IRJC 3Q06A 5HGBA 3NJJA 1SM3L 1BD2E 2A9ML 3FU6A 2APFA 3G6DH 3ZKSD 2EIBA 1ODUA 1YO4A 3G6JE 5EU4A 4HJ1A 1S9XB 1MHEA 2D0HA 3KBHE 2NR6C 2DH2A 4NHCH 5CHNA 3QIWA 1MI5E 1M7XA 3ARWA 2Y2YA 2B15A 2XACC 5CLWA 2NW3A 1TXKA 4YHPB 4ZFGL 3DO4A 1AYOA 4R26H 3N85L 4RFOL 3KS0J 2VR4A 5DLLA 1I85A 3NZSA 2JB6A 4PVBA 3BJLA 1DBAL 2HCZX 4F2MA 2FJHB 3S8FB 4L4VE 5I0ZA 4W9DC 1S7XA 3H9YA 3C9NA 2OJEB 5DRXB 4L3EA 4I7ZC 1NKRA 3R8BB 2PPFA 3PHAA 4G7SB 3RPBA 3SKMA 1BZ7A 1G6RA 5EN2A 4TNWF 4E41B 1KJ3L 2DQCH 5EZLB 4DP1X 1PZBA 4K2UL 1XGTB 3VI3B 3OM3B 5DR5L 3SGJA 1ID2A 5I1HL 1NL0H 1AD9B 2DLGA 1K8IB 2VISB 3M46A 3ATDA 3QDGA 4Y9EA 1CGTA 4JM0A 3STLB 2QMJA 3NZ8A 4HJIA 5CKGA 4Z7VF 1DDHA 3W5NA 4LOUC 5CZKA 3UEZA 3D69B 4N2GA 5J4MA 2WCGA 4TTGA 4NQDB 2HT4C 1ZA3A 3FO2A 3WD5H 2ZOLB 5CJXA 1AC0A 3WDHA 1NLDL 1UH4A 2CBQA 5ICXB 5EC1B 1M6OB 1MF2L 3L3IA 4L0ZA 3L6FA 1JZ4A 5F6IC 4X9BA 4FS0A 3DVNB 1F8TH 3FFOA 2ICCA 3B2UC 4TPRH 4XBEL 4D9RE 5IP4A 3ZDYF 1T2XA 3I9IA 3LIZH 3BZEB 4PJEB 1Y07A 4HZAA 4Z7VE 3TBYA 2R2BB 2AC0A 3OHMB 1MCEA 1HXMB 4MJIB 2XZAH 3D08A 1KTLA 3OPZH 5LGHL 2NY0C 2PXYA 3QO1B 4OGZA 1W6LA 4NEHB 1JZGA 4MQXC 1YMME 1V5JA 4NP4L 2OPCA 1FGNH 3T65A 1F4WH 2AAVA 4UINH 4XPAL 3HUJF 1G0XA 3FHQA 4GT0A 3DVGB 4HIIA 2MCPH 1HXKA 3WTYA 4U0RC 3AU1B 4MMYA 3RE0A 5CFAA 3ZDYE 3ZYZA 4LP5A 1C5CH 4KNSA 1N5YL 3HE6A 1U91A 3KPTA 1EXGA 4XRCA 1OGTB 3ELAT 4UT9L 1K4DB 4UM9A 3Q1SH 4EN2A 1BG1A 4ERSL 2IG2L 1QKZH 5D7JD 2VQ4A 4HWZB 3OB8A 3WE6B 1PZAA 5EBLA 3WIAA 1ZT1B 2KERA 3KWUA 1BXXA 2A6DA 3ZL4L 1MH5A 3U79A 3RRQA 3B34A 4JPWH 5FCSH 4G43A 2PO6C 3IJ8A 4FNPA 4WFFD 5HGAB 1MG2C 3PNWA 2WLZA 2ZOWA 1KELL 4IBZA 5IFJB 3OKDB 4I2XB 4IBSA 2XXCB 4HCRL 5FF6B 4FQLH 3M1OA 3MYJB 2PMZA 2AJVL 2FEEI 1PX4A 2NLJA 4LPTA 3FW6A 5KSBF 5C6WH 1RU9L 5JO5B 3P77B 1G9NH 4LLWA 1NMCC 5CZXD 1BF2A 1J9QA 4E9LA 4JRXA 2EO9A 2VLME 3GEWB 1FV1B 1A6TB 3RPIA 4Y5YB 3F7QA 3D0VA 1XSKA 4BH8A 1HH6B 1GW0A 1AR1D 3EGDA 4NQVA 4F9LC 4OI7A 4MQSB 4GMSL 3ILPA 1W80A 4UM8A 4BCZA 1WZ1H 2UZYA 3VXMD 3ESVF 4E9SA 2X9ZA 1JPST 5T1LA 5FXCH 3V9EA 3KDMA 1VB9A 5LBSL 3F85A 3A67H 4OCSL 5EIIB 2E47A 1R24B 1UXSA 2YSSA 5SWZD 2G75B 4LPYA 5KSBE 3JBG7 1R3IH 1IGIH 2XQBL 5DD6B 2CGRH 1NUNB 5D2LB 3D4ZA 5F7WC 5L9DH 3QORD 1KEGL 2NQ3A 2FIKA 1KJ2H 1BIHA 2HJKB 4H0GA 5HHVH 4ATWA 5I24A 2X6VA 2Y6SD 2PPCA 1RULH 4ZW8A 1U3ZA 2FTAA 1B2WL 1XVSA 1E30A 3RWIA 3ULVC 3BZ4B 5I66B 3QR2A 4PS8A 4Y5VA 1VFBB 2WIIA 3M8OH 3T6WA 4IIQA 4XBGA 5EBMA 2I7SA 5TK2A 3DXAE 1BMZA 4JPSA 1TR7A 3CN1A 1JD9A 1TQCC 4KK5D 3II1A 1B4LA 3EZ8A 1NSNL 3V7MA 3MV01 3ZQ9A 4LRNH 1O0VA 3ARBB 3SBPA 2P24B 2AERT 3E1ZA 3C5JA 4P2OD 1G4RA 2JKLA 1WHOA 3WHXA 1PZSA 2CGYA 1HSAA 2EH8H 5KTEH 4QKTA 1SQ2N 4JJ5A 2XVBA 3ZO0A 2Y25A 5TH2A 4GAYA 4XX1E 2DQUH 4MBOA 3VA6A 4AUUA 2JCCA 2WXQA 5LG1A 4XNBA 5GGRB 4XAWH 4YL9A 1F6FB 2LTQC 4JN2A 3ZY7A 5I18H 5F1IA 2OTUB 1OK0A 4DGVH 1J0JA 2CLRA 5GQBA 4L8SA 2YXWA 1E7UA 1LWHA 1UWEH 1FZKB 1N70A 2Q7YB 3MX0A 4F5CA 1E9PA 1I85C 3I9GH 4WCYH 1JTPA 1FFPA 4OBRA 1FNSL 5F3HB 4F8LA 1I75A 4G11A 3AM8A 2CHDA 3EFOA 4JVPA 2QHLA 2CDFB 4FZ8H 1X9QA 2G30A 4YPGB 3TL5A 5B3NA 1ETJA 1WCBB 2ICWB 2VZUA 4TNVK 4PUBH 1XR8B 5MENA 1DVUA 5AG9A 5E2VL 1KCRL 1E2ZA 1RHHB 5DEGB 1FC2D 1E4WH 1OEZW 4XI5C 5E2TL 3ELQA 1Y6KR 3VD4A 4W6YB 1BFTA 5I1CL 5KUKA 4J8RA 4DUXA 4U1JB 5CUSH 1MELA 1WE5A 2X0VA 4K7FB 1MFDL 2WOBA 1OP3H 2PF6A 3P0VL 2A9DA 2R9HC 4XHJC 4LLQB 5J5EA 2MQGA 2X5PA 4DO4A 5IHBA 4XPHH 4AL8H 3SPVA 1FNEB 1T4WA 3C60A 4WFGE 2CAKA 4N5EC 5KBPA 1ACXA 2L7QA 3UJJH 5L2JA 3TX4A 2DI7A 2X7LA 3D6GA 4HBQA 1WGOA 4A66A 1FA4A 1IV8A 4DTGL 2E8YA 3UAJD 3NJLA 3D25B 5C7XL 3K8KA 3TESA 5JIMA 3EHBC 1U8PA 2CSPA 5FECA 1I1YA 5C0CE 4YE4H 3WDJA 4Z7WF 4N90D 2FR4B 2PXYC 1AO7D 4MDIB 3WKYA 1FAIH 2F5BL 3BD5A 4IKJA 1U2YA 5KSAD 4AVKA 1SQMA 2E86A 5CU9A 1MDTA 2EDYA 2EXYD 2UWEB 1BV8A 2EDBA 2EIMB 4Z0XA 4WW1B 1BAFH 2NY4D 1JE6A 3NCJL 2JI3A 1RUPL 1UGNA 3FB7B 4Y1TA 1A4CA 1H3TA 4LEOB 1JPTH 2HTLC 3PGFL 2XICA 4PB0H 3WJMA 1WIUA 3SN6N 5FYKU 3VMOA 5LVEA 3DO7A 2VR3A 1UASA 3V0AC 1Q94A 3EDEA 1A7QL 3GSNH 4M7JH 2F53A 1AIFB 4Z7WE 1WFTA 2GPZA 5IIEA 4P5MB 5EU3A 4XZ4A 5F88B 1IC0A 2MNUA 3FT0A 4S0SD 5E4AA 1XGRB 3LKQA 4ENZA 4NRXB 4P23A 4O51B 4JDEA 4OQTA 4KXZI 3S34L 4G8GD 4P3CH 2I24N 4ZBJA 5HDLA 3IDJB 4ZT1A 4LSVH 4PW9A 2D2CC 3G9VA 3UOAB 3M17A 4G9DB 1W0YT 3UYPA 3KPRD 3MRRB 2HFEB 3OB0K 3RWHB 3WS6A 1YEHH 4PVNA 1XXFC 3VXSE 2NUPA 4HLJA 4LASL 4R4BB 2YPKB 2OR8A 1E6OH 3O6FC 4NQUA 4W9HC 4DEUA 1E43A 2A3TA 2G5RA 3HMWH 4JZJB 3RKPA 2ROYA 1D5XA 3NSDA 3FCSA 3MNZB 4JM4H 3JWOC 1PNCA 2WAQA 1MPAH 3CMOH 1MDAA 5EZJA 2VERA 2ED9A 3EG9B 5IW6B 5C0IA 12E8L 2HG0A 2EVIA 3EOYG 4Q9RL 2TSBA 4UTBH 3TEWA 4YBHA 2ZXBA 2OL3A 5J11C 4JO5A 3I2CH 4DH2A 4KTGA 2I9TA 2X4QB 5LNDA 5IB1B 2ZPKH 1PD1A 4PGEB 4ZTOL 3V52L 4CADA 5DHVA 4XH2B 3HN8A 4TLKA 2EABA 4L4JA 1U6AH 3M07A 4OFYA 4PH8A 2X4NB 4LVHB 4NS0A 1W0VA 2XPGB 3CFTA 2F54A 4U1NA 3MRBB 1LO3L 1A65A 1C5DA 4ZO9A 1BFOA 1QEWB 4IGBB 3RB7A 4XCEA 3WXVH 2CCVA 1FZMA 4NO0D 3VI3F 4ZMZA 1TCRB 5HPMB 1LK3L 5DRZB 4Z1PA 4JZOA 2VXUL 4F27A 1NWPA 1MSPA 3AS1A 1J9CT 5EA0L 3RWJA 1DP0A 2N7BA 4HLZH 5B4MD 1UEMA 1Z9PA 1C7TA 2IV9A 2NMSA 2A83B 5C0FA 3BRGC 3ISYA 3ZTNH 1DE4A 4TVSa 3KS0H 4K23H 4ICXA 5BS0D 3HMXA 3SD5A 4Y2DD 3UH8A 3ZHDA 1QSZA 3SKUD 2X2UA 4NO2A 4X7SH 5JUEH 5IJCC 3MBED 4BDVA 3O3BA 3FTXA 3OLEA 2OP4L 1IFHH 1IAII 4E41E 2VWEC 2YAHA 5DQDL 3QRFM 1XH2A 3FT2B 1NBYA 3VI3E 1A3LL 2NUTB 1RUAL 2E76C 4LU5H 3K71A 1M53A 4N6RA 2V2XB 5HGDB 3GJEB 3MREA 3SYQA 2VE6A 4KKCC 4LEXL 1KZQA 4NNYB 2ZWLT 4X83A 1DBKL 2OLDA 3I9PA 1NMAL 4RNRA 1MJUH 1QYGH 3L4WA 4HDIA 2CBMA 1CF8H 1K2DA 2E4FA 3EDJA 3L5IA 3NCWA 4KPHL 1D7CA 1UJ3B 3QUZC 4KC3B 3FB6A 5IHUL 3L3KB 4LESA 3NABH 3QPQD 4TUUA 4K3DH 3SOTA 4YQXH 3H3PH 3MNVA 3VGHA 4AGMA 4QTHA 4F2EA 4MJ5B 4XVTL 1A9BA 5KSUB 1T83A 5KJ4A 3CN0A 2VR9A 4XCNA 1HHJB 2UV3A 5C0BB 3MLXL 3MRHA 4CBZA 3D85A 1YPZF 4ZFQA 3ZTJG 2FO1A 5ADOH 1R6VA 3GSWA 1I7ZA 1JK8B 4PJEE 4IRZA 4WFHE 2BNUA 2JLPA 2ZYSA 4DP7X 3COOA 2X6UA 2VZSA 2VCOA 5I6MA 3JQOB 2ZJSH 1MHCA 2IOIA 5IUSA 1OK8A 4XXDB 4TLSA 1YJDH 4J3BA 2B9AA 3QZLA 5KEZA 4X9HA 5JHDD 2XN1A 4IS6A 2FO8A 5ENWA 4XNMB 4I77H 2I9LA 5IMKB 5ITBL 4JFYB 1Q0YL 1MXGA 4P2RB 5D72H 1KGWA 3KL5A 3ZKMC 5AVZB 2VO8A 3S36L 1DCLA 4HWBL 3RVXC 3CU7A 4D0DA 4BHUA 4MZ2A 5D7HA 1EO5A 3CXDH 3QJZA 3QHZL 2VDOB 2Y7QA 5GIRA 3HNSH 2K3HA 3QG7L 4TV3A 2KH2B 2ZP0T 2W81C 4X6BA 3RDTB 2RH0A 4N2BA 5G5DA 1MWAH 4PJDB 3RWCA 1UATA 5JXED 2EECA 1BBDL 4P9HL 2EVHA 1PGRB 4QWWD 1A47A 1QOKA 4AYBA 1UOLA 4D0CB 3KBEA 2EXWD 2VN6A 4ADGA 1FL5B 3OLGA 1ORSA 4MS6A 3RURA 4FXLA 1NCGA 3DSFH 4GXUN 3BPNB 2LE9A 5C0JB 1WS7A 1AG6A 3MA9L 1KBGH 3RNKB 1RZKC 2A77L 1WZKA 4I2XE 3QT2A 5EO0B 4AJ0A 3V6ZA 1KBBA 4ONGL 4GSXA 4A2GA 3UPRA 4Q9QH 3LXUX 1LO4L 1NPJA 5D2LF 4HIEB 5HHMB 4JGNA 3QUMA 2BDNH 2ISDA 3ATEA 1A25A 2VUKA 3T0BA 1AXIB 2BW4A 2UYLB 2ZF8A 3MV9B 3DOHA 1FFOA 4P23C 2VQ1B 2M8XA 4WF7A 3FDWA 1MIMH 4RFEA 2B1HH 3DHUA 1Z9LA 1J1OL 1YUHB 5DJ6A 1MLCA 5IK3A 1IUZA 3P69A 4W6WB 2C3VA 5J8OA 1GMEA 2MOGA 2ZZUT 4F15C 3WTWA 4XAKE 4PB9L 4UDUA 2BC4A 2Z35B 3ARFB 4AQEA 1JGIA 4DESA 1TVBA 5BV7L 2R0ZL 3AQXA 4BFKA 5D2LE 1QO3A 3D2TA 1EX0A 5EC2A 1FRGH 3HNTL 3BLBA 1CURA 1S7TB 3OMIB 1TTAA 3SOBL 1BZOA 3U7YL 4IJTA 1NCIA 3PUUA 1P4IH 5SWZA 2UZIH 3VO0A 2X89D 4HXAH 4M93C 2P3YA 3BAIA 3SODB 1XCQA 3QORA 1A5FL 1SEQL 3Q2LA 4QYAA 1M1XA 3EBAA 4IRJD 4KTEL 2YEZB 4O58L 1DLHB 1ZHLB 3PRZA 3QXVA 3VW3H 4JJHA 1KEML 3LS5L 5E1GA 4KRPD 2G5BA 3N04A 4MD0A 5DJXA 4Z18A 3UTOA 1E4HA 1MZZA 5JIKA 5CD3A 3DRTB 1TYJA 3LIZA 3IJEA 3DJSA 4ENEC 1IBFA 3BQVA 3CFCH 1UCBL 3PYCA 5C6TH 1JZIA 3S6CA 1ML0A 3JUZA 4XXCA 1WS8A 2ZAGA 2C9UA 1S7SB 1ZANL 15C8L 1T80A 4P2OA 3GXUB 4P8QA 3OKKA 3TPUA 3ML9A 3V4VB 3CVIL 3TTYA 1YMHB 2NOYA 1WBXA 2EE9A 1J5IA 2ERJB 2OR9H 3FO9A 4H13C 4JNXA 4P46B 3VCLB 2F1BA 2AQRA 3ET9F 3HCVA 2L7UA 4AYMC 2QV2A 3IFOA 2VGLM 2GHWB 4OT1L 1I1CA 3VFPB 2VR7A 4BQCA 5FR3A 1OAKL 1RCYA 1NANI 1W9XA 2ZKHL 3K91A 3RI5K 1E27A 1YAZA 4JPKH 4OB5L 1D7DA 2CO2A 4D0BA 4ELKB 5K5YA 5I75B 3DECA 3RPKA 2QLVB 1NGWA 4MXQC 2I7OA 5LWYH 2XTJE 3SJVB 2VXQH 1OALA 3ZR6A 5ESVA 3MUJA 4FL4C 5T1DH 5I8OL 4H8QA 1OCZB 1ZIAA 4P57B 4PG9A 5CJ8A 3HBZA 1GA2A 2YZ1A 4EAEA 2PYEA 3QEHA 4RGMB 3T4AC 3W2DH 1Y0LB 4QNPF 1Z5LA 2P5WD 2FX7H 2PCFB 4N0YH 2PNDA 4MB3A 4EN3C 2UWEF 4OJCA 4YDVB 2Y5EA 3FQTA 1NGYB 4GI6A 3ULVH 1UM4L 3QULA 5JOFA 4I3SL 4G8EA 5CLZA 5J06A 5AVRB 1T83C 3IFPB 3L17A 5DJAB 2P28B 4D3CH 2DQHH 3FN3A 1AMYA 1J5DA 4FZEH 3S2CA 1CIUA 4MJ2A 5LXGH 4Q6IC 2F1AA 4DZBA 5CR8A 1GSMA 3HC4H 5T5FL 1N0XH 2X4TB 4K7PL 4MQXD 1SUJA 2BRRL 3NUKA 5IBUB 3B5HA 1OOAA 1TJGH 5FFOA 4FNLH 2YAMA 3UAJA 1S7RB 1TETL 1U8JA 1E67A 2JCWA 2IO5A 2UWEE 4FI7A 2N0MA 1HYSD 3N40P 1F4AA 3GSOA 3QDJA 4G6AC 4WO4B 3NIDB 4E9WA 4URKA 4PJ7A 4LCIL 2AXFB 2DWEA 4G5ZH 4WW2A 5CEZH 5HYQB 4ZTPH 5F89B 6PCYA 1MNUH 2PPDA 2FWOA 2LVEA 3S37X 2QBWA 1KJ2A 1SVBA 1ZS8A 4XVUC 1XB3A 2BK8A 1BHGA 5C0RL 3MLUH 2BVQB 2ZICA 3CHSA 4U1HA 2A9CA 5KS9A 3ZKQD 5FC9A 1HKFA 5JYMA 3I75A 4LARL 3D30A 5JYLA 3DUUB 2CK0H 1XFPA 3EJCA 3SYPA 3O2DH 2UZXA 1JVKA 4WEBH 4KK8C 2EKSA 5EU4B 1YEEH 5IHHA 4M62L 1MHEB 2FH6A 3NRFA 1B0IA 4OY9A 4XMKL 1DBML 4WI3A 1GGIL 3S0PA 3KJ6L 2BRQA 3QIWB 1MN4A 1MCSA 3LVEA 1AVAA 4HMEA 1V3KA 2NW3B 1A8ZA 2EIDA 2BXYA 5E23A 3MR9A 3ARED 4AIZB 2VR8A 5LLIC 2CH8A 3KM1A 1JXDA 5FA4B 1IC1A 2O72A 4KJQC 4PY8I 3OMAB 4PLKC 4G8GA 2JB6B 2XIIA 5DS2A 2WCSA 4J3XA 1JP5A 1L0YA 1CLZL 4F2MB 2ATAA 5J12B 3BP4A 2K78A 1WWBX 2P8MA 1A7PH 2Y1YA 3C9NB 4L3EB 1A6UL 2G4EA 2J8UF 2R69A 4WNJA 3GMOA 1AXSA 1OT4A 5T1KA 2HX8A 4JQIL 3UAEA 5EN2B 3RKDD 3U9WA 2DICA 2AEWA 4P59H 3WEXB 4UV4H 4NZJA 3C5ZD 3IRPX 3RZWA 4XVSH 3DV6A 5BUPA 2IIJA 1MVYA 1K3IA 4B96A 3F58L 3K6IA 1XIWD 3UJTH 2JKTM 1KN4L 1OSPH 5I6NA 3LSOA 1OQXA 3K2KA 3RGVC 4B5ZA 3A3YB 1GL4B 4JGUA 3NZ8B 4IJ3B 2O5ZH 3PDOA 3K8LA 4CN4A 2JFCA 2DY2A 5JPNC 4JX0A 1NWOA 3V6OA 3CUPA 4PPTA 4KMLB 4YFLI 4JMXA 1ZA3B 3FO2B 5IFAH 3VFOB 5I6LA 1PMYA 1D5RA 3D0LA 4XVOA 5D7IA 4OD2B 1A6WL 5C9KA 2DYRB 4S11A 4U1MA 1BQLL 1SPDA 3QFJE 4APXA 4WUKH 3LMJH 5DQJA 4ZMQA 2H3NA 4PWEA 2CE6A 1TYEB 4NO0A 1UOVA 2WVVB 4QYOA 4O5LL 4Y8DC 3FN9A 4PRAA 3UBFA 4UQCA 5GJSL 3MODL 4ZMNA 1KC5H 5TE6H 1NBCA 2CO1A 2VDLB 5GSRA 3L9EA 4IK6A 1KTLB 3RUGB 1JZJA 3H56A 4GIOA 4KUCF 5CEZD 3MRIA 1P0SE 4XXCC 5BS0A 1J8RA 4W9GC 4Y2DA 2V6HA 4BFEA 1GGCH 3ECUA 2ATPA 2ZCLH 3TLRA 1VFOA 3T65B 2AHIA 4EE2A 2XJLA 2ESVE 2R56L 3HZYA 2JQAA 3Q2WA 4RAUA 2Z92B 4PV1C 3WENA 3GMRA 5E0QA 4HIIB 1PLCA 4DCQA 1EHLL 4WU5B 5KBLA 1R4XA 3UDWC 4E0RA 3GKZA 3U48A 2V37A 4LCWD 1ORQA 1U91B 4DP2X 1QRNA 2A74A 4TSBL 2QKIA 2XXFA 1GOFA 4UM9B 3MV7A 1Q4NX 4PCTA 3F7PC 5ICUA 3TJEH 2GAZA 2XIBA 3MA7B 1SN0A 2ZCKH 3L1FA 5E9NA 5C0BE 1JWMA 3B6SA 2VKXA 5EBLB 3OGCB 5FW8A 4NM8L 1YDPA 4TVPE 4N68A 3W11D 4ZPVA 4KNQA 1MH5B 4L05A 4LSDA 4F7KA 5IM7A 2MFNA 3CK0H 3MXVH 1NC4D 4FCHA 1A7OL 2FBJL 5IW3A 2R9HD 3FCTA 1MCFA 3I6SA 4XHJD 1W2KT 3EOBB 1I3RA 4L0YA 4TOYH 2GHZA 4PJDF 3CFQA 2FUTA 1A14H 2CLVA 3OGOE 1TFPA 2NLJB 4YDIL 5DJCA 2EINB 2W0FA 3C6LD 3WIIH 4Y16D 1D5ZA 2BNQD 2R23A 4LLWB 5JHBA 4XPFH 2O6FA 3GQFA 4PJCB 4G7RB 1F02I 2QQKH 3WAJA 5JHLA 4JRXB 4QRPB 3PWPD 3VSUA 3KGTA 2F7OA 3D0VB 5DRNA 2XWXA 3TO4C 4JO4L 4BH8B 3EGDB 1H15B 3EJRA 3K2UL 5JDSB 5JHDA 3IXAA 1QBLH 3INUH 3ILPB 5PCYA 1DQML