3GUGA

Crystal structure of akr1c1 l308v mutant in complex with nadp and 3,5-dichlorosalicylic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTVDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structure of AKR1C1 L308V mutant in complex with NADP and 3,5-dichlorosalicylic acid
rcsb
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3gugA00
4JIHA 2HV5A 5HA7A 2PDYA 3ONBA 2I17A 5JH2A 1ZUAX 2HVNA 2PDBA 2HDJA 3H7RA 4QXIA 3R94A 5LIUX 3WCZA 4GA8A 3MB9A 3LNMA 4NKCA 2PDGA 3ERPA 1Z3NA 2NVCA 4JQ1A 2PDHA 3CV6A 3EAUA 3LQLA 3RX3A 5DANA 2ALRA 1IEIA 5M2FX 4LBSA 3R7MA 3UZWA 4IJCA 1IHIA 3UYIA 2J8TA 3Q67A 3P2VA 3LN3A 1PZ0A 1X96A 4DBUA 2IKJA 1XJBA 1ZSXA 3ONCA 4WDTA 1A80A 4PUWA 2FZBA 1SM9A 4WGHA 1MI3A 4LAZA 1M9HA 4JTCA 1XF0A 2P5NA 2F38A 3FJNA 1EKOA 1Q5MA 1R38A 4GACA 2ACQA 4JQAA 3BCJA 3CAVA 3G5EA 2AGTA 3V36A 2NVDA 4LB3A 2PDUA 1XGDA 1VBJA 3LQGA 3EB3A 3GHRA 2PF8A 1PYFA 3LZ5A 3UWEA 2VDGA 1AFSA 1RY0A 3EB4A 4FA3A 2FZ8A 4WDUA 4PMJA 3GHSA 4JTDA 2FVLA 4XVEA 4H8NA 1MZRA 4Q3MA 4L1XA 4GQGA 5LIKX 2PD9A 4DBWA 5AZ0A 2PDLA 3R6IA 5C7HA 4AUBA 4PRRA 3R8GA 1S2AA 1QRQA 3M64A 4WRHA 4YVXA 2R24A 4IJRA 3B3DA 4FALA 5LIXX 3V0SA 4GIEA 3R58A 3UP8A 2IKHA 3WBYA 4GABA 2DUXA 4GCAA 2PDWA 1Z8AA 2PEVA 2CLPA 3S3GA 3O0KA 2FZ9A 4OTKA 3LENA 3UZZA 1LQAA 4IGSA 4XVDA 3CAQA 2BGQA 1EXBA 1GVEA 3VXGA 2HE5A 3V0UA 1LWIA 3BURA 4QBXA 4YU1A 4JQ3A 2IKGA 2DUZA 3RX4A 2HEJA 4LAUA 2PDPA 4F40A 3DOPA 2A79A 3BV7A 1Q13A 1RALA 1C9WA 4JQ2A 2PDMA 4EXAA 3UGRA 4Q7BA 4YS1A 2PDCA 2PDNA 3DN5A 5HNUA 3WBWA 4LBRA 3H4GA 1HW6A 4RPQA 2PDJA 2IQDA 1S1RA 3CMFA 3BUVA 5AZ1A 3QKZA 2FZDA 2PDKA 4JTAA 1YE6A 4JIRA 5LIWX 2F2KA 2PFHA 4PUUA 2IS7A 4G5DA 4LB4A 4HBKA 2ACSA 1AH3A 2IKIA 2PDFA 4WDXA 1VP5A 2WZTA 3C3UA 3G1RA 4XO7A 1JEZA 2PDQA 4JIIX 3GHUA 3U2CA 1ZGDA 2PDXA 1PWLA 1J96A 1YNQA 3LZ3A 4XZIA 3LD5A 2PDIA 4I5XA 3NTYA 1UR3M 4DZ5A 3UZYA 3T42A 5KETA 3M4HA 4QR6A 4XZHA 4GQ0A 1T41A 2DV0A 4XZMX 2QXWA 3UZXA 3UFYA 4XAPA 4ASTA 1OG6A 1ADSA 2PD5A 1AH4A 1YE4A 4PR4A 3LBOA 3WBXA 3WG6A 4FAMA 4MHBA 4EXBA 4DBSA 4WEVX 4PRTA 1US0A 4H7CA 2IQ0A 3F7JA 2INEA 4YVPA 1PZ1A 3V35A 4L1WA 1MRQA 2INZA 1RY8A 3N2TA 1T40A 1Z89A 4FZIA 1AH0A 3GHTA 2C91A 1YNPA 4R9OA 2BP1A 1HQTA 1EL3A 3Q65A 3LUTA 1S2CA 2BGSA 2HVOA 3RX2A 2ISFA 1FRBA 4XK2A 2IPFA 2WZMA 1AZ2A 3FX4A 1ZQ5A 3CV7A 2I16A 3M0IA 4ICCX 5JH1A 5HNTA 2IPGA 2PZNA 3H7UA 4XO6A 3GUGA 2FGBA 4JQ4A 3D3FA 2HE8A 3O3RA 2IPJA 1PWMA 2ACUA 4HMNA 1QWKA 3LEPA 2IPWA 2R9RA 4JTRA 4WDWA 1EF3A 3CASA 3R43A 2ACRA 3KRBA 3N6QA 4ZFCA 3MC5A 1X98A 4XZLX 3COTA 1AZ1A 3UG8A 3V0TA 1Z9AA 4XZNX 1S1PA 4YVVA 4JTQA 1X97A 5LIYX 4QX4A 1K8CA 3R8HA
chains in the Genus database with same CATH superfamily
2VO5A 3N9KA 4O10A 4ATWA 3AU6A 4D6IA 2QIWA 3VO0A 1KA9F 2PGEA 2VR2A 1ZPTA 3ONBA 3UJFA 4GO8A 2HRWA 1NWRA 2FZMA 3B8SA 4UB9A 2E5BA 1A0CA 1WQ5A 3VIGA 3HGRA 3WENA 2HVNA 3EDDA 1E6RA 3TYBA 2PUZA 3MUY1 1CGYA 4F8XA 4CNPA 2E40A 5LIUX 2PTDA 4K39A 2EAWA 2JGYA 2YA1A 4ICMA 2WC3A 2DJXA 1V7AA 5FKYA 2D22A 3L23A 1GEHA 1CNVA 4L80A 1BF6A 1EBGA 1UYQA 2Z1VA 3UERA 3WD4A 2OLSA 2FH8A 3DYMA 4LCRA 3UR2A 1EA9C 1BWVA 7REQA 1G9HA 3ONCA 1P6CA 1YXDA 4WDTA 4LFYA 1Z41A 1UD5A 1P0BA 4ZOBA 3G0XA 1H11A 1RA0A 3TC7A 1H7WA 1KLZA 2PLCA 4L4MA 3U9IA 3L9CA 3CT2A 1FBAA 3TQ0A 1E6ZA 1JDCA 4YN5A 2Y62A 3O15A 1RP8A 4ZB5A 1TPVA 5DO8A 4JQAA 3JS3A 1UZDA 2Z26A 3NEHA 1MYRA 5DMLA 5A6BD 4HA3A 4LRSA 1PUDA 5CC5A 2ZTJA 5DY3A 1A4MA 3MT1A 2QULA 2YR1A 3LERA 3E2SA 4IIHA 1AFSA 1RY0A 2AAAA 4IG2A 4J2MA 2W62A 3F5KA 2WYSA 1XLEA 1CXKA 3C2VA 5A8NA 2QCMA 4GH1A 5I77A 3OYXA 3DBPA 4IH3A 1R2SA 3GU9A 2O7QA 4K68A 2QUTA 2VRJA 3CUZA 1CTNA 2J6XA 2WHMA 4LJ3A 4PB3A 2AKMA 2D69A 3C8NA 3T8LA 2YCEA 3P8IA 2Y88A 3H24A 3AS3A 2CIPA 1YIXA 2DIJA 3NSNA 4UQ9A 4YMZA 5D09A 2NUWA 1MW1A 2WM1A 2REQA 3FXYA 5IBXA 3RRAA 1VEMA 3VIMA 1VF8A 2PA6A 4XD4A 1CCWB 4O13A 2DZVA 4LYRA 2DUXA 4K3ZA 5BROA 4Y7EA 2QDDA 2QGYA 2PP3A 4W93A 3PBWA 2PU1A 5A8GA 3O0KA 3SCSA 1O4UA 2CBJA 3SCQA 4WK9A 5DT7A 1EOMA 4N42A 1TTQA 5TNVA 1SJAA 4XVDA 3GXFA 2E3ZA 5HR6A 2RDTA 1GVEA 1IE7C 4FS9A 1XCFA 5F2LA 4AQLA 1JYXA 1T0OA 1GVYA 4IUGA 3ES7A 3UWWA 5EBAA 4TV5A 2ABAA 3TC6A 2Z2BA 3SEPA 4JTFA 3BARA 2WWCA 4N9EA 2A79A 1DPMA 1OFBA 4HCLA 4PMVA 3OHMB 1NTHA 1VCGA 4YS1A 4K8HA 3LU2A 1FCQA 2PDCA 3QY8A 1EBHA 3A5FA 2NV2A 5G4WA 4YJ5A 1YDVA 2WJEA 2IQDA 4AG0A 1TYGA 3ECQA 4ZO9A 2XVKA 1E1FA 1XI3A 3LM3A 4HOZA 3UU0A 1VCVA 1FDZA 1O1ZA 4JX4A 4CU6A 2OZ8A 2WZTA 3SUUA 4MWAA 1OX4A 2RJGA 1UOZA 2YFOA 1LT7A 5MKGB 2DZXA 3EWBX 3RRXA 1EFZA 4L61A 4A4AA 1RBAA 4PUDA 2OOFA 4MZYA 2NQLA 3T42A 2AGKA 4TMBA 3TWBA 3FHQA 3GE7A 3HPFA 3UZXA 4EE9A 1GONA 1B4EA 1DWGM 4GMEA 3W1UA 2RFGA 1HJWA 1ZBWA 1KM6A 2C1GA 2Y63A 3WO8A 4RPPA 4FXJA 3WNOA 3NGFA 3AIRA 4LAMA 1HJSA 3T08A 4S3EA 2WB5A 3AS2A 3H55A 4ENLA 3XISA 3EKGA 3FHAA 3W1RA 1VFUA 1CYGA 1NQ6A 1YXCA 1JPDX 1UA3A 1V3KA 3ARVA 2YLAA 1P7TA 3LS9A 2D0HA 1QPKA 3TQKA 1EL3A 4UZUA 1OM0A 1HXJA 2CERA 2J7BA 4HU8A 3TAKA 1RQEA 4WZHA 2ISFA 1ONWA 3LBCA 3WH8A 5AFDA 5E6YA 1X8FA 1TPH1 1E9ZB 4DJDA 1IF2A 1F5ZA 5E0FA 1RK6A 4QJ4B 1EEXA 2PZNA 1TZZA 2EGZA 2YA2A 3B9AA 4AVOA 3P0XA 2J77A 3G2GA 3GUGA 2P8BA 3U3HA 4XZ9A 2HE8A 2J4GA 3MBDA 1GOWA 1FX6A 1E71M 1JZ2A 4CN4A 3PBYA 4YIWA 4GJ1A 1ZP4A 3KW3A 4Q22A 4Y6GA 4DIAA 5CSUA 3GXNA 2IQTA 3CASA 3QF0A 1TTIA 2FIQA 3UJEA 3MC5A 1A3HA 2VGBA 4DXXA 1S2UA 4BFAA 2NT1A 5K9DA 3AIUA 3E2VA 3PC0A 4PZVA 3COTA 1UPPA 3WH9A 4P5UA 1F4HA 3HG2A 3NQFA 1Z9AA 3BW3A 4AWTA 5F4XA 3WMBA 2VMFA 2B7OA 2GFTA 4S38A 4LUYA 8RUCA 1FQ0A 1GQKA 5BWAA 2XM2A 2XJ7A 2OWXA 3CM4A 4CVUA 4XAYA 1YX1A 3SCVA 3NO5A 4ZXLA 1QNQA 3WF4A 1TVLA 4J4KA 5I6SA 5FA5A 5MKGA 3SUTA 1FY6A 1S39A 4HTBA 1EIBA 2Z4GA 1WP6A 3MKVA 5HNNA 4GE8A 2Y5EA 3W6YA 3RCNA 2WCAA 1FH8A 2QCGA 3S1UA 4QDWA 1ZS2A 4MJMA 1W9UA 4X0VA 4FOJA 3UYIA 5DXYA 1S5VA 3GU1A 4OV9A 2ZVIA 1WKFA 1HKMA 3SZ8A 2C6QA 4PUWA 1G69A 1SFLA 1IT8A 1FCBA 4W4QA 1NM9A 1KFKA 2JIWA 1M9HA 5CSRA 1IT7A 3QZAA 4A8IA 1TV3A 2YCLA 4EPKA 2D73A 3AXXA 3VINA 2OOGA 1M03A 1VFLA 1ZB5A 1J6OA 4LAOA 4D1JA 3RPTA 3KVKA 3NGJA 1DOSA 3AHVA 2PTYA 3W72A 2BZNA 4LC6A 1Q6RA 5BRPA 3QY6A 2WQDA 3SJ3A 3ABSA 3TZFA 4REQB 2V3DA 3VDAA 3K13A 5D9PA 3BC9A 1YPXA 3HU7A 3GHSA 1BD0A 3W07A 3O6AA 2FVLA 4PA8A 2GK1A 1LORA 1Q6OA 5GQBA 4MFEA 1BVZA 1JL8A 1TJPA 1TPUA 4MKVA 3ARQA 1XDLA 3PBVA 3UG4A 1J2WA 4NSBA 3RFAA 5JVLA 1WA3A 4ZQPA 1TX2A 2E7FA 3BH4A 3BXWA 4C6EA 2CCRA 4FNPA 3QZ6A 1BRLB 2PRMA 4Y8EA 5FEPA 2ASHA 3DXIA 4KWVA 5FF7A 4KT2A 2ONEA 4LS1A 2CLLA 4X9YA 4ADSA 4AH7A 4IPIA 1C90A 5HATA 3HPSA 1PJ9A 1J4EA 3KOXA 3WJWA 5K4ZA 3MQTA 3OGVA 4Z1CA 3WZ0E 3WQDA 2AQVA 3FA3A 3TTYA 3ZM8A 5KZMA 1TE1A 2ZZ3A 3R10A 3U2EA 2XDFA 1SZGA 3AWNA 5CKSA 3SR7A 4RDWA 5A6JA 2BHUA 2BGQA 3PZOA 4C1NA 1VYSX 2G3NA 3W26A 3NCOA 1BFNA 3A4AA 4KWSA 1J0KA 4Q4RA 1QATA 2IKGA 4C6BA 3UQNA 3NYDA 2TAAA 3W1XA 1KBLA 2XN2A 4FP1A 4US6A 3V5FA 3BANA 3TSDA 4RR4A 3H8AA 1TPWA 2PF0A 1UIOA 2P88A 4MB1A 1AQ0A 4KS0A 3T4WA 5A6SA 5BOEA 3ZJ7A 2PDNA 3V4BA 4ORMA 5HK4A 1XC6A 4QGCA 4FHAA 1RA5A 1UD8A 1EYWA 4JIRA 2F2KA 4AW7A 1XV8A 4PUUA 3PWGA 3EKZA 4IP5A 3MWAA 1C3FA 1GQJA 3PWAA 3JUGA 4KRZA 3KLKA 3LPPA 2ZUTA 4ROPA 1EGZA 4DUVA 4YYFA 3CQIA 1SR0A 2O55A 3EEZA 1GW9A 4NXKA 1J18A 4PL2A 3U2CA 1CEOA 3GC5A 5EPDA 3LZ3A 1EPXA 1K77A 2CZFA 2E4TA 4Q8UA 3XINA 3NEVA 3S2MA 4C1KA 1BVWA 1GOXA 3TWAA 2Z0IA 3C3NA 2YXOA 4B3LA 3IEBA 5F2GA 3HURA 3TU9A 2PD5A 5AC6A 3FNDA 1M65A 3PHAA 3S6OA 2CITA 2VM8A 1FCVA 3ZVHB 1ALDA 3I4KA 1I2PA 1V0NA 4JHOA 4UQEA 4YVPA 1PZ1A 2A85A 3CAKA 3WKZA 1EC8A 4ZENA 2C0AA 1AH0A 3GDRA 2I56A 4QSHA 1FHDA 4KPLA 4IIDA 2E09A 3NL2A 4ORIA 1S2CA 3WELA 5LSMA 2BS9A 3G18A 4C7DA 1X1ZA 3BG5A 1AQMA 2X41A 4HNLA 4CUCA 1X8CA 3QTGA 4PB4A 3LSCA 3HG4A 2J8FA 2PTZA 1C8XA 3BLFA 1LDCA 4UTWA 3IGHX 3DC8A 2ISVA 4POCA 1V02E 1TPFA 2QAFA 2YJQA 1EWEA 3LOTA 2DW7A 2NUXA 1QXLA 4LVDA 4LTSA 3DDMA 5RUBA 2DVTA 4K8EA 1TIWA 3P3BA 1ZJBA 4AZ7A 3DHPA 3W70A 3W00A 4LU0A 4REQA 4DF0A 4ZFCA 4PBFA 1OY0A 1NP2A 3E9AA 1NSJA 4N9DA 4LUSA 4TX8A 3UR8A 9RUBA 4NP7A 3GSMA 4P8UA 3AS0A 2I1OA 4PMXA 4GO9A 2PZ0A 2F6XA 2YCLB 2BVTA 2C1IA 4U3CA 4NY2A 1TWSA 1IEQA 4AHPA 1A50A 5I3FA 1I0DA 3ZLFA 8CGTA 1XPGA 2V6AA 1HKKA 3RR4A 1KKOA 4GVHA 4E5TA 1RD6A 1GG1A 3MCMA 1EF2A 5REQA 1ZCCA 2WZHA 1JPKA 5C8BB 1E0VA 4O52A 3ALFA 1OC6A 1W8SA 4LNCA 2XZ9A 5JXQA 1QUMA 1FWTA 1XHGA 2YB1A 2VRQA 5I3KA 3VOFA 3H54A 4DWSD 3BOXA 4GH3A 5JIWA 3S8HA 4GKTA 4C6OA 5KZDA 3VPLA 3W82A 3PR2A 4RNHA 2OR2A 2WK2A 1GQLA 4GNJA 3WLRA 2J8TA 1OIFA 3USZA 1UA7A 3D0CA 3VIJA 3QVQA 3BZGA 4Z2JA 2IKJA 1ZSXA 4I6KA 3EOEA 4MKNA 3QHNA 1AUSL 2I5QA 4UFJA 1KM5A 1TMQA 2TYSA 3AYVA 3W7QA 1YEYA 1EP2A 3WEOA 3CT7A 5A3HA 1GVIA 3SADA 2P5NA 4D6DA 1NIUA 3V5CA 2WNZA 1BWKA 1HF6A 2VCAA 4IX2A 4IIFA 4KMQA 3G5EA 2NVDA 5M1TA 4Q4MA 5FSDC 2OTDA 1XGDA 5CQ1A 1VBJA 1DXFA 3GIPA 4QE5A 4CNUA 4QAIA 4EWND 2P0OA 3SAZA 2C13A 1OD8A 1CXIA 3PPGA 3W02A 4C6JA 4H2CA 4GYPA 1QPOA 3R0KA 1KM3A 1TR9A 4G6CA 1XG3A 5D9OA 4BI6A 3PTQA 2PTXA 3G1FA 3O16A 4GYPC 5FCZA 4QDPA 2ZXDA 4Q6XA 3UF9A 1T8XA 2O4MA 3M64A 1XSKA 2BWGA 4W7WA 1UHVA 1PTGA 2ISWA 4MAVA 3KWXA 4Q8OA 3QW4B 1VGAA 3W81A 2TODA 3WLHA 4GFSA 2ZIDA 2A6LA 3V0SA 4B15A 2G3IA 4DUWA 3WLQA 3IJQA 3B03A 1TQXA 3KHDA 2H6RA 4QLJA 4HZ6A 3O0FA 4GI9A 4QCEA 3L5LA 5M5DA 1S2TA 3UETA 2PC8A 3CIWA 1KW1A 3IUIA 4JTKA 2C14A 2CHOA 3SW6A 1VRDA 3TFCA 3AIWA 3EA2A 3OPSA 1UC5A 1B5TA 2WWDA 4XAGA 1OGBA 1GOIA 1K70A 2QCFA 1FWCC 3JR2A 2R8WA 3BURA 3SRHA 3S2CA 3UCCA 2GGEA 1F61A 3OU8A 3W24A 3P5ZA 3K8MA 1W0MA 1S5TA 3DOPA 2Y8KA 2Y85A 2QIIA 5A1AA 3UXDA 4RCXA 3T2OA 4F2UA 3N9SA 1CGTA 3QC0A 3GYEA 4BI7A 3QPZA 1BQCA 3M16A 2CWXA 2C1HA 3VGFA 1H50A 3AYRA 5DMYA 2JALA 1HW6A 4JX5A 3VMOA 1O94A 4O1CA 1JZ5A 4S3FA 3PUDA 3TTQA 4BA0A 1YQ2A 4NF7A 4MWAB 3VX0A 5AN7A 2QPSA 2XIJA 2Z24A 3CEPA 3HM7A 3WFLA 4JAWA 4EK7A 2E77A 2IKIA 4I5UA 4ZFMA 3SUSA 4F0MA 3STEA 1VP5A 1KC7A 1AW5A 1XW8A 3C3UA 1PAMA 1R85A 1YBQB 1A3XA 4LEQA 4Q4PA 1DXIA 4HSHA 4Y9MA 4Z42C 1DKWA 4RE0A 5M03A 1E51A 4WLCA 1SFTA 1ME8A 1O7AA 1NFGA 1Q6FA 5A95A 4DZ5A 3UZYA 3BAKA 1R2RA 4U33A 4DZIA 1OG6A 3A9IA 2EJ1A 1YE4A 4PR4A 4AISA 1LCOA 2WBKA 1Y5WA 3RILA 3W86A 4QFUA 2O0TA 3QJAA 2ZX9A 4CD6A 4Q6JA 1A5NC 3VZYA 9XIAA 1FWAC 1NFPA 4I5RA 4L1WA 2YGYA 1KTNA 2GLKA 3PS7A 1K3UA 3GTFA 5EA9A 2OKTA 4LF1A 2NQ5A 3REQA 2VR5A 1JIBA 3KDOA 4R9OA 2HS6A 5EB8A 1GORA 3SN1A 3AROA 2Y24A 2OFJA 1F76A 1GPFA 4X2PA 3FA4A 4JFSA 2CZVA 5U7SA 2GZXA 4ZOAA 5XIMA 1I4NA 4P8VA 3KOYA 5ECUA 5A2AA 3W2JA 4ZB2A 3IAQA 4F0HA 1LL6A 3I10A 1WUFA 4OU1A 2DPEA 2OO0A 5LA2A 1H5VA 3MO4A 3AAMA 4O8AA 3TSMA 2VGGA 3WQOA 2B0MA 2X8RA 4B5SA 1M3UA 3SQMA 5MHBA 1Q7ZA 4Y96A 1V6XA 2A6NA 1FKWA 1OG0A 2Q02A 3TROA 1V6TA 3KM8A 2Z1SA 3N2OA 3CO8A 5J04A 4FIRA 4PFHA 4LOCA 3GBDA 2X05A 4NNAA 1CB2A 1PHQA 3U7BA 1TA3A 2CEQA 3FFSA 3RM8A 1R3QA 4F2TA 4URIA 2VUYA 4TX9A 4U4MA 3TIMA 4Q8PA 2IW0A 1MMFA 3TX9A 1A5CA 1OF8A 4LYKA 2RGLA 4A2RA 1X6NA 3BCDA 2ZRUA 4M6QA 4YVVA 1PKYA 2Z27A 2WJDA 3E49A 4C6DA 5AHMA 4INFA 2VR4A 3A12A 1H1YA 5K9CA 3GVVA 3GNNA 1HP4A 4TVCA 1PXGA 3GVQA 3DYPA 2WVUA 4CD4A 1DWIM 1TV8A 2VX5A 4IICA 4CNOA 1TFVA 1Z48A 1O5KA 1V6YA 5D2YA 1L0PA 3M5ZA 1WDPA 4AIBA 2C3ZA 4AX6A 3OVGA 3F4NA 3EX6A 3CL6A 2VD8A 1KTCA 4J3ZA 3IJ9A 4XD5A 2MNRA 2WC7A 1RVGA 2VELA 1IHIA 1XQKA 3WDHA 4LSBA 4Z1AA 4AFYA 4KERA 3IJ8A 4MG4A 4RE3A 4NX0A 2ZXQA 4NAFA 2D1ZA 4IGNA 5KINA 1H2JA 3GFZA 4L5ZA 3LLDA 3VIPA 4GUFA 5AHLA 4ACYA 4RZ6A 2GGHA 4JGDA 3GW0A 3EOSA 3KRZA 2JFEX 3G1XA 3HN3A 2DZPA 4MZ1A 2XUCA 1EQPA 1EKOA 3EWDA 1AA1B 4AIEA 2OGYA 3B8TA 3CAVA 1HJXA 3C2RA 2J7HA 1JYWA 3HB9A 1J10A 1KGUA 1SZEA 1WBHA 2W6RA 5CC6A 1OC5A 3MSYA 3VOHA 2XVPA 3BE7A 5G2WA 1KM4A 4IMDA 1UR2A 5C6MA 2CLMA 4H8HA 2A2IA 3UW6A 1HL2A 2FZ8A 1XISA 3I68A 1UIPA 4KRTA 2G41A 3KEHA 4LT9A 4NZ4A 1U1UA 4XVEA 4GZEA 3WK2A 4OV4A 1EEPA 1F05A 3E0VA 1OFQA 4JN7A 2GVLA 4DEFA 2X0SA 4PUJA 1G0CA 3VD9A 3D3AA 2WLYA 3VIKA 2VX6A 3KZPA 1MEIA 3A3WA 1UD2A 5E6ZA 3AMDA 2ZYFA 2IUZA 4XIMA 3QEZA 8XIAA 1QRQA 5IBXC 1LL7A 3Q2DA 1H51A 2ZVRA 2Y89A 3LXBA 1M5WA 2WPBA 1QFEA 4IJRA 3VM7A 1W5NA 4DUXA 3E0FA 1Z32X 1PYMA 1J12A 4AD1A 5D2WA 3M44A 4ZBCA 3J7HA 4BJHA 4GCAA 1V79A 3NQEA 2Z6JA 1X38A 3CLWA 1QOQA 3H2OA 2CETA 1QPNA 2GQ3A 4B3KA 2QKFA 3E0LA 1JF5A 2FVMA 4IFRA 4UR7A 2IXUA 1YDNA 1CDGA 3ARRA 4HMEA 3WUFA 1E72M 3MP5A 3PZ9A 3SN0A 1ONRA 1R3TA 3N11A 5BYWA 3QSRA 4WR3A 3N73A 2FPTA 3OVRA 1R3WA 2E25A 2WMJA 3RNDA 3IIXA 4JTGA 1OF6A 2C15A 3WLTA 1B3YA 4L6OA 3VUSA 1V0MA 5DFAA 4QDMA 3P67A 2G4FA 1S5NA 3AMGA 4UWMA 2FB3A 3GX9A 4DM2A 3PZNA 2JIEA 1OYBA 3PPCA 3PAOA 1OCJA 2CESA 3S83A 4TV6A 1ZJHA 4ZVJA 1PX8A 5J5DA 4ML9A 4HNVA 4HU0A 3UJRA 2VX7A 3LCIA 6CGTA 2XSAA 1HO4A 3EOOA 3GXMA 1E4IA 2GJLA 1XINA 3V7PA 3MUIA 1ELSA 1CXHA 1OT2A 3SSZA 2VZSA 1B3WA 1LJYA 2BDQA 4YHEA 3BMVA 1VD6A 2AL2B 3O8AA 4HMDA 1ZGDA 3NZ1A 2YA0A 5C0QA 1A5AA 5C9WA 3DGBA 2H9AA 4HHHA 1D3HA 2PPGA 1WV2A 4X63A 2VEIA 3C0SA 3TJ4A 5KETA 1UD4A 5B7YA 1M7OA 4W89A 3LTPA 3GD6A 2QAPA 4E4UA 1AH4A 2ZUVA 3SB0A 4MUPA 1PE1A 1N7KA 4WEVX 4PRTA 5CAKA 4HJWA 2OKOA 2ZZ6A 4ZR8A 1UBPC 4CEUC 1VJSA 1MRQA 1MQQA 4GI4A 4N0RA 4AZHA 2O56A 4P7NA 3C56A 4M6PA 4G56A 1WKDA 5HUPA 6XIAA 1JRCA 3IWPA 2R1PA 4JYFA 5M3WA 1TMHA 4PMDA 4W9TA 3QLLA 1M7PA 2ZZ1A 2NV9A 1WB0A 3KBSA 5U4NA 4WIWA 1UC4A 5IDIA 1C29A 3UVIA 4JOMA 4PTWA 1OGSA 4EPEC 3A3HA 1AZ2A 1FCUA 4HYRA 1KM2A 2WNWA 3S0CA 1T96A 3MV01 4MKSA 1ZP3A 1LQ0A 3BOFA 1XC4A 1BHGA 1DWJM 4C6NA 2ZICA 3NOYA 3AIBA 3QV6A 1JNDA 2YCJA 2J13A 2DFAA 4LVFA 1IQ8A 3S5NA 3IJ6A 3TR2A 4LNYA 4UMCA 2TRSA 4BQ5A 1R6WA 2UZ9A 1U1JA 3LEPA 3VMPA 1TJ0A 3FYYA 3WQWA 1BAGA 3EX2A 3OVPA 1ZY9A 4AWEA 1QU4A 5D2VA 1IXNA 4O17A 3OBAA 4NXSA 4S3CA 3WD2A 4M29A 5DBUA 3OOQA 1SZRA 3I6TA 3SGGA 1ZFJA 1I60A 4O0ZA 1CXEA 2LLEA 4PTXA 2PWUA 4JTTA 3RM4A 1QOXA 1E0TA 2XGIA 3MSRA 2HV5A 4Z08A 4IMFA 5EMJA 2C16A 1UUOA 5K4XA 3N2MA 4U31A 5AVNA 1QI3A 4DWSB 1TMLA 4FNQA 3R79A 1N8FA 3WLMA 3QXBA 1U30A 3EDEA 3VU2A 1D2KA 2YBVA 1AQHA 1E56A 1RJPA 3AHTA 3NPWA 1TA3B 4H9UA 1HFBA 2VEPA 4Z0JA 4AYGA 4NZ3A 1OT1A 1W37A 2O4QA 3FEMA 3VKKA 3LCLA 4H00A 1QI5A 3EWXA 3GDLA 4Z2KA 1UBSA 4AX7A 3W71A 1W9PA 4MB5A 2FFCA 1IEIA 6REQA 5DCEA 2A3LA 1DJHA 5CPNA 3CHFA 1ZENA 4AHOA 1RCXB 4MSSA 4DF2A 1RPKA 1VPQA 1J01A 3CYVA 2H9AB 1NOFA 3GVWA 5DT5A 1VHNA 4NZCA 3T07A 2FQIA 1LOQA 5C55A 3MBFA 3M0LA 3ZT5A 3FOKA 1EZ2A 1TWZA 3FJNA 3WQ4A 4UMAA 3W74A 4AMCA 5T26A 3G77A 3LHZA 2GWNA 5CBIA 3TOYA 4RW3A 1EDGA 1HN1A 2GK1B 1UH2A 3C2YA 5FIPA 3GQYA 3T05A 2BY2A 1TIMA 4OUIA 5BW6A 4RNIA 3IV3A 1LRTA 2BHYA 3GNOA 4HNOA 4W5UA 1VR6A 1DWFM 2ZUMA 1ITXA 3F4DA 3QYQA 4OT7A 1CIUA 3CUHA 1TRDA 3MS8A 1IXQA 5C70A 4GUJA 5CEWA 2G95A 3TDFA 1Q85A 3THDA 4B16A 3MUZ1 5TD4A 3GNPA 4AC1X 3IK2A 2FMNA 1W91A 2TPSA 4OQVA 3G1DA 3R6IA 1R46A 4UOZA 4R3UA 1OSEA 2GDUA 1WPCA 4AU0A 5EMLA 1V6VA 1W3JA 2V81A 4JICA 4HU3A 3DIPA 3WLOA 5FJRA 3SECA 3HG3A 3EWUA 4PCTA 2PDWA 3TW6A 3VMNA 5A94A 1MDLA 3TLLA 3QGAC 3NVTA 1XKJA 4HNCA 3KBNA 4FXFA 4DYKA 3FA5A 3DKLA 4WJ8A 1P1MA 4D6JA 2EQDA 4QITA 1JCJA 1V51A 1V3MA 1JR1A 4GUGA 3STGA 5EBUA 3I7QA 1QO5A 3KHJA 3ARYA 3BICA 1K7EA 1Q6CA 4MUZA 2H90A 1G5AA 3NO3A 3S9ZA 1GVFA 5AY7A 1F2JA 2WCSA 3OLGA 5I3HA 4PMZA 2XIBA 4PMRA 4CQ8A 3A9BA 3GR8A 4EXAA 2PC4A 3KOZA 4H83A 4AIUA 4MY8A 1MXDA 1DTNA 1CPUA 3WY1A 3DECA 5AZ1A 3TMQA 4Q8WA 1KFBA 1D7FA 4US5A 3VYLA 1RH9A 4LCSA 3GUWA 2DSVA 4YNGA 3QMSA 1W8GA 1TWDA 3EXRA 4QLLA 3B05A 1ICSA 4JIIX 3DG3A 2V2HA 5HJYA 4Y90A 2X09A 4IXXA 3CHDA 3W85A 3IV8A 5I00A 4FR6A 1GOOA 3AU2A 4XZHA 2QS8A 4ASTA 5I79A 1QNRA 1PHWA 5BCAA 3GVRA 3E2QA 2NWRA 2D2OA 1KXHA 2QCDA 1H49A 3WG6A 4JS3A 3VDCA 3G6LA 5LNUA 3MY9A 2RDWA 1WXJA 1P7TB 2C7FA 1XBZA 2DW6A 1DIOA 2WSYA 3RXZA 3TA6A 3UBPC 4FLRA 4E38A 1RVKA 1B31A 3N2TA 4AZ5A 4JY9A 4ROQA 5F4WA 3UY7A 3WQGA 3K2GA 4K8GA 1OINA 2QJIA 5LHFA 3P8JA 1CW2A 4ZGYA 4RW5A 5G1MA 5FEZA 3LUTA 3PBMA 4IL0A 2HVOA 1IZCA 4LVBA 2ZKMX 4GG9A 3H4WA 5LKYA 4MFDA 4A8LA 2Q71A 2OPJA 2WZMA 3FAWA 4QNWA 3NUKA 4C5YA 1RHCA 1PDYA 2ZZ7A 1GG0A 1XR2A 1JF6A 2VTFA 4QM1A 3QLDA 4HHPA 1XH1A 3E2RA 4UMBA 5GJNA 3SY1A 4B2DA 5A2CA 3L2LA 2PURA 3TOPA 1WDDA 1M41A 3VZXA 2ACUA 3ZLGA 3JU2A 4U2YA 3B06A 1A4LA 1E9LA 4OKDA 3HZ3A 1CXLA 5PTDA 2QPUA 3F1QA 2J8GA 4YTUA 2ACRA 4MGGA 1VFHA 1U5JA 1OGGA 3ZMRA 4P8WA 2NSXA 2HTMA 1RQHA 3VDBA 4MJZA 4S3AA 3A3XA 4GQRA 5CPLA 3KRSA 3FYPA 1L6FA 3UXKA 4GKLA 2GJXA 1UB3A 3LTSA 4UTFA 1FWBC 4FO4A 1S1PA 1DTUA 2A7PA 4PUNA 4OZOA 1X97A 5JIPA 3SBFA 3UXAA 3O05A 5EL1A 2CLOA 2CKSA 3QHOA 1GOKA 4NNBA 4M5PA 1PIFA 1O12A 4O1AA 1XLMA 3EDKA 1XBXA 2F84A 5AHFA 1QCWA 4DPPA 4GX9A 2NZLA 4WY0A 3WQCA 3NWRA 3REQB 4D6HA 4YXGA 1K9EA 3ANUA 2HXTA 5B7ZA 4HIBA 3ME3A 1DJNA 3MJMA 4WY0B 1E1EA 2UY2A 3M07A 3VE9A 3MDUA 4R33A 5IFTA 4S2CA 2YSWA 2P53A 4QCFA 3SSJA 1SJCA 1D8WA 3NQ6A 5FAJA 3W7GA 3Q67A 2WMIB 4O53A 2FPVA 5I3GA 3B0XA 5KMYA 3A5VA 2BSLA 2W9MA 3W7OA 3CO4A 4CNNA 1AMYA 1SZNA 3VD5A 2YCIX 3USBA 1I45A 3B0YA 4KEMA 4IPJA 4JTCA 4HVXA 3UVAA 1H5YA 3CUIA 5BOFA 3RIKA 1O1HA 1WDWA 4Z1DA 1QHPA 4HCHA 1I0BA 1WZLA 1ZBCA 4V2XA 1GOMA 2EPHA 3ICJA 2V5KA 1JCLA 1LUCB 1K1DA 3VIIA 3WQ6A 1JQVA 2DT3A 2X1IA 4C6QA 4Z2LA 3W37A 1W5MA 2A3EA 4RZ4A 1KRAC 3HTWA 3WNMA 4DJDC 3TXZA 3CV1A 3JW7A 3GHRA 2J9ZA 3R5EA 3W73A 4M8UA 3RPMA 2DZSA 4ERAA 3M7WA 2YL8A 3ITTA 1G1YA 1KXQA 3WJYA 1JD7A 3ZWSA 3NM3A 3P7YA 2AMGA 3MMWA 3LHTA 2GOUA 3QV7A 2VOTA 4MOZA 4AAJA 1ZAIA 4AY1A 1G67A 4FK9A 4LEFA 2GVGA 4D6EA 4C6PA 3HFTA 1MDRA 1XLCA 1H62A 2DJLA 1TCMA 3CQKA 1XLAA 2WAGA 1Q7QA 3I6EA 3M0VA 4JIQA 3HV8A 4QG6A 1GKRA 4GIEA 6TAAA 3H2NA 5HULA 2DORA 4M51A 1UZHA 1EHAA 1DHKA 5HUOA 4HPNA 2J9XA 3DEQA 4GZ7A 2CU0A 1A5LC 2ZUWA 3OJGA 5CSYA 4C6CA 4CN6A 4UOQA 4IGSA 3W1NA 3L68A 4LV9A 3PJWA 2J7GA 3T8QA 3V0UA 1ZU8A 3C4UA 4PSPA 2WZEA 2XIMA 4JQ3A 4OFCA 4CCEA 2OSXA 1Q6DA 2J88A 5FSEC 2PGRA 3TVAA 3E5BA 5A6LA 1OC7A 1CX9A 3B40A 2Q8LA 1XQLA 1Q13A 3NURA 1AL8A 1C9WA 3PY2A 3A6OA 1DP0A 3KVMA 4ZCWA 4S23A 5CG0A 3BAJA 3ABOA 3UNTA 3W7KA 1W54A 3DN5A 1EIXA 1S1RA 3RLUA 3QKZA 4ZOCA 2OELA 2FZDA 3N14A 3O6YX 2V38A 1W1TA 4MYXA 4B9YA 1A5UA 4BKNA 3SCTA 3GH5A 2V67A 2Q3OA 2PDFA 2YOCA 3CK5A 1X1OA 3TW9A 3S6DA 2Z1BA 3H2MA 4YTRA 1AJZA 1EX1A 4XZIA 4IMCA 1KQZA 3AS1A 2D3LA 5ABFB 1TJ2A 1B3ZA 3AICA 4GJJA 5DN1A 3A64A 1MW3A 5BXRA 2PLMA 2PGFA 1V93A 2WVVB 2OU4A 1OX4B 3UWYA 3A22A 1A5SA 2J62A 3EMCA 3TYEA 2W3ZA 5K9XA 4KFNA 4HT3A 1NF0A 2A21A 3UG5A 2AAMA 3IJIA 4FAMA 3G8EA 5MF5A 1UW9A 4U10A 5CPQA 3PWIA 4AEEA 3GXTA 2OYLA 3LRMA 2IQ0A 2HK1A 1AODA 3HIJA 3H2FA 4M81A 1XYLA 1GW1A 1JZ6A 2B7NA 2BVWA 5REQB 1BVNP 4J7RA 4L6DA 4QLKA 3BMXA 3GHTA 4PN2A 5C9UA 3FEQA 4ATDA 2XFYA 3Q65A 3VOGA 2EXOA 5CSSA 3LBMA 1E6QM 1D8CA 4YWSA 2Q8XA 4Q32A 1PX4A 3WD0A 4QSFA 1JCMP 4MM1A 1XCXA 1ZBKA 1R3RA 1ZQ5A 3MI6A 3RO8A 1P0DA 2QDGA 3M0IA 1NF7A 4ICCX 1EJWC 3EX4A 1WZKA 4DI9A 1UD6A 3RCYA 3ABRA 3LHWA 2OLAA 5DMNA 7XIMA 3F2BA 1IWPA 3B9NA 5D03A 4FNRA 3LPGA 2A3AA 2E6AA 4J3WA 2OCZA 3DC0A 2XM1A 3LI1A 3GLCA 4AC7C 5EY5A 4ZODA 3EDJA 3ZQ9A 5EMMA 4UFLA 3ELFA 1ODZA 1MUMA 3HFYA 1MEHA 3QYSA 5HPCA 3SCRA 1FH7A 4IGMA 4XAZA 4UC5A 4O57A 2XGZA 3B0PA 2V2DA 4UCFA 1PX3A 3O1NA 1FWGC 2Z25A 4FOKA 5FJIA 5I24A 3S46A 3B0VC 5XINA 3CYJA 3UR5A 4L9ZA 2G97A 4KBXA 1W1PA 4LYQA 5A69A 2OB3A 2HJPA 2L5HA 3L7RA 3W38A 3FK4A 4WOZA 2X7VA 2EKCA 4EANA 1HJUA 5HWMA 5FI8A 4EWJA 1G6CA 1SFSA 1ZZMA 1QASA 3BMWA 1GZGA 2WVVA 2I17A 3OLDA 1KFWA 3IVTA 3ZYZA 4NT0A 1BTCA 1NWTA 4ICNA 1CI1A 3N6HA 5C2GA 5FJTA 4L4PA 4GINA 3BLKA 3W27A 3AC0A 4J5NA 1YPFA 3CL7A 1EDQA 2FHFA 3VDGA 4AEOA 1LRNA 1SQ7A 5HMDA 1OBAA 1BWLA 3EA3A 4RKAA 4CN1A 4S3KA 3ATZA 4IGHA 3CB3A 5BXPA 1ZL1A 3B8VA 3MYOA 4KGLA 1X96A 4B5VA 3FSTA 3SUVA 4LF2A 2ZX5A 4MY9A 3GKFA 4O4WA 4WX2A 3LX9A 1A80A 3AXHA 2J7EA 1DJGA 5A8MA 4DAFA 1U5HA 4N2YA 5H1WA 2F38A 5JMUA 1DXEA 2CFFA 1UWRA 2PBOA 2HWGA 2WKJA 2RAGA 1JFXA 3VCCA 3N1AA 4WSKA 3ENLA 4KIEA 3VGBA 2VDIA 3M9YA 4KFPA 3EDFA 2PDUA 4M0XA 1BEUA 3CZEA 3SFKA 3VC6A 3UWEA 2W27A 3W1QA 1W5QA 3BO9A 5E1QA 4S2BA 1OFDA 3JZUA 1JXKA 1VLIA 4Q3MA 4JL2A 3WNLA 1O5QA 4EPBC 2J27A 3L2IA 3DKJA 4FLQA 1R2TA 2EO7A 4CQCA 4DJEC 4KETA 1QK0A 1L6SA 3CIXA 4JTUA 4ZTYA 3GU2A 2WNQA 4AUBA 1UR9A 4FB7A 4PMQA 2DU2A 3IJDA 4IP4A 4V1YA 3EWWA 4P7QA 5FL1A 3CPGA 2BXYA 1H41A 4JEQA 1C8VA 1FXPA 2GGIA 3CNYA 1GJWA 4GABA 1JJKA 1KV8A 5DRCA 4MAZA 5D30A 1XLFA 1B1YA 1TZ9A 4OHQA 2BMBA 5ECVA 3PB0A 2PWDA 5L6UA 3NO1A 3TXVA 5F2IA 1NDWA 1XRVA 4V27A 1YW1A 4X0NA 1S3HA 4XZBA 4WHBA 3BAXA 3CWOX 1JZ7A 4D1IA 5HMEA 3KBWA 2HE5A 5CPOA 1RLCL 3C52A 2R14A 1KWGA 2Z2AA 2WSKA 4AF0A 4XV0A 3AO0A 4HD5A 2HEJA 1MXSA 2PDPA 2HSAA 3UY8A 3KOFA 4A29A 4NRRA 1ESWA 2QUNA 3TP4A 3A13A 3BOLA 1N55A 3I3BA 3SQLA 3LV6A 4L64A 2QMJA 4GY1A 4GXWA 3U7VA 1KNWA 5CPSA 3T0BA 3W2KA 2ZX8A 2XIOA 2PP1A 3CMFA 4R53A 3GKAA 4ZOEA 2HZGA 1KRCC 4LX4A 1S46A 2SFPA 3MW7A 4IX0A 4KRUA 3P0WA 5AOUA 3F5LA 3VNIA 3M0MA 3WNNA 2PE4A 1QK2A 2DSZA 3KZSA 1UWTA 4HP5A 4ZO8A 5F1UA 2ZZ2A 2NX3A 1LBFA 1SU5A 3DAQA 2YDRA 1CLKA 4IISA 5DQPA 1JQXA 4QR6A 1T41A 3VIHA 3M5XA 4WY0F 3TH6A 1Y5XA 4EXQA 2W67A 3IGUA 2J74A 3L5AA 1V03A 5A6BA 3CWHA 3M0HA 3UZ5A 1N8IA 3BJTA 1BLIA 2DSKA 2VKZG 2NV1A 4D9PA 3BLLA 2INEA 1Q65A 1PIGA 3RR1A 1FOBA 4LBUA 3P82A 3LGDA 4P7RA 2NX1A 4H6QA 4LS2A 3SY8A 3IGSA 1FWJC 1UJQA 3UJSA 1UR4A 5E9AA 2C91A 1ECEA 1AW1A 5FEWA 3HQPA 4GGHA 2XH0A 3OBEA 3DFOA 4E3VA 4WCJA 1VHCA 2OT0A 5K3VA 1JZ4A 4GI8A 3RX2A 5CJNA 1FRBA 2QNEA 1E5JA 3C0QA 1AG1O 3VIOA 2IPFA 1RJRA 3RU8X 3H4XA 3GH7A 3K1GA 1JCXA 5BNKA 3S2JA 2IPGA 3OIXA 3EX3A 3NPUA 3LCXA 1BGAA 3ZIZA 4D8ZA 5CZ0A 2ZCGA 3NDYA 1DQXA 1GTEA 2WMKA 3FV9A 2QJNA 4X22A 3W2MA 3ZJ8A 5CGQA 2CHRA 4MDPA 3BLIA 1UKPA 1MZHA 4N6EA 3T2QA 1IEWA 1W56A 1QWKA 4RDZA 4E6MA 2VWTA 4PTMA 2JEQA 5H8PA 1WZMA 1HJQA 2QCDB 1JNEA 3R43A 3GDKA 4JTEA 3HBLA 3TKFA 3U6WA 2I9EA 4JTHA 3NSMA 1TRIA 2WLZA 1DV7A 2Y2WA 3AJ7A 1GT8A 2GPTA 4G9PA 2VCBA 1FP9A 4DBDA 2WHLA 4UTIA 4PMNA 3VAVA 1K9TA 1K8CA 1EJRC 3KRUA 4JIHA 4JFWA 2P50A 3KXQA 2OT1A 1E70M 2VOMA 3MUCA 4Q4QA 1HVXA 3VGHA 2EBNA 5GNZA 3DYOA 1L6GA 5AC8A 4QS6A 2YXXA 2PDBA 5LNRA 3S9YA 4DX3A 3OA5A 3GG0A 2BOFX 1XH0A 2TSYA 1E15A 3PVFA 3GAYA 3B9DA 4NZ5A 2NVCA 1J79A 4ALDA 1I2NA 2INFA 3SURA 3UWZA 2ALRA 3APGA 2X1SA 4QG8A 4D6FA 4KEUA 4RDVA 1FWWA 2DUAA 1XP3A 5IHRA 2ZZ5A 1GHSA 4OIFA 1FH9A 4CNSA 3LN3A 2ISDA 2VEGA 1XJBA 2DQXA 2HPIA 3EBVA 4P7LA 2FTWA 4XIAA 1X6LA 3G8RA 3NQGA 3QKEA 2OWCA 2ISSA 3V16A 1U1HA 1S5MA 1SM9A 3LXAA 4H9TA 5E70A 3IVUA 1MNSA 1V3IA 3M0YA 4FNTA 1BKSA 1YHTA 1XYCA 2AGTA 3OGRA 3W1PA 3ISIX 5G1YA 3FGCA 1M7XA 1QNVA 4EF9A 2NT0A 2PF8A 4HU4A 4TR9A 3W84A 5EGRA 3PG9A 4M56A 4UXDA 1C7SA 2PSNA 2X30A 3MDWA 3B4YA 2BY1A 3ARWA 3NL5A 3NQ2A 2OYKA 4IPPA 2E6DA 4O11A 2FHBA 5I3JA 4HQVA 2G96A 1XLIA 3PJTA 4QE1A 1H7NA 2ALDA 1JFHA 2V5DA 1F6YA 4Y8FA 4G8TA 4IFKA 1TTPA 3O2LA 1QI4A 2GSHA 4AYSA 2VYOA 1F74A 1MVYA 4UIOA 5LGXA 4JHZA 3WEZA 5J8LA 3HPAA 6REQB 2YCKX 1H0GA 4ZEPA 4Q33A 4JTIA 2F2HA 2ZUNA 3UD6A 1D9EA 4GXMA 4CQAA 2PRLA 1VBGA 4PRWA 4A21A 2REQB 1W1A1 5D38A 5HINA 5GNYA 3S3GA 1A53A 2CBIA 2FZ9A 4QQ3A 4H9ZA 4MJ2A 3GDMA 3H6OA 4ZZ9A 4NJGA 1U5VA 4O4VA 2Y8VA 3BCFA 1KCKA 2J7CA 1LWIA 5D8WA 1Q66A 4QBXA 1ZRQA 1VBHA 4LPCA 3MZNA 3TTSA 3KFTA 1QI2A 3OP2A 3ABXA 1LROA 3A47A 4BWLA 3VNZA 2E5DA 2VWSA 2VT0A 3A4WA 4K36A 3SCWA 4UFKA 2ATMA 5FJJA 4Q7BA 2QDHA 4IG2B 1E4MM 1UMLA 2HBXA 2BBFA 1REQB 4BS0A 3T09A 3OEXA 2PDKA 4DO5A 3M6YA 1OEPA 3PPHA 4LW7A 1NOUA 4IP7A 1VB9A 4DBEA 2ANUA 4K1GA 1UWSA 4MY1A 3W4RA 4WDXA 4MF4A 1FWFC 5A6MA 1HG3A 1UUQA 3LDVA 1XDJA 3WMSA 2AQWA 5JU6A 2Z7GA 3PPFA 3WUBA 2O9RA 2P1FA 3AMCA 1JEZA 2DZBA 3WK3A 4CD8A 1J96A 5BRQA 1SO6A 1T5AA 1UR3M 4TX6A 3OIHA 4JHMA 5FF0A 3WLKX 4F48A 2FLIA 1JUKA 4DNHA 3TA9A 1X1NA 3HOJA 3IJ7A 2XSXA 4TMCA 3N34A 4LALA 2NLYA 4BK9A 1P6WA 4ZMGA 4I6VA 2A7NA 4K37A 5TBOA 4RXGA 1WUEA 4LANA 4KCUA 4MDOA 1MQRA 4N7QA 1TX0A 1OD0A 1BSIA 4UNKA 3F7JA 1LLZA 3LY0A 3G1SA 1VPXA 5CC3A 3KAOA 4X9SA 2RDUA 2BXVA 3T44A 3WYZA 3TK7A 4PODA 3LYEA 4LV4A 2PBGA 4S3GA 2OSYA 1UWUA 2P3ZA 1XRSA 3GRIA 1O5RA 3MSDA 3K46A 4FXRA 3E96A 2Y5SA 5D02A 1GWJA 1XYAA 3DBNA 1IT0A 2Y7EA 3N18A 1EJXC 3KWSA 2PWHA 1P5BA 1ZCOA 4Z2GA 1XSIA 3BWWA 1N2VA 4S3DA 4XO6A 1F7BA 4M80A 3E3HA 3ZFHA 1PKLA 4ZQRA 1F73A 1NARA 2FGZA 1WDQA 1XIBA 3EYPA 3TAOA 2ZA3A 3VOIA 3HJEA 4HYVA 4H6RA 3TZNA 3OVQA 3LPFA 3TE9A 2F7FA 4H7ZA 1GNXA 1NEYA 3HO8A 3KRBA 3N6QA 1R47A 4UTHA 3MZ2A 2XN1A 3ITXA 1VFTA 1DJXA 2FB2A 4HYWA 5I02A 1XYFA 5C2XA 3W88A 3HF3A 5AC4A 3KVLA 1QHOA 2ZRVA 3W7EA 4M24A 2C18A 2G3JA 3L0NA 2VVSA 4H6KA 1UKSA 4XZNX 3THCA 8XIMA 1A5BA 3WQEA 3NDOA 1GVOA 3T78A 1J5TA 3G24A 2BY3A 2PDYA 3FYOA 4B5NA 3C6CA 3MANA 4CQDA 1W2PA 3VI2A 1S3TC 3R94A 3E12A 2AL2A 1EC9A 3WCZA 4F0RA 4JDYA 4AZBA 3LNMA 2CXGA 4H3DA 2J24A 4A3QA 5FF3A 1XFCA 2QV5A 2CHNA 3N12A 3SI9A 2V5JA 2Z00A 4AD3A 1B2YA 5DANA 4I8DA 2XVNA 4CCZA 3U5YA 2FDMA 1CLVA 4PB5A 4FI4A 3NQ7A 2X40A 1XL9A 2OEMA 1N82A 4BEUA 4DBUA 3TJIA 5GJPA 1T7LA 3PZGA 3T0AA 2W66A 3VFCA 1IGSA 2BHZA 2XH4A 3GR7A 3AYSA 4CVWA 5CZJA 5CGTA 2I57A 3S5OA 4ZSUA 2OO6A 4R9XA 1GCYA 1W32A 3AOFA 2BVYA 4MWAC 3EXSA 1B90A 1R38A 4CNTA 5CBJA 1ZHAA 3B04A 3PBUA 3FXGA 1XGZA 4B92A 1VFOA 3P93A 2VL4A 4U5KA 5D32A 3WBAA 3W75A 5CPMA 5BU6A 4DELA 3V36A 4LRTA 1G4TA 3P62A 4U5IA 3BLPX 4WXZA 1PYFA 4M82A 4M1BA 1WKEA 3CPUA 3PZVA 4WDUA 3EA1A 4ADTA 4MJ4A 3URNA 4QAWA 1GZ1A 7ENLA 4QHRA 1U83A 1IIHA 2HS8A 2WSRA 5F7UA 3WMCA 1WO2A 3DI1A 2VEKA 1R9YA 2PDLA 1VZWA 5KEZA 4NAFB 3W7IA 2Y5JA 1O66A 4GZJA 3HGJA 3VGEA 1NVMA 2XSBA 2R24A 1FHLA 1V5XA 1Q63A 3GFXA 3Q58A 3QQ1A 2YBTA 1EJ7L 3N6JA 4JCMA 2IKHA 3N15A 3UCDA 3U8GA 2XZ7A 4DJFA 4UTJA 3WLIA 1ONEA 3HQ1A 4FF7A 3QGVA 4M1RA 4N4QA 8TIMA 2PEVA 1IIGA 2CLPA 1BF2A 3NPXA 2EF9A 3NXFA 4GHRA 3LENA 1KBBA 2B7PA 5D2TA 5C9RA 4GOAA 1FXQA 4ML4A 1UG6A 3GDBA 1F3EA 1JYNA 2QJMA 1ZJIA 4JTJA 2IXVA 2EPNA 1K7FA 1B3VA 4ZXOA 3NL6A 2NQHA 3U4FA 3OG3A 3BW2A 3QRHA 3CQ0A 2DY3A 2VC6A 1TE6A 3T81A 2GWGA 4JNZA 2PODA 3DGRA 1VJZA 4PFMA 1BXBA 3AHYA 3W7LA 1OJXA 4MYAA 3BUVA 2CXEA 4I9AA 3SJNA 1Q3NA 3MYPA 3WLNA 1YE6A 4D6CA 5KZ6A 4PBEA 4TU1A 4RX0A 3HPZA 3ALGA 2VI0A 3LNPA 3IUHA 1TELA 4J35A 1V3HA 2G8ZA 4NRSA 4DXVA 3RMJA 1EP3A 2QMKA 3IPWA 1S38A 3G1RA 3RJXA 2WC4A 4HZMA 1DVJA 1XYMA 3ITCA 5I23A 2V82A 3BJSA 1PWLA 4W85A 3WX7A 1HKWA 2GVEA 2PI6A 3NTYA 1K9DA 3B97A 1WYIA 1DJQA 3VOCA 1H7XA 5KTLA 1V3LA 2ICSA 3THQA 1UWIA 3WIJA 4R5EA 3GTIA 3NIYA 2Y8UA 1Z7AA 1I2QA 2CLFA 3JRKA 4O1FA 3F5JA 3WBXA 2E28A 2Z28A 1YTDA 1W1VA 3ZXWA 1QDSA 1SW3A 5H6HA 5E9XA 2A3CA 2JKEA 3WUGA 3S5ZA 2AQOA 2CLHA 4AXNA 3UG3A 2MUCA 1VFMA 4NJJA 5I09A 3U4AA 4F4RA 4IFKB 4NZFA 5T9CE 4CCCA 1T6MA 4XX6A 3TQPA 2NVAA 2ZTKA 4HPHA 2WKGA 1WCGA 3ATYA 4YCPA 1UP2A 4C60A 3N2XA 3DHDA 1FWHC 2VFHA 3GC2A 4AMAA 3MPGA 1DWAM 2QCHA 4C91A 1IR2A 4HPGA 4ERGA 3RUBL 4H6EA 4CD7A 1PPIA 2YDSA 5GVJA 3FS2A 2OSWA 5HNTA 4E2BA 3NPVA 4NVTA 1K02A 3QPEA 1R0MA 3O06A 4EF8A 4GQQA 1ZLPA 1IXPA 2OWWA 3SY5A 4WF7A 2O92A 2PB1A 2JBMA 2V3EA 4JTRA 4Q8MA 3GK0A 4W8AA 4Y2WA 2VQUA 4LUIA 2F8QA 1GKPA 3DG6A 4S3BA 3URBA 1C93A 2CLEA 3FY1A 2NUYA 2WMGA 3KTXA 4Q8QA 3QTPA 1AZ1A 4L6HA 1P48A 4HN8A 4EKJA 2J7DA 4FOUA 3O6CA 4LH8A 1JULA 5D05A 3PF3A 2OGJA 2R91A 1SW7A 1WAUA 3WF0A 4ECLA 1BPLB 1KGWA 4JCLA 3ORWA 2C0HA 3DCPA 2QF8A 1G4SA 2E9LA 1W1YA 2W0UA 2ADAA 3M0JA 1M6JA 1MFUA 2QCEA 3ANVA 1D3CA 2V30A 3I7RA 3LMYA 1M01A 5JH2A 3PUEA 1KQYA 4QXIA 4QNEA 3C61A 3G1VA 3VGGA 2WVSA 1OYCA 4F9DA 1XCWA 3H70A 4GA8A 5M17A 2PU0A 2WBGA 2CZEA 3S1GA 1K8ZA 3NSXA 4JQ1A 3V18A 2F61A 3NVDA 1E6XM 2X16A 3NA8A 3SDOA 3HJZA 2GOKA 5E5CA 5C2CA 5LNSA 4H9XA 3OBKA 3WDRA 1VIWA 5DF0A 4IHCA 5FJUA 1SO4A 4XD6A 3P2VA 3KL3A 4K7VA 1UOKA 3LGGA 5HAOA 4KEVA 4HNUA 2YXGA 2CBUA 1BG9A 1MSSA 4J3XA 1ZTVA 3IARA 1SO5A 2VUNA 3AMKA 3DFHA 4NG3A 5HQEA 4DY1A 3WUEA 3AWOA 2V68A 2ACQA 2H8ZA 4DZHA 5LZLA 1CLXA 3QV9A 4H01A 1UUMA 2QCCA 5G5IA 2XVLA 3B9EA 4D72A 3MTWA 3LTYA 1ZNNA 1HKVA 3WK0A 3LQGA 1I6NA 4KH2A 3EOLA 4F66A 3N4AA 4DXKA 1JCNA 3SIMA 1UROA 1XS2A 3GS6A 5H2ZA 1A49A 4C5ZA 4V15A 3RJYA 1W3NA 3GXDA 4JTDA 4D8LA 4E2VA 4H8NA 1MWOA 1WDSA 3BW4A 2R1NA 3S1VA 1LBMA 2XIIA 2XIQA 3KCLA 2OMAA 2EKGA 3G3MA 4IQJA 2EPKX 5ABTA 4W8BA 2VX4A 4B2DD 4MNKA 2YL9A 2Q01A 4G7FA 3I65A 1PV8A 2BVDA 5AZ0A 4O16A 3MCNA 1KRMA 3TTEA 4WUIA 3WQFA 1U22A 2QEZA 3R8GA 2AMXA 4MIMA 1CGWA 1MQPA 1Q6GA 3GY1A 5BXSA 3ZLHA 1XLJA 2BLEA 2WJFA 3FJ6A 2FPYA 1D7KA 3B3DA 4QJ1A 3S1WA 5BRBA 1EGVA 4KWOA 3GG1A 2UY5A 3DFPA 4GLEA 4AY7A 3NJ3A 5JBEA 4M7SA 1OZMA 1J93A 3ITLA 2FTPA 3TYDA 3S6TA 1OCQA 3P81A 1SJDA 4GIRA 1UR8A 1NWUA 1PO9A 4RL3A 1LQAA 3T4CA 2PWEA 3WN6A 1H1NA 3WJSA 1Q8AA 1SMAA 5FJPA 4QJ3B 1QW7A 2XFRA 1TVPA 4YU1A 4LCQA 4DI8A 2DT2A 2DT1A 2FGLA 3LCWA 1OYAA 2HVMA 4I90A 4R34A 4GC3A 4TVUA 4F0SA 3CB8A 1IR1A 1W9BM 3K5XA 3H21A 5A5WA 4WOQA 1HGYA 3MI2A 3H4GA 2AL1A 3LLFA 4DNMA 4FX6M 2CLIA 5CLWA 3LLXA 1X39A 5AYYA 1KTBA 2PFHA 1HL9A 1FDJA 3NQMA 5BZAA 3RITA 1PSCA 3VE7A 1R3SA 3TN3A 4K38A 4M3PA 3E1F1 1E40A 3BQ6A 1R9ZA 1KR1A 1FFRA 4BF7A 1XBYA 1XWYA 3BL3A 4AIOA 3IIPA 3QM3A 3PNZA 1HT6A 2O9OA 2DH3A 4ZSTA 4MB3A 2WO5A 3G6MA 3GDTA 1DE5A 3DG7A 3ZS4A 4QE4A 4GQ0A 4XKMA 1NDYA 1CZ1A 2J47A 2CKRA 3KCJA 1HNYA 4UQDA 4DQWA 1PKMA 3AUOA 3AMLA 4XB3A 3LBOA 4G1KA 1XFBA 3H23A 1W3KA 4CLMA 1B30A 2C79A 4WKAA 4TXEA 2D2JA 4JL1A 4DJDD 3MV11 5TAOA 1JDAA 2Y1HA 4QJ5B 1DIEA 1JUBA 4NJIA 1Q6QA 3POHA 5DXXA 1L6YA 5EMKA 2BP1A 3F4CA 3UNDA 1AJ2A 2XU2A 2H3BA 1US3A 4Z2HA 3NDZA 2JQXA 3PG8A 2V5CA 2PCEA 4XKYB 4XK2A 5DBTA 2WNNA 2DZAA 1F07A 4Q7NA 2OQYA 4MLJA 3N2CA 3P84A 4NAEA 1VBUA 1J0IA 2Z1XA 2Y7FA 2YLLA 3KBMA 3TN6A 1NDZA 1EGMA 1T99A 2VRKA 3I3EA 1WDRA 2VP8A 4L65A 4BWLC 3CQHA 3P60A 2F6UA 1NELA 1S5WA 2DT0A 1PWMA 2X1UA 1RPXA 5EKYA 1K7XA 4HMNA 1E73M 1Y8BA 1PZ2A 2R9RA 3OW1A 4DF1A 3AIQA 5A8OA 1O6IA 2ESCA 3PBGA 1PTDA 3ZVHA 4DO7A 2XHYA 1BYCA 3N04A 2E8YA 1Y65A 3TYAA 1LLOA 1LG2A 3M43A 5EFFA 2RJHA 1POJA 2JE8A 2B7QA 2VGFA 3DU0A 3V0TA 5CJMA 1EPVA 2VDHA 1OABA 2HISA 2OEJA 4FX7A 1HUVA 3IIZA 1LG1A 4UTUA 5LIYX 1MUCA 1RBOB 3CJPA 1NWSA 3KCOA 2CNCA 3M5VA 2OXNA 2B4GA 3W3OA 3EWZA 1GTHA 2GGJA 3HG5A 2C71A 3WQ5A 4LQ1A 2QJJA 1QBAA 1VCFA 4GJIA 4W7UA 1EXPA 3P14A 1U33A 3DH7A 3P80A 2P76A 3WSUA 2G37A 3MMTA 4DO6A 2J25A 5I2UA 4FNSA 1X6UA 3VFLA 1B3OA 1GOQA 4Z1BA 2ZA2A 1BQGA 4JEJA 4YYCA 3A4JA 3U5UA 2QJGA 1XG4A 4X2RA 1ADDA 5BXTA 3WLLA 3LQLA 3RX3A 1JCYA 2WM0A 4PEEA 5AC5A 3QH2A 1ICQA 3EKLA 3R2GA 5M2FX 1DE6A 1C7TA 3CTLA 1XIMA 1XLDA 3AISA 3CMGA 3UPBA 1VLWA 4AEFA 2FJUB 2FVKA 3L4UA 1TZ7A 4ZO6A 1A3WA 3T0TA 1DJYA 4C1NB 1LM1A 1UZ1A 4U28A 1V02A 1KV5A 2ZX6A 3PJUA 4HK7A 1GYLA 4GYFA 1XF0A 3I4EA 1EC7A 1P43A 4TTUA 1R9XA 5T9BG 2FTYA 4UR9A 4HKPA 4AZGA 4R27A 1VQTA 1MW0A 1SUXA 4NHVA 3WD1A 3AYTA 3SCUA 4HZ8A 1E5NA 1QW8A 4L56A 4IPNB 1UP0A 1Q4WA 4W87A 4B91A 1ZJAA 4DUOA 1OCNA 4FA3A 3RU6A 4PGLA 4BQ4A 4DN1A 1GVSA 4UTLA 3BSHA 4JKLA 3NZQA 2RDXA 4C6LA 1BKHA 1K03A 3PJXA 1TTJA 2EG6A 4JNYA 1TB3A 4BR1A 2X7WA 4MLRA 4L1XA 5D9NA 1XIJA 2XFWA 3L0GA 4PTNA 3TYCA 4PCFA 3TNOA 3OTRA 3W28A 4A6GA 4DBWA 3R0UA 2DZWA 1YTKA 2QUVA 4YLWA 1BRLA 3Q45A 4JYEA 2YKKA 2VXNA 1SO3A 2DZTA 4AD2A 8A3HA 3HMJG 3PZMA 3WH5A 4BQ3A 1VEPA 3Q37A 2W4XA 1V08A 1K8XA 1YBQA 2J79A 2E67A 2GUYA 1A0DA 3DI0A 2Y61A 2D0FA 6TIMA 3U48A 3B8UA 3AHZA 3U0HA 1KFJA 3VNKA 3H2CA 2VEMA 5CGMA 1QJWA 4ZTXA 3P5YA 3WL0A 1YDYA 3PZUA 1JXJA 4GCXA 3UCQA 5FOOA 6A3HA 4XSLA 4AY8A 3KL0A 3VKCA 3CUJA 3TSBA 3RCMA 2DSUA 2Z1KA 4WJXA 4UFIA 4WKHA 1A5MC 4MZ8A 1Z44A 3FN9A 3TV8A 1JCTA 5EFDA 4A8NA 1PZ3A 2OLHA 1L8NA 1HX0A 3LG3A 4FR1A 5FACA 4JQ2A 4JDBA 3WLPA 1QWGA 3OZOA 3UGRA 1IWBA 3GNXA 5LXXA 4S1FA 1BYDA 4PYSA 3U57A 2J7FA 4RPQA 1EJTC 3KDNA 1FWDC 5EMUA 5F1VA 1LT8A 1TV4A 3IACA 1F9CA 4A35A 5C5YA 4F3HA 3WH6A 3MHFA 1Q2RA 5LNVA 4XQ6A 2BXZA 3ZT6A 4EVZA 4W86A 9CGTA 3BTNA 5HWJA 1SFJA 2ZRZA 4G7EB 3TJLA 4BQ2A 1AL7A 4AWSA 1YLVA 2A7RA 3TTOA 2VFGA 4XO7A 1VFSA 2PDQA 3DX5A 3GTHA 2PLKA 1SZFA 4ATLA 1VFFA 1ISYA 3UA4A 4QQUA 2R1LA 3QMTA 3QW3A 3N2BA 2O7SA 4HMCA 4K2SA 1H61A 1P0KA 2CC0A 2UWFA 1KB3A 4XAPA 2F6KA 3GW3A 3AJXA 2HNHA 4NZJA 1FTXA 1W3LA 4QEHA 1ISXA 4R7OA 4JY8A 2E68A 3AXIA 4LY4A 3N19B 4MHBA 3ZJ6A 3ARTA 5L9FA 3NQVA 5E0CA 3URQA 4H7CA 4RE4A 2DVXA 1EQCA 5BMWA 4B3ZA 1E0XA 4M19A 4GWEA 1QTWA 3PTKA 2DP3A 3CC1A 5LYRA 3NL3A 1YNPA 1QHZA 2RUSA 4C7FA 1QNOA 3R0DA 4JN8A 1O95A 5TQLA 5LGZA 1HL8A 4XD3A 5LXEA 1SGJA 1XM3A 3HQOA 3OZMA 2ODOA 2ZX7A 3CV7A 4JBRA 1HIZA 1H3GA 3H2AA 3RDKA 5H91A 3LHUA 2FGBA 1JD9A 4MPKA 1ZAJA 3D3FA 3WL1A 1SVDA 1JG9A 4M6VA 3MU7A 5DLCA 4IZGA 5HBFA 1E1CB 4Z17A 2IPJA 1LTDA 3WD3A 3ZR5A 3E0WA 3I3DA 3GXIA 2YW3A 2A3HA 2YB4A 1GUVA 4DJFD 4E8DA 4G7EA 2VFEA 4DM1A 2C8NA 1O60A 4MB4A 4S3JA 3W22A 3O6DA 4I8YA 3QBUA 5G4EA 3TYUA 1VKFA 2D3NA 3L67A 5D33A 4YTSA 3W25A 1GYNA 2VC7A 3DZ1A 2FKPA 3VX1A 4NYUA 4I9MA 4RV3A 2IMRA 3EX1A 3L4XA 5D9MA 1XH2A 4A3RA 2XVGA 2ZXAA 5HA7A 1R7OA 1CB7B 1WAWA 1ADOA 1E6PA 1YKWA 2WPGA 3HMCA 1X7FA 1TSIA 1YDOA 1XLKA 3RLGA 1P0EA 1ZUAX 5C9XA 4LUSB 2R82A 3L4TA 1E4NA 1KBJA 1B3XA 2ZBTA 4Y9NA 1G7VA 4OBSA 1OFEA 3G1HA 5C9ZA 3WLSA 4ZO7A 4XG1A 3DFSA 4ZQCA 3HA1A 4TIMA 4DB7A 1Z3NA 4GVGA 2PDHA 1AD4A 1B9ZA 3CS2A 1TWWA 3FVMA 1LBLA 4J3TA 3TJXA 3RAOA 1R8LA 3R11A 3WEMA 3OZPA 1LL4A 3SIZA 2OX1A 1A5OC 1QPRA 1VH7A 4H7VA 4IT1A 4DPQA 3S2LA 1PVNA 4J3VA 1CGUA 4XBKA 3LK6A 1V7YA 3LHVA 4XBJA 2YL5A 4GUIA 3C0LA 1EWDA 4MTVA 1MI3A 4LAZA 1PS9A 3MHUA 3SN4A 4IQDA 1UCWA 1Q5MA 3K4AA 1XYZA 3T55A 5HWNA 1RBLA 4J27A 5G2IA 1LYXA 1QT1A 1E43A 3POCA 3C2OA 5A8QA 2ZC8A 1Y5VA 3BG3A 4AXKA 5FESA 3AALA 3UESA 1BYBA 4HOXA 5T91A 3ZR6A 3VNMA 4LB3A 3C0JA 4ERIA 3WDPP 4D8AA 1YPIA 2MANA 1KM1A 3PAJA 2FFIA 1YXYA 2VDGA 1R3YA 1WX0A 4ADUA 1V0KA 3C8FA 5IFPA 2ZXBA 4AWUA 2NSOA 2BGNE 4AF0B 5FAGA 3TONA 3S42A 4GNVA 2BOEX 1ITQA 1JZ8A 1LWHA 1KXTA 4KIRA 3BJFA 3DFTA 4GUHA 2GJXB 1XKYA 1H63A 4E2OA 1RJQA 2OJPA 2NX9A 2Z1WA 4JPGA 3VABA 1UKTA 1J8VA 5G1TA 2XN0A 3OQ8A 2PGWA 3QQWA 4DRSA 4QIUA 4UNIA 3UP8A 4PUMA 5F4SA 4F9JA 7PTDA 3TNBA 5ABHA 1EO7A 1ONXA 3F2CA 3V1HA 3EMZA 3TUUA 3FIGA 1WE5A 3ARXA 2X1RA 4GI6A 3PNUA 2QVHA 3KS5A 2HXUA 3WQPA 4GYKA 1ISVA 1L6WA 3UZJA 1OHLA 1GKQA 3AXMA 3F2DA 1MEWA 3LRLA 3GYCA 1UJPA 1EYEA 1FWNA 3PANA 1LQ2A 4WKFA 1GEQA 2PRHA 5E0KA 1AVAA 4AZIA 2EG7A 4E8CA 3STPA 4W84A 5LA0A 4LAUA 3B8DA 4JZ5A 1G4PA 2CYGA 3OLIA 1QNPA 4FF5A 3MP3A 1XRFA 2P0IA 1Y7VA 1F8MA 2X0YA 4HA4A 3PN8A 4HK5A 4EACA 1PBGA 4MVAA 5HNUA 1RD5A 2XH7A 4MNLA 1KD0A 3ZSTA 3NQCA 4K7YA 4EAMA 2WJZA 5BWFA 3VVGA 5LIWX 2I7GA 3NQDA 2VQTA 1F6KA 3QC3A 2EG8A 1TPEA 3E0IA 4F0LA 2ZRWA 1XLLA 3CLMA 1V77A 3W7DA 5CZSA 1TWIA 1REQA 1T8QA 4OOUA 3H7VA 2QCNA 3EPNA 1I2RA 2R6OA 2B81A 2E1WA 3FJ4A 3A23A 4X61A 4A22A 3PSWA 5DELA 3STCA 1GVQA 4JX6A 4ONVA 4Y9PA 2QDEA 3GFYA 2QXWA 3T0CA 3UFYA 2AKZA 2V0TA 1ADSA 2CPUA 4XKYA 2GQAA 3NOEA 5A6KA 3W01A 4G2DA 4O1EA 4ZL1A 3QHMA 4H9VA 5FEXA 4BI5A 3SFWA 4HSOA 4HPJA 1OZQA 2YBUA 4KWUA 4E0CA 1SJBA 4O8RA 3GIYA 7CGTA 2D24A 4OUEA 4UTWC 4GIYA 3G1AA 1Z42A 5G2HA 1KFEA 1CBGA 1TUXA 4H8VA 3IGXA 3TFXA 1OADA 1RK5A 5DCBA 5E93A 1CGXA 1H1ZA 2VC5A 3OYZA 4H2HA 3T0DA 1ISZA 4Z1YA 1UQZA 3EPOA 4FX8A 3WDIA 4AB4A 3SGUA 2GVJA 3WH7A 3AXKA 3FKKA 4E4FA 2XINA 5JH1A 3GNRA 4O54A 5D4YA 3W83A 2V5LA 1IEXA 2OYMA 3ZT7A 1ZALA 3BDKA 3H53A 3W1MA 1M7JA 2DIKA 1WBJA 4F2BA 3ZOAA 4PH6A 4UBPC 1TG7A 4J28A 2J66A 7ODCA 2I9UA 4IL2A 4L9XA 4W7VA 4AZCB 4WDWA 4BY3A 2UV8G 1EF3A 3D5HA 2YZRA 4JIEA 3U2ZA 4BF5A 1BXNA 4J1OA 2XISA 1C91A 1TUFA 3L0KA 3TCSA 1TV7A 1UR1A 5DRIA 4UR8A 3UG8A 3VD4A 2DSWA 3GG7A 1AJ0A 2VZTA 1FWSA 3NZPA 3R89A 4W8LA 1I1XA 4I9JA 3E6EA 4WRHA 3GIQA 1CT5A 4HCDA 4JYDA 5K7JA 3NQ8A 4UFHA 5LNWA 2PAJA 3CUFA 4AD4A 3P61A 5ABEA 3SRKA 1J0ZA 3ITGA 3TMLA 1AD1A 4GC4A 4DAIA 1ITUA 4M7TA 2E6FA 4CEXC 4FLSA 4I7VA 4FPSA 1DQUA 3NR0A 2G4JA 1DQWA 3BAYA 1DJZA 2Y7GA 2W63A 1VJIA 1C8QA 4UNLA 3MB9A 4NKCA 5EYWA 3MI3A 1NH6A 2BASA 4GYJA 1C92A 1OK6A 4O28A 3CV6A 4K6AA 4HJFA 1E9YB 3QN3A 4TVDA 2POZA 3PK7A 1B0IA 3DFQA 1FWRA 4NNCA 3CZLA 3N4FA 4MNMA 3OGSA 1IZKA 4A3YA 4GVFA 1R3VA 1PZ0A 3ES8A 2E0PA 4OBTA 7TAAA 1J0YA 1SMDA 3L4WA 3GVGA 4P61A 3CV2A 4B4FA 4IIBA 2ZRYA 1E3ZA 2JKAA 2I5GA 2Y70A 4NYYA 1QMLA 3D6NA 3TC3A 4AD0A 3ANYA 3KBVA 4PMOA 2V69A 4HA0A 2WKLA 4X3ZA 1GK8A 4XZWA 2NWSA 1OFOA 3RG6A 1KR0A 3BCJA 2P3EA 2W92A 1XIHA 2V63A 1R86A 4QP0A 1WZAA 1SR9A 3W7HA 4Q8TA 4QROA 2OEKA 3EPMA 3P74A 2WSPA 3BGAA 4WSHA 5LHEA 2ZE0A 2YX0A 3WNPA 3UT0A 1A0EA 2GQ9A 3LM7A 3VKJA 2CLKA 1FKXA 1TQJA 3GTXA 3VNDA 5JQ9A 4CU7A 4XUYA 1EZWA 3M0ZA 1SW0A 4RDYA 2JGQA 3B8WA 3SRFA 3VZZA 5E09A 4YPJA 4XAFA 3K8LA 1X7IA 3SUWA 1V4YA 1OFPA 3DERA 4YWIA 1EA0A 1I8JA 4RXFA 1UH3A 1DL3A 3L66A 1POKA 2X2GA 4IOTA 1G4EA 3SQSA 3MJYA 4WSJA 1S2AA 5IOBA 1BXCA 3WJZA 4HZ7A 5I7GA 1BG4A 2YYUA 3O7UA 5FD0A 4KESA 5B80A 2PWFA 2QYGA 1WKYA 5HNRA 3HPXA 4RZBA 5KZEA 4YCOA 3ABQA 3M6DA 5I03A 2DIEA 3CXOA 1Z6KA 1AMKA 2ZZ4A 3E38A 4UZSA 3IRDA 4FXSA 1W9DM 3ID7A 2Z6IA 4XSMA 4NILA 3DFNA 4KKXA 1LZOA 3S1XA 3CAQA 3EZ4A 4EPDC 3DFYA 1VPYA 4XTDA 3VXGA 1LUCA 2WMIA 4LVAA 2E1DA 4FNUA 5D2XA 5I3IA 3CBWA 4RJEA 3ARPA 1E0UA 1TJRA 3CZKA 3CZJA 1EJSC 3OB8A 2G50A 4F40A 3NXLA 1B4KA 1JI1A 4FSAA 1EUAA 2X0HA 3LGEA 2EHHA 3D46A 3GG8A 1EJVC 1EHNA 4H19A 4CU8A 3LB0A 3NZGA 1J6PA 3S47A 1AK5A 3B8IA 4XWUA 3R1ZA 1J0HA 4QRNA 4LUJA 1PDZA 2V2CA 2WXDM 5AHNA 2DZUA 2ATSA 1K6WA 1UH4A 3CWNA 3PZQA 1YYAA 4MPQA 4G5DA 4L4OA 1DWHM 4PCPA 2CBVA 2WANA 3SCOA 2ZWZA 4HBKA 2ACSA 1TJ1A 4PMUA 5HMSA 3HGOA 4FEZA 3CUXA 3W7RA 4IMGA 5H8UA 1PL9A 3APTA 2GJPA 3MCOA 3K4WA 1FFQA 3IANA 4S39A 3XIMA 2QZRA 2PDIA 4O12A 3B9OA 1VYRA 2V9DA 3LRKA 3M4HA 2Q3RA 3CAWA 2QQ6A 3WK1A 3AIVA 4NASA 1JPIA 2RGMA 1IV8A 5IRPA 5CG7A 2OZ3A 1XIIA 2ZE3A 1OQFA 3NQBA 1QAPA 1HVQA 4ACZB 5CZTA 1V6WA 3H26A 3W9ZA 1EDTA 3MMUA 3LV5A 3CUGA 1C9DA 3DHUA 1E3XA 1MO0A 3KL5A 4O0KA 4EAYA 4BF9A 1XSJA 1RY8A 3NM1A 4O15A 1GPWA 2FMOA 3EXTA 2WQPA 4C6MA 1XLGA 3CQJA 3O07A 1FDYA 2YPIA 2HPMA 5IDZA 2GDVA 4OE7A 1OK4A 3L4YA 4KF1A 4YL2A 4PC8A 1OCBA 3EB2A 7A3HA 4TO8A 1RCOB 4GPNA 3C5QA 3IIOA 1EUNA 4O14A 4DJFC 1QR7A 4G1NA 1LRQA 5I06A 2GSJA 2C19A 1QOPA 2BX7A 1BTMA 4UQAA 1LP6A 1MXGA 1WXYA 6ENLA 4CKQA 3KS6A 4M6UA 3O3RA 1C8YA 4PCSA 3ZO9A 5AVHA 1XGEA 4JFVA 5FJOA 3WDQA 1XUUA 3QZEA 1ENUA 3Q94A 2PWGA 5F2MA 3KTCA 1IGWA 4DLMA 2BTMA 3VNJA 2HMCA 1E1CA 2X42A 4FMVA 3R13A 2FJKA 2YIHA 3PP7A 4P8XA 1GHRA 2WV8A 2F9RA 4DYJA 3KLLA 3FVDA 1Q8JA 1M68A 1US2A 3ARSA 4H04A 1VBRA 3CIVA 3RN6A 1TREA 4ZQOA 2JKPA 4NQ1A 1KFLA 1H4PA 3FCPA 2NW0A 4CGTA 1B54A 4UFMA 1NJJA 3WQ8A 3V75A 4ZQMA 1LLWA 3CL8A 2CZDA 5I5RA 5D04C 3FDGA 2GJRA 4TQTA 3UPWA 4IPLA 4Q4SA 3P6LA 7REQB 1KFCA 3QQ0A 1BSLA 3MUAA 2QV4A 2ZRXA 2VFIA 9XIMA 1OX5A 5CC7A 1UWQA 4JKMA 1VEOA 4MNJA 4NX5A 1RR2A 3MKCA 3EAUA 1W2VA 4RNJA 2GYIA 2ZQ0A 1Y0EA 2WMFA 1NAL1 5AHEA 5XIAA 1K8YA 1CWYA 1KKRA 2VURA 2ZDRA 1MRAA 1QO2A 2A1YA 5A8PA 2PS2A 4KW2A 3R7MA 2E9BA 3PB2A 2V3GA 3VIFA 3PFRA 2VNCA 1JAKA 1J9YA 1NFBA 3CHCA 2WCGA 3WLJA 2FZBA 4WGHA 3L4ZA 5AYZA 4NAEB 3T2PA 3OG2A 1YNYA 4HA1A 4QG9A 2VHLA 5A6AA 4RK8A 1KLYA 2NXGA 4LAKA 4LC8A 5GPRA 2QCLA 3VCNA 3FJLA 3FW6A 2BV9A 2DH2A 1J2BA 3LI0A 4MWAE 3LMZA 2VZVA 2OZTA 1Q6EA 1U2YA 2EPMX 1NQKA 3NAVA 4WQ6A 3OHIA 5IHSA 3T40A 3A21A 2QVNA 3VILA 1IEVA 4JR5A 1W5PA 4OOZA 3G1YA 3PZTA 2YL6A 4F79A 5TIMA 1W1B1 3N29A 1JZ3A 4TOQA 4Q7IA 3W2LA 2PLJA 3CH0A 1MZRA 4LUTA 2Z7KA 1H0IA 4GQGA 2NQ9A 1EJUC 1SSDA 3IIVA 3STFA 4LXFA 1VAHA 3A24A 4HHMA 1W3IA 2G3MA 2XG9A 3TW7A 2WZIA 2VVNA 1W5OA 3L12A 4ILSA 3I7SA 1HKIA 4ZE5A 4PRRA 1E9IA 3NQAA 1NDVA 2YYTA 2QLYA 4IM4A 1JGIA 2EPOA 3N25A 3WF1A 3DENA 5CXPA 4RZ5A 1VRXA 5I78A 2J6VA 4J2PA 1DYSA 3WBYA 4KWWA 3PTDA 4E2DA 3E5PA 3UXIA 3AZSA 2GSEA 2OQLA 5C7VA 1CXFA 4DVOA 3VKAA 1Z8AA 1J11A 4B4HA 3AFBA 3T7VA 1PCWA 3EWYA 4OTKA 2W5FA 4QTGA 3QSTA 3CMJA 4XISA 1XLHA 4IF2A 2YW4A 4HNTA 3F4VA 3WQVA 4GY7A 4O1BA 5BU9A 3AI0A 2P10A 1JPHA 1B9BA 3MKKA 4C6FA 5A6TC 5AHIA 1L2QA 2ZDSA 5DY2A 5CBBA 3OLEA 4IXHA 1Q7MA 5GNXA 2DUZA 2ABBA 2VD9A 1KCXA 3M46A 4IIGA 2X2YA 1RALA 2JK2A 1RXOB 3URAA 1MW2A 3WF2A 1CECA 1OX6A 2PDMA 3ZJKA 4U3AA 2BB0A 4C65A 1AW2A 4KCVA 3VCRA 2YDQA 3UR7A 5I07A 4LBRA 3MWCA 2HNEA 2Y0FA 2PDJA 3AZTA 3G0UA 3T6CA 3AIEA 3TEVA 2GQ8A 3UPMA 4J3SA 3BGJA 4P7OA 2DVUA 4C6KA 5EMYA 3RYSA 4JNMA 1JPMA 1F3TA 4Y9OA 2R94A 4DWSA 3GM8A 5A2BA 3TLQA 3GB6A 4QEEA 3QPYA 3IJLA 2CWNA 3BVJA 3ZR4A 4ZB0A 2DDXA 3GHUA 1A47A 1UMYA 5G4HC 2ZC1A 3KOWA 4DYEA 1YNQA 1DEDA 2QUMA 1EH9A 4GRSA 4GFIA 1F4AA 4UTTC 3UJ2A 2DV0A 3E02A 3JVAA 3FAXA 2VFFA 5C71A 1V0LA 3PTMA 1H7OA 4P2VA 3VGDA 4GZIA 1CGVA 3CZGA 2D23A 2WSQA 3OQEA 4EXBA 2XTKA 3NFUA 2VZUA 3B0UX 2VZOA 4O18A 3QOKA 3EWCA 1Q45A 2D2HA 4R7WA 3QV8A 1K9FA 3KE0A 1GJUA 3VNLA 3W23A 3CEUA 1UQYA 4J9JA 1Z89A 4FZIA 4LY8A 3ZSSA 2VENA 1P0NA 3QR1A 2H8XA 3WFAA 2BODX 2BGSA 3IUDA 3LCFA 4DO4A 3R12A 2ZA1A 3DESA 4AVFA 1I2OA 3W7JA 4E3TA 3MA8A 3UYCA 4IQLA 1KO0A 3S5YA 1XXXA 1QNSA 3R8RA 4JN6A 3QR0A 1K4GA 4PBGA 3LSBA 2GDQA 1V6UA 2ZOXA 3THAA 1H7PA 4V1XA 1DBTA 4JQ4A 4PUEA 3K30A 3HV9A 3WFZA 1S2WA 1EX5A 3UGVA 1QBBA 2R1KA 2ZWYA 1B57A 3C2EA 1KBKA 1H7RA 4WVXA 1W1ZA 1BGGA 2JEPA 5HJXA 4KEZA 1KBIA 1XIDA 1TCDA 1THFD 3GZAA 4NJKA 3RF9A 1XIGA 5LA1A 4RE2A 3EGJA 1JUEA 2WHJA 1ITCA 3SGZA 5CLTA 5BOOA 3N9RA 4LS0A 2OG9A 3RM9A 4OWGA 3BPWA 4L7ZA 1UKOA 2RHGA 1VYPX 3GZ3A 3Q4DA 3AZRA 2E5CA 2JF7A 1YADA 3MSGA 1JDEA 1XDMA 1SSGA 1RV8A 4GD0A 4QS5A 4PULA 2NQZA 3UWUA 1XBVA 1R7AA 3BK0A 1L8PA 2HDJA 1TPC1 4HGXA 3OODA 6XIMA 3M5YA 3N3MA 4B5XA 3W1LA 4PTDA 2VCCA 1TPB1 3L2MA 3GTNA 3ERPA 4JD4A 1RQBA 1WOBA 3IVSA 5CH9A 1F3WA 3G22A 3V3WA 1RZMA 3W76A 1UR0A