3GUGA

Crystal structure of akr1c1 l308v mutant in complex with nadp and 3,5-dichlorosalicylic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTVDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AKR1C1 L308V mutant in complex with NADP and 3,5-dichlorosalicylic acid
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C1
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3gugA00
4YU1A 3LZ3A 4H7CA 1C9WA 4IGSA 4YS1A 3BV7A 1SM9A 3LZ5A 3D3FA 4YVVA 3EB4A 1ADSA 2FZ9A 5DANA 1LWIA 2PDWA 4RPQA 3GHTA 2PF8A 3N6QA 5LIWX 2IKIA 4GQ0A 3CAVA 3O0KA 3Q67A 2PFHA 4LBRA 2I16A 3U2CA 2FZDA 4JIIX 3LNMA 3R94A 2PD9A 2PDKA 2HEJA 3ERPA 3GHUA 2HE5A 4R9OA 3BUVA 3UGRA 1XJBA 3UYIA 1QRQA 4JTDA 1ZSXA 1PWLA 2IQ0A 3R7MA 5M2FX 2IS7A 2PDFA 1AZ1A 1RY0A 2FZBA 3R8GA 3UG8A 1MZRA 3CAQA 1M9HA 3FX4A 2ACRA 4JTRA 1IEIA 1AH4A 2NVDA 4XZMX 4IJCA 3M0IA 4LBSA 1XGDA 3FJNA 5LIXX 4JTCA 3P2VA 3VXGA 3WBXA 4H8NA 3LUTA 1S1PA 4FZIA 3F7JA 2DV0A 4DBWA 5HNTA 4FA3A 3WG6A 1EXBA 3KRBA 2C91A 3H7UA 2DUXA 3G5EA 4JIHA 5LIYX 4IJRA 4WDUA 1VP5A 3NTYA 3V35A 3CV7A 1XF0A 3B3DA 3BURA 2AGTA 1Z89A 3M64A 1S1RA 4XO6A 2PDHA 4PUUA 3V0UA 5KETA 1HQTA 4GIEA 4HMNA 1ZQ5A 1Z3NA 3CASA 2DUZA 3Q65A 3T42A 1EF3A 4JQ4A 3RX3A 1FRBA 3RX4A 2FZ8A 4XZLX 3V36A 3UZXA 4GACA 4GCAA 2CLPA 3UZYA 2ISFA 4OTKA 4I5XA 3O3RA 2IPGA 4LAZA 3LD5A 2F38A 1YNPA 1RY8A 1US0A 2I17A 4WEVX 3C3UA 2PDPA 1AZ2A 2PDGA 4L1XA 4WGHA 2INZA 4PR4A 1Q5MA 2ALRA 1MRQA 1ZUAX 4WRHA 4YVXA 1A80A 3S3GA 3V0SA 2PDJA 4JIRA 2IQDA 2ACUA 3M4HA 3WCZA 2PDLA 4WDWA 2PDBA 4PUWA 1AH0A 4DBSA 3ONCA 1IHIA 4FALA 1YE4A 2FVLA 3G1RA 1YE6A 2PDCA 2IKJA 4LB4A 3ONBA 2PZNA 2IPJA 4GABA 1S2AA 2J8TA 4XZHA 1JEZA 4Q7BA 5HA7A 2HV5A 2A79A 4GQGA 2IPFA 4WDXA 3WBYA 3UZZA 5JH2A 4G5DA 2PDMA 3DOPA 3COTA 3R43A 3LBOA 4XVDA 1PZ0A 1EKOA 4AUBA 2IKHA 4QX4A 2WZTA 4PRRA 4L1WA 5C7HA 2IKGA 3RX2A 2PDXA 4XZNX 1YNQA 2PDQA 2PD5A 4JTAA 2ACSA 3CV6A 3MB9A 3V0TA 2F2KA 1PZ1A 3BCJA 3CMFA 3LENA 1J96A 4ZFCA 2PDUA 3GHRA 1Q13A 3UWEA 3LQLA 1PWMA 2ACQA 2FGBA 2PDYA 4XVEA 4HBKA 4JQ3A 1GVEA 1RALA 4F40A 4XK2A 3N2TA 4JQ1A 3GHSA 2PDNA 4GA8A 5JH1A 4MHBA 1X98A 1AH3A 2PEVA 4JQAA 2BGQA 4Q3MA 4XAPA 4JTQA 2HE8A 5AZ1A 3EAUA 1Z9AA 3UP8A 5LIUX 1T41A 4WDTA 1PYFA 1OG6A 2HDJA 1X96A 4XZIA 2WZMA 4LAUA 2P5NA 1ZGDA 3LQGA 1R38A 1EL3A 2HVOA 3R8HA 4LB3A 3WBWA 1HW6A 4QBXA 3UZWA 1VBJA 3R6IA 3LN3A 4JQ2A 3H4GA 4YVPA 4DBUA 3QKZA 1X97A 4EXAA 1MI3A 3LEPA 3EB3A 4ASTA 5HNUA 3DN5A 4XO7A 4PRTA 2HVNA 2IPWA 4FAMA 4EXBA 4PMJA 2BP1A 3H7RA 2QXWA 2NVCA 2PDIA 1Z8AA 4NKCA 1LQAA 5AZ0A 5LIKX 3UFYA 3MC5A 4DZ5A 1T40A 2R24A 1UR3M 3GUGA 1AFSA 4QR6A 2INEA 3R58A 4ICCX 2VDGA 2BGSA 1QWKA 4QXIA 1S2CA 1K8CA 2R9RA
chains in the Genus database with same CATH superfamily
4HT3A 3KS5A 3SY1A 3IRSA 1PKYA 1UKPA 2V30A 3GAKA 2Q02A 3H22A 1TELA 2OOGA 1L8PA 3DFOA 2QGYA 1W17A 3H2NA 4XSMA 2WMFA 2CNCA 4I5UA 5CZSA 2OWXA 5CEWA 1RAKA 1ISVA 1GW9A 2W62A 3E5BA 2ZUUA 3GH5A 3L4TA 1ZHAA 3AIWA 3PBGA 3SEPA 3UR2A 3HQNA 5I0DA 5IOBA 1NH6A 1NTHA 1I1WA 1MEHA 1B31A 2PCQA 2HBXA 2E1DA 1C9DA 1UPMB 4HA1A 4UTKA 1TA3A 2QDHA 4LUTB 4P8VA 3IVSA 4TVUA 3DX5A 5ABHA 2XWEA 3LHVA 4CD6A 3ARPA 5HQEA 2W67A 2OT0A 4B5XA 5CGQA 4IL0A 4FF7A 2FDMA 3L4ZA 2D20A 3S8HA 2ZXAA 4D8AA 1E43A 3GO2A 2PPGA 2Y63A 1LBFA 4NNCA 4YJ5A 5EMUA 1H1ZA 3SIZA 4UTIA 3NZRA 2OWCA 1EPXA 1V6VA 1ZNNA 2RAGA 2NQ5A 1ZL1A 4O1EA 4H8UA 1AUSL 3W7QA 2ATSA 4V1YA 2VC6A 2WOQA 3W88A 3VFLA 1XSKA 3WD2A 3A4WA 4BY3A 3VD3A 3NWRA 2C13A 4GC4A 1OFPA 4ZQOA 2JEQA 3UCQA 3KWSA 5JIPA 1GVYA 4KCVA 1Z48A 2GGGA 1CBGA 2IW0A 3QQ0A 4AIUA 5CG7A 1X39A 1J12A 2GQ8A 4RNIA 2OZTA 4JHOA 5ECUA 4MUPA 5LHFA 1T7LA 4AD4A 2OPJA 3N1AA 3BMXA 3CZEA 1AJ0A 2DUZA 1U30A 1V3IA 3CM4A 4RW5A 4FOJA 4GUGA 1JD7A 3BW4A 3WK2A 2RJHA 3L23A 3GM8A 3N18A 5BMXA 1V03A 1WUEA 4IFKB 3UVIA 3JR2A 4PRWA 1IWPA 1UZ4A 4YIWA 3AWNA 1DIOA 3HQ1A 2E6AA 5HMSA 5FACA 1XI3A 4HN4A 1TJRA 1EC9A 3TQ0A 1ICQA 1R87A 2GVEA 1K6WA 2OMAA 4GC3A 4ZQPA 2AMGA 5HMFA 1XRFA 2TMDA 2V38A 1LYXA 3OHIA 1EJRC 3BMWA 3AS1A 2NT1A 2NUWA 1K8XA 5XIMA 2PRHA 1NIUA 3CO4A 4B5NA 1QOXA 3SCNA 1I45A 5JBDA 4WK9A 3UWQA 4HQVA 3SADA 3PY2A 4AYSA 3V5OA 1J01A 1A3WA 5FAGA 3B40A 5FOOA 1GVQA 2PTYA 3TCEA 3LXAA 2V3DA 3LGGA 4QE5A 1ZP4A 1TMLA 4UWMA 2IKJA 3W7KA 3VKJA 1DPMA 3E02A 5FAJA 3MTWA 4IL2A 5D4YA 2XVGA 1R3TA 4MKVA 3TE9A 3TK7A 3WO8A 4P7RA 5HPOA 4FO4A 3W83A 2YA2A 3WQOA 3PZ9A 4PCSA 4W8BA 1T8QA 1YDNA 3TJXA 4UOQA 3W2NA 2WK2A 3RIKA 1ONRA 4O14A 1J0IA 3L0NA 2Y85A 2CEQA 2J7FA 4QS5A 3KLLA 3K4DA 2RUSA 3W1QA 4N9CA 4PC8A 1XLKA 4AQLA 4KIEA 2IKGA 3WFLA 2PDXA 1YNQA 2XM2A 1QBAA 5A6JA 2O92A 5A8PA 1V3LA 2VEIA 2QF7A 3E9AA 2FJKA 4AY1A 2Z1VA 3LPPA 1NU5A 4GIRA 1F3WA 3N4EA 2ATMA 5HK4A 4ERIA 3GD6A 3M0MA 1CGUA 1TZ9A 5A69A 1FWGC 2W5FA 4AD3A 4C1LA 4N9BA 3LHZA 3EGJA 1KKRA 1GVEA 1RALA 4JD4A 4YWSA 1XSIA 1JULA 4KCUA 2I1OA 2O9RA 4JQ1A 4LVAA 1TPB1 3KVLA 2D0HA 3W3OA 3N2OA 3TLQA 3THUA 2PEVA 2D2OA 5DT5A 4PFMA 3VDAA 3MUCA 3VM7A 3TP4A 4LUJA 3GNOA 4DF1A 3QTPA 3KRUA 1CNVA 1QHZA 5D38A 4ADSA 4PSRA 2ZDSA 3NQ6A 4BEUA 4Y96A 1O5XA 3T0DA 1X96A 3WNOA 4JKKA 2YCJA 1REQB 2V67A 3WH7A 5DQPA 4QAIA 2XVLA 1Z44A 4MVAA 5CZTA 3LI1A 4U31A 4QDPA 3C2FA 1HJVA 3H8AA 3VOHA 3BJTA 2ZE0A 2XSXA 3OODA 4AYGA 2Y2WA 3I3EA 4IPJA 1O12A 1W54A 1XP3A 1PKNA 4LEFA 2V5CA 1VPXA 3JRKA 3MSDA 4HTYA 1SZGA 4CLMA 1LLZA 3RU6A 2QW5A 5AC4A 3MO4A 3S9ZA 2QLYA 4WJEA 1OEPA 4LJ3A 4S3JA 3CHDA 1XGEA 4A35A 4S2BA 2DZVA 2CPUA 3DGBA 3VGDA 1EIBA 3R58A 2DP3A 2VGGA 2W66A 4Y9NA 3NDYA 4Z2KA 3HFTA 2BOGX 4S3FA 2ZX6A 3F2CA 1M04A 3L0KA 1DJXA 4G1NA 4JZ5A 3ANVA 4JFSA 2TYSA 3MUIA 4OWGA 4X63A 2NQHA 1P0BA 1K4HA 1TV7A 4G6CA 4DJDD 2VZVA 4B91A 2YZ5A 2OO6A 4GYPC 4RPQA 1DE5A 4J3SA 2QCLA 3CPGA 3JZEA 2J88A 2PFHA 4NT0A 1WYIA 5ABGA 1AMYA 4L56A 1HG3A 5IBXA 1JJKA 4BJHA 1FFQA 1XLEA 3BAJA 4M56A 4JY8A 1VFMA 1VCVA 3BUVA 1XJBA 3N34A 2PWEA 1YXDA 2DJLA 4KWWA 1OY0A 2QKFA 1DEDA 1VFFA 4I9JA 3GH4A 1M01A 4PB3A 3R8GA 1R30A 4EE9A 5D03A 1EPVA 4Z08A 3WJSA 5C6MA 4CU8A 1AJ2A 4GH3A 1KRCC 1QR7A 3FX4A 3VO0A 3UY8A 4OV9A 1NFGA 1QASA 3UPMA 3IV3A 2VCBA 3FAWA 2VGBA 3AS2A 4CGTA 4MPKA 3GG7A 5FSDC 1DWGM 1K02A 1E3ZA 5TQLA 4PUNA 4D6GA 1JZ8A 3KAOA 2R1KA 3DBPA 3H2AA 2WANA 3F7JA 2DV0A 1BRLA 2GVJA 3R5EA 1NFBA 3DAQA 2VCCA 3RGTA 5HBFA 2DPEA 4GNVA 1DQUA 4KQNA 3WK1A 1GNXA 4ZQMA 4GVGA 5LIYX 4K7YA 3TQVA 3FDKA 2PC4A 4OHQA 4GLEA 5G2WA 1KV5A 3FKRA 3AXMA 1VB9A 1MUMA 2H8ZA 3C0LA 4Q8WA 2ZTKA 3LRMA 4JN8A 1KFJA 1R3SA 5DMLA 4GZ7A 5CPTA 3GBDA 4I8DA 3V0UA 4US6A 4CQDA 5DF0A 4W84A 1XH0A 1NWTA 2W92A 4U4MA 2C0AA 3VGFA 4ROPA 3TSBA 3Q65A 3CIWA 1TB3A 3MI2A 4UR8A 5LNRA 3BLOA 1YRRA 4CD4A 3LLXA 4GCAA 4IIBA 4AD1A 1OBAA 3SCRA 3WF4A 4C90A 4LV4A 3DHDA 4LAZA 3KBWA 2WKJA 3IGXA 2VX7A 4TIMA 4IMDA 1W3KA 1VHCA 4BF7A 4RCXA 4NZ3A 4H2HA 4UB9A 4L6HA 4LT9A 1B0IA 5BOFA 1TYGA 1FHLA 2YOCA 4NILA 1ENUA 1VHNA 3M41A 1FBAA 1UPPA 1Y5VA 3CUGA 5A6KA 2X2YA 4CNNA 1BF2A 4RKAA 4YMZA 1BGAA 4ZCWA 3S0CA 3QY8A 4CCCA 3KL5A 4NXSA 1A5UA 3WQWA 4ZE4A 2PGEA 4F66A 3LX9A 1F5ZA 1R5YA 2R6OA 3MV11 3KRZA 1NDWA 4NZCA 2J7EA 4GABA 1H7PA 2GWGA 3PAOA 1SO4A 3TSMA 4WKHA 3NM1A 4FXJA 3E0WA 4R33A 1EJUC 2A2IA 2UBPC 3W1AA 4ZO6A 4XVDA 4IGNA 1GKPA 1ZZMA 3GXFA 2JALA 1MO0A 2QUNA 3NQFA 3WJXA 1W5QA 4NJHA 1VKFA 3APTA 4O16A 1XRVA 1GOKA 4S23A 4HPGA 1EX1A 2V0TA 4D6CA 3GDMA 4JTAA 2GVLA 3P60A 1TZZA 3CMFA 2ZDRA 1VF8A 4MAZA 1KBIA 1KTNA 1VRXA 2X1TA 1VPQA 1V93A 4OT7A 3EB2A 3LQLA 4EXQA 4EACA 2GWNA 3R13A 4Y9OA 1E6QM 3BAKA 4U2ZA 1DWJM 3MQTA 1TMQA 1UR9A 3WLKX 2Z28A 1FCBA 2VQUA 3KCLA 4DJEA 2Y1HA 2OKTA 3KP0A 4NNAA 2CLHA 2F6XA 3AHVA 1HKJA 3BV4A 3QZAA 2YB4A 5I06A 4JTQA 1P43A 1Q2SA 1CB7B 1R9ZA 1SFTA 2PF0A 2ZZ4A 4NYUA 3QYSA 3HURA 1NAL1 1XCFA 3SCTA 2PLJA 3UP8A 2OGJA 5JUVA 4Z2HA 4ZXOA 2H8XA 1PDZA 1A5OC 4P7OA 4XZIA 1TUFA 2ZX7A 1UZ1A 1EP3A 4XZ9A 5D30A 4XBSA 2C18A 3LLDA 2HVMA 4CN4A 5E9AA 3LQGA 1DOSA 2E8ZA 3GDLA 3M9YA 3TQPA 2J7GA 3SW6A 2OQYA 3PK7A 1VH7A 1VBJA 2WHKA 3AMDA 3ZXWA 2ZUWA 3L4YA 3IEBA 3QZEA 4WQ6A 3M5VA 3CIVA 1UMLA 5CZ0A 1W5NA 3RLHA 1ITQA 2HS8A 4KMQA 2JK2A 5AZ0A 5LIKX 4QDWA 1X8CA 2VC5A 3MC5A 1JUKA 4J3TA 4KEVA 2OR2A 4DZ5A 4FK9A 5E93A 2FFCA 4MUZA 4KS0A 4MMWA 1IIHA 2ZUTA 3SQLA 1F07A 3NGJA 3SCUA 3W76A 3N3TA 4AHPA 3BGGA 1LWHA 1VBRA 4DWDA 4GXPA 1R3VA 2DIEA 3PZUA 4BKNA 3EX3A 2GSEA 3PZVA 4M1RA 1VJZA 1UHVA 4F0LA 3OIXA 5LNWA 5FEZA 1N8WA 2LLEA 2VOMA 4Y7EA 2CW6A 2X30A 3JU2A 3QF0A 4HMEA 4Y8FA 4KWSA 4JKLA 2GYIA 1SPQA 3UJRA 3NL2A 4A2SA 4K38A 3AISA 4XAZA 5I5RA 5D05A 4DI8A 1V3JA 5SWUA 3TC6A 1Q4WA 1J0ZA 4IMFA 4MWAC 5AYYA 4NAFB 1IZCA 1E72M 3RHGA 2GSHA 5BRPA 2NWSA 2PU1A 2OSYA 3QR1A 4D6FA 1ZSXA 1UWSA 9RUBA 1H7RA 3WNLA 4LY4A 3L7RA 4X0VA 3NQ7A 2FGLA 2J24A 3FYOA 2HCVA 2F6UA 4IQEA 4H9UA 3H6OA 1JNEA 4K6AA 4ZB5A 3GW0A 3LNPA 1S3TC 4KFOA 1OQFA 3W2UA 3STCA 1OADA 4JTRA 3K46A 1FKXA 4XZMX 3VIJA 4EF8A 3HG2A 3OVRA 5MKGB 5KSWA 3E2QA 5F2GA 2ZRYA 3ATZA 5EA9A 1A49A 2OELA 4EKJA 3P5ZA 3T4CA 3CTLA 1JXJA 3N2MA 4F0HA 1V6YA 1GVIA 1N7KA 2CBVA 4PFHA 1QUMA 1UKQA 3SCQA 2Q71A 3DERA 1E4MM 2QVNA 4Y9AA 3T05A 1EP1A 1XBZA 2WSRA 1LL4A 1JUBA 5MF5A 4L9YA 3MP4A 3GK0A 1QO2A 1A5CA 3HTWA 5D2WA 3W7DA 1H7OA 2Z24A 1LBMA 4V27A 4GQQA 1DJGA 1XLJA 4Z1YA 3LV6A 2WHMA 2X7WA 3WNMA 8RUCA 3KBVA 4PTDA 5AKQA 4MJZA 3WEMA 5FF7A 1ZQ5A 1RP9A 2PP3A 3ZWSA 1BTMA 1OGBA 2X42A 3RX3A 4MZYA 1LF1A 2FZ8A 3Q45A 1UW9A 4XZLX 2GOUA 2VP8A 3LCIA 3AIVA 3VUSA 1Y5XA 2EJAA 3AC0A 3O3RA 4CQAA 1TREA 2HPIA 4JNZA 1Y8BA 3WLMA 2QCEA 1RR2A 4O0KA 1OHLA 2GPTA 3LMZA 2PTWA 3E49A 1PIIA 3DYMA 2B4GA 2PB1A 3UQNA 3L4VA 3ZR5A 4HMCA 2ZA1A 4MNMA 1VEOA 4TVDA 3M6DA 3QYQA 3LI0A 4FNQA 1WDRA 3NL6A 1DJYA 2ACUA 3UGVA 1AVAA 4I8YA 5I3HA 4WDWA 3O0FA 4WSJA 4GJIA 1YE4A 4LYPA 1J0JA 1RVKA 1KW1A 4RDZA 5F1UA 4U3AA 3RK8A 1IXQA 4JEQA 3QLLA 2FQIA 1YADA 3VIFA 3WDPP 4DJFA 3T4WA 5KZMA 1A5BA 1POKA 3N12A 5KZDA 2PURA 1DJWA 4E4PA 1W3NA 5CSUA 2Z1WA 1BHGA 2CZVA 1RK5A 1BG4A 4DXXA 3W4RA 3H2EA 2C3ZA 1MUCA 2QCDB 4GRSA 2GOKA 1PX3A 2IQTA 2NV1A 2O4MA 4C6NA 3F5LA 3VDHA 5D2TA 3UPBA 2YLAA 3M5XA 3V0TA 4MADA 4EPEC 2C79A 4GIYA 1X7IA 1EJXC 2PDUA 2J13A 1FWDC 2R94A 1EA0A 2WCSA 4HCLA 5PTDA 4EAMA 3LPOA 3UY7A 2Z1BA 3TTYA 3SSJA 4B4FA 2E40A 1JAKA 3I3BA 2UY5A 4C6EA 4JQ3A 4QG6A 4BR1A 3APGA 4W5UA 3OZOA 3V7PA 2FYMA 3SUUA 1JPHA 1R8LA 3URBA 2AL2A 3BDKA 5BRBA 1VFUA 4GYPA 4LAKA 4W7WA 3S5YA 2HRWA 4WLCA 5F4WA 1NWSA 3FSTA 2ZUSA 1E15A 1OFEA 4M19A 2J9XA 7REQB 5AZ1A 1Y0EA 3MKKA 4JTJA 1AL8A 2A7RA 1EDTA 3V5FA 4G2DA 2VFEA 4J3WA 4NJGA 3NNTA 4OOUA 4Q8QA 2WC3A 4LC6A 4HZMA 1AA1B 3U2ZA 3EMZA 4C6OA 1NP0A 2X2GA 4AEEA 1IXOA 1FUYA 1EL3A 2HVOA 1FKWA 4JFVA 3W81A 3PANA 3GXMA 7CGTA 1OZQA 2CXEA 4M8UA 3AJXA 3N29A 2XSAA 1TQXA 3LGEA 3QKZA 4DBUA 1XLCA 4JIEA 1W8GA 1GWJA 5GNXA 1UR2A 1IEVA 3V1HA 2BXYA 4UNIA 3U8GA 4Z1AA 2HSAA 2PDIA 2YCIX 3CO8A 3NZGA 2AAMA 1K03A 1DV7A 4RZ5A 3PJTA 1L9WA 1BYAA 4GXWA 4JCLA 2A1YA 3LBMA 3MP5A 4FNRA 4A21A 2BGSA 3GC2A 4EPDC 3WLJA 4L6OA 4KGLA 3LLFA 1O95A 3CL7A 3WQCA 1E51A 4DBEA 4E8DA 4EPBC 3ALFA 3GXTA 3PZQA 2EKGA 1B57A 3VOJA 5HQMA 4O1DA 4JHMA 2R1LA 3LERA 5A8NA 8TIMA 2ICSA 3NSMA 4XZWA 3VM5A 1QNPA 1UWRA 3KP1A 2BHUA 1H5YA 2AQOA 2QNEA 3OA5A 3W28A 1A3XA 3LG3A 4PMVA 2P0IA 1WB0A 2Y5SA 3UWZA 3BL3A 4IP5A 1PJ9A 1MW1A 4E4UA 5HWNA 3G0SA 2V81A 3MMUA 5A6MA 2FVMA 1SW0A 2G3FA 3RO6A 3G24A 1KBBA 3TZNA 5KINA 4KFPA 1UH4A 4DUVA 2PDKA 1JPMA 3UG5A 1ML1A 3OBAA 4NX0A 4IPPA 3A4AA 1CDGA 2F9RA 3ZVIA 4DJEC 5CPQA 2MUCA 4ACZB 1NARA 2YXGA 3W37A 1OFOA 3CWHA 1KLYA 1EHNA 1XIBA 1XH1A 2IS7A 3K8MA 3CUXA 4DWSB 3SO7A 4C65A 4D6IA 2QUTA 3T0CA 2O4QA 2Z2BA 1J0HA 2HK0A 1H0GA 3VGBA 2NW0A 1UOKA 1IEIA 2WNZA 4ICNA 4QISA 3VGHA 3MYPA 3MKVA 3SRKA 3VDBA 1X6LA 2BXZA 4LOCA 3O63A 3ZJ7A 4IPNB 1YQ2A 3UNTA 4WY0B 1X1ZA 3UXIA 3LBCA 4GI9A 2W79A 4MWAA 1QI2A 2VT0A 1Q2RA 3QQ1A 3UWVA 1B90A 1O1HA 1MW0A 3AIRA 3ARRA 4KCWA 4JL2A 4RUBA 1TWDA 1TA3B 3KRBA 4LUTA 4F4RA 4C6QA 4QLLA 2QJHA 4AC7C 1JG9A 1CGWA 4AD0A 3KTSA 3ENLA 4JIHA 4RDVA 1V79A 5EFDA 1TSIA 1VJSA 2C7FA 4C1KA 4PUMA 4GI8A 3P80A 5CQ1A 3ARTA 4J2MA 3W38A 5DFAA 4UC5A 1FDJA 3PJXA 1VCGA 2EPOA 3C56A 4REQA 4LRSA 4WSKA 1XBYA 4LYKA 3WJWA 2CKRA 2F6KA 1XIJA 4W4QA 3LHTA 3QEZA 1XBXA 1H0IA 3VD4A 1R3RA 2HXUA 5HJXA 4LUSB 5K4XA 3NURA 3KTXA 1ZJBA 2WNWA 3G1FA 3PR2A 4QCFA 3VINA 4BQ5A 4AVOA 2DSKA 4S39A 4O15A 2EBNA 5AHEA 3N17A 5I00A 4OBSA 4PCTA 4IMCA 4K36A 8XIMA 4QITA 2WVVB 2PDGA 3VZXA 1O66A 2ZUMA 3VKBA 1EOKA 1H4PA 2PRLA 1WKFA 2ZVIA 1ZUAX 3QXBA 1EXPA 4O8RA 5DBUA 4A8LA 5K9CA 4UTUA 1Q85A 2NXIA 3SN1A 3ZT6A 3HZ3A 2EPNA 1W5PA 4GG9A 4PE8A 1VBUA 2X1IA 3THDA 1I2QA 1R2RA 3W72A 4NXKA 5CXPA 1OB0A 2VVSA 5D37A 4HOWA 3ONBA 4JTFA 1S2AA 1KXTA 3WQ5A 2TSYA 1NELA 1P6CA 2ZRWA 4LV9A 1EEXA 2DUAA 4FNSA 1SJCA 4MYAA 2XPKA 4QSFA 1KXVA 2Z6IA 1ITCA 4JYDA 2OYKA 2OU4A 2J6VA 2AQVA 2BY1A 2NLIA 2XJ7A 3OHMB 4E3VA 3UR7A 4E2DA 1WXYA 4I90A 3M44A 4L1WA 1UA7A 3NIYA 3RX2A 1VGAA 4NJJA 2C16A 3LDVA 2O9OA 1XS2A 2ZX8A 4GI6A 4DYEA 1ZCOA 4YTSA 3P8JA 2ZZ2A 4MOZA 1IT8A 3PPHA 1ZU8A 5HR6A 1XYBA 2WVVA 4B4HA 4UMCA 1K9FA 6PTDA 4HSHA 2GUUA 2XYLA 1JDDA 1F4AA 4LW7A 2GQ3A 2WNNA 2C14A 4JFUA 3W1RA 3T78A 1UD2A 1E6RA 3N2TA 3GG1A 2PDNA 4FNTA 5IHRA 4DLMA 3CWOX 4DPPA 5A2CA 4M6UA 4XSLA 3ARVA 5FD0A 3MI6A 3PB0A 4N9EA 2XISA 2DZUA 3EAUA 3R79A 3HGSA 1NEYA 1BYBA 5A6BD 2QUVA 3RF9A 4CNSA 4NRSA 3W86A 5GJMA 3UXLA 3IJQA 2E6YA 3MT1A 3MWCA 2WZMA 1JFXA 1H50A 3U9IA 1QFEA 4EX4A 1BVZA 1TKKA 1TX2A 2P10A 1IYXA 1C90A 2YCLA 4NZJA 1GT8A 4ACYA 1SR9A 2GQ9A 1YEYA 3WBWA 5I03A 2XZ7A 1XX1A 2A6LA 1V7YA 3W6MA 3AZRA 2VHLA 2CETA 3HG4A 4V1XA 3UYCA 4B2DD 4QROA 2VJXA 4UZUA 5I3DA 1UIOA 1Q6RA 4QM1A 1W31A 3CK5A 2VURA 4H6QA 1BLIA 2QV5A 2BVWA 5JQ9A 3PUOA 3NAVA 1B30A 1GG0A 2BX7A 3CZ8A 1MQQA 4HPNA 6A3HA 3IIVA 4FMVA 1S2CA 4D6EA 1YTKA 1C9WA 1HNYA 1UWUA 2OEKA 1B3OA 3LZ5A 4Z2JA 4GVFA 5M1TA 2YYUA 1JCLA 1MXDA 1RPXA 1G4PA 3VC6A 4RNJA 3QTGA 3SGZA 1TCMA 4UFLA 3M6YA 4GQ0A 3Q37A 3SFWA 5J5RA 5BNKA 3O0KA 2WWDA 1KFLA 1VFOA 4UQAA 1P1XA 4NQ1A 3GIPA 4ZGYA 1FWJC 3S2CA 2F8QA 5T26A 4IG2B 4FB7A 4QJ1A 3BQ5A 2I9UA 4LNCA 1YTDA 3GB6A 3B8DA 1F76A 2Q09A 3OO2A 1UOZA 3ZOAA 2HWGA 5G2HA 4L64A 1P0DA 3QGVA 4I7UA 4HYVA 3UWYA 4ZZ9A 3SB0A 1A0CA 4W7VA 2FZBA 1T8XA 1QK0A 3DDMA 5U4NA 3DI0A 3MKCA 1B4EA 1R6WA 4JKMA 5LA2A 3FS2A 2GJRA 3GZAA 1Y5WA 2ACRA 3R25A 5B80A 2PTZA 1LQ2A 1XGDA 2EPKX 4GINA 3MW7A 2GDVA 6XIAA 4Q7IA 4M7SA 5FF3A 3IIOA 1HL9A 1Z42A 4MPQA 1C91A 3WKZA 1AD1A 2ZXBA 1XD0A 3WG6A 2Z2AA 4ZOAA 1AMKA 4Y8EA 3AU6A 4WXYA 1ELSA 3W2MA 3SDOA 3H2CA 3W1TA 2VC9A 4JTEA 4K1WA 4RNHA 3G5EA 4HNTA 1XWYA 3GNDA 3CQIA 2XGZA 4J5NA 3BGJA 3BURA 1QHPA 3QPZA 1C8QA 3PC0A 3O7UA 4J3VA 3CEUA 1S1RA 1NWUA 4PMNA 4CNPA 2JQXA 2VX6A 3KOYA 4PBFA 4LVGA 3ZR4A 2HBVA 1ZAJA 1JYNA 3LHUA 1KQZA 3MI3A 3LCHA 1Z3NA 3OGSA 4CN6A 3OQ8A 2VRKA 4LGXA 1TR9A 3T42A 1UWAA 2G3IA 1OX5A 4E4FA 1FA2A 1K1DA 1WXZA 3ZZ1A 1JL8A 3N04A 3OYXA 4ATWA 3AMLA 1K9EA 5A6BA 4W87A 4DQWA 1EO7A 3KBNA 1CXEA 5C9RA 2G95A 1QPKA 1AK5A 4QGCA 2J4GA 3QM3A 2F38A 3QHOA 4OECA 5TAOA 2I17A 3M0LA 3UZJA 3EOSA 4LY8A 4WX2A 1GVSA 1ISYA 2RHGA 7XIMA 1KGWA 3FXGA 2ALRA 4C7FA 3LA4A 4HNOA 4FLSA 4JTKA 3WQPA 3CL6A 3G22A 2FB2A 4J3UA 3PZOA 2IQDA 4N6FA 5EBUA 2F2HA 3KX6A 1E1CA 4YHEA 2BTMA 1C7SA 1IXNA 1YIXA 4JICA 2VD9A 1YBQB 4HB7A 5IDIA 1M03A 1RJRA 2Y4SA 2GGHA 3G1RA 4L61A 4PUDA 3WLIA 3AYSA 1I60A 2MANA 3G0UA 1O5QA 2CZEA 4NSBA 1ESWA 2PE4A 3RM8A 1BD0A 4UOZA 4YCOA 4IIDA 5AN7A 3MWAA 4L80A 4R5EA 4NIRA 5BXPA 4E3TA 3JW7A 3AYRA 4WDXA 5MKGA 3WUGA 1KO0A 1JGMA 4L1GA 2WMIB 1PXGA 1ZJHA 3FFSA 4M6PA 4AUBA 5BZAA 2D23A 2CWXA 5J5DA 2P8CA 3CGTA 4NZ4A 2VFDA 2X09A 2G3MA 4UNKA 3B97A 3S6TA 1JCXA 1E73M 1W9BM 3GR7A 3TJ4A 2PDQA 3M47A 3TN5A 2HISA 3CMGA 3RMEA 1K8ZA 3ZQ9A 4GMEA 1YPXA 2I57A 3QQWA 1BXBA 3KDOA 3MCMA 3L66A 3W73A 2OO0A 3OZMA 1W9VA 3LYEA 1Z6KA 1EJTC 2EF9A 1EUNA 4F40A 1OF6A 1CCWB 1PPIA 5C70A 3LGDA 3IACA 2Y8KA 4GI4A 4PMDA 5TF0A 3AHZA 4Z0JA 4DLFA 2XH0A 2D3NA 3T0AA 5CGMA 2BVYA 2FIQA 5KTLA 1PBGA 3VNJA 1NDZA 1XGZA 3WD0A 2CZDA 3T8QA 1LCOA 5ENLA 1TJPA 3R0DA 2DQWA 4BWLA 4JBRA 1A5AA 3FOKA 1W9UA 4R7JA 2OZ0A 3PHAA 1W1IE 1WBJA 3OBEA 3SGUA 3KRSA 2OTDA 1WXJA 3C2YA 2VRQA 4K37A 5A6SA 1I2PA 2DQXA 4EWJA 3F4VA 1RCXB 1H1YA 1R38A 3B9DA 3GFYA 2YW4A 1LM1A 3II1A 1EUAA 3NOEA 3R8HA 3L21A 3QRHA 2WMIA 3H2OA 1TR1A 4FPSA 4GGHA 2YCEA 2WMJA 1X97A 1YYAA 3EB3A 1UC4A 1UD8A 4H83A 4QE1A 1SMAA 3T07A 3TTSA 4Q7NA 3IUHA 2JKPA 1VBHA 5IFPA 1A4MA 3FGCA 2ZRUA 3L12A 2O7QA 1CB2A 2D2JA 2EHHA 1GHRA 1KBJA 1OGSA 2CESA 3BVJA 2E77A 1YHTA 3SCOA 4CQBA 4HA3A 1TTIA 3SCPA 3TTEA 1EGVA 1XLGA 2ZX9A 2OGYA 1RJQA 2NT0A 4FNPA 4I9AA 1RA5A 2YIHA 3S1WA 2CBJA 3IVUA 3NPWA 3WNNA 2D0FA 2WKLA 2VQTA 4KEZA 4H6EA 2AKMA 1AW5A 4AEFA 1AL7A 4B3KA 1RV8A 1G6CA 3CV2A 2PBGA 2Z29A 3GYCA 5LIWX 4PMQA 4I9TA 4OVXA 1THFD 1VPYA 3E0LA 3LU2A 5I3FA 5I77A 5FJRA 4B3LA 3E1F1 1VC4A 4HA0A 3H4WA 4M82A 4PEEA 4AU0A 1P0NA 2HEJA 1ZS2A 1CLVA 2A4AA 3HGJA 1J6OA 1JAEA 5LKYA 4G7EB 3LOTA 3OB8A 3PUGA 1DWIM 2YZRA 4AXKA 4AMAA 4DEFA 3C61A 1DJQA 1DP0A 1GK8A 3VNKA 4FHAA 3I3DA 1Q7QA 1JDEA 5CH9A 5H2ZA 2Z1XA 1H7XA 3ITVA 1J11A 1RHCA 4S38A 5E6YA 1J0KA 1RD5A 3ZR6A 3IWPA 2GLKA 3IAPA 4E8GA 1QMLA 4H8NA 3L5AA 1S1PA 5CGTA 2G97A 4MDPA 3VKAA 5EB8A 3IPWA 4ML4A 4DBWA 2NQZA 3AIEA 1BPLB 3WQ4A 1TMHA 3MJYA 4MSSA 4HD5A 3RILA 5K3VA 3ZMRA 4QAWA 1I0BA 1CXKA 3C2VA 5EMYA 2JIEA 1X1OA 4F2BA 4CU6A 3W84A 3IK2A 1M7OA 1J8VA 3Q94A 1LJYA 3TFXA 8XIAA 1HFBA 4BQ2A 4HSNA 1B3XA 5B7YA 4XO6A 4POCA 3KW3A 3QHNA 3WH9A 3B9AA 4Q8OA 4AAJA 3F5KA 4GIEA 1HXJA 4B16A 1VQTA 5AVNA 4Z1BA 3A3WA 3M46A 5HINA 1VRDA 2DT2A 1X6NA 5KEZA 3G3DA 3PNUA 3RYSA 2QVHA 3RG6A 2FFIA 2HS6A 4IPLA 5FEPA 3PNZA 3SRDA 3URQA 4GO9A 4I6KA 3L65A 1KC7A 3QGAC 4D1IA 4Z1DA 3E74A 5MHBA 3S83A 1EFZA 4PULA 4UTTC 2VUNA 3LMYA 3AAMA 2PDPA 5H8PA 1DQXA 4J1OA 3PG8A 3DC0A 1H49A 3STFA 4JIQA 3NZPA 3R10A 1MRQA 3AMCA 2ZKMX 2A3AA 5D32A 2EJ1A 3BICA 4LCQA 3YPIA 5F2IA 4JIRA 4MFDA 3F2DA 4B15A 4OKDA 3AQUA 1KWKA 2G50A 4OBTA 2WVSA 1VD6A 1F2JA 2YFOA 3U6WA 3V75A 3ATYA 1KA9F 2CCRA 2HZGA 5CC6A 3ITOA 4LVDA 4ZBCA 3BXWA 1BYCA 2V9DA 1YE6A 5HANA 2E5BA 2HNHA 1AJZA 3I10A 3CUZA 1OCJA 3WQEA 4LCSA 1QTWA 2ZVRA 4U2YA 3BG9A 4JX5A 4A29A 3BCDA 3VE7A 3W2LA 3W7EA 1V02A 2RGMA 2G41A 3DOPA 4Q8MA 1PZ0A 1K7EA 1OCQA 1YDOA 4ZTXA 1NJJA 3L5MA 4EWND 1TQJA 3CB3A 4JX6A 3AZTA 4HNUA 5AC5A 1XYCA 3ALGA 3OGRA 2F2KA 1XD1A 4CEXC 4OU1A 1UUMA 1M53A 2AKZA 2QS8A 4PBGA 5F7UA 5EFFA 5H8UA 3VCRA 1RLCL 1DL3A 4XVEA 2ZZ3A 3I7QA 3I7RA 4PUEA 1KXQA 4P8XA 1M5WA 5BU9A 1XYAA 3EKZA 4B5TA 3PS7A 3V5CA 1WDWA 1X98A 3N15A 1AH3A 4AISA 2PGWA 1X8FA 4ZXLA 2QPXA 4I6VA 2FTWA 3BSHA 5REQA 4ZB0A 3KFTA 3L4WA 1NOWA 1PTAA 1J5SA 3CTTA 2BLEA 4WDTA 2BXVA 4BWLC 4K8HA 5AYZA 4X2RA 4FSAA 3HMCA 3CQ0A 3VZYA 3AROA 5TNVA 1HGYA 1L2QA 3VGGA 4M80A 1X6UA 3BO9A 3GBEA 4GBUA 3VNYA 5IXEA 4KW2A 1AW1A 2ABAA 4LB3A 5C2CA 1I4NA 2C8NA 1WKEA 5GNZA 3V18A 3GR4A 1XIDA 3WLHA 2JEPA 1FDYA 1VFHA 4LEQA 4PMOA 1TTQA 3H4GA 4YVPA 1UBSA 2HQAA 2WVUA 3DN5A 1MUWA 2HXTA 3QC0A 3KOXA 4PRTA 4QEHA 4FR6A 4B90A 1TWZA 3W1XA 1FWCC 3W6LA 3NOYA 1VIWA 3N6HA 3EYPA 4ZMGA 5CJ5A 6ALDA 3N9RA 2R24A 3NSXA 2PWGA 2CKSA 2FTPA 4YLWA 1XIIA 3SUWA 1D8WA 2BV9A 1B2YA 3OIHA 2Z6JA 1HJQA 1YXCA 3OU8A 4A22A 5AC8A 2VTFA 3SQMA 5C2GA 4ZOBA 3WUFA 3URAA 3T09A 4H7CA 1H3GA 1OD0A 1JF6A 3TTOA 5C9ZA 3BV7A 1EB3A 4Z1CA 2JGQA 1WKYA 4Q8VA 1Q63A 3G1YA 4HNCA 2Z1KA 4NNBA 1U33A 3VU2A 3FDGA 3XISA 3L9CA 4IWWA 3GHTA 1JZ4A 3N6QA 4P7LA 4J35A 2NV9A 2JIWA 3W01A 4NG3A 3BLDA 3FW6A 2DT3A 3CQKA 2VX4A 2VO5A 3TYCA 2YLLA 2POTA 2PD9A 2OLSA 1O4UA 2DZPA 1UD6A 4XX6A 5BW6A 1YBQA 3HPSA 2ZICA 5CKSA 3DIPA 1K3UA 4O13A 4GPNA 4D8LA 4F48A 1EJWC 1VS1A 1E9LA 2ZZ6A 3ZVHA 5M2FX 2P3ZA 4UR9A 5CSSA 5FL0A 1TUXA 2V68A 3NFUA 1JFHA 2OQHA 1FFRA 3HA1A 1C29A 3P93A 4AB4A 3WQ6A 1JPDX 4IJCA 3GNRA 4Z17A 3TJIA 2WQDA 1LL7A 4XD6A 2O55A 3AIBA 4IM4A 3G0XA 4MNJA 5CJMA 4CCZA 2O9TA 1FX6A 4JFTA 4K68A 4W7UA 3URNA 5C9XA 1W2PA 1L6FA 3IJ6A 4MJ2A 1BQGA 1XRTA 3SY5A 4Z2GA 3WQDA 1I2RA 1IE7C 4J27A 4U10A 3BLPX 4FLQA 1QBBA 3KOWA 3RDKA 2D3LA 4GGBA 2DZSA 1GVFA 3W6YA 1XLBA 3WELA 3Q4DA 5BOOA 1W3JA 3HPXA 1OYBA 4D6HA 1EC7A 1UJQA 1H5VA 3B3DA 1OCBA 3W87A 3HOJA 1LG1A 1SGJA 3K1GA 4C1NB 1DVJA 2C1HA 3CZJA 3F2BA 3NYDA 2ZC8A 3D46A 1ADOA 1F8MA 2XWDA 1ME7A 3T8LA 2Q01A 3VMNA 1EF2A 2BZNA 1HQTA 3KVJA 1W1TA 2BGNE 4P7NA 1JCMP 1P6WA 1H63A 1IWBA 5CC3A 2VVNA 3I6EA 2Y62A 4TX6A 3UG3A 3TUUA 1GYMA 1SQ7A 4XAGA 3UR8A 3MSYA 2E0PA 4J7RA 3V36A 2OYLA 4FXRA 2V5KA 4GACA 5D33A 1EGZA 4MWAD 4I5XA 3O6YX 3WF0A 4UUIA 3W7GA 3VILA 2YA0A 4QNWA 3TSDA 3M5YA 5C71A 4GFIA 3G1VA 4PUKA 1U83A 4OE7A 3D3AA 4Y90A 1S38A 1J93A 1JUEA 3FGCB 1ICPA 1W3LA 3CPUA 3OLDA 3QPEA 3BSGA 1MQPA 3UVAA 3GUWA 1V0MA 2PDJA 4DJDA 1OZMA 3GSMA 2XH7A 2Z27A 3BZGA 5CBJA 3W74A 1UUOA 5I24A 4XB3A 2PDLA 4RPPA 2PDBA 4LX4A 1KTCA 3P3BA 2OQLA 4DBSA 3NZ1A 3MZ2A 3W7PA 3M0XA 4LUYA 4AIOA 4Q4SA 2E4TA 2FH6A 4IG2A 1OIMA 3EKGA 5AOUA 1PKMA 2VMFA 2ALDA 3EOLA 2CLOA 1ADDA 1G4SA 1NQKA 1AG1O 3DECA 1I8JA 4Q7BA 3MJMA 2A79A 3B0VC 2QQ6A 3UZZA 1K7FA 1TV5A 1MEIA 1Q8AA 5J04A 4HPJA 1ZCCA 3TW6A 1KR1A 4LFYA 4QX4A 3HM7A 4V33A 3FA5A 1BWVA 1MYRA 4RZBA 4Q6XA 2C1IA 4TV6A 3S2NA 3VX1A 3EX6A 3DFNA 3WQ8A 1WCGA 1PX8A 2D0GA 5LGZA 5AHLA 3TVAA 2VCAA 3QZ6A 4NI8A 1XYMA 1BQCA 2VZUA 1EP2A 3LRKA 2ACQA 4BF5A 3O9NA 1ICSA 2GFTA 3EDEA 2IXUA 1CGVA 2NX1A 4CCEA 4MDOA 1G0CA 1V3HA 4GO8A 2CU0A 2QF8A 1A5KC 3QOKA 3AXHA 1MWOA 3UNDA 4JXCA 4A3RA 3EWYA 2QR6A 5T9CE 2BGQA 4ZQNA 4DY1A 4Q4RA 4Q3MA 1NF0A 2O0TA 4WF7A 5IBXC 1GORA 3QPYA 1V3KA 1W2VA 2HE8A 3AMGA 1TE1A 5FF0A 3WQGA 5CC7A 2YGYA 3MA8A 4UTWA 1QPQA 4NYYA 3QMRA 4PCFA 2DIJA 3ABSA 4PTXA 1WAUA 2E5CA 3LTYA 1QCWA 1JD9A 2J6XA 3AWOA 4UNLA 3AYVA 3TXVA 1IEWA 4O1BA 5HMEA 1W5OA 2DZAA 4X22A 4ADTA 1S2VA 4C6BA 5I3IA 1XBVA 4O1CA 1DIEA 3EEZA 4TMCA 3O16A 4JYEA 1QHOA 5EMMA 3NQBA 1P0EA 3R6IA 4DYKA 2NSXA 1UMYA 1JQXA 3LCFA 1F9CA 3ARYA 3I65A 3VD5A 3OLGA 3AU2A 1EO5A 1EZ2A 5GJPA 4ASTA 3C2EA 1LL6A 2B0MA 2Q3RA 3SBFA 2V3GA 3POHA 2CLLA 3GC5A 1VYPX 3TXZA 4ILSA 3QW4B 1BEUA 4A8NA 4DUOA 3WD3A 3BAIA 2P88A 4X61A 2WHJA 2YDRA 3MUXA 2E6DA 3S2JA 1FP8A 2X7VA 5DMYA 3CL8A 3UERA 1K8CA 1Q66A 4LC8A 3A12A 2FZMA 3S2LA 3K1DA 4AFYA 1CENA 3QSRA 1TPDA 3PPGA 4IX2A 1GOQA 3B0PA 3N4AA 2O7SA 5AB3A 3QGKC 2QJMA 2FVKA 1ADSA 1D7KA 1ZRQA 5D9NA 4UCGA 4DWSC 2WLYA 5FJIA 5D2VA 3R1ZA 1F3TA 4HCHA 4QQ3A 2C6QA 4LF1A 3TW9A 1OX4A 1ME8A 3IVTA 2G37A 4TU1A 1X38A 4A3YA 2GDQA 4RLIA 1DTUA 3S1VA 2VFGA 2NSOA 1GQJA 1RQBA 5DLCA 2OSWA 3TV8A 2I56A 4CKQA 3W1PA 1VFSA 1GOMA 5LHEA 1QRQA 5F1VA 1TZ7A 2BHZA 4XD3A 4NZ1A 3AYTA 4R7WA 1FXPA 4BCEA 2HJPA 4RV8A 2NUXA 4P61A 4QFUA 1RY0A 2XM1A 4O12A 4E2OA 4CQ8A 2G0WA 3TYZA 3FJ4A 3EA3A 1TPWA 3QR0A 2DJXA 2CLIA 1F05A 3QKEA 1ZTVA 2BB0A 2MNRA 3BH4A 3EPNA 1L2UA 3G1HA 3PJWA 4H9YA 2YBTA 2FGZA 3W53A 3TC3A 1SFSA 1OT2A 4A05A 1ME9A 5RUBA 2HTMA 4O54A 3KWXA 2H3BA 5GPRA 3WBEA 5I79A 4HOXA 3BZJA 4DJFD 3OGVA 3B8SA 2X0SA 3U5YA 3A23A 4YN5A 4CVUA 1BGGA 3FHAA 1E0TA 3K8KA 3HV9A 4AW7A 5BWFA 3KTCA 5K2ZA 1XF0A 2AGTA 3CUFA 3M07A 4IF2A 5E1QA 3ABZA 4H9VA 3AS3A 1Z89A 2QHAA 4P7QA 1YXYA 3LY0A 3N9SA 3CPRA 4XD4A 3ITCA 3B0UX 5BMWA 1KM2A 3F1QA 4H7VA 2CHOA 4KH2A 4HU8A 3TNBA 4HMNA 3GRIA 2QDEA 3T0BA 3T9PA 1J79A 1WQ5A 3A4JA 3CAKA 4QDMA 4IMGA 1QOQA 1E55A 4PSPA 3GG0A 4UZSA 2Z7KA 4ZQRA 4O11A 4DELA 3PWIA 1RXOB 3NXFA 3RCNA 4XWUA 3NGFA 4ZEPA 1B3WA 4TV5A 1XUZA 3KBMA 3EXSA 3L67A 5D8ZA 5T91A 1FY6A 1GKRA 4C6IA 4H6RA 1OX6A 4JTGA 5A6AA 2OJPA 1E4NA 3CJPA 3C2RA 4HVXA 1F4HA 4WGHA 3NPUA 4E6MA 4WY0F 2VFHA 2YB1A 1XHGA 4WZHA 4R88A 4WRHA 1S2TA 4CD5A 5JBFA 5BWAA 1W37A 1XRSA 2WJZA 1TTPA 2VFFA 5BXRA 4F2TA 4K7VA 2VGIA 2XIOA 2GJXB 4K2SA 4QNEA 1E0XA 3BG5A 2J9ZA 2QYGA 4A8IA 3PM6A 4JOMA 3PBVA 1UIPA 2CC0A 2YCLB 1FWFC 4BFAA 2P0OA 3P74A 2IPJA 1C92A 5BOEA 4OBRA 5D09A 4DJDC 4D6JA 5KITA 1WO2A 3G1AA 2CLMA 1R9XA 3L2LA 3WBYA 3CQHA 1XV8A 4UTTA 3VD9A 1UR8A 4R34A 1T5AA 3ZT5A 1EKOA 1A50A 3M43A 5CSYA 3XIMA 4XAFA 1ZENA 3LCGA 1PB0A 4V15A 1DHPA 1IZJA 1KFWA 3P14A 1P5BA 1BFNA 1Q6EA 2B7NA 2WPBA 4HK5A 4FF5A 3L2MA 4X60A 2W27A 3LENA 3GFXA 4YPJA 3EOEA 3WNKA 1HT6A 4I7VA 2YX0A 1WDQA 4LF2A 1EDGA 4PEKA 1Q3NA 2CBUA 4EVZA 1R3QA 4OZOA 1GQNA 1KWGA 2FGBA 1F74A 1MQRA 1JCYA 4JR5A 3KCJA 5LXEA 1I2OA 4JHZA 5ABTA 1R86A 3WJZA 2ZRVA 4PH6A 3WFZA 3EX1A 3DBNA 1ONXA 4O0ZA 1W9PA 1V7AA 3E2SA 1KBLA 3FVDA 1MW2A 1B9BA 2PWHA 1O60A 1PHWA 3B06A 1L6WA 3DEQA 4O1FA 1HJSA 4PMRA 5LIUX 3CZGA 4MG4A 3TYAA 4W8AA 4G56A 4GY1A 3FEMA 2YA1A 1A53A 3OVQA 4AWUA 4QE4A 3CT2A 4H8VA 1LUCB 2QJNA 2VR4A 1W1YA 1ZB5A 1NDVA 4TMBA 2ADAA 1LP6A 4WD0A 1W6TA 3UWUA 3PBUA 3W7MA 1CXIA 6CGTA 1V51A 1G1YA 1OC5A 2JF7A 4MKNA 3MUY1 2E9BA 2J75A 4FOUA 4GK8A 3HO8A 1W9DM 4ACZA 1NOUA 4N0RA 1LORA 3DKJA 3E2RA 3OVGA 3WDRA 5LGXA 3NQAA 1TVLA 1VYRA 5I2UA 4PZVA 4NJKA 4N4PA 3W85A 2X8RA 5G4HC 1T40A 3GUGA 1AFSA 4ECLA 4QR6A 4AC1X 2INEA 2VD8A 2BY2A 1WDPA 3NQVA 3P0XA 1HP4A 3QV7A 1T0OA 4IH3A 4QXIA 4FEZA 1QPRA 1ECQA 4YU1A 1VCFA 4HIBA 4D2JA 3FXYA 2D24A 3KBJA 5HNNA 1V3MA 4H00A 4C6FA 2OX4A 1G4TA 4DX3A 2V5LA 3AS0A 1RPKA 1HJXA 1QW7A 3ORWA 1VR6A 1L6YA 2QCFA 3EB4A 5G1YA 4L6DA 3ABRA 5FIPA 5A3HA 1HJUA 1S5VA 3PUEA 5LSMA 4REQB 3K4AA 3IS4A 1G7UA 1Y65A 2XN1A 1IXPA 1E0WA 3U2CA 1HX0A 4NUWA 3LNMA 4WOQA 2XIJA 5FI8A 3CLMA 1JZ2A 3A24A 2CZFA 3U2OA 3IGSA 5CPSA 3ZS4A 2ONEA 3MBDA 4JYFA 1E4LA 4HYRA 2VEGA 2VI0A 3O1NA 3RNDA 1E0UA 4JTDA 1QNQA 4O17A 1WV2A 1OINA 4LAOA 4JL1A 3V16A 3GU2A 4BI5A 4GUJA 2D22A 4CNTA 2G5WA 1OCNA 3VX0A 1W56A 1XKYA 1K77A 3EMQA 1TIMA 4WY0A 1J2WA 3BJFA 1GZGA 4A6GA 2YXXA 3CUJA 2WPGA 3TA9A 1RQEA 4PCPA 4R27A 3C6CA 1UD3A 4S3GA 1JXKA 4JTCA 1IF2A 1QATA 5LNUA 1UYQA 4ZA0A 5CAHA 1CYGA 1P4CA 4XAYA 3ZVHB 4R3UA 1F6KA 2NWRA 3KHJA 4ERAA 2C91A 1JI2A 3IJ9A 2YYTA 2I5QA 4EF9A 1RA0A 2GK1B 4H9XA 1UZHA 4WKFA 3FJLA 1U1JA 2RDXA 3WMBA 3VNLA 3PSVA 3IIZA 4XZBA 3HMJG 1H11A 4L4MA 1T96A 1TWWA 2V6AA 4HKPA 2V63A 3P7YA 3DXIA 2PZ0A 3BAXA 3NO3A 2XZ9A 3S5NA 3NQ2A 4YHGA 4UXDA 3WFAA 5D2YA 4RE2A 2XFWA 1MXSA 3M1ZA 9XIMA 2GQAA 1R3WA 1PCKA 4DAFA 2H9AB 2W61A 3RU8X 1ISXA 1CLKA 3BOLA 1ZJIA 3KZPA 1EA9C 1O7AA 1W9XA 4HHMA 4V28A 5HOSA 1I0DA 1OVDA 3IUDA 3UZYA 3Q58A 4W86A 1B9ZA 1H62A 3HFYA 3P6LA 1S3HA 3PF3A 6XIMA 4MY8A 3S6OA 4ZODA 3KVKA 4UBPC 1UP0A 1JI1A 3I68A 2F84A 4DF0A 2DT1A 3HPAA 2DT0A 2R1MA 5AYXA 3SCVA 2YL5A 3ZJ8A 1XYFA 3W26A 1HVQA 4I9MA 3A22A 1V77A 3M0YA 4LCRA 3CB8A 1VEMA 1Y7VA 1G67A 2GVYA 4A2RA 3ABXA 1JYWA 4O8AA 3ARUA 1IIGA 2ZC1A 3ONCA 4FLRA 2QJIA 5DX7A 3UA4A 3PZGA 3EWCA 2FVLA 3NQDA 2E5DA 1FTXA 4YWIA 4AIBA 1FWEC 4TTUA 1QNVA 1YPFA 2PWVA 5HA7A 1J4EA 3ANYA 4ZO7A 4C6DA 2P1FA 2NQLA 4YCPA 3CH0A 1IR2A 5A94A 2PODA 1H2JA 1R9YA 3SAZA 1RVGA 5LXXA 3KBSA 3DCPA 3IGHX 2VEFA 3DYOA 5I78A 4CCDA 1XQLA 3FV9A 2ABBA 5XINA 1BKHA 1Z69A 1ECEA 3SR7A 3S9IA 4GCXA 1F3XA 2ACSA 3UXKA 1R47A 2WMHA 3KCOA 2E68A 3C52A 4WUIA 3NM3A 4JCMA 4RE0A 3EEGA 1Q13A 3E6EA 5HULA 4DM2A 5KMYA 4ENLA 1V6UA 2XN0A 1HF6A 4BA0A 2J8GA 2CITA 4IISA 1XIEA 4GISA 4C91A 2X16A 2CLEA 3MUAA 2D2GA 4N4QA 1XXXA 3V1PA 1XLHA 1PS9A 2Y5EA 1J5TA 3T2QA 4J28A 2ZBTA 4UFHA 4FXFA 3WK0A 3REQB 1UKSA 5M03A 4LPCA 3H23A 3TN6A 1WKDA 4WJ8A 1HKIA 1PIGA 4L9XA 4AXNA 2ZRXA 3GDKA 4KPLA 3QFWA 1OM0A 1OG6A 1TPH1 3ZLFA 2NVAA 1I75A 3PVFA 1OWQA 4IIHA 3P62A 2WWCA 3WH8A 1KM1A 3ME3A 1ZGDA 2V69A 4KWUA 4F9JA 1KQYA 5FJPA 3JZUA 1SZNA 4IXXA 3JUGA 4JTTA 3ID7A 2KAUC 3LS9A 1GPFA 3MMDA 2GGIA 4FX7A 1V5XA 4AWEA 2XG9A 2FHBA 2PA6A 5E09A 2Q3OA 1SW3A 3GDTA 3OLEA 3PZNA 2XHYA 4GKLA 4D71A 3H24A 3ZO9A 3NPVA 1US2A 1IEXA 3FIGA 4H9MA 4M5PA 4AF0B 2YCKX 3CZLA 4EXBA 4IFRA 2PCEA 2BP1A 1D3CA 2VUYA 3BLKA 3TJLA 1V4YA 3A3XA 1HN1A 4HU3A 1E0VA 4WIWA 3UA3A 5BROA 3OA3A 1R46A 1EZWA 4GNJA 2XH4A 2QCCA 3VNIA 1GJUA 4ADUA 2A3HA 2ZQ0A 1JYXA 2D1ZA 2XN2A 1I9CB 1MDRA 2UY4A 3VMPA 3HQPA 3QY6A 1Z41A 1KCXA 4HZ6A 2V3FA 3WIJA 4CUCA 5HQLA 4Y6GA 4C7GA 1U5VA 3BQ6A 5BXSA 1EBGA 1SM9A 3T0TA 2BDQA 5JVLA 1F6PA 4DB7A 3QHMA 3D3FA 4X2PA 4JS3A 3QV9A 4NZFA 2ZXDA 1C7TA 2FZ9A 3EKLA 1G4EA 2Y61A 4ZE5A 3WF1A 1ZY9A 4RDWA 4FOKA 4HMDA 2DDXA 4TUFA 7TAAA 4M6VA 4S3AA 2PU0A 1QPOA 2XUCA 4H19A 3C3NA 2NQ9A 1EIXA 2BY3A 3VIOA 3GYEA 1ZFJA 3F4CA 2OEMA 3GVQA 4UQDA 1TCDA 2PAJA 4CQCA 2WNQA 4HZ7A 2TPSA 3OVPA 1JZ7A 2J8FA 1PAMA 2VZSA 5C0QA 3UJ2A 1TE6A 3W29A 3BC9A 3C86A 3QMTA 2EKCA 3T55A 1MZRA 2WZHA 3OG3A 2QULA 4UR7A 2CLKA 3K30A 3CAQA 1E9IA 1E5JA 4ATDA 4S3BA 4DNMA 3M0ZA 2V2DA 1V02E 1B1YA 3PFRA 3FJNA 1PZ2A 1Q7MA 3B03A 4W5ZA 4ONVA 3QV8A 1YW1A 2GJXA 3VI2A 3GVVA 2ZXQA 1ISZA 1EXBA 4AH7A 1H1NA 3S47A 4KGJA 1UWQA 3CHFA 2QDDA 4G1KA 2OODA 1TPC1 3G1XA 4IMEA 3MVIA 1TV3A 2XGBA 1RCOB 3CV1A 3NTYA 3V35A 1QJWA 3CV7A 1IV8A 1R3YA 4INFA 2GZXA 3M64A 1K4GA 2Y24A 3KEHA 4JX4A 5J8LA 1A5SA 1FWWA 4H7ZA 3O07A 5E70A 2WCAA 2GUYA 3M0HA 4AHQA 2CHNA 1TRDA 4HTBA 4LYRA 3P84A 3AHYA 2VL4A 5KETA 2YBVA 4KESA 3SJ3A 1KFEA 2OSXA 4XIMA 1CXLA 2WYSA 9CGTA 1KM0A 1F3EA 4FI4A 4MNLA 1KR0A 4GVIA 4CNOA 4JQ4A 2J62A 3D47A 3A4XA 1QVBA 3S5OA 3EX4A 2B7PA 3C5QA 1YMYA 4MJ4A 1HL2A 5FJJA 4QSHA 2UWFA 3M16A 4RE4A 2CLFA 1PV8A 4LRTA 1RY8A 1FWRA 4QG8A 4HCDA 3VAVA 3CQJA 3EX2A 4K1GA 1HIZA 3FNDA 3MY9A 5C8BB 4KKXA 4ALDA 5FEXA 1FHVA 1PIFA 2G3NA 5AHIA 1ZJAA 2OZ3A 5D9OA 1P6BA 3GH7A 5DXXA 4YVXA 3N2CA 1ZLPA 3TYUA 2F61A 2VXNA 3WEZA 3QN3A 4IUOA 4KWOA 4QS6A 2X41A 3SFKA 1KFBA 6REQA 1XIHA 8A3HA 3UBPC 4L4PA 4FALA 3UJEA 1E1CB 2P50A 2PP1A 2BBFA 1E71M 4NAEA 5CPLA 1XLFA 3NXLA 1TJ1A 1UBPC 3RLGA 1L0PA 5T9BG 1MXGA 4MLJA 1SFJA 1UQZA 2BASA 5JH2A 4L65A 3ARQA 3GTXA 5CSRA 3GXIA 3COTA 3ANUA 3ARWA 3H55A 4KERA 4LVBA 5EU9A 4KRZA 4U5IA 4BI6A 4C60A 3AO0A 2OZ8A 2PI6A 4AHOA 5C7HA 4MY1A 2Z0IA 1EEPA 4NI3A 1RUSA 1V6XA 5C9WA 3VIGA 3BK0A 3EDDA 2DFAA 2CBIA 1JDAA 1QNRA 3CV6A 3MB9A 3NUKA 2I7GA 3SN0A 1J96A 1E5NA 1DJIA 3U4FA 3PTKA 1LOSA 4M6QA 4A3QA 5I3GA 4H04A 5DBTA 4CNUA 4AMCA 2ZFAA 3P0WA 4H3DA 3GNNA 4HU0A 3R0UA 3ZFHA 3O8AA 3I6TA 4C6KA 1PTDA 2UY2A 3P61A 1TV4A 2EEXA 3B8WA 1XIFA 1PYMA 2A0NA 4G7EA 1OG0A 4YYCA 3N19B 7REQA 5EMKA 3UW6A 4Z0SA 3E2VA 4EOUA 3GTFA 4TTGA 1JF5A 4NVTA 2R1PA 5CLWA 4W85A 5M5DA 1V6WA 5D04C 1S5WA 3EDFA 4LS2A 2Y7DA 3L2IA 4I3GA 3BLEA 4S2CA 3P82A 3C8NA 2OFJA 2ISWA 3FA3A 2PWDA 4B2DA 1KFCA 1A0DA 3FYYA 3CHVA 3U7VA 4PODA 2XFRA 5E5CA 4O52A 2X1SA 2RGLA 1E1EA 2Y7GA 5HXMA 3H2FA 3W7JA 1OJXA 3KZSA 1VLWA 4QG9A 3QLDA 4DZIA 4PL2A 1LWJA 3DKLA 1QDSA 6ENLA 2A3CA 4EXAA 2HMCA 3NQEA 3VPLA 4WVXA 3VUPA 3TR9A 2QJGA 3WL1A 4DXVA 5A5WA 2E9LA 1W3HA 5E9XA 1XH2A 4FAMA 3B04A 1EQPA 2FHCA 3H2MA 1IQ8A 2QXWA 2NVCA 1WX0A 3UR5A 1MRAA 3BGAA 2EQDA 1QXLA 1K6AA 1KCKA 1YNYA 4UQEA 1OSEA 4DJFC 3W82A 4B5UA 1XW8A 3THQA 2GJPA 3PBMA 2Q6ZA 1M7JA 3LZ3A 4UTHA 1PUDA 3HB9A 5DCEA 1PHQA 4C6CA 3CC1A 4D72A 1F8IA 5HMDA 1XDMA 5DELA 1CEOA 5CBIA 2E8YA 5A6TC 1HKKA 3WF3A 4DZAA 2PDWA 4DF2A 1LLWA 1P48A 1N8FA 2OWWA 3DHFA 3W75A 2O56A 2O9PA 3ITYA 4Q4PA 2OCZA 3LCLA 3CAVA 1R0MA 4OV4A 2FZDA 1OFDA 1LTDA 3W23A 3DENA 4NZ5A 1TJ0A 3W27A 3TC7A 4MAVA 4F0RA 3CAWA 4FLOA 1OABA 2G3JA 2OLAA 5L6UA 4HNNA 2GSJA 1UROA 5TD4A 1POJA 3WLRA 3G18A 5BXTA 2IQ0A 1CT5A 2PBOA 1WDSA 5K4ZA 3MPGA 1A5NC 2VOTA 2J9YA 5EKYA 5H1WA 3HGOA 3W2JA 4EPKA 4PTNA 3EA1A 5JU6A 3M7SA 4OIFA 3E5PA 3W1MA 3SUTA 1DIDA 5LIXX 1WZLA 4FIRA 3VMOA 2XIIA 3P2VA 4L9ZA 5EYWA 3VXGA 1JVNA 3NQGA 2CFFA 3GTHA 3DI1A 2XGIA 2WVTA 2EG6A 3CHEA 4KRTA 1MW3A 4JDBA 1MNSA 4GD0A 3GXNA 4AWSA 6TAAA 4WSHA 1FHUA 1CXHA 5CBBA 2J7HA 3GC4A 3NA8A 3IJDA 3ES7A 4K8EA 3U4AA 2Z1SA 3MHFA 1KRAC 2DZXA 3T40A 3W24A 3PTQA 4RZ6A 4U5KA 2B81A 3AMKA 3B9OA 5G1TA 4I7WA 4H1ZA 1OFQA 2RKXA 2QDGA 3WH6A 1GYLA 1J18A 2DSVA 1ISWA 1WZMA 4UTMA 1EWDA 3F4NA 1BTCA 3GZ3A 4HOZA 4O28A 3MP3A 1OFBA 3SUSA 3GXPA 3BMVA 1JGIA 1A3HA 2I14A 1NM9A 4JNMA 1Q8JA 3A5VA 5A8QA 3W7IA 2XFYA 3SQSA 1Q6CA 1US0A 4HA4A 3E3HA 3RM9A 1BXNA 1XCWA 4WEVX 4ERGA 2BHYA 4ML9A 2REQB 3A64A 1AQFA 3PUDA 4M7TA 3N25A 3PTDA 3POCA 1U5JA 2HNEA 4PCNA 3GE7A 3ITGA 3QVQA 1AODA 2EXOA 1RBLA 3MHUA 4PMXA 1FWNA 3ZJKA 2Y70A 4PUWA 2A6NA 1B5TA 3R11A 4J2PA 1PVNA 1IHIA 3DFHA 1GQIA 3ES8A 2E9MA 3VGEA 1V08A 4JTHA 3VA8A 4Y2WA 1BVWA 4OOZA 1VEPA 3VZZA 2VKZG 2WW5A 4AVFA 3E0VA 3WK3A 3BOFA 3G77A 3FN9A 3WY1A 3WJYA 1D7FA 1GGOA 3VKKA 4C5YA 2PDMA 3M7WA 4CEUC 2XSBA 1GQKA 3TROA 1JCJA 3KOFA 1CTNA 1NWRA 3BWWA 3ISIX 4HSOA 1E6ZA 1C93A 1E6SM 1K7XA 1G7VA 1I2NA 4PA8A 4W9TA 3BAWA 4XZNX 3PTMA 3BANA 4K3ZA 4XKMA 4M3PA 2VYOA 3GX9A 4MZ8A 3UG4A 2QMJA 4O50A 5EBAA 3SUVA 3S42A 4GQBA 1W1PA 3R0KA 1FWBC 1YX1A 3U0HA 1J9YA 4EP8C 2BOFX 4PB5A 2J74A 1GEHA 3KE0A 4IUGA 4ATLA 1P7TB 2WC7A 3TW7A 2HPMA 3FSUA 2DZWA 1SVDA 1FWHC 4GUHA 2RH9A 3ZJ6A 3MMTA 2CWNA 4LQ1A 2FJUB 4OUEA 3EWDA 1YKWA 2ZUVA 3NL5A 1VZWA 5EMJA 5CPOA 5I3KA 4OQVA 5DEZA 5EPDA 3RCMA 4U3CA 3W1NA 3THCA 2WBKA 3C0JA 2J66A 5A8GA 2YKKA 3NO1A 3AI0A 2UY3A 3ITTA 4UOJA 3NCOA 4QCEA 3DHPA 1TJ2A 4LAUA 5EGRA 4UTLA 4HPXA 1FQ0A 1N2VA 3UXAA 2DY3A 4Q8UA 4AD2A 4H9ZA 3B0XA 1CZ1A 5JXQA 1UG6A 4BZYA 2VR2A 4DN1A 1MSSA 1XIMA 1RSCA 4W89A 5I7GA 4PL1A 4AZIA 5BU6A 1R2TA 3JVAA 3H7RA 4MTVA 3GLCA 1UP2A 4R85A 3UFYA 4DAIA 2NLYA 1CLXA 1RZMA 1UR3M 4P8UA 1BF6A 2YXOA 3MSGA 2A3BA 4GZEA 3FAXA 1UH3A 3ABQA 3NQCA 3LK6A 1GOXA 4GUFA 3UCCA 1H7WA 1D9EA 1EBHA 1GW1A 1S39A 1XISA 2W4XA 5FCZA 3IJ8A 3NDOA 3GFZA 4GJJA 2H9AA 1IZKA 3QBUA 4F79A 3WLSA 4I5RA 4HU4A 3GTIA 4LXFA 5M3WA 3PAJA 3G2GA 4DHGA 4Q33A 5FJTA 4AZ7A 4XUYA 1XLAA 2QJJA 2FDSA 3C0SA 4G8TA 3N2XA 1W1B1 1XINA 3RJYA 4O4WA 1GJWA 4N6EA 4C6LA 3KL0A 5GJNA 4LANA 5AVHA 1BWKA 5M17A 3BE7A 3W7LA 4ZR8A 5G1MA 1JR1A 5DO8A 3S9YA 2HE5A 3UYIA 4M81A 1K70A 5D8WA 2FZNA 1SR0A 2GJNA 2XIQA 1PWLA 4HHPA 3UT0A 3MBFA 4S3EA 3DYPA 2PDFA 1PCWA 2KX9A 1H60A 4FS9A 3R8RA 3WDIA 1TIWA 4D6DA 3TTQA 3H7VA 4MWAB 4JDYA 4B9YA 4AX6A 1M9HA 1JRBA 5HUOA 2WM0A 2ZCGA 4H2CA 4AWTA 1UJPA 2NVDA 1LT8A 1F61A 2CHRA 1CIUA 2REQA 3O6CA 2B31A 4CVWA 4ZB2A 2Y89A 3B8VA 2ZZ7A 1Z32X 1WZAA 2OEJA 3LM3A 1MNZA 1MZHA 1NSJA 1GOIA 3F03K 4GUIA 4GZJA 2CXGA 3EOUA 2W3ZA 3GXDA 3W0KA 1ZBKA 4GFSA 2NX3A 2ZOXA 3FVMA 1IGWA 4A8RA 2VR5A 2EPHA 3GDBA 5AC6A 3CXOA 3IJIA 1RK6A 2OKOA 4WDUA 3O2LA 3GS6A 2BOEX 5CZJA 2NXHA 1W32A 4EAYA 4Q8PA 4AD5A 4NL1A 3A13A 4GXMA 3BOXA 4MB3A 1KM5A 6TIMA 4JPGA 3WMCA 2E1WA 3G3MA 4PUUA 2QUUA 4Z42C 4J3ZA 4HJFA 3CYVA 4AEOA 4GZIA 2FB3A 5DCBA 3RR4A 3S2MA 2OXNA 3B05A 3VDCA 1SJBA 3WH5A 5DY2A 4PTMA 4PGLA 4IIFA 2C15A 2E3ZA 1QO5A 3G8EA 1XCXA 4V2XA 1ONWA 2PP0A 2QCMA 4ZFMA 7TIMA 1Q6QA 2CLPA 1XC6A 3TFCA 1ITXA 2IPGA 1LT7A 2DVTA 5HAOA 1MFUA 1MMFA 1UR4A 3ARZA 3HF3A 5ABFA 1LOLA 4K39A 3UCDA 4UQBA 5C55A 1Q5MA 3ELFA 3S5SA 4RJEA 2YPIA 6REQB 1J10A 3QOMA 3QH2A 4AY7A 1LROA 2AGKA 1GEQA 4Q4KA 3WQVA 5FEWA 1V0LA 1U1HA 3EPMA 4WCJA 1HVXA 3WCZA 2QGHA 2I5GA 1O5KA 3GU9A 4ORIA 3WDQA 3BTNA 1AH0A 3MV01 4ZSTA 1K8YA 3W7CA 5A95A 1XICA 1S2WA 1G69A 3VTRA 4LU0A 1XG3A 4BF9A 2PDCA 1E56A 1OYAA 1B4KA 2NZLA 2J8TA 2QAFA 1JEZA 1SYTA 1TVPA 3LCXA 4O18A 4FX8A 2WZIA 2PGRA 2DVUA 3VKDA 5HDRA 3PBYA 4IT1A 5I6SA 4F2UA 1SJAA 2X1UA 1SZFA 1EWEA 3R4IA 1GVRA 1W0MA 4LTSA 2RFGA 3LSCA 3THAA 3S6DA 4GKTA 1T6MA 2WZTA 4AY8A 2PRMA 1PX4A 1GVOA 1TWSA 2PD5A 2POZA 3TNOA 2X0HA 3CHCA 3DFQA 2UZ9A 1M1BA 2ZRZA 3T81A 2WV8A 1W1A1 2ZX5A 2OVLA 4N2YA 2EPMX 4MB1A 4XKYA 4MYXA 2DZTA 1ONEA 4QEEA 4MIMA 5FF4A 4PBEA 4WJXA 2DORA 3E12A 3KHDA 1BXCA 3PP7A 1KTBA 1LRTA 4XK2A 3PG9A 2QCDA 1FH9A 1BWLA 3SRFA 1LRQA 4Q8NA 1BSIA 2B7OA 4UQCA 3ICJA 1DORA 3UXDA 3RN6A 4P5UA 1EJSC 3PWAA 3IARA 4HNLA 2FKPA 3W07A 1KD0A 1Q6GA 4NU7A 2ZUNA 4AZCB 3PBWA 1AQ0A 3RMJA 1M3UA 3UETA 4MKSA 2PSNA 3VIPA 4DUXA 1TWIA 1VIZA 4B5SA 3TMLA 2QMKA 2ISSA 1QT1A 1AQHA 2PLCA 1XDLA 4O0QA 1Q4NX 3W7RA 3H54A 5F2MA 1W1ZA 3TN4A 4JTSA 3USZA 3WLNA 1HW6A 1FCUA 2WZEA 2Q8ZA 2H90A 3K13A 4RNFA 1WUFA 4AX7A 3S46A 1GZ1A 1YPIA 1TRIA 3EDJA 3K4WA 3CU2A 1SO5A 4OFCA 1L6GA 1FWSA 3OBKA 3SCWA 3G1DA 4PMJA 3HPZA 3IV8A 3PZIA 3LCWA 2ODOA 4NKCA 4NX5A 1U22A 3WLTA 5C9UA 4YXGA 3C0QA 1Q7ZA 3AZSA 4QQUA 1BG9A 1FCVA 2ZYFA 2A21A 3VYLA 2VDGA 3L4UA 1GJPA 4IZGA 2V5BA 2X0YA 3KUMA 3DFSA 2FPTA 4UCFA 1PO9A 2R9RA 1Z7AA 1RLDA 1CGTA 4KETA 4KFNA 4GY0A 1Q6FA 3HG3A 2NXGA 2QCHA 3BPWA 1SO6A 3VFCA 3B9NA 5A2AA 2XINA 3VNDA 4DM1A 3KL3A 1BSLA 2E6FA 3A3HA 3IJLA 3BJSA 4R9XA 3WBAA 2JGYA 3TZFA 2Z4GA 2ZTJA 3N13A 3VCCA 1JNDA 2IKIA 1UD5A 3FLUA 3M5ZA 2VFIA 3IAQA 1UH2A 4E38A 4OGZA 4JIIX 5C5YA 1HL8A 3R94A 1NOFA 3B4UA 1IR1A 1DJZA 5B7ZA 1O68A 3BLFA 4JEJA 4OJYA 4WHBA 1K9TA 2YR1A 3BAYA 4XBKA 3G6LA 3IK4A 2GJLA 1IT7A 3WLLA 3LTSA 1DTNA 3AICA 1QWGA 3DZ1A 3QY7A 1C8XA 3G6MA 1AH4A 1F6YA 4IMAA 3D5HA 4F0MA 1A47A 5CZKA 5BRQA 2BY0A 2QAPA 2V2CA 4BI7A 4LBUA 5D2XA 3MCNA 1KM4A 1XR2A 1UA3A 3WBXA 1RD6A 1YTEA 2XH2A 3LB0A 4QP0A 3SSZA 3TQKA 1TTJA 5DRIA 1H7NA 3STEA 2BS9A 3VVGA 2Y7FA 1JPKA 1QI5A 2IUZA 2Y7EA 5FJUA 4QJ4B 2VENA 1EJVC 3HN3A 3GIQA 4J3XA 2Q8XA 1EHAA 4RR4A 4JTUA 4EANA 4IQJA 4IP4A 2EG8A 4XKYB 1CW2A 1AQMA 2XIMA 4H9TA 5FL1A 4MNKA 2PC8A 1D2KA 3S1XA 2PDHA 2GGJA 2ISDA 4AZ6A 3E38A 5HWMA 4QHRA 3FJ6A 4IHCA 2I5IA 2VDHA 4R7OA 2HROA 3TIMA 4EK7A 3F5JA 1FOBA 5HJLA 3W22A 3WLQA 4NRRA 3N3MA 4HP5A 4GYJA 1ZBVA 4BS0A 1W91A 2ISFA 2VEKA 2DIKA 3SURA 3FEQA 3LD5A 4A3UA 2BG5A 4Q4QA 2G4FA 1JYVA 3H4XA 1J2BA 4WKAA 3A9IA 4GOAA 3C3UA 3ZLHA 5CJNA 4GJ1A 1UP3A 2EO7A 3RFAA 4MLRA 4L1XA 2INZA 1PL9A 3WDJA 3AXKA 2Y0FA 4LS0A 3LXBA 4D1JA 1XYLA 3AXIA 3IRDA 2XDFA 3E0FA 1A80A 1WNOA 1QNSA 2CYGA 2PS2A 1BRLB 3I4KA 1GG1A 2VDIA 3O15A 2Y88A 4IICA 4GH1A 4L4LA 1D3HA 2CZ5A 3L5LA 1XYZA 1QW8A 2VM8A 3PZTA 4M29A 3L68A 3WF2A 5FKYA 3MU7A 2TRSA 1T99A 7A3HA 2OX1A 3WZ0E 4LB4A 3NVTA 4XISA 3CYJA 4X0NA 3LHWA 1GHSA 3DG3A 1AW2A 1HKWA 3PSWA 1OGGA 4GHRA 1KM6A 2QUMA 3T44A 1TFVA 1L6SA 2C19A 1EH9A 4HGXA 3UJSA 4GWEA 1JZ6A 2G8ZA 4KBXA 3EWWA 3RITA 2ZZ5A 1DBTA 2ESCA 5DXYA 3GW3A 4XBJA 1WOBA 1WDDA 3ITLA 4O53A 1CPUA 4RXGA 3DUGA 1D3GA 2WJEA 3TU9A 2JF6A 2VZTA 4M24A 4XTDA 1VFLA 3CIXA 4YTRA 2R82A 4CD7A 2WMKA 1EGMA 1HKMA 4Z2IA 5AC7A 2PLMA 3SY8A 2PDYA 2E25A 3S1GA 4GY7A 3NVDA 3DC8A 4TOQA 4UFIA 3UU0A 4DIAA 4E5TA 3DFYA 1I1XA 1J0YA 4PMZA 3NR0A 4MHBA 3W1LA 4O19A 4DJED 3LTPA 4UFMA 3VIIA 2DGAA 2ZWZA 1E40A 3NYZA 4BHYA 3FYPA 1LOQA 3ZYZA 1OT1A 1Q45A 1RCQA 4AZBA 4QIUA 3I7SA 1B3ZA 2BFGA 2AL2B 2YBUA 3RXZA 5C7VA 4J4KA 3S5ZA 1PYFA 2YDSA 4KEMA 1GYNA 1OC6A 2FMNA 4YNGA 4DVOA 4BQ4A 3VCNA 4J9JA 3TH6A 3JS3A 1R7AA 5JMUA 3E96A 4IIEA 5REQB 5EMLA 1KM3A 5K9DA 2WLZA 1DWAM 2J47A 4L5ZA 3GWQA 4G9PA 1GPWA 4D9PA 1V0KA 4HNVA 3LPFA 1TPVA 3VNMA 2PUZA 4IQDA 3ZM8A 1M65A 1UUQA 1KLZA 1MI3A 3ITXA 1P0KA 5HNUA 4LSBA 3NDZA 1M68A 4S3DA 2V2HA 2NQJA 1GONA 4JNYA 2J25A 3A6OA 3KVMA 4E2BA 3N14A 1VFTA 2JBMA 3A9BA 2EAWA 1OK6A 1PKLA 3QC3A 1E6XM 3WQFA 4HK6A 5H91A 4MY9A 1RJPA 1J6PA 5AFDA 3W02A 5I07A 1IGSA 4XQ6A 5ECVA 1A0EA 1GCYA 2A5HA 2BWGA 2J77A 1FWIC 1FXQA 3WN6A 3VOGA 3RR1A 4DPQA 4UTWC 1H09A 5DANA 1QI3A 3EWUA 4LNYA 3WEOA 3S1UA 4C6JA 2PF8A 3SN4A 4JAWA 4RXFA 3TA6A 1DWFM 4NJIA 3V3WA 4Q32A 2I16A 3DU0A 3BG3A 3RPTA 3WNPA 3TYEA 1U2YA 1WE5A 3H21A 3CMJA 2QPUA 1WPCA 3M0KA 4QLJA 5AYIA 3QJAA 1S46A 1O5RA 2NX9A 3ERPA 2YW3A 2J78A 1XPYA 2CIPA 3DHUA 3MUZ1 3WSUA 4E0CA 1UQYA 3INPA 4X9SA 3UEQA 3M0VA 1JDFA 2INFA 3R7MA 3TWBA 4JN7A 3VKCA 3OG2A 4WGXA 3T7VA 1AZ1A 2P76A 1KXHA 3KM8A 1M6JA 2OG9A 3UG8A 1JZ3A 1LZOA 1H51A 3VABA 1LLOA 1EJ7L 3HU7A 3IANA 4ZQCA 3N73A 3M0IA 4LBSA 1X1NA 2E28A 1XG4A 5AY7A 4ROQA 3SJNA 1REQA 1BYDA 2HK1A 2WJFA 1P1MA 4GBDA 4DO6A 2J27A 5A8MA 4N7QA 4UTJA 2KZHA 4N02A 3HPFA 1JRCA 5IDZA 2WQPA 3J7HA 3DGRA 4HK7A 5CPNA 4TXEA 3WLOA 2Y8VA 4TQTA 3OZYA 1MEWA 5TBOA 2DUXA 4FIQA 1QPNA 2WKGA 3LHYA 4RK8A 3UESA 4FNUA 3GVRA 3G8RA 1FH8A 3CUIA 2OLHA 3CBWA 4KRUA 4LYQA 2ZE3A 3NPXA 3P8IA 1PEZA 2G96A 3AFBA 4IX0A 3VK5A 4M1BA 4GYFA 4GE8A 3WUEA 1DKWA 4FR1A 1TPEA 1M41A 3V4BA 1OK4A 3T2PA 3CASA 1TPUA 3W7OA 4O57A 5K7JA 4ZTYA 5H6HA 3M0JA 4Q4MA 2DU2A 2WSKA 4PMUA 2WMGA 3CLWA 3CWNA 3K5XA 1JCNA 3OP2A 2QCGA 3F4DA 3PWGA 4AZ5A 1SFLA 1DXFA 1V6TA 3C4UA 4F9DA 5E6ZA 1F7BA 3MZNA 3FA4A 1E9YB 3TMQA 2WC4A 3SM0A 1AZ2A 1EDQA 1HUVA 2D73A 2VNCA 3PPFA 3ZSSA 4PR4A 4BK9A 3AIQA 3WYZA 1E4IA 1YDVA 1EX5A 1XLLA 1WP6A 2RDUA 3S3GA 2YFNA 5TIMA 1XPGA 1SU5A 3VNZA 2QEZA 3VDGA 2Z7GA 3P5YA 2H6RA 5G5IA 3DFPA 2GDUA 1S5MA 4PYSA 3O6DA 4PB4A 1BAGA 2X40A 1HGWA 2C71A 1SUXA 2WSYA 3TDFA 2OYMA 4IGMA 2BVTA 1P7TA 3GNPA 4H6KA 3MO7A 1UD4A 3VOFA 2BSLA 4UMAA 3WX7A 4UFKA 2I9EA 2HV5A 4XV0A 2AL1A 1PE1A 1QI0A 4GQGA 4CQ9A 2IPFA 3LM7A 2C1GA 2WJDA 4IJBA 1XFCA 2JKAA 4O10A 1KFKA 3FHQA 5KZEA 1A4LA 3VIHA 1OYCA 4F3HA 3R43A 2XVPA 4DO7A 5IFTA 2BODX 2J7CA 4C6PA 1E6NA 4ZOCA 4YTTA 2YL8A 3TOYA 1Q6DA 2C0HA 1VAHA 2VGFA 1FVPA 4G7FA 3CZKA 4IFKA 4YTUA 1XLMA 4JY9A 1CGYA 2Y8UA 1UKOA 2FLIA 1KBKA 1Q65A 3ECQA 3GHRA 3N2BA 4IIGA 3PB2A 1U5HA 1KKOA 3O6AA 4ICMA 1PWMA 3W2KA 1E6PA 4WOZA 5I3JA 1NFPA 1UASA 4XTIA 1U1UA 2Z00A 5D9MA 3UWWA 2FPVA 3EOOA 3WDHA 3GHSA 2J79A 3EPOA 4KT2A 3GDRA 4X9YA 3RO8A 2NUYA 2RDTA 1WBHA 2ASHA 1TO3A 4W8LA 1PTGA 1KGUA 1LUCA 4RW3A 1XUUA 1WZKA 3ZIZA 5C54A 1GUVA 3EWZA 4U33A 2HDJA 1R85A 2VC7A 5IHSA 2F7FA 4C5ZA 5AHFA 2FHFA 4C1NA 4GNKB 2P5NA 4S3CA 4KCTA 3F4WA 3WENA 2XVNA 4PMYA 5LNVA 1XIGA 3O05A 3EMCA 4IQLA 4NY2A 2R14A 3BARA 3O06A 4KWVA 2DSZA 4GX9A 4QBXA 1KRBC 1RBAA 4E2VA 3LN3A 3ZT7A 4HZ8A 4IPIA 3AUOA 3WL0A 1RP8A 2PWFA 4Q8TA 3KDNA 4TVCA 2V5DA 4MWAE 2VRJA 2IPWA 4Z2LA 1GTEA 4PTWA 1Z8AA 1LQAA 5EL1A 3TYDA 4TX9A 4QRNA 3L4XA 1QWKA 1V8EA 1UKTA 3STGA 2QCNA 5LZLA 2TODA 4CD8A 3NQMA 1SZRA 1FH7A 5A1AA 1XM3A 1IWAA 4XD5A 4RL3A 3LXCA 4IGSA 4RV3A 4YS1A 3FCPA 3A21A 3QSTA 3IJ7A 1HJWA 1XLDA 2GL5A 3CEPA 4UMBA 1DJHA 5I23A 2E67A 3DFTA 4YVVA 1GTHA