3GTVA

Human-mouse sod1 chimera
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mouse SOD1 and human/mouse SOD1 chimeras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 38
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gtvA00
1B4LA 1OALA 2Q2LA 2VR7A 5KBMA 3ECVA 2VR8A 2APSA 1E9PB 2Z7YA 2WZ0A 1IB5A 4FF9A 3ECUA 2JCWA 3HFFA 1SXNA 2GBUA 1SXAA 1XTLA 3KBEA 2ZKYA 2K4WA 3CQQA 1OEZW 1EQWA 2AQPA 3KBFA 3MKGA 4L05A 4BCZA 2GBTA 1SPDA 2AQSA 2WWOA 1SXSA 1YAIA 1PZSA 1AZVA 3T5WA 4A7GA 1IBDA 1XSOA 1IBBA 2R27A 1QUPA 1HL5A 1P1VA 1MFMA 1SDAB 1YAZA 1XTMA 2V0AA 3SODB 2JLPA 4OJAA 1UXLA 3GZQA 4OH2A 1CB4A 1PTZA 2Z7ZA 1SDYA 1N18A 2LU5A 4MCMA 4U4IA 2WWNA 3GZPA 2VR6A 4MCNA 4A7SA 4B3EA 3F7LA 1BA9A 3KH4A 1F1GA 3PU7A 2ZKXA 1KMGA 2WKOF 2AQRA 1DSWA 1E9OA 1N19A 3KH3A 4BD4A 1EJ8A 1ESOA 1OZUA 1SXBA 2E47A 2Z7WA 3CE1A 3F7KA 1RK7A 4A7QA 1U3NA 2AF2A 1L3NA 1S4IA 1Z9NA 3QQDA 1Z9PA 1JK9A 2XJLA 3RE0A 1B4TA 1JCVA 3CQPA 2C9UA 1IBFA 3GTVA 3H2QA 2E46A 1OAJA 2WYZA 2AEOA 1E9QB 3QQDB 2WZ6A 3L9YA 1IBHA 1YSOA 1JK9B 3K91A 1E9OB 2SODB 1HL4A 1SXCA 2XJKA 1SOSA 2AQQA 1E9QA 3S0PA 3H2PA 2ZKWA 1F18A 2WYTA 3GQFA 3KM1A 3GZOA 4A7TA 1F1DA 1TO5A 2WKOA 5KBLA 1F1AA 1BZOA 2ZOWA 1Q0EA 1UXMA 4A7GF 1CBJA 4A7VA 1COBA 2Z7UA 1TO4A 1OZTG 1DO5A 2C9SA 4A7UA 3ECWA 4BCYA 2AQNA 2C9VA 3L9EA 3KM2A 5CU9A 4N3TA 3GTTA 3HW7A 1SRDA 2AQTA 2NNXA 1FUNA 2WZ5A 4N3UA 1PU0A 3LTVA 5KBKA 3HOGA 1E9PA 1SXZA 2GBVA 3MNDA
chains in the Genus database with same CATH superfamily
1YC8A 1PAZA 3WCYA 4AT6B 3BPNB 1AQMA 4QPEA 4PV8B 4KQ3L 4IDLA 4W4OC 3VG0L 3BWSA 3BRDA 1SXNA 4Y88A 2QKIB 5F3FA 4D7PA 1PLBA 5FA3A 1YVLA 1IC0A 4ZSOA 1P2CA 2JKTM 2YQ2A 4IMKC 1NPJA 1A2YA 1JZJA 1QQDB 2YXVA 2J20A 4FQQB 4BSWA 1GCYA 1CU4H 1M7UA 3WUZA 4F33B 4ZI8A 1YEDB 3TWCL 5BV7C 3T77A 1T66D 3CDFA 1A3LH 1OCCB 2CUHA 5HPMA 5AVSB 1N8ZA 4RBPK 1IC5H 2YIHA 3L7EB 3RILA 2X2YA 1UT2A 3IK2A 3D51A 1IV8A 2BC4B 2W65B 4RMUA 3QO0A 3QXWA 4DW2L 2JJVA 5KYUB 4HYTB 3FT4A 4ZMTA 3M45A 4NWUH 4TUJA 2N1KA 4YQXL 1P7KA 4AGNA 3FS9A 4DTGH 1LXMA 3H42L 4B96A 1JWUB 4JFYB 2X4NB 1TZGL 3OWEA 3FFCD 3S7GA 3Q6FA 1E9OA 5TQ2H 5ES4B 2BWDA 4BD4A 2YC1A 4RGNE 3EGXB 3HE6B 2ITDB 2P8PB 2WC7A 5IWLA 4MA8L 1WFIA 3QPQD 3LB6C 5AB9A 3LPOA 1WP6A 4FMKA 2ATKB 1JK9A 4Y4FD 3BEVB 3I2CL 3VACA 5IQOA 4HVBA 3CDGA 1S7UB 1XF3A 2ZUQC 2IDCA 3L1GA 3VFUA 3RWJB 4DZ8B 1T0NB 1C16A 4DK6A 2DTML 4GOSA 1P4LB 4GO9A 4K9JA 4TN9A 2XN9D 3GI9L 2BNQE 4WNQB 1YPZB 4ZOEA 1L5GA 2A6JA 5EUOE 3VXUD 3FZUC 1T2QL 2P5WD 3I6SA 1CK0L 1ZOXA 5F1OB 4L1SA 1ODAA 2ICEB 1AHMA 4BZYA 3WIHA 2IBZY 4QHLB 5A1AA 4KKCD 1OK0A 1E42A 1YNKL 1PS3A 1U8NB 4NCC1 5IM7A 4UINH 1LVEA 3X14B 3FSVA 3RTQD 4L3CB 2P9RA 5LBVA 4N2EA 5KVGL 4U1MA 5JO5B 1P7BA 1JRHL 4MZ2A 1SXZA 1ZXQA 3MRFA 1SF5A 1X5YA 2VJ0A 3HS8A 3NK3A 2J57A 1QABA 5EU7C 3M1CA 4UTAL 2VDKH 1IEBB 3PGFH 4KZ0A 2RH0A 3HLAA 1FZMB 1MHHA 5CJOL 5TJWK 2MCPH 1YC7A 2WXQA 4HJSA 3DV4A 3U4EA 3FONA 3L5WA 3MJ6A 2AQPA 1HXMB 3CG8A 1LO5B 1Y0LA 3QJXA 5CCKL 1NEUA 2VITA 2WKLA 4DUVA 3BZEB 2OYKA 2GT9B 1FO0L 4JG0H 1A6TB 5LNDA 5EU3A 3ZPDA 1LWJA 5LN4A 4ALAC 1MCSA 4AZ8B 4FA8A 2WSPA 1F2QA 4G7VL 5TGBA 3QPXL 3RAJH 4PGBB 1EMTH 1RJYB 3V9CA 3CK0L 1Z1WA 1M7DB 3JWNE 4JG5A 1QBBA 3B7SA 4DP1X 3D0LB 5E8NA 1AXSA 2VDQH 1EHAA 4H25A 2CA3A 5BRPA 2H1PL 4H13C 4RMQA 4GMTH 4L37A 4BZ1A 3GIVB 1B0WA 3F58H 2AQ2A 4AVHA 2H3KA 3KH4A 1FDLH 4E68A 3FRPA 4RDBA 2P80A 4MMXA 3P54A 4BE6A 1BA9A 4DQOH 5TF1H 2B8OT 2RD0A 4N0YL 5HHVL 1IAMA 4WFED 4Y4HC 5TPWL 3I3EA 5GGQL 6FABH 4WW2B 1A7OH 1DBAL 4AEIL 3N43F 3FO1A 1X5GA 2G60L 4QRTB 5JW4Q 4UU9B 1WIPA 4IEFB 4ZW5A 3QEQD 1AJ7H 3V55A 2F18A 5GSRB 4FMFA 4POYA 3SDXA 3MREB 3DVIA 1FHNA 1DR9A 2NY6B 3CZUB 1IBHA 2D7MA 4OFDA 2DQJH 4PN6A 4OV5B 4WFFE 5LXGH 4R4ND 3U7WH 3MNVB 1J7VR 3KLHC 4Y9BA 3RIFF 2GFBB 1IC7H 3NJKA 3UMNA 1WISA 1WIOA 4JVUA 3B2UC 2AJ3A 2IAMD 5FKAA 2W9DL 3TN0A 3LQAC 1PLGH 4P48A 2JCCA 2X70A 1USQA 3VA2C 3OD3A 5EIIA 1HKLH 2VKXA 1MDAA 4WENB 1HOCA 3DSFL 4NP9A 4UQ2B 3JQOB 3VXNA 4HXBH 1CYGA 2B1OA 1A5FH 4PSPA 3ZE0F 4HD5A 3GDCA 3M88A 4M5YL 1J5DA 1WD8A 4NQED 2B2XH 1INQB 4I2XE 5BZWA 1CMOA 4K9EH 4ZMOA 5CNHA 3GMRA 3ZGHA 4Q52A 3BISA 3MJ9A 3HB3D 3JWDC 1D5MA 1I1AB 4JJHA 3S3CB 5CJ5A 4MB1A 5LGJA 2GC7C 4TRPH 4OQTL 4OQTA 3UO1L 4RAUB 1HTYA 4X8CA 4YSRA 4LSQH 1UKTA 3IS1X 4BELD 1PMYA 2LR4A 4MNQA 2GBUA 2PP8A 3ZTCC 2V37A 1U33A 5CFHA 3TEYA 4QYOA 3GJFK 2J1ZA 4WSJA 4BXSV 4QLWA 3GSQB 3BKCL 2OMXB 5KEZA 3E80A 2C1OA 1PQZA 5FYJD 3TN0C 3ZE1B 1JNHA 4PR5A 1QRNA 2HT3D 2JH2A 5ICZA 4JNXA 2XQYK 5FYKD 3PXLA 1PLAA 1FC2D 4TQEH 2DB8A 5K1NA 4GS7C 2YARA 1ERNA 1FORL 2VDML 3QQXA 3Q13A 5HVFB 4N0UA 4QKTA 3T4AC 4I2XB 2CIIA 2VC2B 5DU7A 1J8HE 2NMSA 4PI0A 1E4WH 4HT1L 4XHJD 3WNIA 4ZX3A 2NZ9C 1J8RA 1ZSDB 1ZPUA 2W80C 3PIQA 2Q6WA 4QIRA 5EG6C 4DKFL 2XKUA 2GSGA 5ID0B 3GF8A 3FHEA 3HBPA 1J0IA 1KCVH 3SOBH 2HN7A 4MDRA 4ZO7A 4PJGF 4NNYA 3IPEA 4JJ5A 2VO5A 2F7RA 2BXZA 4NO2B 4Y4KD 1PDKB 3PXHA 2XTJE 3CCHA 3FQTA 2EIJB 1FA4A 4OZIB 2CBOA 4V1DB 1CICA 1U8QA 2N0MA 2IFFH 5KOMC 3LS5H 5FUCE 3DO7A 2CDFB 5B39A 1MELA 1RK1B 2YQBA 3L3HA 3ZR6A 3EDJA 4G3YL 2YFNA 4GB9A 5TPWH 2N56A 4L9LC 2A1WH 4X5XB 5EFIA 3ATFA 2VXSH 1D9KA 1MJ7L 3T0WA 2HJLA 2WBJD 1HEHC 3DC0A 4JRYD 5TDOA 4NQSB 4D9LL 1QNZH 1WC7A 3F84A 1AD0A 4LPWA 3VX0A 5KBLA 2APBA 1CBJA 1RUMH 5C07E 5J1TC 2ESVE 3ZDZB 4Z3TA 2XPYA 1EJ6A 3VXPA 2VLRB 5KG9B 2NTSP 1KJVB 1RVFL 2C5DC 4LLWB 5IEHB 2HYMA 2XQBL 2ZPKH 4NWTL 5HI5C 1CYXA 4XNMB 4B9JA 4QRUA 2ZOKB 3HNTH 2NNXA 2MOGA 5ECGA 1FUNA 5E5LA 5LB1A 1K8IA 2PTTB 1LDSA 3KLQA 5TDPA 1EXGA 3L4ZA 4HPYL 1PKQA 3KLAB 5DMJB 3BPCA 3KPSB 5EZLB 2X88A 2C7UB 4ZW7A 1JZEA 3TZVB 1JHTA 5C2BL 5CEZH 5F1IB 4M4PA 1SMDA 3PJLA 4LVHC 3RTQB 3TONA 3GHPA 3V0VA 1WQVT 3W37A 4OZHB 4I0CC 4QRRD 4Z8FL 4TL5A 4J2XA 5FECB 3QUXD 1Z32X 2WQUA 4GW4B 5LQBH 1R5IB 4XMTA 3K1KC 4YC2B 2GTWA 3QWRA 5GS0H 4XN4A 1XSOA 4U1KA 1IBBA 3CLEL 3TO2A 3L4CA 3IMVA 4Y1TA 4WSKA 5EOQH 3VXUB 3O11A 3HKZA 3IKKA 3UYRH 3BVDB 2CK2A 4HMCA 2WXRA 4G1EA 4IMLB 1FPTL 3G5WA 1KCSH 4XRCB 3GXIA 5DJDA 4M9PA 3RIAF 3KWWA 1K85A 2X4QA 5CKGA 15C8H 4OH2A 1MCPL 4MAYD 3LAFA 3OR6B 1YJDH 3NA9H 1DEEB 1ITCA 4Y5XA 2HTLD 4NO0A 2A6IB 3SSGA 2VZOA 5L2KB 4JJOA 1ZHNB 4JB9L 5EO1A 2NT0A 3KPSE 4OZGE 3BQUC 3TIEB 4B7LA 5DR5H 4RGOH 5HDBF 4WW2C 2X12A 4GP4B 4PJ5B 3PWNB 3V4PB 3THMH 3ARPA 2WLNA 4KDVA 2TSBA 5FUOH 5GZND 2WAQA 2VMCA 4HIQA 4WWNA 2J8UF 4FQXA 4ZUUB 3OC5A 2VXTH 1A6ZA 1FVEA 4LSPH 1L3NA 1JZ6A 4HU2A 1FGVH 3MV8A 5DJCB 2QSVA 3LDBB 2XPGB 4R97C 1TR7A 4LPYA 1W72B 5C0BA 3EH3B 4J3VA 3M46A 5J1SC 4Y9CA 5L4MA 2MNWA 1VLXA 4HZAA 1G1YA 3PABA 2I9LA 3BD5A 1GZPB 3BQUD 1KB5A 3K0WA 1HT6A 3N91A 3PQYB 4FQHA 5F96H 3WIFA 1UWXH 2XZQH 2IFFL 1JF1A 3TO4C 5DUPL 4QO1B 4J1UB 1B9ZA 1C12B 4BKLB 3CHSA 2X4PB 3REWA 1DE4B 4QTIL 4S0TD 4L0YA 5DUMH 4PS4L 3R1GH 1H6UA 2KC0A 2C9SA 5JPMC 5GRXG 2I7OA 1C5BL 4XBPB 1TPXC 3AVEA 4RAVB 3D3VD 4WI0B 5CU9A 3WLWD 2A0LC 3KJ4C 5T3XL 3SE6A 5FM4A 2W0PA 1NGWB 5C0CE 3MACL 5DYOB 4YMPA 5E24E 1FFOB 2VUYA 1Y18B 2ZX7A 4HIXH 3A6CH 3DO3A 1ICTA 1QFUL 4ZFGL 4OLWH 3PCYA 2QPUA 4EN3A 2R2EB 3DARA 4NHUA 4NQXB 1RP8A 4MS8D 2AJYL 2NW2A 3RUGF 1O6SB 1FH2A 3BGFB 1HL8A 3VXRD 3OAZH 3JUZA 4XNUL 3PWPE 2L3BA 3QI9D 1QI4A 1UADC 2VZVA 2FB4L 1WPCA 3F64A 4GQZA 4R0LA 2X40A 2JKJA 1MH5A 1TTGA 2TRHA 2ZP9A 4DKAA 4PRIA 4HCFA 1AS7A 1BZ7A 2XIIA 5LG1A 3O4OC 2BVEA 1Q72H 5D7SL 2AJXH 1UACL 4AQZA 3RPBA 4G8AC 5AAWA 3EYOA 3BLBA 25C8H 1DQLL 4UT9A 4JKLA 4MD5A 3SQBB 4NKMA 5HJGA 2BOLA 1PTZA 2A9AA 3VXOA 5L2KE 1MHCB 1SUHA 2F54D 2ZG1A 3QR0A 5DHYB 4ONOA 4NT6A 4N1CA 4L48A 2QMKA 4WO0A 3DHMA 3AG2B 1D6VH 5D1XB 4ZPTA 3C6SB 4FYQA 2JKXA 2L7EA 4KFMA 3EO0A 2DWYA 4M7KH 5FUZH 1T5WA 1N3NB 2F8IA 4EXPX 3IE4A 3MRDA 3HMWH 2ESVA 5C9KA 2ZD0A 1QPPA 5E08H 1WFTA 1KBGL 1QTSA 2D9QB 3NOIA 4ZUTA 1XGQB 2BVOA 4FJYA 2ZSWA 4DGUA 4XNYH 3KPPB 3VWJB 2NY7H 3L4UA 3KYAA 3HHRB 5HHMD 2A83B 2VLKD 1LP9E 3PP3K 2VL4A 3FU5A 3Q5TA 4QXTB 4CVXA 3IDYB 5IOPB 2D3VA 3MROB 3KCWA 3L3KB 1UB6A 1KB3A 4LSUL 4E41E 2FEJA 5I5IA 4N8CH 3V4PL 1S7RA 5AAMC 4L9LB 3SDCD 5I8OL 1MZZA 1YO4A 4D3CL 1J5HA 1KEGH 1KLGA 1N64H 2QT6A 4QOKD 3LHPL 4QRSB 2WZPD 1YG9A 4N8PA 1S3KH 4UQDA 5IBLC 5KZCD 1DL7L 4JK0D 2IMMA 3SBWA 1QSFB 5IZ7A 3MGTB 2B15A 4HFWA 3KMDA 2YAPA 1CLZL 4ZQKA 1ZAGA 3GYRA 3ARBA 1M71B 1BLIA 3BD3A 3KYOA 4HK3J 5EBLA 4Z77A 4OCNC 2CGZA 3HW7A 5C09E 2Y5TA 5GJSH 1PSKH 3OVUB 1JTTA 2QR0B 1KIQB 4MJ5A 2CR0A 5KSBA 2JCCF 4Q9QH 2OZNA 5D1XC 1FVDB 4JZJB 4F93B 1XL4A 1I4FA 4P3CH 5TD4A 2MOQA 1DVSA 2BSRB 2FX7L 2KZ1B 4OF3A 2Y7QA 1RLWA 2W0LA 4FXTA 4AV4A 2GK0B 1P1ZB 2H32H 2R1WB 3E6FB 5ABAA 5K59F 4GP8B 1LE9A 2ID5A 4FNSA 4FTVD 1QFWM 2BVPA 5CAYB 4XT1C 3P77B 1DBML 1TYRA 2XTLA 4ODWB 4RZKA 3U9PH 1LEIA 1NCNA 3ZJAA 3TA3A 2ZCKL 1HWHB 4DGIL 3KL3A 1F4XH 1IBDA 2VLME 1GH7A 4JO3H 4M43H 2R0LL 1YEKL 3MV8E 5CMAA 5BRZE 5BO0D 1MFMA 4UAOB 4NUGL 3TTSA 3CZFB 3BZ4A 4YXKL 3QB7C 3SBWC 4GH7B 3WTXA 3PGCA 1G7HA 2A74C 5LCVA 3ZE1F 4J8QA 4M7ZC 1JI2A 3HMXA 4NJ9H 1L9RA 3L1OH 3K6FA 3B2XA 1M7XA 3MYJB 1CGVA 4PIBA 3EFDL 5BZXA 4L23A 3H2WA 3AM8C 5F7MC 3D3VA 1DQLH 4NUMA 3QUXC 2EYRB 1RU9H 2WVVB 3A4AA 4AV0A 3A3YB 4KTYA 3C6EA 3QNZA 1JXGA 1I9EA 4YUEL 2JELL 2CH8A 3B2VH 3U2SA 5IJVA 1ET8A 1BF5A 4LGPB 2NXYD 4DGWC 5EN2A 2GCYA 1A66A 3RPKA 3MLXL 2BSSB 3G6JA 4NP4L 5GS1C 5CINH 3WNLA 3WELA 1UUNA 2VMDA 5T1DL 2X2IA 4G7YH 5L6YL 5EUKA 4W9FC 5HYJA 5AW0B 3FTVA 4XMXA 4BYHA 1HINL 1F18A 1S7XA 3HRZA 1F6AB 1J5CA 4LP4A 1W8OA 4PJDF 3GUFA 3N44B 3BP4A 3DXAB 5C0EB 3M7OA 4R5XA 2OJZL 3CGTA 2H9GB 3QNYA 3L8QA 3QPQC 3S3JA 3QG7H 4BQ9A 3CN2A 4K71B 1UWEH 4NNPL 3S37H 3ZL4H 2NZ1A 2X87A 3EJUA 5GSVA 4U1SA 3NH7L 1FLRH 3P11H 1XT5A 1I8MB 4PW3A 2UXTA 4RZCB 3VWKC 4JPWH 5IHHA 2C34A 2VH5L 4ZTPH 1FRGL 2I9TA 2FVNA 4JKMA 3VRIA 4ZAKD 4FXLA 4U6VL 3ULUE 3WYRA 5KSAA 2OL3L 4K23H 4M5ZH 4WHDA 1GTFA 4NM4L 3HFML 1L6XA 2EDNA 2OMWA 2YGPA 1SBSH 3X1EA 2BY1A 3QZPA 2A74A 3QZWG 1WA0X 3VI4A 3MLTB 3ECVA 3GEWB 4NZJA 5F7WC 1BM7A 2KLTA 2XYCA 3QI9C 1QBMH 1IZKA 3CX2A 4W9ZA 3FT0A 1DQQB 3I6KB 3GLAA 5IVOA 5FF6B 1W6LA 4B6ZA 4M1DL 4D0CA 3IU4H 2PW1B 1KNOB 3DMMD 1MCOH 3EFFA 4R7VA 4MD4A 4O58H 5DQJB 3AREC 1HILA 4H8QA 4HGKC 1U92B 3EYUL 5DD0L 3P02A 1AGEB 2AJZB 4KKPA 4OZIF 5FV1L 1UM5L 3CVHA 2YFOA 4R7XA 3OB8A 1YNTA 4JDEB 1HCFX 1JOIA 3GXNA 1Z5LA 2P5ED 2NY5L 5AQ0A 5CZVH 4BFBD 3SJVD 2HPOA 1FCCA 5DO8A 3VVWA 1F4XL 2Z7ZA 5IW6B 4GSRA 5B4MD 2MFNA 1A1NB 5HYFA 3J8F7 3C08L 2ISDA 4NIYE 3EO9L 3VI3E 1G4RA 5D1QA 4F8NA 4UNVA 3BAEL 4L2YA 4XCEA 5EO0A 1ZV5A 5AVUB 3QDME 2BPBA 3AB0B 4DK5A 3Q8FA 3FF8A 3V4LA 4YHPA 3GMLB 4NFDA 3QJFB 4AQ8C 1OP4A 3TFKC 1T2QH 2BVTA 3FAXA 3KPTA 4LLQB 4PTUA 3TCLA 2G75B 1XR9B 4GAJH 2GTQA 3QQDA 2CALA 1FV1B 1IC1A 2MNUA 2DY2A 4R5TA 5KYWB 1E27A 1MCBA 2BOCA 1CT8B 4ANKA 3F7PC 2DQIL 4LCWB 1ADQA 1FBIL 1S9XB 2GJ6D 3HHSB 4HHAB 5BS0E 4LSSL 1MHEB 4O51A 2C1PA 2CG9X 3U48A 3DOHA 3SPCA 3N0AA 2QKIC 4GAYA 3HMXL 1RUPH 5GS0D 1BFOB 2VXQL 3QWOA 2WKOA 3SQOH 4X98A 1FSKB 4MMYB 3CC1A 2Z91A 1ZEAL 4ZTOL 4H26A 4AUUA 3VI3B 3L3JA 5ICYA 3EBHA 4QRFA 4JO5A 1HYSC 3FCTA 3KDMB 1IJNA 1VKXB 1L6ZA 1EZUA 1XDTT 1RI8A 3OJVC 3A0OA 1LNUB 3UCQA 5B38G 1GAFL 1NOAA 1NKRA 2BRRH 3BUYB 3LZFL 3MLSH 4BFFA 4D0DA 4NRYB 5CCKH 4KKAC 4IMKA 2OJZH 4LDCA 2W81C 1I9JL 1U93B 3CSFA 5F9JA 4BEIA 3UJIL 2X89A 4FABH 4QD2E 4OLYH 2FEDC 3CMGA 4BWUA 2AXFB 3L3IA 4JDVB 1GYUA 4LSPL 4PMEA 3NH7H 1U36A 3P11L 4LEXL 1FVCA 4LHUG 3DJZA 2ZAHA 5HHPA 1UXSA 3M86A 4XPFH 4IDJH 2W5PA 3CN4A 1N59A 2LTQB 4NPJA 4UQEA 1I3RA 4P2RA 2Y5EA 3HFFA 2O5XL 4BFIB 2R0WH 1R34A 4BUGA 4MSWB 5SV4A 5DRNA 2NX5D 4UV4L 4NO5A 5E4AA 2F74B 4GMTL 4ELMF 1SBSL 3FU7B 4K5LA 5FO8B 2WSKA 5I6OA 4N1HB 1HCVA 1MDTA 2J43A 2FQFA 1CXKA 5C3IA 1QLFB 2C26A 5JMOC 1JGLL 2OL3B 2H0EA 4LEBA 2A9NL 1PJ9A 4PHZA 2YEQA 3GZQA 5FYJU 4EZLA 1VADA 2G4EA 2QBWA 5FCSH 2KKQA 4GRWF 1CJYA 4GKSB 1TZHB 2V9RA 3KVQA 3FT3A 5HI3D 4ALAH 3R06A 5BMFH 4JE0A 3N5AA 4BRJA 2CO6A 3G9VA 1IM3D 1X9RA 1XSJA 3GSRB 2K70A 3E8UH 2H26B 4FG4A 3VB8A 1MWAH 4J39A 2IBBA 1N19A 3DWTA 1FAIH 4Z7UE 5MI0B 4AQOA 4Q9BA 4F7MB 3OSVA 2OXHB 3O6FC 2CSPA 5IREA 4UOZA 1AHWB 1R47A 1KXQA 2O6CA 3OAYK 5ENWA 1YY8B 4DP4X 4V1DE 3LKQA 4NPYA 4ZZFA 1MFEH 3K91A 3N40F 4JG0L 4NN7B 1A4KB 4RDQG 3O2VH 1IGTB 2EDWA 3S4SG 3BPLC 3NCEB 1AOHA 4HZLA 4OI9A 2H8PB 3CC5B 4CC0A 1ID2A 4DP6X 1TOXA 3VCLA 1OV8A 1WZAA 2AV7A 5I2IA 3BKJL 5F89A 4PG9A 4PS3A 1SN5A 4PCYA 1BZ9B 4HMEA 5C97A 3OKOB 1UWGH 2P28B 5E4EB 1NFDF 1GR7A 4FTVB 5EA0L 1JE6A 3P4MA 1HSAB 3JT0A 4L8DA 3RL2A 4UOJA 3ILPB 3VSTA 2KZBA 4YXLL 2ARJQ 2B4CL 1AR1D 3RL1B 4MQXD 4NQVB 4K71C 3N2JA 2XHNA 3IDMB 4ZRGA 4NAJA 2VDNH 3UYPB 2XWBB 3FT2B 1YNTF 4RISL 3MKKA 3ZR5A 4F91B 5C6WH 2PP9A 3SGKC 1OLLA 4XX1G 3PL6B 3MNMA 4POZD 4OCRH 1RHFA 2DQJL 1KC5L 5LXGL 1XMEB 2ENSA 4HCRA 5DEGA 3O6ML 4JM2A 3UBXG 4F15B 3ZE0E 3ZO0A 4KO5A 3UYOD 1IGIH 3X1FA 3ATBA 3O3AA 4P23B 4OZFB 2CJUL 1WICA 3MUHL 3T5WA 1KTRL 4JFDA 3IJHB 1VEOA 3VFPB 1XCTA 1D7BA 1IL1B 4H20H 3STLB 1AQKH 2NTFB 3IRCA 2CO7A 4N2GA 3UTPE 2F19L 4GG6F 3WEXB 4AXWA 4LVEA 1OSYA 2A38A 2IG2L 3LH2H 4FLRA 4QHKJ 4L8CB 4F24A 1KGCD 3PAZA 4PHXA 5I9QB 2WKGA 2EKJA 2J12B 4S1DD 4WU7B 4YVUA 3EGSA 3ETSA 3BAYA 4DQAA 1UZ6E 3MCG1 3WJJA 1G7QB 3GRBA 1KOAA 1FP5A 3LNDA 1EXUB 1PSKL 2B08A 4ODSH 3MJ8B 2X2JA 2X53A 3D69B 4G80B 3F01A 4JFQB 4WJ5A 3LXBA 1ZT1A 2X9WA 3GD1C 3TU6A 1GPOH 3DBXB 3NFNA 2XT1B 2AEIT 2LLLA 3OKKB 4NWUL 4YHZH 3DGCR 5JXAH 4CU7A 3MCLL 2P5WA 1Z9NA 3JWOL 1I8LC 3L4TA 4G6AD 5DQ9A 3RDJA 4CMMB 1EZVX 1ED3B 1NCCL 1XF4B 2PCXA 4HBCL 5DHVA 7FABL 2ZXWB 1CN4A 5CP7B 2E9JA 1MW2A 4IOIA 4P3DB 4U2ZA 1MIML 4MYPA 3RWDB 2VDLH 4HJJL 5SWZE 1NFIA 3ZYJA 1QZNA 2FDBP 4R90L 5F1NA 3UG5A 1TZIB 3COOA 4JRYB 3FQUB 4FQ2L 1HX0A 1TETH 2A73A 2APFA 1SOSA 3KYNA 2R7EA 1H3PH 3BYYA 3T65A 1U58B 2NNRA 3QFDA 3GUTA 1XD1A 1NFAA 3QT2A 1ILUA 4LF3A 1WBXA 4Q0XH 1T5KA 3O8XA 4LPVA 4A37A 5GGRA 4M93C 4Q6YA 3J27A 5E1GA 4GSXA 1OT1A 3VFNB 1ND0A 4QXVA 2O93L 5DGRA 3TEUA 2B1AL 2Z35A 4ODXA 3V0GA 5GS1A 5BRZB 4MKMA 5E5MA 1AKJD 1X5JA 1PZ5A 4ZUSB 4PJ9D 1FNGA 5BVPL 2WLHA 5CEYB 3OXRB 4ZNCD 1FWXA 1DVFD 2DLTA 3MOQA 1AQ8A 1ASQA 1ONQB 2XIBA 4HULB 7TAAA 4IIQC 4UOW1 4Y89A 5CCGE 3TZVD 1KTDA 4G6ML 5K33A 2WWKO 4OLXH 5D71H 4HW6A 1SJMA 2I60L 3QUMH 3OPUA 3UTSB 1N8OE 5E5RB 4PJ5E 1OALA 2ZSVB 4XVJL 4BM7A 1JAEA 2DYRB 1E9PB 4PRAB 4CMHB 4QRAA 4JRYE 2CCWA 3MXWH 4NFCA 3WJJC 4KROB 4NP4H 2ROXA 2ZP0T 3NDZE 4YDMA 4F8QA 5I75B 3V7AG 1OAYH 3MOBH 1U91A 1E6JH 3KYMA 1NANI 2GITB 3L9RA 1L7IL 3BT2L 4JY6A 2JFCA 4N2DA 4CW1B 4AQEB 3DV6A 4FXGB 4AQAA 4I1RA 1U30A 4YDKH 2CGYA 5GRUL 2MWCA 2X6MA 4KJYA 2G3MA 4N2NA 5HHQB 3V2AR 3HC3H 4LLAA 4ZNEE 2A5UA 5DA4A 2CRIA 3CVHH 4X80H 3VAEA 3EJTA 3FK3A 2NW3B 1I3GH 2ATPA 2WUBL 1YUHA 3EDEA 2MOVA 1D5ZA 2YD5A 3BN9D 3HI1B 4H1LB 2BIHA 3B6SB 3VGFA 4YBLB 35C8L 3BH8B 1JIBA 2FJHB 2YPVH 5FR3A 4X0KA 1OZUA 4JFOB 1CPUA 5GRJL 3TL5A 3O6LL 3ZDZF 4MNGA 3X1BA 1YY9D 3ZO9A 5H37H 2IXQA 1ACYH 2XZZA 3T2NH 1OGSA 1HHHB 4XC1L 3SPIA 4MZ3A 5TF1L 1DVYA 1JF6A 3BJLA 1BGXL 4FXKB 1LP9B 3MMEA 4WW1B 5D7LA 3WOVA 3HG4A 4X4MA 4DGYL 3O2DH 2J8HA 3BHBB 5D70H 3RJQB 3JWNC 1A8ZA 3GMOB 1ZK5A 4YHIB 4AIXA 1KB5L 3X3GH 4X99A 1XH3A 1CUOA 5KJRH 1T80A 1V7NL 2ZKWA 1M1SA 1DLHB 2QTVA 2XDHA 4WTZA 5EF1A 2APVA 4GG8A 3D09A 5D1QD 3OBAA 5D7LD 5J4MA 4A2LA 4IHBA 3L13A 3VH8A 1E50A 1EJFA 5FYKH 1YUKB 5LXVA 4IGBB 3UOAB 4KRPB 4P2QD 5DCCA 5I0WA 1HI6A 1TNMA 1HL9A 4P2OB 4QRBA 5D96C 2YA0A 4KY2A 5EZOL 5AZEL 4QF1B 3ROLB 1I1AC 1P0SE 1LO0L 2AK4A 4AL8H 4MJ4A 1G7IA 1Q72L 5D7SH 1UA3A 3MI6A 3TNNB 3LEYH 1T7ZA 1RZKC 4NCDA 2X42A 4A6YB 1SJHA 2VMEA 4I3RH 2R69A 5BOPA 3CZKA 4KKCC 1U21A 1CGYA 1FZOB 4JHAL 4G6JL 4KMTH 4X6CE 3LXAA 1IM9A 3MAWA 2UZIL 2NXZD 4OLXL 1BD2E 5JA8B 1AP2A 4NC1E 4EI0A 1KFGA 3P0VH 2AABL 3D0VB 4IGBC 1PZBA 1XO8A 3M8OH 4RFNC 3QA3B 4I4WB 4OD2A 4QTHB 2OA9A 3U79A 4ZW6A 4ELMB 1ID5I 1OTSD 2LW3A 3T9WA 2FH6A 1Q0XL 3QO0B 1MEXL 1KBPA 3FYIB 1CDBA 1ORSA 4OJAA 1OP3K 3WI9A 4Q14A 1Q94A 1RUKL 4K15A 2EVJA 4M56A 3HCVA 4ADJA 4A2FA 3S35X 4A2MA 5EEZA 1FNAA 5BJTB 2VSKB 3M07A 1RZ7L 3C5JB 3GJFA 3IMWA 4HGWA 1GAFH 4NUJA 1KV3A 4HIXL 5ID1A 1G9MC 1WBYA 2OTPA 4KGJA 5DS2A 4XWGL 2J25A 3Q6FB 5KS9F 3VGBA 4R4BA 1I9JH 3DJSA 1WZMA 2VLJB 4Z7UF 2C4FU 2ITDA 3GNMH 4ZD3L 1NINA 1OD7A 2P45B 2AJVL 1ZPLA 4FCHA 1A6AB 4HH9B 1UEMA 1PBYA 3F7KA 3QCUH 5BS0D 4EOWH 1I3GL 2WUBH 1WAPA 3RWGB 3VW3L 4QNPF 5K1VA 3QZWA 4JUTA 5DT1H 2RBLA 5C08A 2FX8H 3KPRD 1A7QH 3FQ1A 4IS6A 2N7AA 4JQVC 2P5EB 2DLGA 4I9WE 4TSCH 2JTYA 5DK2B 4BZ2A 1X7QA 3BFOA 1SOXA 1TLKA 4KI5C 1QI3A 3VTAA 5T1KA 1JPGA 2KDYA 3NAAH 5DVNA 5KUMA 3KAAA 2XWXA 4EDWH 1HIMH 4Y7MA 3O3BB 2ARWA 1C5DA 3ARTA 4XC1H 2W38A 1G5GA 3QHFL 3IJ7A 4TNGA 4QI3A 2QGBA 4Q9QL 1CLOH 4QHLA 4WHYH 3C12A 5J3HC 4ZFFB 3O3EB 1LO4L 3GXUB 1UT1A 1I53A 2VXUH 3QIBA 3G6AB 4D9QD 3VG9C 3KPNA 1OTTD 4KVNH 4EI5B 2GJZA 4OD3L 1BX2B 4TSBL 4U1MB 3HMWL 4I18C 5B21A 5KAQF 2P7TB 3MRFB 4KK5D 4HLZH 3U9UA 3X1GA 4YSDA 1W6WA 3TCTA 3QEQA 3W9DA 3SE9L 2VLKE 4M7ZB 2R29L 4FNLH 3AU1A 4ICXA 1RJZB 2GSMB 3HLAB 5DJXA 1RPUA 1SHWA 3AWFA 4J4PC 2EDDA 3VJ6A 4P4KD 1EEYB 3BE1L 3LKSB 1LQSR 3PPSA 3QDGE 4Z7QE 1LO5A 3RNKB 2FIKB 4NO0D 3GBML 3NP4A 2JCWA 1TSRA 1RZGA 2UZXA 5E6SB 1WD9A 4ABUA 1K5NB 4LRIA 4FLOA 4NAQA 4A1RA 4HIEA 2OR9H 3QH3B 4LCCA 3BP7A 4KXCA 2AW2A 2DQCL 1UM6H 1A6TA 2YD0A 4AZ8A 2E8YA 4F2MB 1EBAA 1DLFH 4NXKA 2HKAA 1NGYB 4NI3A 1BQKA 1EAJA 1GC1L 3JWNG 1E4XH 4UIKH 1K2DB 1RKRA 3RKDC 4R9HA 2FBJH 2PXYD 2F9BT 3IEAA 5KVEL 1UQSB 4GNKB 4NDMA 4MB5A 4Z7WA 1SLUA 4HUVB 4IIZA 5EOQL 3MV7D 3FCUB 1I1RA 3BDBA 3ARGB 4OGAC 2EYSB 3NACH 3I6GA 3SKUD 3TBYA 4KFZC 3ZKMC 3MRBA 4WUKH 3A6OA 1ETB1 3VXTB 4YIQB 1MCPH 4MYWB 4QOKA 4P5TA 2WZPA 3VGAC 1NIBA 1THCA 1G43A 3GO1L 1CF8L 4MAZA 3PP4H 3KVPA 3NPZB 3PJNA 4QRTA 3WD5H 3ARFA 4XP6L 2QLVB 1T21B 5DR5L 4ZMVA 3HUJF 4GBXD 5D6DC 4V1DD 3KLKA 3Q48A 3MNZB 2VAJA 1O9WA 3EJYD 3N1GC 4XO8A 5KYXA 1T0MB 5ISZD 3W11C 1PFOA 3NJNA 4PV9B 5C7ZA 4BQCA 3B34A 2CBTA 2H47C 2DD8H 4WO4B 1KN2H 2JF1A 5GS0C 1QOKA 1UWFA 3S3DB 3IDJB 4E0RA 2ZOLB 4EOWL 1QZ1A 5IEKA 2XSKA 3NSFA 3MLRH 5CZXD 4LCIL 5CIPA 5DI8A 3ESOA 1DDTA 3E6HA 3LQAH 3QIBC 1CGSH 5E2JA 3MRGB 3FTSA 3U1QA 4NM4H 2EE0A 5H94B 3O3DB 3QS3A 2WNXA 5AOIA 1XGTB 1XZWA 2FT6A 3ME0A 4Y5YB 2IG2H 3LH2L 3PUUA 4KTEL 1OP5K 1D9KC 4OGXL 4C54A 3FB5A 4ODUB 3SD2A 4M3KB 4AIOA 2G5RA 1TTFA 5IW1A 3FN3A 5E1AA 2YMOA 3GMRB 1ZLUK 2YEZA 4GLRI 4EQ2A 4ZAKB 3GXMA 3IKCB 4Y4HB 1TYEB 3C6LB 3S98A 4O58L 1NGPH 4IBUA 2VLKB 5IF0B 2BIIA 4BK8A 1RMFH 3DI3B 4G6FB 4IBWA 5DMGC 2VZUA 1YN6A 3ARWA 2B5IC 1UJ3A 5JNYB 3RNQA 2OP4H 5DDHB 4GT7A 3K4ZA 4AJ0A 1ZE3H 4Z7QB 5HYIA 1SQ2N 2NYZA 1D6EA 1JDAA 1F41A 1TJHL 2YPLD 3AB0C 4KUCF 4OLWL 5DC2A 3VFVA 5L7XH 1CURA 5C6PB 3E2HC 1I7ZB 4L1BA 2YKLH 2WLIB 1DJXA 4HG4K 5C86A 3IYLW 2VM9A 3MYZA 1U8MB 1WYJA 4YHNB 3LXCA 3ZT5A 4MNHB 4KUZL 4PJFB 3S4SA 1I8KA 4UDUB 5D6DA 4F58H 4QRPD 3FHAA 3VYPA 3CFMA 5HYQA 2CK0L 5J5EA 3IAGC 4L8SC 2XFXB 5IJBC 4W6XB 3ZYZA 2O72A 4HLEA 4AKOA 5ADPL 3W2DL 3LJ3A 3AM8A 1BZ8A 1UACH 4U3SB 1ZSDA 2Q6WB 2EEBA 2MIZA 4TULL 3V0IA 4CN6A 2GSGB 3JWNH 4EIZC 5DURB 2HT4C 2E75C 4U4IA 4K23L 4M5ZL 2IH3A 2OMTB 3CU7A 4MTMA 5HGBA 4M29A 1KJ2B 1A47A 4JJ5B 4HHGA 4YDVA 1L9NA 2V4LA 4ORGA 3ZDZE 4C8XA 4Z7NF 4ES8A 2FYYB 3FCBA 1KXVA 1E0OB 2D7QA 1JGDA 5LWYL 3VWJC 3TJHC 3SJVA 1IKFH 3D85D 4HHWA 5HHOB 1M3JA 2FRGP 5ICUA 3F6JA 4OZIA 4LL9A 4XNQA 1FNLA 3I75A 1U4FA 3QQ4B 3MGOB 1A7OL 1DBAH 4AEIH 4OFVA 1MCOL 4P2OD 5E08L 6CGTA 1MLCA 1RIUH 1S8DB 4RGND 5F8QC 3WD5L 3ARBC 1NGQH 1EUTA 4FHKA 4XBMA 2WANA 2K78A 5SWSB 2DKSA 2M2DA 1UXWB 3MV7B 1WA1X 2IEPA 2JI1A 3AS3A 4NRXB 2YMXL 1KGXA 3IMRA 3GHBL 4YR6B 2W88A 2B59A 3AG1B 4LLMA 2Q7NA 3HE7D 2ADIA 3BLPX 2VZTA 5CEZD 3DURB 4MLSA 4MVBC 2VLRA 1SM3H 5KG9A 3IGAB 3NZ8A 3C08H 3QUYC 2DRUA 4QHUA 4QRUB 4AH2A 1VIWA 4ZOBA 3P9LA 4WQOA 3T0DA 4YSSA 2ADGB 1K8IB 2IVFC 2PTTA 3VXUE 3SE4C 2R0ZH 2J6EA 1PKQB 4MQSB 1PD1A 4Y16C 2BOBA 5FGCB 4OIFA 1DL7H 3KPSA 5EZLA 3MRQB 3QAQA 5D7JA 1W8EA 5I16A 1Q9OA 2DQHH 4F8OA 4KTEH 4OGXH 5DRZA 5A2KH 2CRZA 3HBGA 4NZTL 1TCRA 1CBVH 1X5AA 2PYEA 4TL4A 4ODBD 3DOSB 2DQGL 2NX5A 3BWUC 1S5HA 5CSZB 5IHLB 5ITBL 4KKBC 4BBWA 3IDIA 2QQLH 1X5LA 3D4YA 3LKPB 5T1LD 2HP4A 2GABA 1WO2A 2BWQA 1WZ1H 3CX5K 3APFA 2EUXA 1RHHA 4Z7UB 4S11A 1NBYA 4YK4C 3UZQB 2FX7H 5J1AB 1GJIA 1TKWB 4F8LA 1SPDA 2AANA 4TVPE 4XN7A 4UM8A 5I66B 3PWUA 4UTAA 1XGYH 3P0YH 5IESH 4U6XA 4R4NC 3PGDA 1QW8A 2ITEA 2FQGA 3KJ6L 3HA0A 2DBJA 2FECL 4PRNA 2X6UA 2L4OA 4OBRA 4PJAE 3WNJA 1KULA 2Q5BA 4Y16B 5JHDD 2IAMA 4WW2F 4NS0A 2HVBA 2ZAGA 3MRHB 4JG1L 1U8HA 3TIEA 3TBWB 4OT1H 3F7VA 4PY8I 1RZQA 1MJUL 1B0RA 5DWUH 3PWNA 4ABVA 3L16A 3PHOA 1ETJA 4FJZA 1AGFB 3RY6C 5DJ2B 1GGCH 4JFFB 4C4BA 5F2FA 43C9A 3LNIA 4Z3JA 2VM4A 1FVEB 4JMXA 2EZ0D 4KO9A 3WDHA 4YHMH 3MV8B 2NSXA 2E59A 5LDSA 2LOEA 3L5HA 3FAWA 3JSSA 4U1IB 2VC2L 4WUUD 5DFTA 3UP6A 5EEXA 3CH8A 4N6RA 4RCAA 5AZ2H 1TJIH 3OKEB 3PWJB 3S5LA 3HAEA 3QCVL 4HUCA 4L3EB 5KWYC 5G4MA 5JOFA 4OJFH 1P6FA 1NTDA 4PBVC 3HNVL 4B7IA 2R2HA 4B9YA 1AHKA 2B7DT 2IDTA 3PQYA 1E8ZA 1P7QD 3TX4A 1ETZB 4LESA 1F8TH 3UPCA 4XHQA 3P40A 3VFWB 4MD0B 4GG6A 1LMKA 4LDOB 2ZX6A 4TSAH 1TF4A 5CINL 5I6XC 1T04A 4MS6A 3GQFA 5EZPA 1BD2B 5ANMA 5M95B 2OMZB 3TASA 2WXHA 4MKTA 3TWYA 1X5ZA 3KPMB 2H32B 4X7DC 5BMFL 4WI0A 4M7LL 1A1OB 1CD1B 2R2BA 2XIDA 2YPKA 4FDWA 3KPLB 1RSYA 3K7UA 1D2OA 3E8UL 2XY1A 4BRVA 5B1BB 4OZFG 3LPPA 3IE9A 2WW8A 4HA1A 1UZ8A 4XMKL 5INCA 3ZQWA 5HGGS 2FEDD 2WLKA 4O9HL 3ARBD 5I1CL 5I23A 1O6SA 3EJRA 1WWBX 3FTWA 2AZAA 4HK0B 5IQ9B 4Z7QF 1OARL 1L7TL 2WQ8A 4AW7A 3T4AA 5I1IH 2YLHA 3WUWA 2D8KA 1MRCH 4R0LB 2X1WL 4AIZB 5EEYA 3GI8H 1MH5B 4IQHA 5F0LB 4F9LC 1KPRA 3HFMH 5L4IA 4QWWC 5G2NA 3D30A 1NCAL 3CDZB 1WWAX 2C3VB 5IB4B 3U2IA 1OCWL 3QNFA 5E70A 1CXFA 5F97E 2CKBB 2NY4B 4P4RB 5IMLB 4M3JA 5CUSL 3N04A 2QSQA 3QHFH 4ZMPA 4ZMNA 3T0BA 5B1CA 4NM8L 4Y2DB 3TA3D 5LBSL 4OZ4A 1OAQL 3I6LD 4OCXH 3MX0B 4PS7A 3GRWH 3RI5K 3CIAA 3V6OC 2VXQA 4KKNA 2NR6D 2YAEA 5E2VH 3II3A 5CJXC 5I1LB 4RBPH 3W9EB 3V95A 7PCYA 4AUYA 1M2VA 3DJTA 5D1XA 4RFNB 4BFGA 1KGIA 3LZLA 4GAGH 1N18A 4HWBL 4LRIC 5C07A 5DGQA 4Z7NB 4RISH 4AJYV 5BV7H 1DYZA 5AVWB 1PG7H 3QEHB 5BXFA 1GYAA 1ECZA 2ZWZA 4NJAH 5EB9A 1LO2L 4LCUB 4TVUA 4XAKD 4BJLA 2V2XB 1G94A 4WTZG 1ZVSA 1I82A 1XGZA 3BSGA 5FHAL 4ZFZA 3BZFA 2ZAIA 1PFCA 3EO1B 3DGGB 4Y9EA 1BLNB 4GY4A 3VNYA 3BE1H 3AY4C 4YHOL 5FO2A 2H7WA 1SEQH 3AACA 3GS4A 1AO7B 2EVGA 1IGIL 1JMXA 1TEYA 4OGYH 4B53A 3CHPA 4GG6E 2XVGA 4N0FA 1WDAA 4HWNA 3HE7B 4FQLH 5TE4L 2QPFA 1YMHA 1IRAY 2WTRB 3HPLB 4H8HA 1YSOA 4LASL 4OGAD 4CDHA 5T5FA 4K8RH 5J7CC 4XB8A 1FBIH 2BSDA 3EZJB 1DLFL 3O4LB 5HGAA 4D9QE 2BNRD 1TT6A 4CNIB 4F7PA 4EN3C 4DUWA 2BJML 3KS0J 2WYTA 3FBQA 4KPHL 4LPUA 4P5SA 4WGKA 3UZVB 1A25A 2DMGA 4QRRB 4HPHA 1QHQA 1W72L 1JVLA 1F1AA 1AYRA 3M1BA 4K3EL 5DUPH 3DROA 3GMNA 1TDQA 1TNNA 4M48H 4U4BA 3BAJA 1M71A 3QHTC 4IHOB 5EBLB 3SDDC 2NCEA 5KS9A 3TESA 1AZUA 1RUPL 3BP6A 3EJZC 2DF3A 3WY2A 1ZIBA 4WI7A 2YK1L 4AT6A 1I9RL 4EDXB 4OCWH 3F62A 3KM2A 4R4FH 4EQ3A 4B50A 2GI7A 5FDWB 4AVKA 2ZXQA 3H9SE 5FA3B 4NERA 1PU0A 3BO8A 1AGDB 2XG5B 4NBXB 2XA8L 4UI2A 3A5VA 2BRRL 2GK0A 2R1WA 2OYPA 4B9CA 5MEPB 4AJVA 1BFTA 4GXFA 4N2MA 1XWVA 4L4JA 2PCPA 4K2UH 2N1TE 1F4WH 3P30L 4Y1AB 2CAKA 1HZLA 1KN2L 1N8ZB 3EOTL 1I8AA 3V4VL 2IGFH 5CD5D 3DLQR 2AQ1A 1KCRL 5AKTA 2XNAB 4PRPA 5HDRA 4Q6IA 2BC4A 2WWOA 1D5BB 4MBRA 1UFGA 4FQCH 2I5YL 2W60B 4HV8B 2MKLC 3TH4T 4S1SH 5BUAA 5C0RH 2RCSH 1KTJA 2OPCA 2WGXA 3ES6B 2XG4A 4HH8A 4KX7A 1CB4A 4TMPA 3X13A 2OW6A 3CD4A 4LEOA 5HY9B 5HHXH 4Z7NE 1YA5A 2YGOA 4BHUA 4EPSA 3N41F 2C3HA 3QYNA 1RULH 4J23A 3TTYA 4MCNA 3UTQB 3TBVA 5C0AA 1RMFL 4IKNA 5GRZA 5IB5A 1S78C 2VDRH 3D08A 3S48A 3ZMRA 4YHKH 5KJRL 2VSDA 5JZ7C 3VFUB 4FQIH 1SLWA 4PVMA 5FKPA 4B9PA 3AGVA 4OCMC 5BV7L 2VERA 1EHNA 3IDGB 3NRPA 1XGRA 5FYKL 4PLKD 3SDYL 3MOBL 2RFXB 1Z9PA 3A6BL 4XXDA 1MIEL 4OV6F 3L5JA 3SYQA 4TUKL 5DC4B 3RZWA 4Z7VA 5E6UB 4WHYG 1GS7A 2ODHA 1NICA 4UAOC 4Q6KA 4IBTA 5C7XH 1F6AA 4JMNA 2EDXA 1L3WA 3DNKA 3IU3A 3OGCB 4G72B 2X4SB 2JKWA 5K39A 5I1EL 2H9GA 5E2UL 5E8EA 4HCGA 1U6AL 4QRRE 1W0VA 4YDJA 5I17A 1UXMA 1CGXA 5GSVB 5HJBA 4JFHD 3TV8A 4LPXA 1JYVA 2P3YA 2A7BA 1RQ5A 2VSCA 5JHBA 1OVZA 2N01B 4BCYA 1IEBA 1BFSA 2C9VA 4GRMB 2YQ3A 2DQEL 2DQMA 3AS1A 5D7IF 3ZMEA 3PUCA 4Q56A 1A14H 1PD6A 4GUPB 4QRQB 4JDTH 3TS8A 3FONB 3L5WB 3T2OA 3N1PC 4WGWB 4KK8D 1ZLUH 5JW5B 4BGDA 1T1ZB 1WHPA 1MCWM 3KPSD 4J3UA 5CCJA 3BZEA 4AG4L 4ELKB 3IMBA 4A2EA 2O5NA 1KNOA 5EU3B 3K8LA 4MD4B 1NGQL 1T22A 2XZCL 2GBAA 3M17A 4WV1B 2XCMC 4Q2ZB 4R7LA 1LDPH 3RJOA 3DUSB 4GIPD 4R5VA 1QUNB 2EXWD 3LKNA 4Y16D 5JHDB 4N6QA 1NMAH 2ZNWA 2I7SA 1Z5LB 3O9WD 1R17A 3SGEI 1FYTA 3SYCA 4DN4L 3ZDYF 1CL7I 1MW0A 4RFEA 3U1PA 2GI0A 1FL6A 2IH1A 4A67A 1UURA 4WIQA 5D7EA 3SODB 3MRJB 2V3EA 1GIGL 2VAAA 1A7QL 4K3DL 1BP3B 1EFXB 1NQBA 4RAHA 4LHUA 1OGAD 4B9ZA 4Z95L 5GRVK 1F5WA 1MI5E 2NNAB 2HT2C 3MA7A 4H0HB 3DTDA 5HSFA 3W39A 4HKZA 1J1XL 1KJMA 3GLZA 3QJOA 4GIOA 4R26H 1NDTA 3ZDWA 3D85A 3P9MA 4PTUB 4NN5C 4TTDD 1UKSA 2GKIA 3RFZA 1HXYB 4EUPH 3BSHA 3LH9A 4JHAH 3CN0A 1E8YA 3OKLA 4ZPVA 3MNVA 2Z64C 1XVSA 3TGXA 2J6EL 3BPOC 3PDDA 4OZHE 1P6WA 3RPIB 1QD0A 4KK6C 2AJ3B 2IWFA 5FKAB 2DM2A 4JN2A 2EDJA 2PW2B 3PWLB 2X70B 6PAZA 3DYPA 1IGYB 4YHZL 2GEQA 3UBGA 4PRIE 3V6ZB 1ZGLM 5E6IC 1H3TA 2XKNA 3IXTB 1JBJA 4D8PB 5JW3L 2F8XC 1JZDC 3KWXA 5IW3A 4AYDC 2XZAL 3HS0B 1MFAL 1H19A 4G7YL 3GXPA 5KVDE 4RWHA 3ARFD 1CTOA 4J3OC 5DO2D 1IGCH 3ARED 5LBGA 2P5PA 1S78D 2IH8A 3UBFA 1ZHLA 3S9DB 4U31A 1VA9A 2NXYC 2JB5L 3MRIA 5BV7B 2C9QA 1MCEA 1D5MB 1I1AA 4AE1A 4E41D 3KHOA 1MJUH 2K8MA 3QYCA 3CPLA 2EKSA 2VLLA 3MNWB 3ZDXB 4ESKA 1DN0B 4P46D 1GGCL 2WHVA 2EDLA 3V0AC 1I9IH 4G9DB 5G5DA 2E6QA 2D73A 3K4AA 1IQDB 1OAKL 5DMGD 1K8DB 4AMWA 3MLWH 3O6FB 1BMZA 5CEXA 2FX8L 1BJ1J 3D4CA 3NIDF 5D4HA 1I3RB 4P2RB 3ENEA 2C1OB 2ITCA 1M56B 5A43C 1ZA6B 3NAAL 4FF9A 4EXKA 1UUSA 4K5MA 3EOBA 4JRXA 5GS2D 3ARUA 1NAKH 4M1DH 2H6PA 3D05A 3RZCB 1I1FB 1NH6A 4NNXA 5JHDE 4L5FE 5DSCA 3P73A 4MA8H 4QHMA 5FO9A 3VDCA 2YD1A 4LKXB 1AE6H 4X7TB 2A4EA 1T03L 4WKXA 2NSMA 1F4YL 5I1GL 2Z31A 4R2GC 2MCAA 4V2BA 1A1MB 3FULA 2CM6A 4K3GA 3WTSA 3L2NA 5AFAA 3MRRA 1FNEA 2CJSA 4J3WA 3MC0A 2R4SL 3CPUA 2WLLA 1QQDA 3ZHFA 4WWID 1XGPB 4OIBA 3FQTB 5IJDC 2IWKA 3WE6B 1Y07A 5C0FB 1X3DA 1X6NA 5D9SB 2CDFA 2QL1A 1TCMA 5DMKA 3UTSD 4HPOH 3DSNB 1EBPA 5ENWB 1P5UB 4UTBL 1TFPA 3X12B 1CO1A 3UTOA 2DQCH 4P49A 1G9EA 2OULB 1NCAH 3FQ2A 3MOAH 3F8UB 3SOTA 4FLQA 3G08A 4JE4B 2PN5A 4KOBA 1MUJA 1E9OB 1Q8MA 4FFZL 4IBZA 5DD1L 4K5OA 3I85A 3MV7E 1DBKL 1K4DA 1KJVA 1MCWW 2EE6A 2F7IA 1IJ9A 4ZXBD 5JA9A 1WAAA 2YBGA 5DZJA 1A7RH 3KR3H 1JTPA 4KXBA 4AC2A 1I8LA 2WZAA 1S7UA 3AS2A 1SYVA 3L81A 4IRJC 5K9KA 3GKZA 4CBZA 1FQ9C 1T0NA 5C70A 1GOFA 5I0VA 2O26U 4HS3A 3ARZA 3P3UA 5FPIA 4M6OL 2X2HA 5JPMA 4RRPM 3RTQA 3W1ZA 2WXNA 4PLKC 5JUEL 3NVQA 2H45A 4Y4FB 5C0NC 1XR8B 3OKMB 1E5BA 1QR4A 1A7PH 2ICEA 4F58L 2ICWJ 3CK0H 1PD0A 1I7TB 1B88A 4CU6A 1KLUA 1IZJA 4ZSOE 1PEWA 5DD6B 2R83A 3NZSA 3LEVL 4O2FB 4UB0L 3TO2B 3ULUD 5IVZB 1OP5H 2EACA 2Z1PA 1UFUA 5TE4H 2EO9A 4YS4A 2AXHA 3QULB 4MDJB 2X6VA 1L9TA 4M62L 1EQWA 2SEBA 1RPQA 1QVOB 4NQCE 2QVFB 4NQCA 2OMYA 4AM0B 3VFPA 4BCZA 4E41B 1IO4C 2DQDL 2O5ZH 2FLBT 1AZVA 3QZMA 3O45A 5ALCH 2NY2B 5EO1B 4AYSA 4DCQB 2WCSA 3S5LG 1W9XA 3MLPA 3CXDH 3U4EB 5D55A 3W3BA 2JLPA 3FMGL 4L9DA 4LBEB 1HXMA 1UYWL 1HNFA 5SX5H 4X9YA 2GTZA 2OFQA 1BXXA 3D50A 5T1MA 3T3PB 4D9LH 4WNJA 2PO6C 4K8RC 3OKKA 3FDWA 3EGDB 5TGBB 3T09A 4HAGA 3VFMB 1ACZA 3V4VB 5FFLA 3G7TA 4WCYH 3N43B 4B3VA 2QZQA 1JGUH 1GGUA 1KB9K 4PRBB 2FJFB 3AG3B 4OJYA 4LSRL 1NFIB 3D2TA 4WEMB 3D07A 2PWDA 1U3HA 5C0IA 3ULSB 5DVMA 3QFGA 4JRYA 1U8LB 1NMCC 4FQXC 1IFHL 3BVNB 4XNXH 2WXFA 1AZNA 2R7EB 3SE8L 4HOXA 1NLDL 3QFDB 1S7SA 2FIRT 2E9WA 1VENA 4ISVB 3O2VL 1U3HD 2EDYA 2NY3B 4WAFA 2FJUB 3OMAB 2HT2D 3S97C 3QVAA 5E99L 2J8UA 4KNSA 1S6NA 3MOAL 1ND0B 1PY0A 2R0KH 4M61B 5C0CB 5LQBL 5DYOA 3NSXA 5MEOA 4K5PA 2XXGA 4LPCA 4PWEA 1UHVA 4UM9B 5CEYA 3D1MC 3OB0K 4JM2C 2AS5M 4EN3B 5HYJD 1J1PL 3X1NA 1I31A 4F7KA 3K81A 5ANHA 3SO3C 1YDPB 3MTRA 5LWYH 1KY6A 3DJ9A 3PHAA 4RMRA 1VZIA 1BF2A 4H8WC 4LSVL 2QSCH 1ZE3C 1OGTA 3T0XA 4F7EA 1H6EA 1SDDB 1E9PA 3FN9A 3DECA 4UQ2A 3RWFB 2PP7A 4QT5B 4ETYA 3H9ZA 4OM0H 5JQ6H 4MXVF 3LN4A 2CPCA 1MPAH 5AD0B 5LGYA 3SPHA 4XPAH 3VG0H 3QDMD 5CEZE 1T20A 1X6LA 1P84J 4FFVD 4QTFA 3OQRA 2PYED 2Y2YA 3NABH 4ACTA 3TEXA 3DX1A 1INEL 1JV5B 4DZBA 4L4TD 1IGJB 1MY5A 3BW9B 4KK9C 2UWEE 1Z9MA 4YSEA 2E7MA 1NL0H 3WEMA 5C0GA 2W91A 2BMKB 5DUJA 3HIZA 2F5BH 1R9FA 3QDGB 3E38A 1DANT 4QR7A 3ZHDA 3ZYOA 2CR3A 1U95A 2GW5A 5ALCL 1NCBH 1KDJA 2OMXA 1SMOA 3CFDB 1H0DA 3KLSA 3ZYIA 1ZVYA 4X0KB 1KENH 1N6VA 4JDTL 5IV2B 3GBNH 3PU7A 4K07A 1H3UA 4YBQD 3ZKXB 3I50L 4CVXB 4KVCH 4YDLC 3WMQA 4YX2L 1T89A 2EEAA 2GHWB 5IOPA 2CIIB 2F61A 3ILEA 1NUFA 4TLUA 1WG3A 3L3KA 1OIOA 1LM8V 2E9GA 1A3RL 3BAIA 3VRLE 43CAB 1S7RB 4XP5L 4RGNC 3VU1A 4KI1A 3Q1EA 3PIQB 3UBHA 3GM0A 1IBFA 4O00A 2FNBA 1OGAB 3GSNH 3CFNA 3HNSH 3DDGA 2HUHA 3EH4B 4HJJH 1JGUL 3KJ6H 5T3ZL 4NNYB 3HAEH 1MRDL 4ZQKB 1HZHL 5E6YA 4OFYA 1OOAA 2Z0UA 2Y5TB 1IFHH 3EJCA 3QUYD 4O02H 4UT9L 1BEYH 1G7MB 5ICXB 4LIQL 5ERWB 3P0GB 2QR0A 1JGEA 1Q0EA 3MV9E 2CE6A 4DPBX 4CADB 4WFGD 2V3FA 5CP3A 4Z7VF 1BIIA 2CO1A 2GIMA 2QSTA 3TM6A 2F8VA 2B1AH 1ZT7B 1WH0A 1E2WA 2AAVA 3Q2VA 2YHGA 1YEFH 4P2RD 3T2LA 1R5VA 4A2HA 3DVNB 1CD9B 1A6WH 1C1EH 2AV1A 5JDSA 1A6PA 4RGNB 1R19A 3FUNA 4JKPL 3BEWB 3U7YH 4PAZA 4C55A 2CBMA 2E7LC 4F3FA 3VXPB 1P5VB 4MJ6B 4WI9A 1IM9B 1MFBH 1MCJA 2QQKL 4LLWA 5E00B 4YDLB 2JIXD 1AP2B 2VDKL 1HH6B 3PGFL 3RDTC 2VLJE 2WMPB 4DGVL 1F8TL 2YUZA 1R75A 4JFDE 4NIKB 5CJOH 1Z3GL 1HHIB 3D06A 3KLDA 3NGBB 1SN0A 5E6RB 5TDPB 2ZT9C 4TVPL 1OE3A 1U0QA 2GQHA 4OM0L 5JQ6L 3HZMA 4I77L 4OTXH 4HWZB 1JG9A 1C8QA 1VCBC 4F9PC 2Z92B 3WE1A 5F1IA 4X5WB 1QUPA 1IBGH 2X4RB 5EOCL 2FO4A 2UWEB 3RBSA 1IFRA 3I9AA 4P4KC 3GSUB 4OZHA 4M03A 4BSVA 3DETD 4ZMAT 5FECA 3IDYC 2Z9TA 4GQQA 4PJBA 3KJ4B 4AV5A 5CKAA 3C5JA 1OAUH 3GJFB 5FV2A 1CGUA 4KXZH 5ID1B 1XXDC 1RZFL 1YZZA 4LDLB 4YSTA 3CVIH 2ZKMX 2A4CA 1DQKA 1WFUA 3H9HB 1S46A 3FU3A 4RQQA 3K4DA 3GMPB 5CCHE 1J8HB 4B27A 2DIAA 5EN2B 4ZXBB 3VD2A 2F5BL 4PJFF 3GSNB 1GL4B 1KYOJ 2WGNB 4B9IA 4XNDA 4XN1A 3GI8L 5JW4M 3KW8A 1A3LL 3D87B 4PJHA 1CLZH 4A7QA 4FLSA 1FZKB 1D3CA 2Y7MA 4BQ8A 2VLRD 2FGWL 2XX1A 4AGMA 3DXAE 3BP4B 3DXAA 2WWKT 3BSZA 4Q4EA 3O41A 1GYWA 3MACH 5AEAA 3II1A 3LKRB 2G3NA 3OC8A 2EH8L 2X5PA 5EZIH 4CC4C 4G9FB 4OCXL 5JIMA 1OCRB 4ZFFA 4FQXB 1R3JA 4U0QB 4JO2H 4JL1A 4DOHB 3Q8AA 1A6ZB 4MRCA 4E9WA 3ROOA 4Z7IA 3DX8A 3AWEA 4X6EA 3WJMB 3QUZD 4YDIH 2XA8H 5DJCA 5IVNA 3EADA 1TVHA 3QORC 3T0ED 3ABLB 1HKLL 4L29B 3UJTH 2BSCA 2XV6B 4IBLT 3HC2A 1E4HA 2MMXA 3N42B 4WY7H 5F7DA 1ULVA 2K9UA 2BCKB 1GZPA 2R0LH 1KB5B 2DQ6A 1ACCA 5F7KC 2X4TA 2AQTA 5H4ZA 3EYVB 3OL2A 4KO7A 5IR1A 2XA3A 3BGMB 4YSCA 3CXFA 5I8KL 1MLBA 4FFZA 3LKSA 4L4TA 2BSBA 1RZKH 2FHBA 2R9HD 1BQLH 4GP5B 5IGXH 5J9PB 1MREL 2Y1VA 3KNBB 2CXGA 5T1LA 2AHIA 1FYTD 4CGTA 2MH4A 2PR4H 1T66C 3DX9B 4PYGA 1IE5A 2NYYD 2X9YA 4M7KL 5KOVC 2WINA 3U7YL 3WJLC 4C4KT 4LLYA 4E9VA 4LVHB 4PJ5D 3W5MA 2YAOA 1MFBL 2GJ6A 2NDFA 3AXHA 2OSWA 5I6NA 4RSYA 1QSEE 1RURL 2IADB 3FTUA 2E74C 4EI5C 4G5AA 4Z7WB 3HRZC 3RI5F 4JFXB 5EORL 4WKZB 2F54E 1MNUL 2V0AA 2PTVA 1F0LA 2EUVA 4TTGA 3VXTA 3A6BH 1XCWA 2F1AA 4XE0A 4ATWA 4NZUL 1JHLH 1HHGA 3UG4A 2BM3A 1DQMH 2G75A 3QORA 1P69B 2VL5A 1KTCA 5JUEH 1Q9WB 1QBLL 4J28A 5KYWA 4JG1H 1CT8A 2B5IB 3UEQA 1ZRUA 5A2CA 1J05A 1NJ9A 4XC3L 2H4EA 3GNML 1ZLSL 5SWSE 1FO0H 5JHLH 4WI8A 5KYXB 1PZDA 1UWEL 3NSDA 2I07B 3INOA 3S35H 2Y6SD 3TWCH 1VZHA 3FO0L 2YQGA 3MODH 3QUKA 3SDAD 1LYQA 1EZLA 4IBQA 1BBDL 5D8JH 1PG7W 3G5XA 4MHHG 5IEKB 3B2DC 4K73A 3EO0B 1NWPA 3BWAB 1KY7A 5IHZA 1T5WB 3L3JB 3ML8A 1GKOA 1O0VA 2WBWB 3JV4A 3LV3B 1P4BH 2IWEA 4HUKB 1HL4A 3GSOA 3JTBA 4S1SL 4MA7H 4P2CG 5KZCB 1OTUC 2A1WL 4YQXH 1L9OA 2R39A 5EULV 4ZUTB 2ADYA 5E9DE 1FH5L 4NYLB 2JJUA 5E7BA 3N3EA 4WWKD 2DI8A 1TZGH 2OCCB 4O4YL 3U7AA 1DJGA 3FB5B 3SGDH 5C1MB 4JKWA 4R7NB 3GXFA 2PR9A 4IGBD 1LO4H 3N85H 5KSAD 2G60H 2ICES 5C09D 5DK0B 2F0CA 4KJWD 4ZAKA 3IKCA 5C8JB 3EG9A 3QUXB 2RALA 4NSKB 1IVLA 2VDRL 2VLKA 3MROA 5IF0A 4JRFA 3ZDXE 1UM5H 1UB6B 1UXSB 4M43L 4UUJB 4XN9A 1N59B 3QJRB 5DMIH 3Q43A 1HC1A 4M7LH 3ZT6A 3GXDA 3RNQB 2AFNA 1N4XH 3IRPX 3MLVL 5I5JA 1I75A 1CL7H 2WUCH 1NDMB 1Q0YH 1MI5B 4NO5B 4ZDHA 2LHAA 2YEVB 4ZS7H 3C8DA 1DJZA 1M2OA 2F08A 2WQAA 4LARL 4ZMZA 1QSFA 3HZVB 3MGTA 3VFVB 4AC4A 1NOFA 1UKQA 3DMMA 1CR9H 2VDOH 4XXCC 1TQBB 3ARBB 1I7ZA 1KWKA 2NLJB 1WFNA 1BXAA 1ZTMA 5CSBA 5B1AB 4UM9D 2OL3A 4K7FA 3IPBA 3IWUA 2VLMD 3EHBD 3KXFD 1RZKL 4DEWA 4D94A 4ODHL 3BGFC 1QSFD 4ZO6A 3WHXB 1KPVB 3IAPA 2PPCA 4U6YA 1TVBA 5EBMA 1TZHA 1UM6L 1S9YA 1N70A 4JHWH 4A7GA 3WIIL 1IAIL 4K94H 1P1VA 2E86A 4FQQA 1FPTH 3ARRA 1LK3H 5I1DB 2JV6A 2Y3NA 4ABQA 3T77B 4UTAH 2OMTA 1DO6A 5LBSH 1U42A 4DF9A 3ATEA 1KLFA 3TA3B 1KJ2A 2WVSA 2Y07H 4UT6L 3EZ8A 4F7MA 4YJZL 2VOTA 5C0AE 3NACL 2FWLB 2DMHA 3CN1A 1AHWA 2J55A 3KBPA 3II2A 3QJSB 2EICA 1FL5B 3BZ4B 3L17A 1KJ2H 3BLKA 3ZLQC 4XMZA 3QP3A 3TFBA 1G9ML 2PO6B 3TH3T 5DVLA 2VT0A 1JWUA 4JFYA 1QP1A 2H8PA 2XBTA 4J3SA 5AB2A 3LIZH 4BH7B 5ITFA 2MCMA 3U0PA 1LDPL 1AMXA 1UXWA 2VABA 2Z8WC 4PBDA 1KJ3L 1QPXA 3D3VB 2UZYB 3ULVD 1JZIA 2ZWNA 2B59B 3OAUL 4L8SB 1I9IL 1JK9B 3BEVA 4FTVA 1DCEA 2XN9B 1JXDA 4L8DB 2BNUA 2ZUVA 4MQTB 4F8TA 2UVEA 4OLVL 4MDIA 1MFUA 2DWEB 5AOMA 3RWJA 1IARB 3N42F 5DHDA 5IROC 1JPSH 2XKSA 3B9DA 2GCYB 4M5SA 3UYPA 2XWBA 3FT2A 3W11D 2JMRA 4MX7A 1TU2B 2JB6B 1HHKA 1YPZF 4JPIA 3BP5A 1I1YA 4APQA 3MUY1 2OTUB 1Q9OB 2UVFA 3PWVB 4O2CB 4LXFA 3PRZA 3BOVA 4ZT1A 1R3LA 3GWJA 4ZFOB 4G3YH 5E7FA 1EZVY 4KK8C 4P9HH 2ERJB 5GGSB 5IVXE 1N68A 3RY6A 4TQPA 5D7KD 4C47A 4JM2B 1U8NA 1AE6L 5E23A 4BIKA 3ZE0B 1BQHA 5FK9B 1FGNL 1F86A 5EWIH 2DYPA 2UX6A 1M9SA 3RVVD 2L8AA 4OZFA 4GQ9L 1J48A 5HDQH 2MNJB 2OMUA 5IFAL 1JNJA 2YUVA 1YJDC 4AQ1C 4F57H 2NDGA 5JW3H 3ULAB 2XN9E 1O6TA 4MA1B 4M6ML 1MWAL 2DEWX 2X38A 5I66A 1G6RL 4AXWB 3MR9B 4Y19A 1EZSA 4X7SL 3ARXA 5KSAB 3HPJA 2AQSA 2J5LC 3RX5A 5C0ND 3KCPB 3WTYA 5HI3C 4DWHA 4WRLA 2A74B 2EC9T 2IAMB 2WK2A 5BW7A 3FNKA 4HPOL 4EJ1C 1NSNH 3VFSB 1U8HB 3WY4A 3C5ZC 1LGVA 3UIYA 4JAMA 3KYKL 2QVMA 4LDEB 4JFQA 2BWIA 1IKNC 4OAWB 4APQC 5FF6A 2D7TH 5FFOA 4UYPA 3LPFA 3Q6GH 2I5YH 1YRKA 1WZLA 2QELA 4GUOA 3MBWB 4X8XA 4JHWL 3MRLA 4PJXA 1YY9C 2LU5A 4MCMA 5DQ9B 5E56A 5IBUB 4CMMA 1TG8A 3N1MC 2HUEA 3MJWA 1A6WL 1TTCA 5E9AA 3SQOL 5I19L 1U8CB 4HF5L 4JDEA 4ZNEA 5MENB 2EXTA 2OK0L 4Z9KB 5JOFB 2W07B 4BDVA 2GJ6E 3G6DL 2IOOA 3FQUA 5MERA 3ZUCA 1KB9J 3FFCB 3V0FA 2R2HB 5L0QB 4GW1B 4XNYL 3WDJA 1WE5A 4JPVH 1BV8A 2Y3AA 2NRDA 4AMKL 3GRWA 1MCRA 4XCEB 3O8XB 3IRZA 5GGRB 4AQ1B 3PNWB 3S36L 3SYOA 1H3XA 3PL6C 4PJCA 1N6QL 5BZZA 4S1QH 3GMLA 1KTKE 1YEWA 1KYDA 4FFYL 4OCRL 4R97B 4ELME 5E5MB 4FP8H 2EECA 3MRKB 1PZ5B 1NCHA 4ZUSA 3H2PA 2E7HA 2R4SH 5I1KH 4WO4D 4KH9A 1A4AA 3N55A 3LHPH 4P2OC 3B3BA 1TYJA 2WXJA 3WEBA 1C9SA 1E7UA 1XF5A 4J8RA 3KEHA 5E2UH 3UTSE 2AJUH 2EDHA 4KZDH 1H5BC 3FHQA 1VCAA 4FZ8H 1KF9B 1NEPA 2AQNA 1OANA 5AKSA 4GAYB 1PJWA 3CMOH 3T3MB 2V2TB 1JGLH 3QWOB 1Z9LA 3QQ3A 3T4AB 1JV2B 2ZG2A 2Z91B 2YRZA 2QPDB 3O9WA 5I9QC 1FFNB 5ICYB 3NBNA 1B0GB 3KXFB 4FG6D 3FSAA 4BSJA 3CXDL 1D2PA 5EEVA 1QMUA 4M1CC 2EQDA 1EO8H 3L9RB 3LHAA 4KY1L 4J3TA 4N1EA 4WHTB 5KBMA 1JVOA 2DJUA 4FFZH 4LB8A 4PS4H 4HALA 5GIRA 1LEGB 3AWGA 5FW7A 1PGRB 1CICC 1TQBC 4RAUA 3QEGH 3T0EA 4HC1A 4AG4H 1B6DA 1NDGB 3U9PL 1DJHA 3Q06A 4OZ4B 3V5DA 4JDVA 1T6VN 5IMOA 3SBRA 5FYJH 1HAWA 5K9JH 1EAPB 4YO0A 2UYLB 1WHOA 2AVGA 3U6RA 5E1IA 3GSQA 1VPOL 4WEBL 5JR1H 1LHZA 5K5YA 3QJQB 3NJIA 2IGLA 4UT6A 2IIJA 5D4QA 1JZ4A 3GBLA 4AEHL 4MSWA 1R33A 4IKKA 1JNHB 1YEGL 1QRNB 4PR5B 3LVEA 4DOHE 4U0RB 2F74A 3O4OB 4GUCA 4Z3IA 4G8EB 1Z66A 2DN7A 4W81A 1ZV2A 3H7LA 4YXHL 1HHHA 4Q0XL 4A7SA 4O5LH 4FYSA 5B1KA 1QLFA 3FRPG 2ZWYA 2D7TL 1Q1JL 4AENA 4XOCA 3WY1A 2CO3A 4ONHB 5B22A 4LNVA 5KW9L 1SEBA 3LQZA 1QYGL 1AS6A 1J1XH 3GMOA 4MCZB 3EXJA 2V9QA 3KGTA 5D4IA 1YMMA 3H9SB 5E6IB 1I8IA 1EGJL 3W0WB 3VU2A 5CR8A 15C8L 4NKQB 1DQTA 2H26A 2ICWI 1NAMA 2AEQH 2ENYA 2PCYA 4KQ4L 5HGAB 3ZHKA 4ES9A 3MJ9H 1VFMA 3C09B 3NYKA 3MN8A 4GT0A 1LL1A 2CPUA 2SODB 3UZVA 1SXCA 3V79C 4RGOL 3TN0D 5CXPA 4ZOCA 2K3TA 1HWWA 1JGVH 1X5FA 4RMSA 5HYEA 5I75C 3QXAB 2AK4B 3VTTA 5EFIB 2FUQA 3O6MH 1H9VA 1EIBA 4YC2C 3V5KB 5H8DA 2ICWA 2NY7L 1ZGLA 4F92B 3CH1B 3QNXA 1A4KA 3ESPA 4FP8L 4NZFA 1TXKA 5FDWA 1SJHB 3S37L 3ZL4L 1P7HL 3CC5A 1L9MA 3BO8B 3P2TA 3JWDL 5I2IB 1V5JA 1NLBL 5DC0A 3Q1SL 3JZ7A 5FW8A 5CN2A 5EIIG 4GUQA 1KV7A 4Y4KC 5IEHA 4QXGH 2X6BA 3MHZA 2WQXA 3HC3L 1BYNA 7CGTA 4DK3A 5I1CH 5KUKA 3MCYA 2GEEA 5F70A 4B60A 4K3JL 5F96L 4XI5D 5IB3B 3P4MB 4Y1AA 4U49A 4NN6C 1R3KA 2DKUA 1SY6L 4GBXC 1IB5A 1AXTH 3WLBB 5EV7A 4ELMA 3TZVA 3TEWA 5KVFL 4U6TA 2E8ZA 1JYWA 4XVSH 1BHGA 1MG3C 2NSQA 2W60A 2FZ3B 4HJIA 3K0YA 3V0VB 3HCVB 4QAWA 1ZVHA 3D48R 5GJSL 4GRLC 5BJTA 1HE8A 4HGWB 1MCLA 3R19A 2Q8AL 4HKJB 1WWCA 3RP1A 3MJGX 3F6LA 2P24A 4O02B 4X0NA 1J1PH 4G8GB 1LE5A 4W9LC 3BAWA 5HDOA 2VDLL 4U1KB 5HI5D 3MLZH 4DETA 3O11B 3LPWA 4P23A 4M4RA 3RWGA 2W9DH 2HFTA 3EOAB 4YZWA 1JZ8A 1DQDH 2CMRH 3JV6B 2ZICA 4M93B 5A2AA 3FQWA 1QAWA 3IGUA 4LQFL 4E9RA 5DZAA 2HH0L 5H4YA 5A16B 1BAFL 2A9DA 5FKPB 4U1LA 4Y5XB 4HIJB 4W4OA 2YSTA 4AEHH 5I1HH 2CO7B 1KMGA 2WCGA 4DP8X 3ARGC 4D8OA 1L9QA 4DKDC 1MPAL 2F54B 4KZEH 1JPGB 5DS1A 4PJEE 1CR9L 2VDOL 4JHBA 3V4PA 2LFGA 3SKOB 4WU7A 5CSGA 3HI5H 4LSDA 2FTAA 1BREA 4UQCA 3NABL 2DZEA 3O3EA 1C8PA 5E9DD 2BHFA 4ODHH 1U2CA 1FLTX 3MJ8A 4ZUUA 2AI0H 2ZG3A 4JQIL 3QIBB 4JFPA 3K80A 3QUZC 1R5WB 4WJ5B 3LIZA 1S9VB 5DO2C 5E8EB 4IRSC 4XO5A 3NFNB 4LSQL 1VFUA 3X3FH 4E9YA 1BX2A 3POCA 2OV0A 3WIIH 1IX2A 3CLFL 1F11B 5I17B 4LNRA 1R1CA 3TVMA 5DLLA 1ED3A 1XF4A 1DZBA 3U9UB 3POHA 5CJQL 5DHVB 5F0PB 5E4OA 4P3DA 3KLHD 1O7DC 4GRLA 1W72H 1BZDA 3B9AA 1KPUA 5KVDH 5TE6L 5KBPA 4KRLB 2WYIA 5GJTL 4PRHE 4J1UA 1IGFL 1EEYA 1UGNA 4DVRH 3GC3A 4NQEA 5J13C 1L7IH 1A7BA 3BT2H 2XN2A 1U58A 3T2PA 4N8UA 4FQ1L 5T1DH 3NIFE 3W0WD 2FIKA 1BVKB 1G9NL 2J73A 1P4IH 2B1HL 4NENA 5DHEA 2XLLA 1QKZL 3TBCA 4EKXA 1BPVA 4PY7B 5AW6B 4ELKA 3U0TB 2Z4QB 3QH3A 5HVHC 4Y4FC 4FG6C 4ZX5A 2Y06H 4N8CL 2NYYC 3VE0A 3PREA 1HQRB 3UGUA 3JWDH 1FFOA 4FGMA 3AGWA 4LSTH 4RETB 1Y18A 3RURA 2R2EA 4NHUB 4NQXA 3LKNB 3HS0C 2PWEA 2NW2B 1UQSA 4LVNB 3RJDA 4H44C 2ENJA 3LEVH 4FEIA 4HUUA 1KTDB 5EN3A 2WQSA 1G84A 2ZX8A 2VH5H 3HG3A 4ZTPL 4GQRA 1M7IB 1MCHA 1FG9C 3UH8A 2DPKA 3K72B 2ZSVA 1AG0A 5H37A 5I8CB 4FX5A 2GYSA 3MRBB 4N5EC 5IQ7L 2UXGA 2DLHA 3D3VE 2Y5QA 4NQUA 4PRIB 4QOKB 5KVFH 5BW7C 1NOLA 4JZOA 3C60C 2CO2A 4DTGL 1WV7T 1KJMB 1UT9A 5FGCE 4RFOH 2YPLA 4LCCC 1QNZL 2GITA 4ALAL 3SDXF 1HXYA 1UZGA 3T6ZA 4JY6B 4P46C 5DK3A 4B3EA 1UYWH 5DJYA 3MLZL 4QXUH 4WF7A 5E9NA 3PWPD 4HCRH 4J2QA 3SDAC 2W0KA 5A6IA 3NEEA 1P9MC 4OLUL 1KIRB 3IGLA 2Y6SC 2KPWA 4NAMA 1KYUA 1KXVC 4JN2B 4KBPA 4L3FA 5D1ZA 3BH4A 3RWCB 4YHLL 3ULVE 4LQFH 3C09C 2H2PD 1NMCB 3SKNA 4HDIB 3VQLA 2XKNB 2CKNA 4DP5X 2VDLB 3NN8A 4HUWA 4N2BA 1D5ZB 4N87A 2R29H 4FNLL 1XGQA 2I24N 4IBYA 4GXUM 3ME0B 4KZEL 5T3ZE 3VGHA 2E4TA 2FJHA 2NR6A 1CYWA 1FFRA 3UJJH 4B41A 3AY2A 3LMJL 4KWUA 5D7LE 1CTNA 4BGLA 1Z9SB 3KPRA 4AKQA 5L2KD 2YEZB 3BSZH 1UWYA 4QXTA 1I85C 1YYMH 2G3XA 2QHLA 3C8HA 3PPEA 3SE8H 3WXVH 1BQLL 3HUJA 4ATTA 2XPZA 2FL5A 3N9GL 1HJCA 2ZE0A 1W16A 2OTWB 1DN0A 2ARJA 4A7VA 5F7LB 5E99H 1CVSC 4L9LA 4G9DA 5DDHA 1KLGB 4JFFE 1IQDA 2NY1D 5CHNA 4N5ED 5G55A 5H35B 2XTJC 3JV5A 1JDCA 1T2JA 2VLRE 1D6EB 3N06B 4BE5A 4ENEC 4URKA 1ZIAA 4Z23A 1YJDL 4DVBA 2VYRE 3KYOB 4Z77B 1R3IL 4QGYA 5C6TL 2CCLA 4JB9H 1RV6X 1ZA6A 2VZSA 1HZKA 3LZPA 3CDYA 1MNUH 4H2AA 1A9BB 4PJFA 2K45A 2DQTL 3BIKB 3L2LA 5DEFA 2EUZA 3UFIA 1FVDA 1T4WA 3ABKB 4GKNA 2AXGA 2XFXA 3S36H 2BSRA 4JM4H 3CQQA 4LKXA 4JVPA 1MJ8L 3EYFA 3BUTA 4AVIA 4I7ZC 4QJ4B 2ICEC 1FGVL 1LE9B 1G7PA 3REVB 1F13A 3P77A 4ODWA 1FFPA 4Z5RB 3F7YB 4LAQH 5HGBB 1MVUB 1D5RA 3K8MA 5B8CA 3WTUA 1RL1A 1XTMA 3EDKA 3ZL1A 2FYYA 1AS8A 1JRHI 3G5VB 3O0RH 4BFRA 1L0YA 5E9DB 2XACC 4IDJL 1E90A 3BDXA 3HAEG 1BAWA 1WK0A 3WE6A 5HHOA 4LCVA 3CZFA 4LEEA 5AOLA 4B9GA 3IFLL 3TBSA 4Y1SA 3CMOL 1JK8A 3C2SA 3QXUA 5FB8A 3U46B 2EO7A 4QTHA 3WFEH 1MLCB 1S8DA 4S1RH 2Z3FA 2DYPD 2K6ZA 1TEFA 1KFAL 2V5TA 4XP1L 2AQRA 5TDNA 1ORSB 3FUEA 3BGAA 3FOLA 1Q94B 1PY4A 4HJ0D 3EJSA 4NRXA 3S2CA 4Z3FA 4OD3H 1S9WB 2DQUH 2DDQH 4UILH 4AW4A 3G08B 1HAUA 1WBYB 2A9MH 4GW5A 2Q8BL 1MUJB 5I1JL 1IC7L 3DURA 3OM3B 4PJ8C 1J18A 2DH2A 3FB8B 4APQD 4NZ8A 3S3BB 3IXAA 1IVTA 2DJMA 4AH2B 4G1MB 4H0GA 3CU1A 4YNYB 2XJKA 1PZUB 1T3FB 5SWQA 1KXQE 4HXBL 3QZWB 4J4PA 2JNZA 3GSNL 1NAMH 3WG7B 4EIGB 4G8FB 2XI9A 1MHPH 3MRQA 3O4LD 4LARH 4WTWA 4X6BB 4X4XA 1HHJB 1JPEA 2VJXA 1AI1L 2YKLL 3WN6A 2C7FA 3B8YA 4PP2A 3ZKND 1S7XB 3SDCC 4IJ3B 4DAGH 1Q9KB 1IT9H 3BSZL 5C0EA 1N5YH 1VB9A 4UQIM 1UCBL 2G4GA 4HEPG 5F7FA 3TIDB 4PJ7A 4RDQF 1FYHB 1G0DA 4ZS6D 3RTLA 4F7TA 5AVVB 4KJQC 4PQXA 1RHHB 1QRNE 2JIXB 4LL4A 4O2EB 2H2SC 3FU8A 5DD6A 5B39G 5J1AA 2Y2WA 3UZQA 1UENA 4U1SB 3RY5A 1TKWA 4Q74A 3LZRA 1PKOA 2FHFA 5AYQA 3HMXH 4YSOA 3RFRA 4JW3A 2AVFA 5CLWA 3VRIB 4NHCH 1XB8A 4MRBA 3VGDA 4XVJH 1JPTL 3CFKB 3NDYE 1I1AD 4KGLA 4E41A 4FE9A 1TTBA 4PJAB 5C6TH 1KCKA 4ZW3A 3HTLX 4FOMA 3WXWH 2IO5A 1RJZA 2J4WL 1WA2X 1O5PA 3HI6L 5FOBA