3GUGA

Crystal structure of akr1c1 l308v mutant in complex with nadp and 3,5-dichlorosalicylic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTVDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AKR1C1 L308V mutant in complex with NADP and 3,5-dichlorosalicylic acid
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C1
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3gugA00
2PDIA 4ICCX 4DBSA 4XZLX 2NVCA 2CLPA 3MC5A 5AZ0A 5JH1A 4L1WA 3G5EA 1C9WA 2PDJA 3R8HA 4PMJA 3LD5A 2BGQA 4OTKA 3WBXA 3B3DA 5LIWX 1AFSA 4XVDA 3O3RA 1PWMA 4GA8A 3GHRA 2R24A 4IJRA 2PDCA 3M4HA 4FZIA 2IKJA 4JIIX 3QKZA 2HEJA 2P5NA 3UYIA 3UZYA 3UGRA 3CAQA 1VBJA 2PDLA 4GACA 3F7JA 4Q3MA 3T42A 1Z3NA 1RALA 4H7CA 1XF0A 2PF8A 2PEVA 4XZNX 2PDUA 3R94A 5HNUA 1MI3A 1AZ1A 4I5XA 3LN3A 1EL3A 1AH3A 2VDGA 1XGDA 2INZA 2DUZA 1VP5A 1A80A 3V0SA 2HVOA 2FGBA 1J96A 2PDHA 3EB3A 5AZ1A 1S2CA 1ADSA 3RX2A 2IPFA 4XK2A 2DUXA 3LZ5A 4XZIA 5HNTA 2INEA 3LBOA 1PZ0A 2F2KA 3U2CA 3GHSA 2IQDA 4QR6A 4WDUA 3ERPA 5LIYX 2PDQA 3V0UA 4JQ4A 2NVDA 3LZ3A 2BGSA 3O0KA 1QRQA 2PDNA 1YNPA 3FX4A 3V36A 3WG6A 2IKHA 3C3UA 2IS7A 4YVVA 1SM9A 3KRBA 4GIEA 3UP8A 3N2TA 3M0IA 3Q65A 3GHUA 2FZ9A 4LB3A 4JQ1A 4PUUA 1MRQA 4GQ0A 2FZDA 1RY0A 1GVEA 3RX4A 1LQAA 3DN5A 5LIXX 3COTA 4L1XA 1M9HA 2ALRA 1IHIA 2IQ0A 2PDGA 1Q13A 4DBWA 1PZ1A 3V35A 2IPWA 2BP1A 4WDTA 3LNMA 3CV6A 2PFHA 3UZZA 1AH4A 1FRBA 2R9RA 3WCZA 2PDMA 4GQGA 3M64A 3N6QA 3LENA 1UR3M 4EXBA 5DANA 5LIKX 3CV7A 2PDXA 4JQ3A 1YE6A 5JH2A 2PDYA 5HA7A 3Q67A 3R7MA 3LQLA 3FJNA 1Z9AA 4Q7BA 1S2AA 4PRTA 2HE8A 4XVEA 2PDPA 2PZNA 1RY8A 2PDBA 3BCJA 3D3FA 3G1RA 1EKOA 2PD9A 2C91A 1T40A 3RX3A 2WZTA 3NTYA 1AH0A 1S1PA 4WDWA 1MZRA 1US0A 5KETA 2WZMA 1K8CA 2DV0A 4LB4A 2ACSA 1X96A 3WBWA 4FA3A 4H8NA 4JIHA 3R58A 2J8TA 4NKCA 4LBSA 3R8GA 3LQGA 3UZWA 1PYFA 4QX4A 3BV7A 1PWLA 4FAMA 3BUVA 4MHBA 4XO7A 3CAVA 4XAPA 4YU1A 3UG8A 4EXAA 3R6IA 1ZUAX 2FZBA 1ZQ5A 3UFYA 3MB9A 1QWKA 4JIRA 4XZMX 1HQTA 1YE4A 4FALA 4LAUA 4GABA 1HW6A 2PDKA 4QBXA 2ACUA 4HBKA 4JQAA 4GCAA 4JTAA 2AGTA 4XZHA 2QXWA 4IGSA 4PRRA 3CMFA 1Z89A 4ZFCA 3S3GA 4PR4A 4AUBA 3EAUA 2F38A 3P2VA 1Z8AA 2I16A 1XJBA 2ISFA 2HDJA 3WBYA 3ONBA 1X98A 4WDXA 2PDWA 4JQ2A 4ASTA 4DZ5A 3CASA 1EXBA 4HMNA 2FZ8A 4R9OA 4WEVX 4WRHA 4IJCA 3DOPA 4YS1A 4F40A 2IPJA 1OG6A 3GUGA 2ACRA 2I17A 1ZSXA 2HV5A 3VXGA 4XO6A 1YNQA 4DBUA 4JTDA 3H7RA 2IKGA 4QXIA 3LEPA 4WGHA 4G5DA 3V0TA 2A79A 1AZ2A 1IEIA 3BURA 3EB4A 2ACQA 1ZGDA 3UZXA 4JTQA 4JTRA 4PUWA 2IPGA 2FVLA 3ONCA 3H7UA 4YVPA 1X97A 5C7HA 4YVXA 4LBRA 5M2FX 3LUTA 2IKIA 1S1RA 3R43A 1LWIA 2PDFA 3UWEA 3GHTA 2HE5A 1JEZA 4LAZA 5LIUX 1Q5MA 1EF3A 1T41A 1R38A 2PD5A 4RPQA 4JTCA 3H4GA 2HVNA
chains in the Genus database with same CATH superfamily
2D0GA 4ADUA 2Y6ZA 1P48A 4HU4A 1FTXA 2A7RA 2CLMA 1QBAA 4U4MA 1DJGA 1VEOA 3I68A 1CWYA 4ES4A 3ZOAA 3U2EA 3BOFA 1VHNA 4YN5A 4WGXA 4UTHA 4AVNA 5JVLA 1JFHA 1GVOA 2XJ7A 3BCDA 1TWDA 3QY8A 3DFTA 3U5UA 1Q4NX 2OOGA 4F0KA 4HHHA 4CN1A 2BMBA 2FJUB 2I9EA 1SMDA 1A5SA 2BVDA 3VD9A 4BK9A 4LNCA 1J0JA 4Q3MA 3M7SA 2E7FA 3IGUA 1B3OA 3D3AA 1YEYA 4ZO7A 2QULA 5AYZA 2PF8A 3W6MA 5K4XA 1HKJA 3VVGA 2ZUTA 1OX4B 4C6LA 1AH3A 2D0FA 4R7JA 2INZA 1BWKA 4B5TA 4PTVA 4MWAB 4C6NA 4ROPA 4JPGA 4B5VA 2R1LA 1OGGA 4BF5A 5I79A 1HTIA 2WHLA 4D6FA 4QQ3A 4E0CA 3SUVA 3UWWA 1W5OA 1WX0A 5AZ1A 1ADSA 3QMTA 4H3DA 2DUXA 3LZ5A 1XC4A 5C2XA 3G24A 1JULA 3C2RA 1ZBCA 2ASHA 1G69A 3T2OA 3ZJKA 3WZ0E 5H2ZA 2KZHA 3WQ4A 4HOZA 2FH6A 5T8GA 4Q32A 4B5SA 1QI5A 4X2RA 3M5ZA 4LBUA 2NVDA 2WMHA 5EBUA 3ZLGA 2BOFX 3L2MA 1TPB1 3KVJA 3FX4A 4YXGA 5IHRA 1JYXA 3A5VA 4KT2A 2OCZA 4K3ZA 1GVYA 2DW6A 2ZXAA 3ZVIA 3RLVA 1E0XA 1VCFA 3AJXA 3VDAA 5C9RA 1V6VA 2FFCA 2J6XA 1E6XM 1DJZA 3SCTA 3CZKA 3GAKA 1X6NA 3SB0A 1GONA 4JY8A 4JTSA 4RDYA 3A4AA 5LIXX 3COTA 1DE5A 2DSVA 1UASA 4B91A 1R30A 5HINA 3FFSA 2PDGA 5DN1A 3UY8A 1X7IA 1WBHA 2JKEA 6A3HA 3TOPA 4HVXA 1UQZA 2TODA 2QPSA 3S83A 1POJA 3U7VA 3TJ4A 3O63A 5LGZA 4MFEA 1ONRA 1HJXA 2DVXA 3W53A 1ISZA 3FEMA 5JH2A 1MUMA 3WQCA 3RLUA 2H9AA 1ESWA 4QSFA 3LM3A 5C71A 3AO0A 3TZNA 2DGAA 3MS8A 1M6JA 4AD0A 2WZTA 2KAUC 1AH0A 2GOUA 1BVNP 1J2WA 5KETA 3RYSA 2RH9A 4IUOA 3DYMA 1MO0A 4O18A 4IICA 1QOPA 3L4ZA 1KGWA 2GDUA 4J2PA 4LUTB 4PMUA 1H5YA 3RCNA 3V5FA 3AOFA 1K7FA 5FCZA 1E0WA 3OA5A 1AJ2A 2QCDB 3H54A 2BGNE 4IF2A 2PU0A 1A5AA 3IS4A 3UJSA 5IFTA 3M0VA 3OZPA 2BX7A 3FOKA 3EYPA 3AHYA 4GYJA 5EY5A 2Y4SA 1ZALA 5D9MA 3BG9A 4ZSUA 3SCQA 4REQA 1UKOA 4XD6A 5HULA 4O17A 1I75A 4ACZB 1E71M 2DIJA 2CFFA 2ADAA 4QRNA 3JZEA 1EWEA 4H9MA 4BZYA 3GTHA 4HNOA 1ZJBA 4ZMGA 2TRSA 4NZCA 2BXVA 3P8IA 1M03A 3W74A 3MJMA 3PBMA 3WDHA 2Q8XA 2QXWA 4O4VA 3UVIA 3SGUA 2IMRA 4A8RA 4HYWA 1W3JA 3TSDA 1Q7QA 4F8XA 2AMGA 2PZ0A 4AUBA 1XICA 3NVTA 1A5KC 2I16A 3LS9A 4NY2A 3ARRA 3BLPX 3K4DA 4UMCA 3BAKA 2QIWA 1KBJA 2A21A 1E6QM 2V5JA 1TG7A 4KFPA 4XZBA 4PH6A 3T05A 4MSSA 4GUJA 4IPLA 1LBFA 1WKFA 1DJIA 4Z1YA 3S5NA 4M29A 3WNMA 4IP5A 4OOZA 1EBHA 4P8WA 3FVMA 4OHQA 5REQA 1S39A 1E9YB 1UMLA 3O7UA 4PMXA 2Z1VA 3SECA 4B2DD 1JPIA 2A79A 2A3AA 4A3QA 4RE0A 4FNUA 4ZCWA 1NOWA 6ALDA 4MVAA 3ARQA 4W5ZA 4D6GA 4PUWA 1J0YA 4N4QA 1EYEA 5M2FX 3APTA 5TNVA 3OODA 2VX4A 5AB3A 2RUSA 3DG6A 1J0IA 3A3HA 5DO8A 3LHYA 2CYGA 3DBNA 3BLLA 4MNJA 3KBJA 4LAZA 6XIMA 3LG3A 3B8VA 1W8GA 1HGYA 1FWHC 1LLWA 1XLAA 3NZ1A 4NSBA 4HGXA 3UU0A 1E4IA 2ICSA 2VI0A 3SUSA 2XSXA 6XIAA 2QJIA 4NF7A 3WFAA 4JFUA 5AKQA 3GC4A 2EPLX 4MTVA 1HKKA 3MWCA 3VD7A 3CWNA 4YLWA 3VOFA 3SURA 4FF7A 4G7FA 3WBXA 4J3VA 3RM8A 1SQ7A 3K46A 1W17A 3SN0A 3T44A 5B7YA 4HK6A 2YXOA 2WVVB 4DJFC 1EQPA 3QLDA 1PX8A 4U31A 4EXQA 2R24A 3WUFA 4UMAA 2JF7A 5GNYA 2WCGA 1A47A 4GY0A 3EDKA 2NSXA 4CQAA 1GKPA 1VRXA 3MKVA 2I7GA 3ZJ7A 5C0QA 3I10A 2OODA 4M7TA 1ISYA 1HNYA 2ZDRA 1D3HA 1UWAA 3PF3A 3AHVA 1QI4A 3QYSA 4B5UA 5I2UA 2JEQA 4DJDA 3GR7A 3VIFA 1SFJA 1XGDA 4MNLA 1DWHM 3PZTA 3EWCA 2YLLA 4F9JA 1ITQA 1JXJA 3KRSA 4QROA 3MDWA 1LRNA 4ACYA 1TMHA 5EMJA 1QBBA 3WSUA 2BASA 2UY5A 3VIGA 3P93A 4CNNA 2X0SA 2X1TA 1A50A 4K6AA 5HNTA 3M47A 2KX9A 2WKLA 1EC9A 1QHZA 4CCEA 2O92A 2YCLA 4KF1A 4PTXA 1K9TA 1TWSA 1V0LA 3WUGA 1FX6A 4AD3A 1RA0A 2A1YA 3UPMA 4LOCA 4RDZA 1YNPA 4F2UA 3PZMA 3ZVHA 4PMQA 3HJEA 3C3UA 4ERGA 4FOKA 1AJZA 3S2MA 3H53A 3D46A 3NFUA 1G67A 3OOQA 3BLDA 3CLWA 1EHNA 3LK6A 3W7MA 4LB3A 2VFGA 4Z2HA 2FZDA 2IXVA 2ZZ6A 1XUZA 2O56A 3E0WA 1Q8AA 2DT3A 2HNEA 3PG9A 4PMVA 2PMQA 2IQ0A 5HR6A 4M56A 3MJYA 3CK5A 1PTAA 1VPXA 4E3VA 2HRWA 3EWDA 2DIKA 3ARXA 2A3HA 5CBIA 2SFPA 1FXPA 1UPMB 1JF5A 3N04A 3P8JA 4HD5A 4TX9A 1NF0A 3HFTA 1TCMA 1ENUA 1KWKA 5G1TA 1XCFA 1LORA 1IGSA 2YL5A 3M64A 2CPUA 4OIFA 4URIA 2ATMA 1XM3A 3HN3A 3GH4A 3UCQA 1G6CA 1QCWA 3BW2A 4A22A 5CGQA 4GUIA 2VFFA 3L7RA 1J4EA 2CZDA 3OYZA 1XIGA 2D2GA 4NRRA 1FDYA 2W4XA 1E9LA 4ZQRA 2VOTA 3I3EA 2NX1A 3PUDA 1MZHA 4MDOA 3TLLA 4Q8WA 4JNZA 1V4YA 2E28A 2XIMA 2X09A 2VKZG 3EPMA 5C5YA 3NOYA 3TU9A 1H1ZA 1DQUA 1XIJA 1X6UA 2PC8A 2XWDA 5BNKA 3VZZA 4R5EA 1LQ2A 3BC9A 3Q45A 1I4NA 1OYAA 3R8GA 1JYWA 1TVPA 3WDIA 3NXFA 1B31A 3KW3A 3UW6A 1A5NC 3URNA 2D2JA 4M51A 2Z2UA 3HQPA 3VGBA 4L1GA 4AD5A 3PFRA 2DH3A 3RNDA 4PEEA 1P6CA 1XLIA 3QPYA 3ABOA 6REQB 3STCA 4WQ6A 4IIFA 2R6OA 2X16A 3S1WA 3WLSA 2PCQA 1JZ8A 1DWJM 1ALDA 1PS9A 2XH0A 3EPOA 4DXKA 4MZ1A 2XYLA 4Z1DA 4Y6GA 1XKYA 4IIGA 4IL0A 3BAXA 1XDJA 2B7NA 3NQGA 1HXJA 2GJLA 3EOSA 5G2IA 1Z8AA 2WKJA 3W7QA 3AYRA 5LGXA 3I4KA 5FJOA 2PCEA 3PPGA 3PULA 3VGDA 1J12A 1B54A 3R10A 3JRKA 3OLEA 4WSJA 3PP7A 2XZ7A 1YDVA 1GCYA 4PEKA 2QCCA 3EX3A 2CBIA 1LUCB 3BQ5A 5FA5A 3WQGA 1YXCA 4JFTA 3ATZA 5I07A 3CHVA 2I17A 1WXYA 3GDTA 3OGSA 1PCWA 4DJEC 1XLCA 1QPRA 3M0JA 2XFYA 3IUIA 3KBSA 2IKGA 1RA5A 2O7SA 3FA5A 3DAQA 4UOQA 3NR0A 3JUGA 2UBPC 4AZHA 2Z0IA 4KERA 1L6GA 2VD8A 2PE4A 2Z4GA 3WQOA 1LWHA 3S1UA 3RGTA 2XVPA 4YVXA 2FB3A 5J5RA 7REQB 4JFVA 4D6HA 1XLKA 1YDYA 4V1XA 2REQB 4DUOA 1RVGA 5D32A 1UD3A 2YOCA 2ZXQA 1WZLA 3JS3A 2XWEA 2NLIA 3P82A 1W5MA 1A5MC 2PP3A 2G4JA 3PHAA 2QPUA 1XH2A 1W3LA 3CV2A 1EC7A 2J79A 2PDIA 4ICCX 4RV8A 5CCZA 2V3DA 3G0SA 4NAFB 4JEJA 2DZVA 5EB8A 2XTKA 1K8XA 2GPTA 4RZBA 2PGWA 1PKNA 3G5EA 3T09A 1TJRA 3W70A 1VB9A 1C9WA 5A8GA 4W4QA 1P0DA 3TROA 2JBMA 4LV4A 3FA4A 3CT7A 2QNEA 1OFQA 2WCAA 1QJWA 1NDZA 3FDKA 2AQVA 3N1AA 3W1XA 1M68A 1YXYA 4KWSA 3D0CA 3GVGA 1IT8A 3NQEA 6ENLA 3N19B 3CZLA 1OK6A 3CAQA 4HCLA 3H4XA 1HL9A 2WC7A 2Y5EA 3VNIA 4MLRA 4PL1A 7TAAA 1L0PA 3CTLA 3W6LA 4DYJA 4KQNA 3TN5A 5C8BB 5HQEA 2V63A 3WMBA 1A80A 1W3TA 4UCGA 3T8QA 3HU7A 5CPNA 3SY5A 2PDHA 1VPYA 5FJUA 1XLGA 2D1ZA 3RR4A 1T0OA 4OECA 3R8RA 3GS6A 2EPMX 3W38A 1JNEA 1VGAA 5HNNA 1JDCA 4Q4PA 1T96A 4LT9A 3FGCB 4JNYA 3U2OA 5A8PA 3KTXA 4EF9A 3U4FA 3P80A 1B5TA 1OB0A 3MI2A 3BDKA 4W89A 3LXCA 4O14A 1I9CB 3VZYA 1KCKA 2DSWA 4LEFA 1V6YA 1BXCA 4ZZ9A 2BGSA 1QRQA 4XD3A 1IQ8A 3ARTA 4UFMA 4S23A 2IS7A 3CUZA 3DG3A 3HV9A 1JZ6A 1Q2RA 4LAKA 3N2TA 3WF3A 3UXDA 3E0IA 3DFPA 4AF0A 5D2VA 2XUCA 1R9XA 3FYOA 3RM4A 2EJ1A 1RY0A 3MT1A 2X1IA 1B3XA 4MY1A 3ITTA 3GR4A 3OW1A 2WOQA 2D69A 4D8AA 1FKXA 1IXNA 2EQDA 2YSWA 3G1YA 3HPAA 4NX5A 4DBWA 1O60A 4LAOA 3VOGA 1UUMA 3KP0A 3L21A 3M07A 1MEHA 5HANA 4JD4A 3TR2A 2GQAA 1W9BM 2ISVA 3VIKA 5D2TA 1PZ3A 5BXRA 4S3DA 4KRTA 1YPXA 1XSIA 3WLJA 3GZ3A 1OY0A 4XAGA 4JL2A 4FOUA 2E67A 2WZEA 3PWAA 5FACA 3SY8A 3FHAA 2WMIA 4IPJA 2GK1B 4LYPA 1H63A 4XD4A 3KZPA 1HKIA 4C6PA 1EP2A 4FI4A 3MUIA 4YMZA 4JYEA 1WAWA 5E5CA 3S1XA 1IXOA 1BF6A 3IJ6A 4L4PA 5LA0A 1DP0A 3NTYA 4LQ1A 1PIIA 3PTKA 4NRSA 2B7OA 4PFHA 1DVJA 2Y0FA 3O6DA 3HJZA 3OBAA 3AQUA 4H8HA 2YDRA 3EXSA 4Z2LA 2ABAA 4ZE5A 1C9DA 4H8VA 1K8CA 4LB4A 2Z7KA 1R3YA 4S3GA 1GVQA 4ZE4A 1QK0A 4OOUA 4PODA 4JS3A 4LBSA 4TU1A 1X7FA 3LQGA 4IXXA 4EKJA 2OU4A 4KW2A 3GO2A 4ILSA 4PMZA 3HB9A 5DMYA 5MKGB 1ADDA 4H8UA 5BYWA 3BSMA 3BMVA 1FOBA 2VGFA 2ZC8A 1W1B1 2W66A 2H3BA 3V4BA 5ABTA 5XIAA 3RIKA 2QLYA 4JTGA 4KETA 1HO1A 2A5HA 4MYAA 1XHGA 3KVLA 5D02A 3WLLA 2X0YA 4WIWA 3KOFA 4U33A 1XIEA 2PUZA 3WELA 1U1HA 4XKYA 4HBKA 4X2PA 5ABFB 5AC6A 4GCAA 3UWYA 5ECVA 2AGTA 4I7WA 1A0CA 3B8TA 1P1MA 5BMWA 3CS2A 2G8ZA 5AC4A 1B2YA 4ZFCA 2DORA 4MJMA 1KA9F 3WJWA 4EPKA 3T2QA 3ABSA 4LUTA 2BXYA 2PDWA 1NH6A 4NJIA 5G1YA 1XV8A 4UZUA 2O55A 3KLLA 2GVYA 3H6OA 2WYSA 3ZSSA 4NILA 1RCXB 1E9ZB 1ZTVA 1Q63A 3WK0A 4NT0A 4D6CA 4F40A 1X1NA 3GU2A 3BSHA 2BHYA 4DYEA 3UCDA 2ZZ5A 3VNDA 4F2BA 1HGWA 1UUOA 3VMOA 2Y70A 4C60A 3BGAA 2YZRA 1Q7ZA 4DWSD 3M1ZA 1V3IA 1HP4A 4JTDA 4JX5A 2DZXA 3W25A 5C7VA 2BVYA 3L12A 4WGHA 4G5DA 2VM8A 1DOSA 3PPHA 3TOYA 2G96A 2V5LA 1DJHA 1E5JA 1IEIA 2VTFA 2WXDM 1M3UA 1JG9A 5BXTA 3UWQA 5DQPA 1FBAA 3VABA 4WJEA 5DRIA 3UR5A 4DN1A 4GJ1A 3ONCA 5JBDA 3SRDA 2CETA 1LUCA 3AS3A 4V33A 2IKIA 1WOBA 3GXMA 3R43A 1LQ0A 4V27A 3AYTA 3HZ3A 1W5NA 1YW1A 4WSKA 2V3GA 1T41A 4O8AA 4XBKA 3ABQA 4JTCA 4AVFA 1E1CA 1TRDA 1W6TA 2DT1A 3QOKA 4ZQNA 4NJGA 3W6YA 3MSDA 3G77A 3AS0A 3EA2A 3B05A 3D5HA 2YL9A 3BL3A 4UXDA 1FCBA 3NDYA 4HN4A 1JR1A 1XQKA 2W79A 1TPEA 1V3JA 2NQ9A 2R1NA 3R8HA 3LD5A 2Y24A 4PCNA 2ZUVA 4CCDA 1UBSA 4GIYA 2VR2A 1EGZA 4N2YA 1AFSA 3M16A 2YX0A 3U7BA 4B5WA 3ALFA 1U33A 2C1HA 3TW9A 3O05A 1FWWA 3M0YA 5CAHA 4DPQA 4ZQMA 3CIVA 5I78A 1JDDA 1F61A 3EDJA 4GH3A 3L5MA 3VKAA 2HEJA 4UFHA 1D3GA 2VX5A 3SCPA 3DXIA 3UGRA 2ZWZA 3UR8A 5EA9A 1U1UA 1E4NA 1SJBA 2XU2A 1OX5A 4FXSA 1ONWA 2EG6A 5I5RA 3URBA 3SCVA 3R94A 3HQNA 1QI3A 4UR7A 1TX0A 3WEOA 3M9YA 1M7JA 3OQ8A 2HWGA 3TTEA 2Z6JA 3ZR6A 1RJQA 5A8QA 1CBGA 3GZAA 4RNIA 5AHIA 4IH3A 4ATWA 2GWNA 1AQHA 2ZUUA 3KHDA 1TTIA 1CLXA 1A49A 3LSBA 3T0BA 5I00A 4EPEC 1QPNA 1PO9A 3VGEA 3W1MA 3UWUA 1VBHA 4UTTC 2VZTA 5CSSA 2GJXA 1UQYA 1ZL1A 1FWSA 3U2CA 1W9UA 5E70A 3F03K 4ALDA 1H4PA 1R85A 2VCAA 3LPPA 1FA2A 4LANA 1CYGA 3OG3A 1TPUA 3K8KA 3CQHA 4C5ZA 2C14A 1W9PA 4MUZA 3FXGA 1V02A 1HFBA 3NM3A 3T78A 4J1OA 4O19A 1YXDA 1CGYA 1TA3A 1VBRA 1G7VA 1OD0A 2E5DA 4AZ6A 3T55A 2ZZ3A 2P8CA 4DF0A 1K70A 3NL5A 1NP0A 3A4XA 1FVPA 3XINA 1KKOA 1V93A 1S2UA 1OIFA 1KRAC 2O7QA 1J5TA 1W56A 4TVUA 3SQLA 3LRKA 4DHGA 5HAOA 3CEPA 3CPGA 5I0DA 2WM0A 5T91A 1XPGA 3CGTA 4W7UA 1IT7A 2VT0A 2CHOA 4UFIA 1OABA 1UP0A 3QRHA 3S5OA 2IPWA 4GVIA 3W2MA 1G01A 3CB3A 4UTWC 1OF8A 4CN4A 4UOJA 4RK8A 4HHMA 3UESA 2XN1A 2X1UA 1DV7A 1NM9A 3FJ6A 4IISA 3TJIA 3QBUA 4DELA 4J40A 4RZ4A 3E6EA 3T7VA 1UH2A 4KFOA 4XISA 1D8CA 2V5CA 5FEZA 3FJNA 1EFZA 2Z29A 4Q7BA 5JXQA 1QFEA 4OUIA 4PB4A 7ENLA 1OGBA 3B0VC 2ZXDA 4HT3A 1AODA 2XH2A 2GDQA 4BHYA 3ARPA 2J75A 4MJ4A 4K1GA 1G4EA 1ZS2A 3OVGA 4BQ5A 1WYIA 4DJFA 3GDLA 5K4ZA 3AUOA 4JIHA 4F0MA 1VCVA 1EDGA 4Z08A 4PSPA 5FAJA 2IW0A 1VFFA 4GCXA 1OF6A 1YX1A 1OC5A 3MKCA 1H7RA 4JTJA 1AUSL 1PWLA 1UUQA 4Z2GA 4JX6A 4O15A 4HN8A 5CZ0A 4NIRA 4KIRA 3KS6A 3W7CA 4KEZA 1A53A 4KWUA 2ZWYA 4GINA 1QWKA 1X39A 1D7FA 1RSCA 4HJWA 3OVQA 4NJJA 4A8LA 4UFLA 1ML1A 4JTIA 3AIBA 1O5QA 1TYGA 1HW6A 3B0XA 3CC1A 4GI6A 1WQ5A 3CL6A 3A12A 3PTDA 2Q3OA 4J3UA 2Y2WA 1P0KA 4Y2WA 4PC8A 4JTFA 3CTTA 2A3CA 3VC5A 1FWJC 1ONXA 2VOMA 4QJ3B 1OJXA 2QJJA 3BE7A 4JFWA 2VUYA 2JFEX 4JYDA 4N6FA 4PFMA 2ATSA 3JR2A 3VKJA 4Q8UA 4RZ6A 4J3WA 1QNVA 3UZ5A 2VRQA 1XKJA 3QZEA 1E15A 4V2XA 3C2OA 4Q8VA 4UQDA 4BQ4A 4IQEA 1NARA 5LNSA 1I2OA 2A4AA 4DEFA 2V2HA 3O15A 3WMSA 1JPMA 2J77A 2C6QA 1YNQA 2V82A 3LEPA 4RR4A 4HMEA 4QE5A 1PBGA 3RPTA 2NXIA 1I2NA 4G6CA 1HKVA 1KCXA 2YXXA 1LDCA 5CPSA 5JIPA 3USZA 2IPGA 3BPWA 4G9PA 2HTMA 3BCFA 3G1DA 5JU6A 3L9CA 2WAGA 4BQ3A 3QV8A 5C2CA 3THAA 4JOMA 3V5CA 4HA3A 4LVDA 4QDMA 1I2RA 1VJSA 4PMRA 4W8BA 1GZ1A 3W1AA 2ESCA 4B3LA 4Z17A 1MW1A 1JZ4A 5BROA 3HO8A 1H51A 1WZAA 1L6SA 1HN1A 1EOKA 4LAMA 3KVKA 4DUXA 5D4YA 1XYFA 3G6LA 1ME8A 4JHZA 3NQAA 4QLLA 2QGYA 2BY3A 1NU5A 4HA0A 2AL1A 1F6KA 3QQWA 5AY7A 4JTLA 4AU0A 3O06A 2F2HA 4CGTA 2FPYA 1B30A 3NQMA 5HWNA 3KM8A 9CGTA 1E1EA 4OTKA 3HG5A 3MSRA 6PTDA 3BMWA 1WOAA 4U2ZA 3C2VA 1KRBC 2WQDA 5KINA 3P67A 2AL2A 4IWWA 3SCUA 1LLZA 3U2ZA 5DBTA 3KL3A 3MYPA 1KFJA 1NJJA 4QJ1A 1Q6EA 2MNRA 3CUXA 4UTLA 4ACZA 4CVWA 3THCA 3QFEA 4PB5A 1QO5A 3EA3A 4GYFA 2W91A 3EKLA 3W2LA 1XIDA 2FMNA 7REQA 4CD5A 2X42A 2PDLA 4NZ3A 4LC6A 1F07A 4UTJA 3U9IA 3AZTA 4LV9A 2G3FA 4UTIA 3BLIA 4L9XA 3CYJA 4XB3A 3CUFA 3GKAA 2G95A 3W02A 2Q09A 3EX4A 3IUHA 3AYSA 3BG3A 3GYCA 3P5ZA 1DXIA 1CGTA 4MG4A 3P60A 4AD1A 1X1ZA 1BYBA 2PWHA 4RNHA 4AFYA 4JXCA 1V6WA 1V3LA 3ALGA 2JKPA 3WK1A 2EO7A 3H2OA 1U83A 5JBFA 2ABBA 3V3WA 4WJ8A 1GQKA 1N55A 4AIBA 1OX6A 4MB1A 1YMYA 2B81A 2F2KA 2GL5A 1W2VA 4O0QA 1JIBA 2ZRWA 3GAYA 4YTTA 4GD0A 5CGTA 3I65A 2UY4A 3L4XA 1Q6LA 3BJTA 3UYCA 3KP1A 2ALDA 1GQIA 3O0KA 3NOEA 4BF9A 1QW8A 4ZQOA 3P81A 5ABEA 4ZR8A 4KWWA 1VBGA 3UNTA 1L8NA 3MCOA 4NNAA 4JIEA 3M0ZA 3B4UA 2OLHA 3F4NA 3SSZA 4INFA 3KVMA 2J24A 2VEPA 3OTRA 1K6WA 5K9DA 1IGWA 1GVEA 3OGVA 3CZEA 1H5VA 5F4XA 4MOZA 1ODUA 1RD6A 3SIMA 2Z28A 4N02A 1IEWA 3QH2A 3SCWA 3WLPA 3QV9A 4XBSA 4LUSB 3NL6A 2GQ3A 4P7RA 4F0SA 3VC6A 3O6CA 3KWXA 3MDUA 4H04A 3HQOA 5H8UA 3CUHA 2QV4A 4WY0F 3CHEA 1K9DA 1KFEA 2WVVA 3W7RA 5D33A 4Y96A 2VELA 2FTPA 3G1AA 4GQGA 4DF2A 4R85A 3NG3A 3QR3A 1E51A 4Z1CA 2PAJA 2Z7GA 5CJMA 1JD9A 1IZKA 1TE6A 3CHCA 4GK8A 4GFSA 1MDLA 1GOIA 3TE9A 1VHCA 5BRPA 2Y85A 2ZKMX 1F05A 1LF1A 1TQXA 2DQWA 3EOOA 1SYTA 2QT3A 4JL1A 1EKOA 2OT0A 1N7KA 4C6IA 2Q02A 1W3IA 4KCTA 2CZVA 1XYLA 4K8GA 1IXQA 3LB0A 5CXPA 3CL7A 4TXEA 1UH3A 2DV0A 5BMXA 4KS0A 1DPMA 4KCUA 1H0IA 3GTNA 4UR8A 4A35A 1RH9A 4NZ1A 4ICMA 4HK7A 1JNDA 3IJDA 5PTDA 3W88A 4QX4A 3PS7A 1AQFA 2H3DA 3ARWA 4W8AA 2DZWA 2BVTA 3LCFA 3MHGA 4XAPA 3VIHA 3T81A 1VYPX 1KM1A 4GYPA 4FX6M 3GDBA 4UTTA 2FZBA 2PTDA 4NX0A 4WR3A 2TSYA 1TO3A 1H0GA 1VD6A 2BG5A 5FEPA 4WK9A 5DXXA 1EGVA 1HL2A 3K4AA 2GJNA 4GABA 4RDVA 1O7AA 4JQAA 3SN1A 4JTAA 1SO5A 3CL8A 3NQFA 4HPJA 4IX0A 2YKKA 4D1JA 1T5AA 5DBUA 3PJWA 1E73M 1X1OA 4KCWA 4E2VA 3DU0A 4PGLA 3W7KA 1TV2A 2WMIB 1NDYA 5A5WA 3LV5A 4HK5A 1S5TA 2PBOA 3EB2A 4BWLC 4Q8PA 2VJXA 5LSMA 4JKKA 1AG1O 2ZA1A 3B06A 4F79A 3IPWA 3PR2A 1PHQA 5BU9A 4R9OA 4WRHA 4H83A 3ZXWA 2C7FA 3IJ7A 3KL5A 4YS1A 3CNYA 2XPKA 2GSHA 3VIOA 2DZTA 3MBFA 1OG6A 2CLKA 3CZJA 3U3HA 1WV2A 4I8YA 3WF0A 1DXFA 4P7LA 4ENLA 5D8WA 1KM6A 3EX1A 4ZB5A 4S2BA 4IIDA 4IT1A 3VI2A 1LBMA 2Z27A 2UV8G 4RUBA 3SUWA 2JGQA 3TKFA 1CPUA 1WXZA 4P7QA 1GYNA 1H7XA 5AN7A 1XINA 2XVGA 3HOJA 2E40A 1O94A 1JAEA 2QMKA 4JX4A 2V81A 3A21A 3L68A 4XIAA 3ICJA 4PTNA 4BI7A 2XN0A 2GGJA 3A24A 4DO5A 3WUBA 2J7DA 2GJRA 2VFHA 4N9EA 1SU5A 1YNYA 3MUZ1 3NNTA 5JUVA 4A3YA 2GGGA 2C1GA 1S46A 3OJGA 3VOJA 2VO5A 1VIZA 4XKYB 1E43A 1R38A 4PUKA 1PKLA 1QK2A 2VHLA 2WWDA 8A3HA 4AEOA 5HMSA 4DBSA 4H9UA 1MQPA 3UR7A 3QKEA 1IXPA 4A21A 1KKRA 3M6YA 3O6YX 4LS2A 4UQBA 8TIMA 5I3GA 2DP3A 2NQZA 3WNNA 4L1WA 3LHWA 3IIZA 1RK6A 3IIPA 4GYKA 4PTMA 1NFBA 1C8QA 4Z0SA 2QUVA 2RDWA 3P0WA 2V38A 2ZZ2A 3WLIA 1KV5A 5A6AA 1F3WA 3L4VA 3PNZA 2VQTA 4E2BA 1QAPA 2BY2A 2VGIA 1PPIA 3WQPA 3GU9A 5DRCA 4GZEA 2QAFA 4RV3A 2OFJA 1CB7B 2PTXA 3UYIA 4CEXC 2QDHA 4LRSA 2DDXA 5I03A 1ZPTA 3DUGA 3QN3A 2FH8A 5JMUA 3DESA 3PM6A 1BD0A 4IG2B 1XYAA 1MI3A 1WDSA 3WJZA 5XIMA 1JCJA 1SSDA 2G5WA 4B4HA 5LNUA 3WIJA 1TPC1 1UOZA 1JYNA 2FTYA 5CPMA 5BRBA 2B7QA 4FNRA 3N13A 2VVNA 3W76A 2XINA 3MVTA 4UQEA 5C9ZA 2OQLA 2WVTA 4ZB2A 5FJJA 2C15A 2INEA 4AISA 3LBOA 1BHGA 5CKSA 1TJ2A 1VH7A 1PZ0A 1DIKA 1XW8A 3WJSA 1UD6A 4LWWA 3WYZA 4GBDA 4JQ4A 4R9XA 4GFIA 5DT7A 4MIMA 3GG7A 5D9PA 4UCFA 3ME3A 1OFDA 4FPSA 4X22A 3WG6A 3MSGA 1XWYA 1S2TA 2GYIA 1F6YA 5BCAA 3UT0A 3I7SA 4O0ZA 4A29A 1NTHA 3AHXA 1BKHA 1PJ9A 2YYTA 2VFIA 2PWEA 1D2KA 4NXKA 4DBDA 5I02A 4JCLA 1H3GA 1NVMA 1UH4A 1V3HA 4TVDA 1MFVA 2ZADA 2CLLA 2QDEA 1XYCA 1P5BA 4QHRA 1Q6QA 2JKAA 5I09A 3TLQA 3SZ8A 2B7PA 3SR7A 2GVEA 3C2FA 3OHIA 3UZJA 1OVDA 3WD3A 3F5KA 2Y1HA 3W87A 2XH4A 5EFFA 3HPFA 5LXXA 2QDGA 4BF7A 1HX0A 3CO8A 3LPGA 4HNNA 4YL2A 5DMLA 3PWIA 4DY1A 1F2JA 4OBTA 5CPOA 1O95A 3BLOA 2GQ8A 3VDHA 1YADA 2WC3A 2RFGA 4V1YA 1CXIA 4H9TA 5BZAA 2PLJA 2HE8A 2QVHA 3QMRA 2GJXB 1XBVA 4S3CA 1W8SA 4M1BA 1DTUA 4JCMA 2OJPA 4BEUA 1GKRA 2Y88A 1LTDA 1KQYA 5FF4A 4LS1A 4J2MA 2E8ZA 3ZJ6A 3UA3A 3W73A 1US0A 3AUJA 2ZIDA 1A5CA 1XG4A 1K3UA 3D47A 3L2IA 3MVIA 2Z1SA 4MWAD 3WBWA 5EGRA 1UKQA 1K7EA 2ZOXA 2J8TA 4XD5A 2F8QA 3AIRA 4KKXA 1WXJA 1F8MA 1MXDA 4XZ9A 3IGHX 1O68A 5CZJA 3LLXA 4YU1A 2Y5SA 4PMDA 5A6SA 2NUXA 1FP8A 3C2YA 4R33A 1DYSA 4L56A 1ZUAX 4DXVA 3GXIA 4LF2A 1GEQA 4QAWA 5FEXA 3N4FA 4CN6A 1UC4A 2OEJA 4B9ZA 4FALA 3WH5A 4Z2IA 1WE5A 1UIOA 3FSTA 4LW7A 2HQAA 4LXFA 3UXLA 3GG1A 3VYLA 3EXRA 1K03A 2X7WA 4RXGA 2Q8LA 2VURA 1VEMA 3LLDA 3W07A 1Z89A 1JXKA 1E1CB 4CD4A 4ZOBA 4GJJA 3VKKA 2JIEA 2CKRA 3KCOA 1TJ1A 3SRKA 4CQCA 2OX1A 2ISFA 1IWAA 1OYCA 2XIOA 2NX3A 4AF0B 1OYBA 2WJEA 1UWIA 2ZA2A 1S5VA 4WY0A 4I90A 5F2LA 4CVUA 3W7NA 1UZHA 3CASA 1AQMA 1REQA 1K9EA 4O52A 1HKMA 3ELFA 4JZ5A 1ICQA 1V5XA 1M7XA 1Y8BA 2INFA 4UTKA 1A5UA 1CLKA 2IPJA 4D2JA 3H70A 4LF1A 1W3HA 1YDOA 1TTPA 1EZ2A 3WN6A 3C2EA 3B8SA 3SIZA 4AY8A 5TBOA 4GH1A 1VFTA 4S3BA 4AD2A 1D8WA 3GIPA 1JPKA 4ZGYA 2QCDA 2RHGA 3OIXA 4PBEA 5I3DA 6CGTA 3PB2A 1AA1B 2QUUA 4I9JA 1M7OA 4GISA 4O1CA 1QI2A 3EBVA 4CU8A 2D3NA 1EO5A 3HGRA 3MYOA 2QPXA 4HCDA 3RO6A 1SGJA 3GXNA 4FEZA 4HZ7A 2J9YA 1HVQA 3BGGA 2R1PA 3H4GA 4RNJA 3C0QA 1EJSC 2IUZA 3WENA 4IXHA 3WEZA 4I5RA 2YDSA 4PCTA 3K30A 3N29A 2W62A 2V2CA 4PL2A 4F48A 5AZ0A 3REQA 2CXEA 3DHDA 1W3NA 1XBZA 3JVAA 2X05A 3TNOA 4Q8TA 3ZWTA 3VCNA 4PUEA 2E1DA 1W54A 1EDQA 1Y5WA 4C6QA 1HG3A 1H61A 1L2UA 1XIHA 4GA8A 3THUA 4PCSA 4F2TA 1JUBA 1MUWA 4FNPA 3VNZA 3LLFA 3TTQA 1VFSA 1QR7A 4RE4A 2REQA 4C6BA 4X60A 1KR1A 1J9YA 1HVXA 4MWAC 3KOXA 3H21A 3QPZA 4FOJA 3BG5A 2QMJA 1RCOB 4QSHA 2BOEX 1KBKA 4V15A 2VDIA 2ZYFA 1PEZA 3GNRA 5DX7A 3H7VA 4CU6A 4ZTYA 2VDGA 2X41A 4ATDA 5LYRA 3KHJA 1QNSA 2DUZA 3CO4A 4ERIA 4HU8A 4XAFA 1XD0A 1PAMA 4P8VA 5DY2A 1J96A 2P76A 1YHTA 2FGZA 1E40A 4KEVA 3TUUA 3TMLA 1MVYA 3W23A 3LI0A 2WPBA 2YCKX 3MV01 2BXZA 4IFOA 4U2YA 2ZA3A 3WH8A 4O1EA 1AD1A 2G41A 4WKFA 2NQJA 3G6MA 4UNIA 2Q01A 3NZQA 2O9TA 3TX9A 1I0DA 2PDQA 3DCPA 2QCLA 2PRHA 3IANA 4GXWA 4C1LA 3RPDA 3U5YA 3RXZA 4GNKB 1BRLA 1V7YA 4AEEA 2PDNA 1CLVA 1PTDA 5BWFA 3GH7A 3ITLA 4O13A 1V7AA 4W84A 1XL9A 4F9DA 4UZSA 4M19A 3RRXA 3XIMA 3R79A 2Y7GA 3A22A 4PMNA 5CC7A 1JFXA 3VIPA 3SM0A 3G3MA 4UR9A 3K5XA 5GJMA 1HP5A 3CXOA 3W22A 1BWVA 5AC7A 1OGSA 4ZL1A 3H24A 4YJ5A 4D8ZA 3R4IA 3QLLA 3SY1A 4L1XA 2QYGA 4YWSA 4AH7A 4I9MA 4Q6XA 1XYMA 2EPKX 1DORA 4D6DA 3OLIA 4HNTA 3GDKA 5E0FA 1Z6KA 4PE8A 2OXNA 2X30A 2WB5A 4FK9A 1AH4A 3BLEA 2VC9A 1J5SA 4LYRA 2FZNA 4LUYA 5A6TC 2Q6ZA 3GK0A 2PDMA 4FIQA 4LH8A 3GKFA 5CZSA 3U6WA 4C5YA 3ANVA 3S8HA 2WHMA 2CBUA 3L4WA 1E0VA 4Q4OA 5KSWA 4GY7A 4TIMA 8XIMA 1B4EA 3BW4A 4ZQPA 2AKMA 3TXZA 2EG8A 1VPQA 1R3WA 4C1NB 4IX2A 3VPLA 1XI3A 3S42A 4HZ8A 3D3FA 2VEFA 1YIXA 3W26A 2X0HA 5AHNA 5CC5A 4C7GA 3VFCA 4DXXA 1EOMA 1O1HA 1XYBA 3UGVA 1BGAA 1TB3A 2PTYA 2E68A 1B9BA 4UIOA 1G7UA 1B90A 1PIGA 3TA9A 3HBLA 3LSCA 1EP1A 1SO6A 4HA4A 3WQEA 1ZCCA 3B8IA 3MV11 3KBNA 3B9OA 2PODA 4R34A 2F6KA 1EBGA 2C16A 1NDVA 1R9YA 4ATLA 4AY1A 4KEUA 4IQJA 4DNHA 4Q4RA 4O16A 2EGZA 2Z26A 3VNYA 3B4YA 2J7GA 4JIRA 4PYSA 4XZMX 1YE4A 5G4HC 4C91A 4GX9A 4NG3A 4LAUA 8CGTA 2PWFA 4LYKA 3KCJA 3SW6A 1ZP3A 1VLWA 4Z2KA 2PGEA 4DJDC 2XFFA 3OZOA 3GVVA 5KMYA 3BOLA 4FR1A 2CLOA 5HUPA 3G1SA 3MUXA 2FHFA 2XIBA 4M81A 4POCA 3P2VA 1T7LA 5HMFA 4M8UA 4FX7A 4LVAA 5CH9A 4BJHA 2GGIA 3WQDA 2JIWA 4BI5A 3V75A 3S1VA 3UR2A 1LG1A 1CZ1A 3FV9A 1GQNA 1DKWA 3A3XA 4O12A 2NQLA 3BK0A 1Y5XA 2OQHA 1UD5A 4WCJA 1XG3A 2Q71A 3NXLA 2X40A 5GVJA 4MKNA 1RBOB 4DM1A 2BDQA 3FSUA 3GBDA 1V0NA 3LCHA 4Q4SA 4BY3A 4DO7A 3QGAC 1MXSA 3W00A 3CIWA 4JHOA 2FHBA 4KRZA 4J7RA 3N34A 4LUIA 3KDNA 3L66A 4GYPC 4MF4A 1DWFM 2BZNA 1K1DA 3IIVA 4AMAA 1TE1A 3USBA 2BY0A 1IIGA 1IZJA 1XSKA 1XS2A 3LBMA 3UF9A 4TV6A 1NAL1 3VMNA 4E8CA 1OC7A 1EGMA 1EZWA 2UZ9A 5G5IA 1V02E 3GH5A 1LROA 1ISWA 3C56A 1EEXA 5A6LA 1H11A 4IGHA 1VFLA 2G0WA 3AAMA 5LIUX 4L4OA 1CGWA 4PN2A 5I7GA 2C19A 3PG8A 5DT5A 1R2TA 5FJIA 5JIWA 1BG4A 5A8OA 1QNPA 1ELSA 2Z24A 2CLPA 1Q65A 3CAKA 1AMYA 3DHFA 2I5QA 3WLNA 3JW7A 3QHOA 4IL2A 1JUKA 3EXTA 4YIWA 4I6KA 3THQA 3LRLA 4XVDA 2ISDA 3FYPA 4GKLA 2VL4A 1SSGA 4LTSA 2ZVRA 1ZY9A 2W92A 4IJRA 1JCMP 4OE7A 3T0AA 4J5NA 4JIIX 3UZYA 2R1KA 2YL6A 3E02A 1OZQA 4KMQA 3WQ8A 4X9SA 4JIPA 3HPXA 4GVHA 2W0UA 1WZKA 2YLAA 1YTEA 1M65A 2HNHA 3U48A 1HJWA 3DG7A 3WLTA 3LN3A 1EL3A 5A2AA 4IJBA 2GLKA 1RLDA 1RPKA 3TQKA 3EWUA 1F3TA 3WO8A 3WFLA 4H7VA 2Z25A 2W3ZA 3EB3A 1C92A 1ZAHA 5K2ZA 1JGMA 1PZ2A 2QR6A 4IMAA 3MWAA 4AWSA 3E2QA 1GVFA 1P7TB 1J6PA 3PBUA 5I77A 5ENLA 4DI9A 1SFTA 1TR1A 2QIIA 1JCNA 2PURA 1VKFA 2PS2A 2P1FA 1UWUA 1F74A 3V0UA 2ZC1A 1NWSA 4XSMA 2DT2A 5H91A 4H6EA 4IP4A 4NU7A 4H2HA 1I1WA 3N2OA 1H1YA 3C61A 3N9SA 3NQVA 4LNYA 2Y7EA 2QVNA 1OFOA 2X2GA 3CYVA 3S47A 1MDRA 3TCEA 5U7SA 3WH6A 4UOZA 1NWRA 4DIAA 1AJ0A 3PPCA 5KZEA 3KRBA 4IMCA 1RXOB 4ADSA 2OPJA 4DJFD 4JTEA 1KM3A 1W2PA 3VGFA 2YR1A 2ALRA 1TWZA 1XYZA 2AQWA 2ZDSA 2XVLA 4WDTA 4B90A 3PBVA 1QOXA 3AXMA 3NSNA 4TX6A 2E3ZA 2E6DA 4IG2A 4AW7A 2HXTA 3GXFA 3PUGA 4IQDA 3B8UA 1CXHA 1TUXA 1ZENA 1FKWA 2AAMA 1MNSA 2Z1KA 4UUIA 2VWSA 4A6GA 3WF1A 3PWGA 1YE6A 1TA3B 1LOSA 7XIMA 1JI1A 7CGTA 2PDYA 3VM5A 1Z9AA 3ARVA 2J27A 4HNLA 2J4GA 3W7DA 5I24A 3MHUA 2PZNA 2ZUMA 3BJFA 1KXVA 2PDBA 2PB1A 3LI1A 2J7BA 3WQ5A 1T40A 5ABGA 1ZZMA 2VC7A 2CESA 3TTSA 1MZRA 1A5OC 4WOQA 1PKMA 3KDOA 3C3NA 1JD7A 5I3FA 3UXAA 3A9BA 4R7WA 3LGGA 1W91A 1WDWA 2HSAA 1XC6A 3GR8A 5RUBA 1VFMA 4EPBC 3R0KA 4M82A 4GLEA 2H8ZA 3BMXA 4AG0A 2EXOA 3SEPA 2QJMA 1BG9A 1UR0A 4QG6A 4O8RA 1XDMA 5E9AA 1IWPA 3OBEA 5CZKA 4GUGA 1TJ0A 4PRWA 1QO2A 4ZTXA 3CLMA 4O1FA 1KRMA 2LLEA 1WKDA 3RK8A 1QWGA 2E9BA 5DELA 3MB9A 3QW4B 3OLDA 5EL1A 2YCEA 4JNMA 1L6FA 3MCMA 2J13A 2DT0A 1GEHA 4K39A 1CXFA 1PUDA 1XIIA 2QJGA 2EJAA 5D2WA 3POCA 2CZ5A 1GQJA 3IVTA 3NSXA 1D7KA 4DPPA 1SW0A 4YTQA 3ZZ1A 3CWOX 4EOUA 1K4GA 5AVNA 2WLYA 1EUNA 3ARYA 2YDQA 5MHBA 2PRLA 5EFDA 1X8FA 3EDFA 1KRCC 3VNKA 2J88A 5D05A 3EEZA 5ABFA 3P3BA 4NL1A 2WJDA 4FXRA 4NUWA 3ONBA 4QS6A 1O5XA 1A0EA 4QCEA 1R7OA 3APYA 3IRSA 4NHVA 1XLBA 1EXBA 4FX8A 1VEPA 2WNQA 3WL1A 3DOPA 4GKTA 1OM0A 3HMJG 1QNRA 4QAIA 3LM7A 4LX4A 3WX7A 3TN3A 3WK3A 3LPOA 2BTMA 3TZFA 4H6KA 4QQUA 4B5NA 1LBLA 3ANUA 2V9DA 3UJ2A 4UTUA 3WJYA 4OQVA 1SVDA 1RAKA 5U4NA 1KD0A 5C9XA 3AZRA 2RJGA 3VCCA 1Z48A 3P14A 2FFIA 2Y8UA 1BGGA 5DMNA 3HG2A 1W1PA 2X8RA 4QS5A 3WDQA 3LUTA 3T6CA 5A1AA 2OSYA 4OGZA 4LEQA 3W1NA 2PDFA 3W85A 4E38A 2PF0A 1XQLA 3LMZA 1ZBVA 5MF5A 3ID7A 4NI3A 4Y8EA 1JGIA 2VXNA 2XVNA 3W29A 2XIJA 2R91A 4MZ8A 4P61A 2PD5A 3VK5A 2Z6IA 1F3XA 1E9IA 2DVUA 3EPNA 1FWIC 1O5KA 5D2XA 2PU1A 1K9FA 2YBTA 3VZXA 1J10A 5J8LA 1W1ZA 1Q6GA 3CUIA 2HCVA 1AL7A 5T9CE 5A69A 2Y8VA 5J5DA 3BV4A 4BQ2A 3PZNA 4GC3A 3K13A 1EPVA 3MO4A 1UR1A 2YXGA 3B3DA 3DI0A 3MZ2A 3N2XA 1PTGA 5FKYA 2WHJA 3UA4A 2VWTA 4UBPC 3GHRA 2QHAA 1ONEA 1U5VA 2WSQA 3O9NA 1NF7A 1FHDA 3GD6A 3VD5A 1GPFA 3RFAA 1OCNA 2IKJA 3G8RA 4HKPA 5I3HA 1SW3A 5GNZA 4AZIA 2GVGA 3NYDA 4UQAA 5TF0A 2OMAA 1SR9A 4TMCA 1E0TA 5BOEA 1CTNA 4LALA 3L2LA 3BLKA 2Y5JA 4TTUA 4XUYA 5BRQA 1AK5A 4OVXA 3LTSA 2YBVA 1DJWA 2CU0A 1TV3A 2I5IA 4NYUA 1XLMA 2NXHA 1NOUA 2NWSA 4X0VA 3RX2A 4GI4A 2J7FA 1W0MA 3PNUA 4ZXOA 2J7HA 1KBIA 3B0PA 2QGHA 1GWJA 2V5BA 1Y7VA 2RJHA 4AZ7A 1GYLA 2VVSA 3A64A 1U1JA 3AIWA 1UR4A 4CKQA 4B16A 3RO8A 5DEZA 1UWSA 4ZO6A 4CEUC 3FLUA 1UP3A 1UZ4A 1ICPA 1PX4A 1C93A 5H6HA 2V30A 3XISA 1EX1A 2OYMA 3QQ0A 4K7VA 1F5ZA 1CB2A 3AU6A 1W32A 4H00A 4J4KA 3GIYA 4XKMA 4FNSA 2QKFA 1TV5A 3HM7A 3URAA 5M03A 2OKTA 4GQ0A 3WQ6A 3W7OA 4JFSA 3RX4A 3CIXA 5ECUA 4XG1A 5FJPA 3WLMA 3TQVA 1R46A 4KWOA 1IHIA 1JYVA 3BANA 2V6AA 4OV9A 3V7PA 1BEUA 3RITA 1BPLB 3C4UA 2VYOA 3IJ8A 3ZMRA 3TYZA 3S2JA 5BWAA 1XFCA 4XQ6A 3M7WA 4M3PA 5A94A 3DC0A 1JZ3A 3TXVA 3QZAA 3OO2A 4XIMA 4BCEA 4Y7EA 2EPNA 5FEWA 1BRLB 2PDXA 1GW9A 1DJXA 2Y89A 4X0NA 2GQ9A 3RN6A 2FQIA 1IIHA 1N8FA 4AB4A 4NAFA 3FAXA 4RKAA 4AYSA 2DPEA 2HS8A 4S1FA 1C7SA 4YWIA 4PRTA 1C3FA 4EE9A 3GFXA 3L4TA 4JTUA 1OCQA 4GG9A 2PDPA 3WNPA 2RDUA 4Y90A 2QCEA 2QF8A 1RY8A 3SJNA 3LPFA 3FVDA 2C91A 2PP1A 1WZMA 3W2KA 4HU3A 4NJHA 3LV6A 5JBEA 1V3MA 4DUVA 5F1UA 4CNTA 1UROA 4HZ6A 4WD0A 1BYAA 4E8GA 3NCOA 5C54A 1TKKA 4PTWA 1SPQA 4LS0A 2E25A 4I9TA 3KWSA 3ITXA 1KR0A 2WSRA 4H8NA 1P6BA 3H12A 3WY1A 3DEQA 1YYAA 1JRBA 1US3A 4RDWA 2QCMA 3NM1A 3WLRA 2CHRA 1W5PA 4MUPA 3TN6A 4UMBA 4HOWA 3T0DA 4QG9A 3PPFA 3C8NA 1E3ZA 4EF8A 9RUBA 3ITCA 3FKRA 1EA0A 3NIYA 2ODOA 3W28A 3I7RA 1QATA 4US5D 1SJAA 3RDKA 2DY3A 3A47A 3H2NA 1THFD 1NFPA 3CQ0A 4N42A 4LYQA 1JPDX 4S3KA 7A3HA 4XZWA 4AEFA 5H1WA 4C1NA 1CX9A 1N8WA 1NWUA 3SADA 4HTYA 1RLCL 4ZSTA 2RKXA 4AIUA 5AYYA 4YTSA 3IGSA 2GUUA 3W0KA 2QJHA 4OBSA 1VYSX 4PB3A 2C1IA 4PR4A 3TJXA 2DW7A 3EAUA 3CB8A 1HJUA 4QDPA 1F76A 1TPVA 4H9VA 3ANYA 3KTCA 3DFOA 2H90A 2ZZ7A 1DIOA 3TJLA 2VCBA 5I6SA 2FZ8A 4QJ4B 1K4HA 5CJNA 2TAAA 1RR2A 4IJCA 1FCVA 1OK4A 3MP5A 1UW9A 4UTFA 1IZCA 4GGBA 1XRTA 1P7TA 5DFAA 3HG3A 3FJLA 3INPA 3GUGA 5DCBA 3WBEA 2E4TA 3AISA 3LYEA 5CQ1A 2ZTJA 4PCPA 3UXIA 3VXGA 4QEEA 2VR5A 4ZQCA 3KEHA 2QCNA 1R3SA 1J93A 4EACA 2PTWA 2ZUNA 1KFBA 3GW0A 1L2QA 4DM2A 1AW2A 1CT5A 3BURA 4JN7A 1I8JA 1KWGA 1H7PA 1W1IE 3S9IA 1LWJA 1VS1A 2OB3A 3QVQA 1JQXA 4ADTA 2BS9A 1SO4A 3BZGA 1F7BA 2ZX6A 2E0PA 1LWIA 3KOWA 4IOTA 3RHGA 3LA4A 1FP9A 3EOEA 3OZYA 1JEZA 2WK2A 5AHMA 1UD2A 1J6OA 2F61A 2F9RA 1GJPA 4CNSA 1KXTA 4RPQA 1J2BA 3G22A 4OKDA 3TEVA 5FF7A 4MYXA 2J74A 3C52A 4JR5A 1AL8A 2NVCA 1B4KA 4MB4A 1WDPA 3N4EA 5CJ5A 3A3WA 3MC5A 4KGJA 5JH1A 3HPSA 2Q3RA 2WANA 1GVIA 4AVOA 5AYXA 1UJQA 1UP2A 4DAFA 2BGQA 3WLOA 2WNZA 3QY7A 1YLVA 4IMDA 1XRFA 3PBYA 4FLRA 3GLCA 4GOAA 3ITGA 1W9DM 2OR2A 4QNEA 4GO9A 4LGXA 3LCLA 3S6OA 4CNPA 3IARA 2EBNA 1IT0A 5MKGA 1QW7A 1SJCA 4H7ZA 3BTNA 3NUKA 1RUSA 2C3ZA 3DGRA 1TVLA 1M53A 5FJRA 3ORWA 5EPDA 3F7JA 5HDRA 3M0LA 2VFEA 3CAWA 1Z3NA 1E4LA 3VX1A 1CXKA 2PDUA 3FN9A 2QDDA 1QASA 4NYYA 3IIXA 2F6UA 4HB7A 4IP7A 3CUJA 1GG0A 1GOKA 2W61A 1GORA 3KS5A 3P61A 1MW0A 2FGBA 1G4PA 1KFCA 3NPVA 1E6SM 1VRDA 4ZEPA 2CBJA 3AWOA 1Z7AA 4F0HA 3NYZA 2MANA 2E09A 3RILA 4JTKA 4GNJA 1TZZA 3V18A 3BAWA 3FJ4A 2WMJA 3I7QA 1WB0A 4AIOA 3C5QA 2C18A 3EA1A 1YRRA 3WQVA 3TYAA 1XGZA 3ZLHA 3NA8A 5HQMA 1UR8A 2WSKA 4H1ZA 1VLIA 3W1LA 2P53A 5IBXA 3CMGA 3N6HA 1KLYA 3S2LA 4AXKA 4AX6A 3WK2A 4E2DA 4C7FA 2EF9A 5L9FA 1AQ0A 4YVVA 2YZ5A 1SM9A 5EMYA 2DZBA 3UP8A 3RR1A 3M0IA 3MTWA 1MMFA 1ME9A 3GHUA 3T08A 4UC5A 5CBBA 2DUAA 1GVSA 3SFWA 1FWEC 2V3FA 3LHVA 4JQ1A 2F7FA 2F84A 3HF3A 3U4AA 3AXXA 1OQFA 4EIVA 4Q4KA 4GVFA 2XVKA 3WDPP 3NZPA 4QTGA 2G3IA 1E72M 2YDAA 3C8FA 3V35A 2BP1A 3MP3A 5KZMA 3LNMA 1C8XA 3LRMA 3CV6A 4GHRA 1Q6DA 3GFZA 3VNJA 1P0EA 1FRBA 2ON3A 1R5YA 3KFTA 3IVUA 1XGEA 3M0MA 1AVAA 1GVRA 4M6PA 4E8DA 3ZLFA 3LENA 1VIWA 2O4QA 2R1MA 5LIKX 2DSZA 1UZDA 2AMXA 1BF2A 1XPYA 1RP8A 2Z1XA 1O1ZA 1C91A 1YBQB 1FXQA 1W9XA 3IJQA 1BVWA 1OADA 3AXKA 3N9KA 4M80A 4MFDA 4TVCA 1YDNA 4TQTA 4HIBA 4LUJA 4M0XA 1ZCOA 3CH0A 1FH9A 1TQJA 1V79A 1UD8A 3WNLA 1JCLA 3BAJA 2PD9A 1S38A 3CPUA 4QM1A 1DL3A 5XINA 3URQA 4FIRA 3CU2A 2OSXA 3ARUA 3UERA 5LHFA 2WZMA 2BNJA 4MY8A 4UQ9A 2ACSA 2NSOA 1WBJA 3P6LA 4ML9A 3GC2A 1ZJHA 4JEQA 4ORIA 3VGGA 2WSYA 1D3CA 2VEMA 3KTSA 1FH8A 2VX6A 3M5VA 4WSHA 3T4CA 1JCXA 2YGYA 4ICNA 4R3UA 5FF0A 4BKNA 1OZMA 3FIGA 3AHTA 5CC6A 3WF2A 4HSNA 3N2CA 3CBWA 3T4WA 4DJEA 3I6EA 3S4TA 1EO7A 4CNUA 1SZFA 1EWDA 1HQTA 4Q8MA 8XIAA 1TSIA 3GU1A 4O0KA 4GI9A 2ACUA 1F9CA 2A7NA 3CZGA 3ARSA 4UNLA 4NI8A 3CEUA 2ZUWA 2CLIA 1REQB 1Q6FA 3WLQA 1WKEA 2GGHA 2J7EA 3ENLA 3LXBA 3B8DA 4A8IA 1Q7MA 3E49A 4RCXA 3EWZA 5IXEA 5A3HA 1ZFJA 3S3GA 4XTIA 4K7YA 1XCWA 1FWNA 1TV8A 1S5MA 4LVBA 1R47A 2HDJA 3WBYA 1PKYA 4WLCA 3AYVA 5FJTA 1K02A 2QUTA 3W1TA 2NUYA 3TWBA 1OSEA 3LCIA 2ZZ4A 4L64A 1NDWA 4WEVX 4HMCA 3W7LA 2VR4A 1J11A 2QEZA 3S0CA 3H55A 2EPOA 2CLHA 3S1GA 1CXEA 2WZHA 3KZSA 4I7VA 4I9AA 1UWQA 2FDSA 3EMCA 4FO4A 3H8AA 4FLQA 1S3TC 1P0BA 3IK4A 5KEZA 2W5FA 4U5KA 3LX9A 3WMCA 1ZLPA 2E6YA 1BKSA 1YTKA 4BS0A 1TV4A 3SCRA 3LXAA 1G9HA 1PYMA 3CMJA 1VCGA 1QPOA 4ZFMA 1WDRA 2OVLA 5EU9A 3PZIA 5BW6A 1V51A 4LFYA 1I6NA 4JTQA 8RUCA 3NGFA 3B9EA 3TYUA 1HIZA 6TAAA 1E0UA 2D22A 4YVPA 3G18A 1V3KA 1ECEA 5A2CA 4L6OA 4ZO8A 2WJZA 3MUAA 3VIIA 3BAIA 3KBWA 1XLEA 2HE5A 1Q45A 4RLIA 3GW3A 2RGMA 4MPKA 3RUBL 3S6DA 1QNOA 4JDBA 2FMOA 3KOYA 4P8XA 4GQRA 2I56A 1VQTA 4GZIA 2WMFA 4GY1A 4CD6A 3W7EA 4S39A 3QW3A 1BLIA 5DXYA 1QVBA 5K7JA 4O28A 1Y65A 5F2GA 4E2OA 1EC8A 4HOXA 1PSCA 5I23A 4UFKA 3FKKA 1HF6A 2HMCA 3RU8X 4LRTA 1QU4A 3RJYA 5LZLA 1OEPA 3AIQA 1JJKA 3VCRA 3PANA 1JUEA 3R25A 4ZVJA 1BTCA 1JF6A 3PVFA 4IZGA 4J3ZA 3VU2A 3E74A 3NVDA 4HHLA 4OFCA 5TAOA 2G3NA 3BO9A 1DHPA 4RJEA 3WMLA 3QHMA 4FNQA 3LTPA 3MBDA 1KXHA 1VF8A 5FF3A 3WD4A 3G1XA 1HJQA 3FHQA 4LU0A 5EMUA 4K8EA 1OFBA 4UB9A 1R2RA 5AYBA 1UB3A 4HPXA 1NQ6A 2ZICA 3W4RA 5HNUA 4NNCA 3GDMA 2GUBA 3E0LA 4X63A 4AZBA 1GT8A 2AKZA 3E2SA 3VINA 4A3RA 3M0KA 2PC4A 4MPQA 1S3HA 3N12A 4H9YA 4C90A 3M41A 4EWND 5BXSA 1YPFA 4I5UA 5HUOA 3REQB 2P0IA 1Y5VA 2BODX 5KTLA 3O16A 4XK2A 3AU2A 1EJWC 2QCGA 4AZCA 1PX3A 3TTOA 1JQVA 4Y9MA 3E38A 1OFPA 2HPMA 1WCGA 3RU6A 3F4CA 4HNCA 4IIEA 4WDUA 2C0AA 4DVOA 5LIYX 1RPXA 1BYCA 1VJZA 3W72A 5LNWA 1GPWA 2GDVA 3LZ3A 3AIUA 3Q37A 2J62A 3B04A 3PJXA 4HU0A 1JVNA 1V6XA 1TTQA 2VEGA 3QFWA 5K3VA 2OZTA 1QTWA 3NQBA 5GJNA 3ABRA 2ZCGA 1TPFA 4YCPA 4HMDA 3E0VA 3KE0A 4L61A 2XZ9A 1FFRA 1KB3A 3BXWA 5AC8A 1LQAA 2WSPA 4JBRA 4CNOA 1FWDC 4GQQA 3TFCA 2PP0A 5CPTA 1CDGA 3PBGA 4W86A 3Q58A 1XH0A 3NQDA 1PZ1A 1I1XA 3N3MA 4IGMA 3UZZA 4C6DA 4EVZA 3WCZA 4JTHA 1GOQA 2ZX8A 2WQPA 5M17A 1ECQA 4K1WA 4P5UA 3VDBA 5BOFA 4Y9NA 3OQEA 1ZB5A 1I0BA 4WXYA 1EXPA 1KM0A 1SZEA 3E0FA 5G2HA 2V8ZA 4FB7A 1S2AA 5HJXA 4AZ5A 4UWMA 1F4HA 2UWFA 3O07A 3QQ1A 3IVSA 2VDHA 3PZGA 3GNXA 5DMMA 3TC6A 4YYCA 4MWAA 3RM9A 4DO6A 3TMQA 3LMYA 4GUHA 2YBUA 1TUFA 1MSSA 4L80A 3NAVA 3KCLA 2OSWA 5CC3A 3M46A 4TOQA 4C6OA 1WDQA 2O9OA 2UY3A 1C8VA 3LGDA 3F2BA 2JF6A 2YYUA 5E0KA 1PVNA 4F4RA 3F2DA 1EA9C 3UZWA 1U5JA 3FGCA 3KLKA 3VD3A 5HBFA 4MHBA 4Q7IA 3RLHA 3CQJA 1S5WA 1IV8A 2XH7A 3U57A 4EXAA 3IWPA 4QE4A 2CERA 2EKCA 1ZQ5A 4AD4A 4MLJA 3TH6A 1BTMA 3AFBA 3QC3A 1MW3A 1KXQA 3TYEA 3SBFA 3EDDA 1S2WA 4QBXA 4B3ZA 3DX5A 4TMBA 4XTDA 4GQBA 1PCKA 2WNNA 3OP2A 5M1TA 5AYIA 4HPNA 1YKWA 1ZBWA 1NSJA 4AHOA 3S2NA 3EWBX 1GOXA 4YNGA 4U28A 4PRRA 2FPVA 5K9CA 4H9ZA 1OFAA 5HPCA 1HKWA 1C29A 2CIPA 4QLJA 1DXEA 1ZU8A 2F6XA 4ZXLA 1UKSA 1JDEA 2OT1A 1XJBA 1XXXA 4M24A 1OWQA 5CGMA 4MGGA 5CZTA 4EPDC 4NASA 1VJIA 3H26A 4LVGA 3HMCA 1Q66A 2YPIA 4M5PA 2WCSA 4JN6A 4EAMA 3TVAA 1UPPA 1MQQA 4GUFA 1KCLA 4QFUA 2CC0A 7ODCA 3SQMA 3UG3A 5CPLA 1W1VA 4PMOA 2FVMA 2GSEA 1KM2A 1J79A 1QHOA 5KZDA 1ZNNA 4X3ZA 3ARZA 2PLKA 4ECLA 1VFUA 1OG0A 2D23A 3C0SA 3LOTA 2PWVA 2E6FA 1E1FA 2HV5A 3QZ6A 1XLHA 4XBJA 2H9AB 4WY0B 5H8MA 3PJTA 3Q2DA 4FXJA 3EEGA 4LUSA 2YW4A 1CXLA 4EP8C 4XX6A 3DC8A 3UEQA 4HSOA 4O1BA 3V0TA 4DF1A 4JICA 2XGZA 3W2UA 3UNDA 3NWRA 3EB4A 3ZYZA 2ACQA 4RE2A 4WKHA 3RMEA 1ISXA 1R87A 4PUNA 4DBEA 5DCEA 1RQEA 2FHCA 2PBGA 1MUCA 3H7UA 4D6EA 3ES7A 1ICSA 4JTTA 1OC6A 3BARA 2HZGA 1DJQA 2W27A 5LNRA 3ZO9A 3ITOA 4GC4A 3F2CA 1O12A 1TVNA 4R53A 4CD8A 1TMQA 4HZMA 5I3IA 5CLTA 4AQLA 5CBJA 1EJ7L 3SJ3A 3WQWA 2O0TA 1GYMA 2A0NA 5IBXC 4W8LA 1TZ7A 2A6LA 2I9UA 3ZWSA 4G7EB 2VD9A 1KCZA 2AAAA 3FY1A 2YIHA 4MB5A 4A2SA 1IR2A 3SSJA 1OIMA 2X1RA 3L4UA 3TP4A 3ZSTA 1SZRA 3RJXA 4Q8QA 1J01A 2E5BA 4PMJA 4B5XA 3VOCA 3HIJA 5B7ZA 3GVWA 4JY9A 5LIWX 4ZB0A 5FSDC 1NIUA 1R6WA 1RP9A 3PB0A 4X61A 1EIXA 3KBMA 5HQLA 3MUCA 4JHMA 1O6IA 1OFRA 2RAGA 3QKZA 1FQ0A 2PGRA 1XSJA 3QV6A 1VBJA 2OZ8A 4GACA 2EAWA 5A6JA 1B3WA 2EG7A 2V3EA 2OKOA 4FMVA 2J6VA 4F0RA 2UY2A 3NDZA 4I5XA 3PC0A 1A4LA 3T2PA 3IJLA 3NO3A 2VUNA 3UVAA 3C86A 2XISA 1L6WA 1OCJA 3GTIA 1LOQA 3V0SA 2DVTA 5DF0A 1E6PA 5CAKA 2I5GA 2IPFA 1SMAA 2Z00A 4F66A 4DZAA 1ZBKA 4QISA 3C6CA 1P4CA 1UD4A 4XWUA 3EWWA 4UTWA 1GGOA 4AHPA 3VMPA 1X38A 5F2IA 1XIMA 5HMEA 3AZSA 1DEDA 3W1PA 3R2GA 4HPGA 1U2YA 4K68A 3ZS4A 1EJVC 1SO3A 1UA3A 3V5OA 1EEPA 3N4AA 4K8HA 3UJFA 1I60A 5JQ9A 2WBKA 2HPIA 5AC5A 1ITXA 4L4MA 5A8MA 1UWTA 1QPQA 4MAVA 3DGBA 4C1KA 3UXKA 4HTBA 3TIMA 3OZMA 2WBGA 4N9DA 3HGOA 4IFKA 5SWUA 4Z2JA 3F1QA 3J7HA 4RX0A 2O4MA 4AZCB 1WUEA 4G2DA 3H2EA 5FF2A 1HZYA 4I7UA 4Z1BA 3HG4A 1FCQA 2HBVA 4E3TA 1R3TA 1Z32X 2Z1BA 3AIEA 2PLCA 3OIHA 2DIEA 5I06A 4FF5A 2ZQ0A 2MUCA 3W01A 4LJ3A 3P84A 5EYWA 4TX8A 5EBAA 4IHCA 1RV8A 4AIEA 4E4UA 5EMLA 2R9RA 4L9YA 4DI8A 1FWTA 4C6CA 4TTGA 5FL0A 4D72A 3OB8A 2HK1A 4GIAA 2PWUA 1LL4A 1U5HA 5FI8A 4M7SA 2PRMA 3TW6A 3NQ8A 4JQ3A 2RDTA 3W71A 3OGRA 3RPMA 4GX8A 1EF2A 1SJDA 1M1BA 1EYWA 2PWDA 1XBYA 2E1WA 4WHBA 1JPHA 1EDTA 5GJPA 2C79A 3NQ7A 4XAYA 4NXSA 2AGKA 3AICA 4GXMA 1UJPA 3BCJA 2P50A 3WUEA 2W67A 3RX3A 1SZGA 3LCXA 1FWAC 2TYSA 3F4VA 1GG1A 1GTHA 5LKYA 2XFWA 3N73A 2ZFAA 3R58A 1RZMA 2C13A 1U30A 3GX9A 4NKCA 3PTQA 1LT8A 1ZJAA 2GJPA 1TMLA 3I6RA 4DZHA 4JAWA 1PB0A 1W37A 4YPJA 5F7UA 3BVJA 1UHVA 1YPIA 1OINA 4XO7A 2EEXA 3CAVA 2CNCA 4U5IA 1TJPA 4R7OA 1BQCA 3LTYA 2BV9A 5HK4A 4TO8A 1JL8A 3UJRA 3VIMA 3ZVHB 4I6VA 3P62A 2OELA 5E6ZA 3EMZA 1H7WA 3T1GA 3MUY1 1HO4A 3ZT7A 3NZRA 4C7DA 1JRCA 2VX7A 3EDEA 5AVHA 5CSYA 4GWEA 3F4WA 2HK0A 4C6JA 4BA0A 3A5FA 4LCRA 3UJEA 4BEQA 2WMKA 3BW3A 3JZUA 3RCMA 4WJXA 3STGA 3WJXA 3G1FA 3SCOA 4B4FA 4Q4MA 4GO8A 4I8DA 1XRVA 1SFSA 1UA7A 4M1RA 1RJPA 2I57A 2OEMA 3OBKA 4NAEA 5E09A 2O9RA 5D37A 1PXGA 2PWGA 2XM2A 1WAUA 2R94A 4S3AA 3PTMA 4KWVA 2VP8A 5T9BG 3GC5A 2A7PA 3PN8A 4RZ5A 3TFXA 4WX2A 3T9PA 3RG6A 4FR6A 1F8IA 2OG9A 1QXLA 4IUGA 1XBXA 2J8GA 3H7RA 4V28A 4H6RA 3TONA 4QXIA 4OU1A 2ZX5A 3UQNA 4N9CA 1V8EA 2WZIA 5D9NA 1TWIA 3NGJA 4L5ZA 1GK8A 3UZXA 2WC4A 1TCDA 3FAWA 2FVLA 1Z69A 2EKGA 3WD1A 5C7HA 2FLIA 2XIIA 2D0HA 3VD4A 4LBRA 4O1AA 3GRIA 1GQLA 3NPWA 2PI6A 1S1RA 4S3FA 3POHA 4JGDA 4X9YA 1XDLA 1XISA 2GFTA 4H6QA 3W27A 4QP0A 1BSIA 3IJIA 2XM1A 4NVTA 1ISVA 4RW5A 4B2DA 4FLOA 3MI3A 1DJYA 3TYDA 2A85A 2HVNA 4YHEA 1GJUA 2WKGA 4XZLX 2OWCA 2WLZA 2VEIA 3PZVA 1WP6A 3G0XA 2V67A 3IIOA 4DUWA 3FA3A 3OU8A 3QR0A 4GZ7A 3A4JA 1XLFA 2WW5A 1G4SA 4YHGA 3STEA 4CQ9A 1KFKA 2CBVA 4Q8NA 1NY1A 3MO7A 3K1GA 3W1UA 2J8FA 4S3EA 3E1F1 1OCBA 2ZBTA 3ZM8A 1UZ1A 3I3DA 3G3DA 1BXBA 2P5NA 4JYFA 1A3HA 3CZ8A 4DZIA 3VGHA 3S46A 1A3XA 5GQBA 4ZODA 3QF0A 1V0MA 2WNWA 4L9ZA 2PSNA 4AHQA 2PEVA 4G1NA 4GGHA 1AZ1A 3LY0A 5C2GA 4IIHA 3NJ3A 2X2YA 1JZ2A 3GDRA 4PUMA 5DY3A 3N2MA 1GZGA 4I3GA 4A3UA 1KW1A 2V0TA 2GOKA 3NL2A 3B9DA 1S2CA 3VA8A 4JKMA 3IJ9A 3MMWA 4ORMA 1QT1A 1FH7A 2XGIA 4ZA0A 3ZQ9A 3M5XA 3DIPA 1RQBA 3CPRA 1V08A 3QSTA 1XFBA 4RW3A 3PJUA 3QHNA 3ECQA 2G3MA 5A6KA 5DCDA 1Q6OA 2RGLA 2VC5A 3AXIA 2G37A 2PTZA 4TR9A 5HATA 1XRSA 2JE8A 3E3HA 1KFWA 4H01A 4KRUA 3GXTA 1W1A1 3NSMA 2IKHA 5D8ZA 3RF9A 1UOKA 2QF7A 2OX4A 3FXYA 4GIEA 3M0HA 2TPSA 3Q65A 3KBVA 1X6LA 4YTUA 1VYRA 3N9RA 2DJLA 1A5LC 4C6MA 3VX0A 1M9HA 1IYXA 2OLSA 2ONEA 1CI1A 1Q13A 3G1VA 1P43A 3BAYA 4O57A 3DFQA 4DLFA 5HPOA 5EKYA 2PFHA 1LL6A 1LRTA 4DWDA 2EHHA 3KAOA 3YPIA 3K1DA 4N0RA 3OA3A 4PUJA 1E4MM 5IHSA 1CCWB 3G2GA 3ZIZA 1KM5A 3QMSA 1UR3M 4EXBA 5F4SA 5DANA 4QLKA 1UR9A 3P5YA 1TR9A 5CLWA 3CT2A 1BAGA 5D04C 1J18A 5A6MA 1LM1A 3PSWA 2NVAA 3WFZA 3QY6A 3SI9A 1G4TA 3HV8A 4DYKA 5C9UA 4PCFA 3VKDA 3U0HA 3PZOA 2POTA 3A13A 1S1PA 2Z2AA 4WDWA 3QR1A 2ZXBA 4HYVA 2NT1A 3SAZA 3BZJA 3CHFA 3S9YA 3TSMA 1X96A 3L0NA 5CG7A 1DQXA 3T07A 2VMFA 1DJNA 1GNXA 4EX4A 3VNLA 3HURA 2D3LA 4DAIA 3UY7A 4FP1A 3CQIA 2JQXA 1BXNA 3G1HA 4MNMA 1RHCA 5TQLA 4J28A 4ZOAA 1ITUA 1XX1A 4XSLA 1QI0A 1JZ5A 1EHAA 1Y0EA 4ERAA 3W37A 3BLFA 3MPGA 4GBUA 2HBXA 4BWLA 4W88A 3P74A 4MY9A 2FYMA 4DJED 1H62A 3QTGA 3APGA 2NV2A 4Q4QA 3DBPA 2DSKA 2ANUA 2FJKA 1KLZA 4LPCA 1I2QA 1IEQA 4W9TA 4GZJA 1J0KA 3G0UA 1M5WA 1UIPA 3W7GA 2Z2BA 1EQCA 1ADOA 2QUNA 5EMMA 2R82A 4RPPA 2HROA 2V5KA 3VOIA 3M6DA 1WPCA 4AYGA 1G0CA 1XP3A 4H2CA 2F38A 2VZOA 2A6NA 3NQ2A 4H41A 3UCCA 2QCHA 3DI1A 5D2YA 1KNWA 2DQXA 4N6EA 1G1YA 4AXNA 3NO5A 3N17A 4M6QA 2PLMA 4M6VA 1IF2A 5IDIA 4CD7A 2W9MA 2WPGA 5FAGA 2CEQA 3IGXA 3QGKC 4Y8FA 1FY6A 3EWXA 1Q2SA 3AROA 4GPNA 2HXUA 2O9PA 2VNCA 1OFEA 1PDYA 2L5HA 3LERA 4FSAA 2VCCA 4DWSC 1L6YA 4W85A 3SRHA 3SO7A 2BOGX 1AW5A 3SCSA 2DFAA 2JEPA 2JK2A 3OLGA 3MSYA 2OTDA 1ODZA 3FEQA 4XO6A 3TC7A 1KFLA 1QNQA 1HT6A 2J47A 1H7NA 2E6AA 2VZUA 5G4WA 4MKSA 5AHLA 3GXPA 2G50A 4CCZA 2ZE0A 1B3YA 1B9ZA 1U22A 3TYCA 1TTJA 3KRZA 2CZFA 2NQ5A 4NJKA 3WQFA 2A3EA 4US5A 3NO1A 3WH9A 3C0LA 1R3RA 1Q6CA 4WVXA 1ITCA 4ZENA 1KM4A 2Y63A 5A6BD 2V69A 3UWEA 3BOXA 4NZ5A 1UKPA 2OLAA 3L65A 4PBFA 1BFNA 1K6AA 2YA1A 4S38A 4FLSA 1XLDA 4U3CA 3ZT5A 1H41A 1Q3NA 4AWTA 4BR1A 5K9XA 4B9YA 1CECA 4Z1AA 4QEHA 4PBGA 4IGNA 1E6ZA 3VTRA 1IR1A 1MWOA 1KBBA 1H7OA 3E2RA 3GG8A 2FB2A 2X1SA 2YB1A 1QPKA 5E0CA 3OG2A 2DSUA 3EX6A 1SFLA 2CHNA 5AHEA 2X7VA 4K37A 3EKZA 3NEVA 5A8NA 2DJXA 5H8PA 2ISSA 1UC5A 4N4PA 1DIEA 3UD6A 4AY7A 2FDMA 3GVQA 3K8LA 1AMKA 3W3OA 3LNPA 1MFUA 4S3JA 3Q94A 3M4HA 2ZRUA 1YQ2A 3MZNA 4J27A 1S5NA 1O66A 2YA0A 4ZOCA 3DHUA 1K77A 2I1OA 3AS1A 4KH2A 3BICA 2BVWA 1XF0A 4XAZA 1LOLA 3ZFHA 3L23A 1RBLA 4KCVA 3GUWA 4TUFA 1EJRC 3W2NA 4G7EA 1PDZA 1T6MA 1XUUA 3TDFA 3NEHA 3F5LA 3LGEA 5T26A 4AWEA 1GOOA 4ML4A 2BBFA 3B97A 1QMLA 2CCRA 1Q85A 3W86A 1XIFA 5KITA 4L6HA 3GTFA 1RVKA 3GHSA 5LNVA 2IQDA 1FWBC 4DLMA 2IXUA 1TFVA 3P7YA 4P7OA 4YTRA 3AJ7A 3FS2A 1C7TA 3VKBA 1F3EA 1HJSA 2PPGA 5C6MA 3SCNA 4U10A 3OPSA 4C6FA 4B15A 4F3HA 3O2LA 2ZX7A 3GG0A 4J3TA 3I4EA 4H4IA 1RCQA 3PBWA 4DQWA 1UBPC 4Q6JA 1EB3A 4JN8A 1N8IA 3EMQA 1F4AA 2ZUSA 3M0XA 4MKVA 1B57A 4AWUA 2WJFA 3B8WA 3N11A 3V1PA 3LBCA 1H09A 1TRIA 3DN5A 3TWAA 4IPIA 1MRAA 4HPHA 1TIMA 4NAEB 3K2GA 1NP2A 1R3QA 3NPXA 1OX4A 3W1QA 3GFYA 2ZE3A 3G8EA 3HTWA 2QW5A 4LY8A 2XDFA 2VGBA 3P0XA 1TPWA 1TWWA 2FTWA 4R27A 1JDFA 2BHUA 3QPEA 3W7HA 3OEXA 1LJYA 5HJLA 4C6KA 3DYOA 4H19A 1MEIA 2C8NA 2J9XA 1T8QA 3CV7A 2CITA 2NZLA 3GNNA 4DWSB 4MJZA 5E1QA 3KX6A 1SW7A 2J7CA 1P0NA 3Q67A 4MMWA 3DKLA 3A6OA 1B3ZA 1SUXA 4OWGA 4XVEA 4LCQA 4XV0A 4Q22A 4MM1A 4MADA 2WVSA 4WF7A 1J8VA 3AMCA 1K8ZA 3VDCA 3GIQA 4NZFA 2G4FA 3AMGA 3M44A 4GMEA 4GIRA 2OOFA 1OT1A 3GYEA 1LYXA 1R8LA 1DWAM 1FHVA 4NZ4A 3PZ9A 4A3HA 3QOMA 2OO0A 1CNVA 1EJTC 5FIPA 3OVPA 3IUDA 4HQVA 2AL2B 1UYQA 1US2A 3FCPA 1ZHAA 1JCTA 1VFOA 4FAMA 3BUVA 2NW0A 3GBEA 3E5PA 3UG8A 2OYLA 2FZMA 4DB7A 3UWVA 3R6IA 1P6WA 3N15A 1OBAA 1YBQA 4QJ5B 5D03A 3VM7A 2ZTKA 3CM4A 3K4WA 4PULA 2WO5A 1RJRA 3W84A 3EKGA 1Z42A 3AMLA 4UQCA 4W87A 4G1KA 1LLOA 1VZWA 2Y8KA 4KESA 4AAJA 1AD4A 2H6RA 2TMDA 4E5TA 4L7ZA 2C0HA 4NNBA 5E9XA 1WDDA 2GVJA 4AC7C 3EOUA 2WHKA 4LC8A 3F5JA 3RLGA 1X98A 4DO4A 4WDXA 2ZRZA 3MMDA 3SUUA 2FKPA 4Y9OA 1J0ZA 4CCCA 1J0HA 2V2DA 5KZ6A 3L0GA 3IK2A 2YFOA 2E77A 2OZ0A 2V5DA 3VUPA 5D9OA 1LCOA 1ZJIA 9XIAA 2HS6A 3WNKA 1VAHA 4JDYA 1TX2A 5D38A 3ES8A 2ACRA 4OV4A 3GNPA 3WBAA 2D20A 4XUGA 3I3BA 3W7IA 4DRSA 1FWGC 3UG4A 1WUFA 1A0DA 5AHFA 1W5QA 2QCFA 3QV7A 2YW3A 1FWCC 5J04A 3QGVA 2GZXA 2J25A 2GUYA 1A3WA 1ZGDA 3WL0A 4Z42C 2CLEA 3M5YA 1TIWA 3GWQA 4B92A 1Z41A 3WDJA 4QG8A 1H49A 4J35A 1E70M 4P7NA 5FD0A 2ZX9A 2P0OA 3TR9A 1HL8A 2OEKA 2P3ZA 3VUSA 3MI6A 4L6DA 3TYBA 5C9WA 5HWMA 3D6NA 1Q5MA 1EF3A 1PIFA 3AIVA 3QYQA 2GK1A 3RAOA 4LVFA 3S5ZA 5HXMA 1B1YA 2HISA 3EGJA 4CQ8A 3N14A 1W31A 1M41A 1MNZA 1E55A 5D30A 3L5AA 3TNBA 3EX2A 3L4YA 1XH1A 4OBRA 3WF4A 3PAOA 5HJYA 1ZRQA 2PDJA 1GJWA 7PTDA 3O0FA 5BXPA 2VZVA 3W81A 4E4PA 1DHKA 1K8YA 2CXGA 4QIUA 4J3SA 3TW7A 4W7WA 3WDRA 1TPDA 3UETA 2A2IA 3VKCA 1L8PA 1NOFA 3O3RA 1PWMA 4AC1X 4IPNB 3GVRA 3GY1A 2GGEA 4LY4A 2PDCA 1TELA 5EMKA 3VILA 5CSRA 3W7JA 3GNOA 4HSHA 1OD8A 4WOZA 2XSAA 1QDSA 4IPPA