3GUGA

Crystal structure of akr1c1 l308v mutant in complex with nadp and 3,5-dichlorosalicylic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
318
structure length
318
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTVDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C1
publication title Crystal structure of AKR1C1 L308V mutant in complex with NADP and 3,5-dichlorosalicylic acid
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 114
structure length 318
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3gugA00
2IPGA 4XZHA 2PDCA 4JIIX 4XVDA 3KRBA 1AH3A 4NKCA 3O0KA 4JQ4A 4WDUA 4HMNA 1VBJA 3D3FA 3UG8A 3CV7A 4JQ2A 1YE6A 3QKZA 5LIUX 1OG6A 3LZ3A 3C3UA 3GHRA 2PDGA 1HQTA 2BP1A 4YVPA 3R43A 3MB9A 1YE4A 2ACUA 3ONCA 1EXBA 3BCJA 3WBXA 3N6QA 5HA7A 3GUGA 2FZ8A 3V0TA 4GA8A 2FZ9A 4PUUA 3V0UA 4PRRA 2AGTA 2PDWA 4PMJA 1ZQ5A 1VP5A 1R38A 1T41A 5HNTA 5KETA 1XGDA 3UZWA 4GCAA 3EB4A 2PDNA 5JH1A 1EF3A 4JTDA 4OTKA 1K8CA 4LB4A 1RY8A 1Z89A 1S1RA 1Z9AA 4EXBA 3GHSA 4AUBA 5LIXX 4XVEA 2BGSA 1XF0A 2PDPA 4IJRA 3FX4A 4DBSA 3CV6A 1ZUAX 1X96A 1MZRA 3LBOA 5M2FX 4XAPA 4JQ3A 1AZ2A 1EL3A 4JQ1A 1X97A 4RPQA 3DN5A 2FGBA 4H8NA 2IPWA 2INEA 4I5XA 3DOPA 5JH2A 1EKOA 3BV7A 5LIWX 2HE5A 4JTQA 3R94A 3V36A 2PDLA 3LN3A 1A80A 3F7JA 3RX4A 4XZMX 2R9RA 2IS7A 2C91A 4XK2A 3B3DA 4WDWA 4EXAA 3ONBA 4ZFCA 3S3GA 3V0SA 3WBWA 2PDHA 2IKGA 3CMFA 4GABA 1Q13A 4LBRA 2FZBA 3UP8A 2HVOA 1FRBA 4QXIA 1J96A 2PDQA 3UFYA 1IEIA 1ZGDA 2IKJA 2ACQA 4IJCA 4WDXA 3UGRA 3UWEA 1AFSA 1LQAA 5AZ1A 1RY0A 1S2AA 2DV0A 4WRHA 3M4HA 5HNUA 3CAVA 1C9WA 4QX4A 1QRQA 5LIYX 3G5EA 1US0A 4DZ5A 3BURA 1XJBA 3GHUA 1HW6A 2PDFA 4ASTA 3G1RA 2PZNA 3Q65A 4LAUA 2PDUA 2IQDA 4L1WA 1MRQA 3R7MA 1PZ1A 2WZTA 3EB3A 4XO7A 3RX2A 2QXWA 4FAMA 1AH0A 4WDTA 4YS1A 1Z3NA 4QR6A 1Z8AA 1AZ1A 2NVDA 2PDKA 2IQ0A 5C7HA 3WCZA 2F38A 4JIRA 3LUTA 3M64A 4WEVX 2ACSA 2IKHA 4LAZA 3VXGA 2I16A 2VDGA 3FJNA 4R9OA 3O3RA 1Q5MA 3LQGA 4GACA 3EAUA 2HVNA 2ACRA 1PWMA 2PDBA 1UR3M 2ALRA 5LIKX 2WZMA 3LZ5A 3LEPA 3U2CA 4Q3MA 1JEZA 2IPJA 4IGSA 4F40A 3COTA 4GQ0A 3R8HA 4QBXA 1IHIA 4YVVA 4LB3A 2HV5A 2IPFA 1YNPA 2HEJA 3ERPA 3R8GA 3WG6A 4PRTA 3V35A 3LENA 4L1XA 4G5DA 2PDMA 1GVEA 4LBSA 4GIEA 4MHBA 1SM9A 4FZIA 3CASA 4ICCX 4XZNX 1PWLA 2INZA 4DBWA 3H4GA 3UZYA 4XZIA 2I17A 3RX3A 1MI3A 4GQGA 1LWIA 2PEVA 2DUZA 3N2TA 4JTCA 3NTYA 3UZXA 2PDXA 2NVCA 2J8TA 4FA3A 4PUWA 3R58A 2FVLA 3CAQA 3R6IA 4JTRA 2PDJA 1ZSXA 2PDIA 1X98A 1T40A 4H7CA 1S1PA 2HE8A 1QWKA 3LD5A 4YVXA 4JIHA 5AZ0A 2F2KA 3UZZA 1AH4A 3LQLA 3H7RA 2BGQA 4HBKA 2R24A 4JQAA 3T42A 3LNMA 1PZ0A 4XZLX 3GHTA 5DANA 3M0IA 3BUVA 2FZDA 3P2VA 2PFHA 2PD5A 1RALA 2IKIA 2ISFA 2PDYA 4YU1A 1S2CA 3MC5A 1YNQA 2PD9A 4PR4A 3Q67A 2P5NA 1ADSA 2A79A 2PF8A 4JTAA 4WGHA 2CLPA 3WBYA 4FALA 2DUXA 4Q7BA 4DBUA 3UYIA 4XO6A 1M9HA 2HDJA 3H7UA 1PYFA
chains in the Genus database with same CATH superfamily
2HSAA 4XZHA 1BF2A 1M53A 4KCWA 4W8LA 3MUY1 3REQB 1XLFA 1VJZA 2P3EA 2XH2A 4NKCA 2C0AA 3PB0A 1VBJA 3GW3A 4GUGA 2VFGA 3UG8A 1OZQA 1ZCCA 5U4NA 3EWZA 4W84A 1TWIA 4UMBA 4LANA 5I5RA 3C3UA 3WUEA 4PRWA 2VWSA 5D2XA 3UWWA 2BP1A 1TREA 4JTHA 3WZ0E 1HIZA 2X0SA 1A47A 4F0KA 4LRSA 1R7AA 1EPVA 3JRKA 4GVIA 2CFFA 1ONRA 1M7OA 1UQZA 2J9YA 2OOGA 2WJEA 3N9KA 2D3LA 5BXPA 3WBAA 3MZ2A 1BXBA 5A3HA 3I10A 5C55A 3N73A 3GUGA 3A5VA 3ZSTA 2OG9A 3HURA 4ORIA 3LCXA 1Z48A 4O28A 3GZAA 1S5WA 4I6KA 4IM4A 4XV0A 1LUCA 1VD6A 4MY9A 1QOPA 3SY5A 1GK8A 2ZZ1A 4WY0A 2V82A 3BCFA 4GBDA 4KQNA 4UR9A 5M17A 3LXBA 4G56A 4B9YA 1BVNP 3WKZA 3LGDA 4JKKA 3KRSA 3BLLA 4O1FA 1I2QA 3WEMA 1RY8A 3TTSA 3W6LA 3CUXA 1Z9AA 1ITQA 3K46A 1YPIA 2WWDA 1D3GA 3O6YX 4GX8A 2X41A 5GJNA 1OFBA 1FWDC 2BOEX 4D6JA 4WSHA 2AL1A 1UWQA 1HKWA 4FXRA 1EDQA 3ANYA 4QE1A 3WH5A 2BBFA 1D7FA 2WNQA 3N11A 3NG3A 4OECA 2DIJA 2WVTA 4UQAA 4AB4A 3DECA 2IPWA 4IISA 3NPXA 3B8SA 3SY8A 1QCWA 2V30A 1DE5A 1JZ4A 4IPJA 4MFEA 4O0ZA 2BHUA 4ML9A 3L67A 3BW4A 2VEFA 3MO4A 4E5TA 1KQZA 1K70A 1O5RA 4OUEA 4EIVA 2HQAA 3EX6A 5CC5A 3C0SA 3KCLA 1VH7A 3RNDA 3GNPA 4M0XA 1AFSA 1JJKA 3NL6A 4Z1BA 1FWJC 5T9BG 2OGYA 4C6JA 4JICA 2EHHA 4CU6A 2QUMA 3S46A 1GQKA 4ZOAA 1ADDA 1HL9A 4QHRA 1QRQA 1NWSA 4NNBA 3VGFA 1XJBA 4H8VA 4L9YA 1VFOA 1KWGA 1JCYA 2PDFA 3VIGA 2E6AA 3AQUA 3RF9A 1OB0A 4H19A 2NSXA 3ATZA 1VEOA 3UCCA 3VCCA 3AMDA 1QXLA 2WMJA 1U33A 2R91A 2PTWA 3P74A 4FAMA 2HS8A 4IFKB 1JNEA 1G6CA 1K6AA 4LU0A 4D8AA 1SGJA 4A8RA 1GG0A 3FKRA 3TC6A 2ACSA 2GJNA 2EEXA 4LAZA 4Q7IA 2XFFA 1TV2A 5AY7A 1CBGA 1L2QA 1FWCC 2XIIA 1GKPA 4N4PA 5FJTA 1T0OA 4NJGA 5CCZA 5F7UA 1RCQA 2VUNA 5DLCA 3SBFA 1HL2A 1BRLB 4OKDA 1O4UA 3R8HA 4YVVA 1XLAA 1JUKA 4K2SA 3V7PA 2Y4SA 4ACZB 2NQZA 3QV6A 4Z2HA 4GXPA 4IG2A 4NL1A 3PC0A 1E40A 5I06A 3S1XA 1XYLA 4LC6A 1SMAA 4DUOA 1KCKA 4HPXA 4LBSA 3TOPA 5TIMA 3ARVA 4HCHA 4ICCX 1ISZA 2Z6JA 4K8GA 3VD4A 4JL2A 1F4HA 2INZA 3SADA 1MMFA 2BMBA 4W5UA 4NX0A 3GXIA 3T44A 2JKEA 1W3KA 4JFSA 4M51A 4Z2IA 4Y6GA 4PMVA 2XN0A 4QGCA 1UROA 4DYJA 4WXYA 3S4TA 1R9ZA 3UWUA 3L0NA 2PF0A 3P84A 3BQ5A 3UA4A 4DXKA 4UOQA 2F84A 1GEHA 3VAVA 1EDTA 2BFGA 2EG7A 5ECUA 1XLEA 3WN6A 4X0NA 3WQFA 3PTDA 3HPFA 3M7WA 1GKQA 4GKTA 5D33A 3N04A 3E38A 1X7FA 3NR0A 5CXPA 1FUYA 3WK3A 3BPWA 3MSYA 2OZ8A 4S3JA 3ZWTA 5K4ZA 3GAKA 3EXTA 3IVSA 2TSYA 3FJ6A 3ZFHA 3OVGA 3LMYA 3LQLA 2XHYA 5A2CA 1NFBA 4K38A 4ZBCA 2F61A 2QPUA 3RPMA 4AWEA 2XWEA 5AVHA 3PFRA 2PDYA 1CGYA 1F07A 1DWHM 3UNTA 1B57A 1EGMA 3PBWA 1YNQA 2ZX9A 5LA0A 5BRBA 5K9DA 2F8QA 4G8TA 4H00A 3VYLA 3OOQA 2BZNA 1LCOA 2VL4A 5K9CA 3TTOA 4JEJA 4MKNA 5AC8A 4FOUA 2XIBA 1JPMA 2QMJA 3KOFA 4QG9A 3R79A 2GDVA 4GIAA 4YIWA 5EMUA 4HZ6A 2BV9A 1ONEA 2W79A 3KBSA 4A8LA 3O63A 3W29A 3H4WA 2GK1B 1O6IA 3S0CA 1Z32X 3SSJA 3KRBA 3MUAA 1RPKA 2BNJA 1Y5VA 1UPMB 1EFZA 4NYYA 3GUWA 3M5YA 1CDGA 1VAHA 1ZCOA 3WF2A 1KNWA 3EX1A 5E1QA 1DORA 3BZGA 3LM3A 5I78A 4A3UA 5E6YA 1IV8A 3VDHA 1WOAA 1FWNA 2PLMA 2VZTA 2NQLA 4MB5A 2WJDA 4JR5A 4TV6A 1ZALA 1ZNNA 4A3YA 2ZRZA 3U6WA 2Y24A 1WP6A 2VURA 3G6MA 4FX6M 3VUSA 3S9IA 1WO2A 1R3VA 3NA8A 4F2TA 5FEPA 1LBLA 3GDRA 1GEQA 3KP1A 1GG1A 4PEEA 1IIHA 3DU0A 1OIFA 1W9PA 2UBPC 3BAKA 3P7YA 5HNTA 3UZWA 3WD2A 3EYPA 2PDNA 5DT5A 2ZXQA 3WK1A 3T0TA 1EZWA 2IQTA 3BAYA 4OTKA 3TUUA 1HXJA 4PUMA 2V2DA 2BB0A 2ZVIA 1B3XA 3ARXA 3IV8A 2ZOXA 2YL9A 1MZHA 2PCQA 3WQVA 4HTBA 5C9ZA 4H04A 1EXPA 3EBVA 4PUEA 2L5HA 4IF2A 1GVOA 1X1NA 3TOYA 1O7AA 2FGLA 3LK6A 4X63A 1X97A 1FCUA 4S3CA 1Z69A 1E6RA 2H9AA 4GZEA 1UQYA 4ZQRA 1XCFA 3W00A 4M8UA 1ODZA 1JL8A 3LPFA 3IUDA 4EACA 3DOPA 1VYPX 3VK5A 5C2CA 2R8WA 1D8WA 4N2YA 1FP9A 3UCQA 2IXVA 2HE5A 1JPHA 3R94A 4GO8A 3VIHA 4J3VA 3SAZA 1W8SA 2BGNE 1VIZA 4I90A 4U10A 1U22A 2DW7A 2W92A 3MHFA 2QCEA 3W1QA 3CYJA 1PKNA 2WBKA 1K6WA 3SO7A 3CH0A 4PUJA 3V0SA 3NQBA 4WZHA 4FLSA 3OZPA 4FLOA 2FMNA 2QEZA 3BL3A 3NVDA 3W07A 3W86A 1NIUA 3STEA 4F0HA 6XIAA 3BW2A 1QVBA 2O9OA 4TTGA 3TJ4A 4ACYA 5HPCA 3EMZA 2REQA 3E9AA 3TDFA 4F0RA 4TUFA 4WF7A 4NZ3A 5HNUA 4FNTA 5C2GA 1AL8A 4QM1A 1WDPA 3V3WA 5M03A 3FDGA 2Z25A 2J7FA 1P5BA 2NW0A 2G3NA 1X39A 3L66A 3EXSA 2YCLB 1RJPA 3MS8A 4B16A 2AKMA 3IANA 3IIZA 3VD7A 4PGLA 3RJXA 4H6KA 3N4EA 3KZSA 4ZSTA 1CGTA 3FVMA 1NOUA 2VEKA 1TR1A 1QMLA 4E2BA 2VX4A 4FNQA 3SRHA 3KLLA 1UUQA 1ITCA 3HZ3A 3FS2A 4KS0A 3A64A 2ZUNA 4JHOA 3W82A 1V3LA 2VP8A 1GJPA 5IHRA 5EGRA 3BMVA 1P0BA 2RJHA 1FY6A 4LRTA 1PWMA 4KGLA 3WF1A 4HCDA 4HK6A 4RW3A 4O1CA 8XIMA 3O6DA 4K6AA 4M80A 3TSBA 1VRXA 1AG1O 1R3WA 1Y5WA 3STGA 3OHIA 3KOYA 3TW9A 2VVNA 4H9VA 4RV8A 4XWUA 2CLMA 3LNPA 2E09A 3K4WA 3WDQA 2VR5A 4F66A 3VOIA 3W26A 5HJLA 4CNSA 3FJ4A 5LNWA 1J5TA 3AWOA 3SN0A 2ZE0A 1RA5A 2YW4A 5FAJA 3T0DA 1UWTA 2QCCA 3L4TA 2FTYA 1M03A 3B97A 4K68A 3NXLA 4KIRA 4DXVA 1K7XA 5K2ZA 1PHQA 5H91A 1GVRA 1XC6A 3W7EA 3W2MA 1F3TA 1MW0A 3LMZA 2GDUA 3C0LA 1S2WA 4AF0A 1V5XA 2W4XA 1V02A 4W8BA 3H4GA 2WV8A 2XIJA 2XJ7A 4BCEA 3E49A 2OPJA 5FACA 4C1NA 2E1WA 2DUZA 3W7GA 4JIPA 3N2TA 5D2YA 3NTYA 5HMSA 3ZVHA 1K8YA 5CKSA 1QDSA 4KMQA 1H49A 1P0KA 2YCKX 4B3ZA 3PJUA 3B06A 3F5LA 4OUIA 4P8UA 3WFAA 2KX9A 1SSDA 1CTNA 4LV9A 1P0NA 3DENA 3NEHA 1A5OC 2HE8A 2G3MA 4GXMA 3NOEA 4JTFA 1OABA 2CETA 3H2OA 4O8RA 1MUWA 4RNIA 1XYAA 4LVFA 4JTIA 2FDSA 5A8QA 5ECVA 1V03A 3H26A 3NQCA 3S2LA 2P1FA 1E4IA 4CVWA 3QXBA 4Z2LA 2YDAA 1XG4A 4PMYA 4QE4A 4GGBA 2ISFA 2YCEA 3N3MA 4YU1A 2CEQA 4NZJA 3MUZ1 5CGQA 3TFXA 1XDLA 3TYCA 2DU2A 3SSZA 2ZUMA 1JR1A 1TA3A 2O9TA 1KBLA 4NZ1A 4JFVA 4YCOA 1OGBA 4E8GA 5CH9A 3NDZA 4XD4A 2OLSA 2Y63A 3IJDA 3I7RA 3LBCA 4NP7A 1EJUC 2XN2A 1MEHA 4Y9PA 1W1YA 3CQ0A 1IT0A 3BLKA 4Q22A 3ZJKA 3WLJA 1V3MA 2OMAA 3KOZA 1A5BA 2ON3A 3BGGA 2FKPA 1NQ6A 3CEPA 5LNRA 4XSMA 1AH3A 3DFSA 3E6EA 4U3AA 5T8GA 4DWSC 4CD5A 4L4OA 4IPPA 1RA0A 5EMKA 2DPEA 2ZWZA 3RM9A 1BWLA 1MQRA 4F48A 4H4IA 4H2HA 3GHRA 3VCRA 4XIMA 4YLWA 1H7RA 2XSBA 4N9BA 2QW5A 4NX5A 4AZGA 4IHCA 2YB4A 4IOTA 3N15A 3GXFA 4IUGA 4ZB5A 3SCSA 3T40A 2NX9A 3PJTA 5DRCA 2Z29A 4M29A 5I3IA 4GI4A 1D2KA 4O14A 3GR7A 3GXTA 1G7VA 1XLIA 2HS6A 4MPQA 3WBXA 3N6QA 4B5SA 1XV8A 3NURA 3ARSA 5DMLA 4Z1CA 1XYZA 2Y6ZA 1W9UA 4ML4A 5KITA 4ORMA 3QC0A 1H62A 3OLEA 3GR4A 3VABA 3W7RA 1I1XA 3B9AA 5BWFA 2PDWA 3CWOX 4BF5A 4DLMA 2XZ7A 4RPPA 4Q4OA 2QDGA 1W54A 3GIQA 2J8FA 3WK2A 5DMYA 1BG4A 1E70M 3S2NA 2ICSA 1M6JA 4NI3A 1K3UA 3VCNA 5GNYA 5A6TC 1JFHA 1RD6A 2WVSA 3WD3A 2YBVA 2B0MA 1YMYA 2EO7A 2VZOA 3GYEA 3JU2A 3LV5A 4DXXA 1X96A 1F4AA 1CGWA 3WQWA 2C7FA 1I75A 4GBUA 4XZWA 4YYCA 3HGRA 3TW7A 2YLLA 2RGLA 1HO4A 3ELFA 4H8NA 2INEA 3HJEA 4FLRA 2H3DA 3OODA 4JTQA 3AMCA 4UTTC 4DO5A 4XZMX 3M0HA 4MNMA 5CBBA 2D0FA 4LPCA 3W1XA 4FR6A 1DWAM 1VR6A 2HVOA 1T99A 4TX6A 3MT1A 4BI7A 2IKJA 3BMWA 2BX7A 2X1TA 5H8PA 2QCMA 2DVUA 3KBMA 1G0CA 4DZHA 3BJSA 4ZXLA 3EDKA 5MF5A 2CERA 5HNNA 3OTRA 2C18A 2Q71A 3TA9A 5KZEA 2E1DA 5EYWA 3AIQA 2V0TA 1SJBA 5HQEA 2Q8ZA 1KBIA 2H90A 3TLLA 1EB3A 1VBUA 2I1OA 2IQDA 4A22A 5XIAA 4XTIA 4R3UA 4QDWA 5DQPA 2AMXA 3GB6A 3LXCA 3P61A 4OJYA 5BXSA 2MNRA 5A1AA 5D09A 1EJ7L 5D04C 4REQA 4F9DA 3CUFA 1QI0A 4YHEA 1E0XA 2VRKA 1BKSA 2ALRA 1E73M 2A5HA 5A94A 4XKYA 3CJPA 3A9IA 9XIAA 2ZRVA 4MKSA 4BR1A 3CH9A 3HO8A 1G4SA 2E6DA 2ALDA 1HL8A 1A0CA 2VC7A 3WQOA 3R8GA 2PWEA 5A95A 2OU4A 4ZB2A 4LYPA 2DGAA 2WMFA 3CO4A 3UERA 4H9TA 5CBJA 3WDRA 3U48A 4B90A 2HISA 2YX0A 4GIEA 3SUTA 5KZ6A 3LTSA 4FZIA 2OOFA 3LA4A 3LPGA 1B5TA 3F2BA 2KAUC 3U8GA 4K39A 3IAPA 3VMOA 2OLHA 3EDFA 2CKRA 4XZIA 2I57A 4NQ1A 3PWAA 3E5BA 5EBAA 1XIBA 3OEXA 4MKVA 1NELA 2BOGX 4MY8A 2CLEA 2QVNA 1JAEA 4GYFA 1PTDA 4AD0A 5K4XA 3RPTA 3WNPA 4LVAA 1NVMA 1XQKA 1ZLPA 2VFFA 3C8NA 4JTRA 4Q8QA 4KEMA 1F05A 1V6YA 1XSKA 1VCGA 1O60A 1T40A 3TN3A 3F5JA 3VNMA 4CQ9A 4U5IA 3OA3A 4LV4A 2Y7GA 2DFAA 3B8DA 1N2VA 4MLJA 1OJXA 5HINA 2O0TA 5U7SA 4G1KA 3GFXA 4JHZA 4UCGA 2DIEA 1UD5A 3WY1A 5LNSA 3H7RA 3LNMA 3FGCA 4MVAA 1B1YA 4IIDA 2PFHA 2YJQA 1H7PA 2GJRA 2FQIA 1TX0A 1UW9A 4EX4A 4I9TA 2X1RA 2H8ZA 2I56A 1QJWA 4S38A 4X0VA 1X6NA 4GNJA 3JR2A 3VX0A 1UD8A 2ZXDA 1QU4A 4KWOA 4CQAA 2PF8A 1TQXA 1E9LA 2G37A 2CLPA 2Z26A 4WR3A 3MKVA 4U2YA 1TUFA 3GBEA 3UYIA 4ALDA 3EPNA 5I02A 2MUCA 4W4QA 3RR1A 2BASA 2P8CA 5JIPA 2HJPA 2C3ZA 2G3FA 3VNZA 4Q8OA 2D24A 2IPGA 3S83A 1ZTVA 3CAWA 3TW6A 2OR2A 4CN4A 2OZ0A 2ZX6A 5LIUX 3C2VA 2ZQ0A 3A5FA 3W28A 3N4FA 4IMAA 2A3CA 1S3TC 5TBOA 1FBAA 1YTDA 1YIXA 3N9SA 2FLIA 3B0XA 5HMDA 3L68A 3UA3A 3R13A 3R43A 3CEUA 4RXGA 3HPZA 4PBEA 3LSCA 1G67A 3NVTA 2NXHA 3AI0A 4PZVA 1A0DA 1IWBA 3QSRA 4D6HA 2GVLA 1TJ2A 3RCYA 3CT7A 3UNDA 3WDJA 1QPKA 2WVVB 1NFPA 4Y9OA 4WJ8A 1S2UA 4Q8NA 3HV8A 1OF8A 2R1LA 3KXQA 5EMMA 1XLJA 2GGIA 4DJFA 5F2LA 1WYIA 3LS9A 4AD3A 1TPB1 2Z7GA 4ROPA 3UR5A 1B3VA 4O10A 4HPGA 1QNSA 4C7FA 1BXCA 1KXTA 3HIJA 5C9UA 2X16A 3M0VA 5JBEA 1V0NA 3CIWA 3H8AA 5KETA 3EA3A 3JVAA 1QHPA 3FYOA 3S2JA 4AZ7A 3LCGA 1KKRA 1KXHA 1XRFA 4LH8A 4PH6A 3EX2A 4Y9MA 3FXGA 1FHVA 2J7GA 4AG0A 1RK5A 4NAEB 4LAMA 3LY0A 1FXQA 3G77A 1UH4A 7TIMA 1XISA 3VILA 2EG8A 1H3GA 4I7UA 3O1NA 2Y5SA 1FP8A 5M1TA 3AJXA 3CQIA 3XISA 1UZ1A 1ZJHA 4J3XA 2JIEA 4JCLA 3Q37A 4QJ4B 1KO0A 3QTPA 3UT0A 3NGJA 2JQXA 1TMHA 1LLZA 1DHKA 4YYFA 5HNRA 3USBA 3WLMA 4B92A 2R9RA 2I5IA 4LAKA 4X9SA 2XIOA 4EXAA 4ZFCA 1DJHA 2PLCA 3GSMA 2F9RA 2O9RA 3DCPA 4Q4QA 1AQMA 3B9NA 3U3HA 3QZ6A 5FJPA 1FRBA 3CTLA 1GPWA 3SCVA 3CL6A 1P7TA 1GHRA 3UWEA 1W5MA 2PZ0A 2ZADA 3HPSA 5AZ1A 1E15A 4Q4SA 3DBPA 1KW1A 3W38A 4FEZA 1VYSX 4GC3A 4GNKB 1HZYA 2UWFA 1C9WA 3EWUA 4BJHA 4L6OA 4GI6A 4CGTA 3GFYA 2SFPA 3Q65A 1YDVA 4E8CA 2V81A 1L6SA 3LDVA 4HSNA 2C6QA 4OT7A 4G7FA 1Q2SA 3H53A 1QT1A 4UFMA 4O1EA 2GJPA 4H6RA 2X1UA 1L9WA 1ZBVA 3DYPA 1KKOA 4DF1A 4L7ZA 4MB4A 3MYOA 1OFEA 4O50A 2CC0A 3CWNA 2VDGA 3BCDA 4CNOA 4KGJA 1DJYA 3V18A 1UPPA 3M1ZA 4EXQA 2Y0FA 5LIKX 1UR2A 1ITUA 1KM6A 1KBKA 3Q4DA 1M7JA 2Y1HA 3GNNA 2DZTA 3UQNA 2P8BA 2TPSA 1EWDA 1ZJAA 3ZVIA 1KCXA 3EWXA 1EIBA 3NQDA 2VGIA 4HMEA 2QCDA 4LB3A 2CZVA 1GOMA 4J4KA 3FSTA 3F2DA 4M1BA 4HA1A 1ML1A 3MTWA 3L2IA 4N4QA 4I5RA 4R34A 4PRTA 3C0JA 2PMQA 3GVRA 1E0TA 3BICA 1E0VA 3AMGA 1W3JA 2EPMX 2OQLA 1GJWA 4CCZA 3P14A 3AMKA 5HBFA 2PDMA 1R3RA 3G0SA 4TVDA 3NZPA 5TAOA 3VM5A 4FXFA 4KWWA 4EPEC 4H3DA 1H1YA 2YSWA 4PN2A 2I17A 2E6YA 4BZYA 5F1UA 4CU8A 3BH4A 4KBXA 2W67A 4JTCA 3VOGA 4KW2A 2NV1A 1IXPA 4J1OA 3LPOA 4RUBA 5HXMA 1S5MA 1GQIA 4P8XA 1TCMA 4UTWC 1O66A 3ZXWA 3OHMB 1PAMA 2PDJA 4O1BA 5AHFA 5BOOA 5GNZA 4JY9A 3WH6A 1TB3A 4X61A 3CS2A 1F8MA 4RDVA 5JIWA 1YADA 4HGXA 4FXJA 3GNDA 4G9PA 1GYNA 1BSLA 1TUXA 4YJ5A 3GE7A 5A5WA 3TN4A 3O7UA 4WUIA 3RHGA 6ENLA 4YTUA 3G22A 3KTCA 2WCGA 3CQJA 3U5YA 2X1IA 1OC7A 2REQB 4IJBA 2D69A 4MSSA 2DZBA 3QBUA 5CEWA 1FWFC 5FESA 3ARWA 2GGHA 4BQ5A 1UP2A 1Y7VA 1E4MM 4QDMA 3GDTA 3SURA 4ERIA 2YDQA 2GL5A 1J79A 3GTIA 4AD4A 3WQ4A 1SZNA 3WD4A 3VGBA 8A3HA 2CIPA 2C19A 1ADOA 3KDOA 1MDLA 3GDKA 3BGAA 4HHPA 4OBSA 3KDNA 2OEJA 3CZKA 2DVXA 3UVIA 3QPEA 3IJQA 1HGWA 3GFZA 4DN1A 2PI6A 1HVQA 4MWAA 3S1WA 5IRPA 1AL7A 5CQ1A 2O56A 2J4GA 3H7UA 1PYFA 1S39A 2EG6A 5E0CA 4Z0JA 4GVHA 3RM8A 4F8XA 1KTNA 1UR4A 2DW6A 2VOTA 1R0MA 7ODCA 4JQ4A 5D38A 3E2QA 4JQ2A 3DFOA 3WQDA 1AJZA 1HJVA 1CEOA 4JXCA 1RCXB 2DJXA 1I6NA 2DT3A 1YTEA 5CC3A 2XDFA 1WE5A 3GDMA 4XBKA 1XLLA 3KX6A 2QIWA 3P62A 4JD4A 4LALA 2ZX8A 1XIGA 1W5OA 2NQJA 2PP1A 1TMQA 1I45A 2ANUA 3BAJA 3ZSSA 3GTHA 2WC3A 3W84A 4LNCA 3E1F1 3YPIA 1KFLA 4EAMA 4G7EA 4OOUA 5H1WA 3PTQA 1NF0A 5REQA 4JAWA 4E4PA 1R2RA 4LYKA 2BTMA 4LUSB 4C1NB 2XINA 4JTLA 1PIGA 4HJFA 5HWJA 4AW7A 1ZAJA 1GKRA 3JZUA 4JTKA 2ZRUA 1XGDA 4KERA 3MV01 4TVUA 2QNEA 5G1TA 4LEQA 1UP0A 1ENUA 3W85A 1EQCA 3T6CA 5JQ9A 1CW2A 5IBXA 1T7LA 5EFFA 1S1RA 1VCVA 3MO7A 4S3EA 3GDLA 3GHSA 3A3WA 2V3DA 3ABRA 4FIRA 4GWEA 2PPGA 5GPRA 3S2MA 4Q8VA 1XLKA 1X8FA 1OFDA 3P93A 3ARRA 4MNKA 1UD6A 4MY1A 3S9YA 4A21A 1GOXA 3REQA 2QMKA 4BKNA 4YWIA 1PIIA 4O0KA 4FK9A 4DJFC 1BTCA 2OQHA 4MNLA 4C6MA 2RKXA 2X7VA 3EA1A 3PNUA 4HNTA 5L9FA 3TNOA 4RCXA 2Q09A 2V9DA 4UMAA 3N4AA 3AHXA 1BXNA 1H1ZA 4HJWA 1KWKA 1ZB5A 3DKLA 2ABBA 1TA3B 4XBJA 8CGTA 4C6OA 1F9CA 4MM1A 2JF6A 4XK2A 3FA3A 4JIEA 4V2XA 3ORWA 3CUZA 5FF2A 4B15A 4GLEA 5HQMA 3TIMA 2YDSA 1LDCA 5AKQA 1JCJA 3AS1A 4KRTA 4DO7A 4UFLA 5I77A 4UXDA 4PTWA 3UFYA 1OM0A 4YPJA 4O18A 4G1NA 4QCFA 4C90A 3PAOA 4BEUA 4WDXA 3CZLA 1DJXA 2FJKA 3PUDA 2DV0A 4FF7A 3LERA 4DWSD 4WSKA 3P67A 3M0LA 4AHPA 1OYBA 1XYCA 3N19B 1I2NA 4QX4A 1RXOB 4WHBA 5F4WA 2V67A 4GZ7A 4D2JA 3MVIA 3GC5A 3G3MA 3L4ZA 3KW3A 1B9BA 4KRZA 4XG1A 3W7QA 3AO0A 4EOUA 1NOWA 1P0DA 1TX2A 3BJTA 3VOJA 2BHYA 1EC8A 2QGYA 3G24A 3CLWA 4G6CA 1W1A1 4S1FA 5D4YA 4JDBA 4IWWA 1JZ3A 3UWYA 4DJDC 2PDKA 1TRDA 3V1HA 1C29A 3UYCA 2WO5A 3IACA 1EDGA 1XIDA 1XGZA 1IQ8A 3N17A 3P8JA 4NHVA 1J10A 1CZ1A 1Q5MA 4E8DA 4UFJA 5AC5A 3FYYA 4GO9A 2J9ZA 1AQ0A 1EYEA 2J75A 1J12A 1JEZA 2X7WA 1S2TA 2DZXA 3M07A 1XM3A 1Q7MA 2A7PA 3BAXA 3TMQA 4Z42C 1KRCC 5D9MA 3H22A 2QVHA 1QNPA 3WNMA 3LTPA 3RFAA 2JE8A 1WPCA 2VC9A 3QQWA 3TA6A 1UD3A 4GI8A 5K9XA 3MZNA 3FEMA 5BXRA 4W7WA 1F3EA 4NJKA 4XZBA 2XIMA 4AY8A 3L5LA 1AW2A 4GUIA 1KFCA 2F7FA 1XKYA 3OBAA 5JBDA 4LYRA 1XLMA 1WB0A 2YZ5A 3SCOA 3A21A 1GGOA 1GVSA 3DERA 3MCMA 3VDAA 3N6HA 4H01A 3UR8A 4O4WA 4IH3A 4CLMA 4PYSA 1UBPC 2G97A 3O07A 3SCNA 2VEPA 3FFSA 2XVNA 4J3TA 1A5NC 1RVGA 1QO5A 3R0UA 3CMJA 2OO6A 4XKMA 2FVLA 5CZSA 2GSEA 2VR2A 3IK4A 1UOKA 5G5IA 1A5LC 3RAOA 4MZYA 2O9PA 2HRWA 3FK4A 5F2GA 2HNEA 4HNVA 1FXPA 3A23A 5H8MA 3DC8A 3ITLA 4RE4A 4PTMA 3E0VA 1LWHA 4KEUA 1NP0A 2WXDM 3KL5A 2R1MA 2F2KA 3EKZA 3QF0A 2C71A 3QY7A 1H11A 2GWGA 3RLHA 2WSKA 3S42A 4X22A 3W6YA 5FF4A 2A6NA 1YNYA 2FZDA 1EUNA 1I0BA 1LT8A 2ZYFA 3CYVA 2VGFA 3BAWA 3PPHA 4KH2A 4HSOA 1X8CA 1U5HA 1U5VA 1WKDA 1MRAA 2EXOA 2ATSA 4ACZA 4GYJA 3IRSA 5SWUA 2QULA 1MFVA 1O1HA 5D05A 3NYDA 7XIMA 5CPMA 2UY2A 3VI2A 3TKFA 1C92A 4X3ZA 4DBUA 5BYWA 1RBOB 3TN6A 4LVBA 1M9HA 3QMRA 3H70A 3GG1A 4NRRA 5A8MA 2PLJA 4ATDA 2ZUSA 2Z2AA 1EGVA 1NQKA 4HYRA 4QP0A 2WHJA 3TTEA 4H6QA 1XIIA 4GG9A 1RJQA 4AAJA 4XKYB 2WKGA 3CV7A 4F4RA 1YE6A 3NO5A 1EQPA 2G4FA 5DY2A 5FJIA 3CUHA 2JFEX 1I1WA 1ZJIA 3LU2A 1MW1A 5AHLA 2OEKA 1MNZA 1J6PA 5FOOA 1KM0A 2EF9A 3GU1A 3C61A 3HG5A 1M1BA 4XD6A 1OWQA 3HG2A 1XIEA 5EKYA 5KEZA 1PEZA 4GIYA 2BVTA 1ZP4A 1WXZA 1S38A 1Q4WA 5CPNA 4TTUA 2XFYA 4W88A 4ZVJA 3WL0A 4D6IA 3EOSA 1IEQA 3GVQA 4DLFA 4XBSA 1PUDA 2WZIA 5I03A 1O68A 4N6FA 4Z1AA 9XIMA 3M16A 3DYMA 1EJRC 4IPLA 3H55A 1W9VA 4F2BA 5BWAA 5FA5A 3NQ6A 1EHAA 1SFTA 3V5FA 2V5JA 2ATMA 4MGGA 2WQDA 3CT2A 3WD1A 2A7NA 3FHQA 4S3FA 4LB4A 2ONEA 5HWNA 1SFLA 4LC8A 2XPKA 4ZOBA 4AUBA 3KZPA 2UY4A 4V33A 2JGQA 4RJEA 2GK1A 1FDJA 1M01A 1Q8JA 3W1MA 3JUGA 3ZIZA 1GVFA 2MANA 1MZRA 1PXGA 4BQ2A 1TIMA 2WYSA 1V6TA 4H9YA 5AHNA 1UKSA 4N42A 1EO7A 1ICPA 2ZX7A 2B7OA 4US5A 4H9XA 2ISDA 2OX4A 1QI5A 3CB3A 4IX0A 3RXZA 1PKYA 4R7JA 4AWUA 1GTHA 4AZHA 2C91A 2E8ZA 4MUZA 3SY1A 1R6WA 3W81A 3CZJA 3E2VA 4ATWA 1IWAA 3T78A 2E28A 2IKGA 4KFOA 1BSIA 1NDZA 3UJ2A 3KP0A 2FZBA 1KM4A 5CJ5A 1R3SA 1E4LA 1ZPTA 3AYVA 3IIPA 4ROQA 1LJYA 3VNIA 5CAHA 1OYAA 5DT7A 1GVIA 2YIHA 4AVFA 4HPHA 3F4CA 3W87A 1XPYA 1RY0A 1S2AA 3BWWA 3O8AA 4YWSA 4MTVA 2O92A 1VEMA 3MJYA 1W32A 3CZGA 2FZNA 3SCUA 5D8ZA 1WDSA 3B9OA 3W83A 4GRSA 3EDDA 1X1OA 3U7VA 1JQXA 5TF0A 4L80A 2P0IA 1KM2A 3SN1A 1DQWA 1WBJA 4O17A 3WQCA 4I7WA 3Q94A 1VLWA 3R7MA 1V51A 1W3NA 1XIJA 3RMEA 5FSEC 1FKWA 4QG8A 2R82A 4QLLA 1ISWA 3PK7A 3R4IA 1DVJA 4HD5A 4N6EA 3KUMA 6A3HA 2KZHA 4LF1A 2QJNA 2VYOA 4H9ZA 3BLPX 3LBMA 4GH1A 2I16A 3QZEA 2QPXA 2QCLA 4R9OA 4FIQA 3AU2A 3VIOA 3HB9A 3NZGA 6CGTA 2WZMA 4UQCA 2ZICA 3N13A 1ODUA 4AIUA 2HZGA 3TVAA 4ZODA 3TSDA 2OLAA 2G3JA 2EKCA 4OQVA 3PZGA 5CZ0A 3HFYA 2W6RA 3GO2A 4B4HA 4P7RA 3WDHA 2GLKA 4RDWA 1XS2A 4UZUA 3WL1A 3R25A 1FA2A 3G3DA 1K4HA 4EF9A 4QS5A 5MHBA 4IMEA 5HWMA 1JNDA 4MHBA 1W9XA 4AZ6A 2BLEA 1G5AA 2CBIA 3GM8A 3W25A 1QNRA 4IP5A 1VF8A 1ELSA 1QNOA 4KWVA 2PWGA 2GJLA 3KRUA 4CQCA 1QASA 3QV7A 3L9CA 3PBMA 3AYSA 5E5CA 4TMCA 1VJIA 4I7VA 2PDXA 2NX3A 2G8ZA 1G4EA 2NLYA 5C7VA 1VBRA 3QGVA 3RO6A 3M44A 4O57A 1FH9A 1PV8A 2A21A 2CZ5A 1X98A 1WDQA 5G1MA 3ID7A 1F3WA 3SQMA 1POJA 1EA9C 4S39A 2WC7A 4DJEC 4L9XA 3CBWA 4V15A 3F2CA 4DZIA 4H9MA 2ZC1A 3SFWA 4MZ1A 1UWSA 3SN4A 2ZFAA 3PY2A 3UZJA 3NDOA 4Q4KA 1BPLB 1OG0A 2PGWA 1UMLA 3PTMA 4ZQCA 4AIBA 4E4UA 4HNCA 1TG7A 2VZSA 1JAKA 1N8IA 3WD0A 3M0IA 3IIXA 1BD0A 1J0KA 1J8VA 3UR2A 2V5DA 1WDDA 4HNLA 1XXXA 4PR4A 4K8EA 3S9ZA 3M0JA 4DWSB 1NEYA 1TKKA 2WWCA 2A79A 3WH7A 1GOQA 1JZ2A 4CEUC 3GKFA 2CLOA 3PZNA 4C7DA 2HDJA 1JZ8A 3BOLA 4XUYA 4YXGA 2QT3A 1DE6A 2OT0A 3FCPA 1RQEA 1XIFA 2FPYA 1PX4A 1KCZA 1QFEA 3G1SA 4LQ1A 2CZEA 3H2FA 4MJZA 3ALGA 4LWWA 4Q6XA 3PG9A 5DRIA 3AZSA 1Y5XA 4AMAA 2QCDB 1VYRA 2BY0A 4BI6A 1TV5A 2GUYA 4DNMA 1TPFA 3BMXA 1B90A 1PX3A 3W7LA 3ENLA 4QFUA 2YXXA 1A4LA 4NXSA 3O6AA 3W70A 3I3BA 2XWDA 1R7OA 3N12A 5TD4A 2FZ9A 2POZA 2VRQA 4ZMGA 4FOKA 1RPXA 3I4EA 5C71A 4AIOA 2ZKMX 1GT8A 3OIHA 4IFOA 2JIWA 1VP5A 1XCXA 3HU7A 4CN6A 4E4FA 1TFVA 2EJ1A 4MMWA 3A22A 3SECA 3CUIA 3SCQA 1PDYA 1EP3A 2GVEA 2GQ3A 1F6YA 2CHNA 4DBDA 1KFWA 4QE5A 1R87A 3T2PA 3ALFA 1SR0A 3G0XA 3VKKA 5CC7A 4HB7A 2QJIA 3IWPA 3PZTA 1YRRA 5AFDA 2OZ3A 1Z89A 4C6LA 4C6KA 4AHOA 4XX6A 1W91A 4FO4A 4QQ3A 4Q4PA 4GCXA 4FF5A 1LBMA 1XF0A 2PDPA 1YXYA 4AMCA 4OE7A 4AEEA 1TV8A 1ZBCA 1XI3A 3LBOA 4LAOA 2UY5A 3OLIA 2NT0A 1XH2A 4JQ1A 2XH7A 4D6DA 3WNKA 1WUFA 1T6MA 4U33A 1Q6DA 3SJNA 3TYDA 1W31A 5CPOA 2FGBA 1AMKA 2OEMA 3W9ZA 2FJUB 4K37A 4Y9AA 3FSUA 1BQGA 2B7QA 2D1ZA 4QNEA 2G50A 4INFA 3BTNA 3RJYA 2VR4A 4GE8A 2I9EA 4BWLC 3W1AA 2OWWA 1YQ2A 2OYKA 1Q6RA 4IIGA 4L9ZA 5LXEA 4GYKA 4PTXA 5CC6A 4HTYA 2F2HA 4MWAB 5A6BD 1KLZA 2OELA 1OSEA 5A2BA 5I3JA 2CLLA 4N7QA 3S5ZA 3GKAA 3GDBA 2E9LA 3AXIA 3W22A 4HK7A 3NPUA 4JTTA 4KRUA 5FSDC 2VEMA 1RK6A 5EBUA 4I3GA 4PL1A 5LHEA 4Z08A 4E0CA 3CK5A 3QVQA 3TE9A 4W8AA 2D3NA 5LKYA 2VFHA 5HUOA 3W7JA 3VIFA 5A6AA 3BURA 2VRJA 2PURA 4UQ9A 3ZZ1A 1XRTA 2G5WA 2VENA 3IPWA 4WSJA 3PHAA 6REQB 3WMSA 4DZAA 3ZT7A 3DAQA 1NFGA 2J27A 4IQDA 3R10A 1JULA 2HWGA 3PS7A 3C2EA 1IZKA 1REQB 2F38A 1XBZA 2PODA 3WUBA 3URBA 2YLAA 1VFSA 2IKHA 4QEEA 2PU1A 2B7PA 1H61A 4P7NA 3CHFA 3FJNA 1ZBKA 4GACA 4NG3A 1IWPA 3AHYA 2FVMA 3NSNA 3QKEA 4ZB0A 3ABXA 4DWDA 3I6TA 4W9TA 4J3UA 2ASHA 3NZQA 1OFPA 1VZWA 1HP5A 3OBKA 3P5ZA 1OCQA 1RBLA 1K7FA 2QF7A 1OK4A 3UWZA 3W7NA 1R30A 3NGFA 1IHIA 3ARZA 1E9ZB 4Y2WA 3IS4A 1H7NA 5FI8A 3FXYA 4Q33A 4RLIA 3SR7A 3WQPA 2VT0A 4NXKA 4DNHA 1TQJA 3LHVA 2BXVA 3TYUA 3NJ3A 3NQVA 3QY8A 3VA8A 1KM5A 4JYDA 1CGXA 1K03A 4E38A 1UWIA 3DG3A 4DJFD 5A69A 5A6MA 4IIHA 4H41A 1KBJA 1O1ZA 2YA0A 3GH5A 3SZ8A 4U28A 3QZAA 4FXSA 1JD9A 1V08A 1XLDA 3TK7A 1EJSC 3WF3A 4J5NA 1UJPA 4DUXA 5KTLA 4IMGA 4R9XA 3H23A 4MB1A 1E56A 2E5CA 1W2VA 2EPNA 5I2UA 1IE7C 2QQ6A 1HTIA 1ZSXA 2PDIA 3M9YA 1NSJA 4XAZA 5C0QA 4A29A 3KBJA 4UTMA 1YDYA 3RPDA 5T91A 1K9TA 3ZLGA 1U1HA 2FH6A 4YTTA 5CZKA 3EA2A 1F6PA 2Z1KA 3RK8A 2PTZA 1QK0A 1TJ1A 3PAJA 2GJXB 4P7QA 2QF8A 4WXZA 5CJMA 2E25A 3EDEA 1XD1A 4UTLA 5ABTA 1A49A 4F3HA 3HG4A 3AROA 1MO0A 5G4WA 4IXHA 3W2JA 5IXEA 2Y7EA 4DYEA 4NU7A 2A4AA 4D8LA 1HKJA 3L21A 1QW7A 5CLTA 3W71A 3K8MA 1VFMA 3RILA 1F8IA 3HV9A 2ZXBA 2EPLX 1TPUA 2LLEA 1ISYA 5TNVA 2G4JA 4K8HA 2VCAA 3D5HA 4QISA 4UFKA 3U0HA 4WGHA 1Q66A 5CG0A 4CD4A 5HAOA 1Q65A 2PC4A 4MDOA 4XO6A 4AVOA 1AUSL 4B2DD 3OPSA 4D71A 1XLGA 5GQBA 1MXDA 5FEWA 4DJDD 1HJXA 4HA4A 3ZS4A 1CECA 3A4AA 1W1IE 1NWRA 3VTRA 3P6LA 3NIYA 3UEQA 1A5CA 1PL9A 3CB8A 3D3FA 4MJ2A 4BEQA 4NY2A 5FCZA 2VFIA 5FJRA 2QZRA 1PYMA 2WKJA 1H51A 4FX8A 4IQJA 3QKZA 2H6RA 4L61A 4PUKA 2J7CA 1WX0A 1HQTA 2WNWA 3T4CA 1YXDA 4XAYA 3V75A 2AQOA 3PZMA 1AA1B 3MWCA 1UZDA 4Q4RA 1XLHA 4DPQA 4UIOA 1U30A 4Z2KA 1J93A 3HBLA 3P80A 4ZO7A 2NQHA 1T96A 1M5WA 2ABAA 2RH9A 4S2BA 1L6GA 4MYAA 2PCEA 5BMXA 3WLTA 3V0UA 3AHZA 1NDWA 4P5UA 4S2CA 3P82A 5LXXA 1BYAA 2NQ5A 1AK5A 1FX6A 1IEXA 4P61A 4L1GA 2AL2B 4JCMA 1EA0A 4B5VA 3OB8A 1KRBC 1MXGA 3C5QA 1E6ZA 5G2HA 4GQRA 4POCA 1NF7A 1EF3A 2PBGA 3R2GA 2QR6A 4S3KA 4QLJA 1UZ4A 3IEBA 3J7HA 4Y9NA 3FLUA 4K36A 4NF7A 1V93A 2E67A 4MJ4A 2PU0A 4QAIA 2ZDRA 4AWSA 3AXMA 1W17A 1YPFA 2WK2A 4DEFA 5XIMA 2WB5A 3BSGA 3A4JA 3BC9A 4XAPA 5FF7A 2P3ZA 2WPBA 3GTXA 3IJ9A 5FEZA 1UG6A 3NYZA 3PUGA 3MVTA 1JDAA 3EWYA 1M68A 1VEPA 3PG8A 2WMKA 1AQHA 4OGZA 4AC7C 4Z2JA 2J25A 1SO3A 2IS7A 3INPA 1OIMA 2QJMA 4R53A 4WDWA 3TCEA 3QHMA 2Y2WA 1B4EA 2V6AA 2WVVA 4XISA 4AVNA 1IGWA 1UH3A 5LA2A 3KCOA 1SZEA 4U3CA 1W3LA 2HPIA 3T0CA 3QMSA 1GYMA 2JGYA 1IEIA 3C4UA 3OZMA 4CKQA 2CZFA 4CNTA 1OT2A 3QGAC 3KBNA 1FQ0A 1LOSA 3KEHA 3DI0A 1SJDA 5DF0A 1W1B1 1TPWA 4WRHA 3M4HA 1TJPA 1VRDA 3CO8A 4QQUA 3TQVA 3GBDA 2ZUUA 3UG3A 3N6JA 1C9DA 1C7SA 3SRDA 5F4XA 3N9RA 2VD8A 3G1RA 4GJIA 1OF6A 4DUWA 2EKGA 1R3QA 3M5XA 4WGXA 5BXTA 1OADA 1MRQA 4L56A 2D2JA 4HNUA 4C1KA 3CL7A 5K3VA 2A3LA 4NAEA 1PZ1A 2WZTA 3AUJA 3MUXA 2FVKA 3S5NA 4F0SA 1MUCA 3AALA 1Z3NA 5C54A 1OX6A 4QR6A 3UESA 2NXGA 1UBSA 2Z1WA 1X6LA 4R88A 5C7HA 4AWTA 4JIRA 2VKZG 4UUIA 2HBXA 4HHHA 1F5ZA 3ABZA 1F76A 3U2ZA 1Y0EA 5KZDA 2ACRA 4M7TA 4B91A 6TIMA 3B05A 1MVYA 3K2GA 3BSMA 4AX6A 2E5DA 1Z7AA 4UTHA 1JZ7A 3RLVA 1R2TA 2FPVA 1DHPA 1VBGA 3SUUA 3UG4A 4A2SA 3PUOA 7REQB 3PBUA 3E74A 4OVXA 1BQCA 5A8NA 3SUVA 2VJXA 4N0RA 2IPFA 2RDXA 1A5MC 3LCWA 2HK0A 3WG6A 2JBMA 4HU0A 2Y8UA 3WMCA 1SR9A 1ZZMA 4LOCA 3OYXA 1J0YA 1W9BM 1JCXA 1RAKA 1DXFA 3POHA 1KGWA 2PWFA 3N29A 1PIFA 2OODA 1Z44A 4QNWA 1WCGA 3WEOA 1DL3A 2ODOA 1L0PA 1BVZA 1QI4A 2R1PA 2OTDA 3AU6A 4GQGA 3W7OA 2PEVA 1XFCA 3FDKA 2RGMA 2ZZ5A 3A47A 3TONA 1Q85A 1L8NA 1EBHA 3U2OA 3K30A 3P8IA 4DUVA 5C9XA 4WOQA 2A85A 4OZOA 3DHPA 4FA3A 4FI4A 3DGBA 2DIKA 2OWXA 3M6DA 1QPQA 1K9EA 3BLEA 3LGGA 2W66A 2ZDSA 3R6IA 3VNJA 1H5YA 1RUSA 3PJXA 5CPTA 5JXQA 3RYSA 3OA5A 1UIOA 1S1PA 3MKKA 4OIFA 4RZ6A 3V1PA 1RQBA 1S5VA 3D46A 4JIHA 2Z1SA 3VPLA 3T0BA 2WSPA 2QUTA 2DVTA 5GJPA 1JCMP 1W3IA 3W4RA 3HMJG 3OJGA 1A3XA 3HM7A 4DYKA 3AAMA 3ZLFA 4LUTB 3OZOA 4HZ8A 5AYBA 3VNKA 1FWGC 1JPIA 5G2WA 4O52A 4BFAA 4GUFA 3PBGA 1VB9A 1JI2A 3ITGA 2WCSA 1JXJA 1KXQA 3W73A 1B9ZA 4L64A 2WOQA 2FHBA 2XTKA 3LGEA 4ZQMA 1WUEA 3U4AA 5BOFA 3PANA 3N2OA 3FKKA 3KVKA 4L65A 3GG0A 3B0PA 4HA3A 3TSMA 1HN1A 4LXFA 4HP5A 1Q6CA 2VZVA 1W3TA 4IL2A 3A9BA 3VC5A 1LM1A 1CNVA 4WK9A 4XAFA 3TFCA 4NAFB 5AHIA 3A13A 2XM1A 1GJUA 3N14A 5LSMA 1AD1A 4WDUA 1OX5A 4HMNA 4MG4A 3L0KA 1NOFA 5AOUA 4GYPA 1DWFM 1Q6QA 4MPKA 1OD0A 3OIXA 1GOWA 3RO8A 2HXTA 1OGSA 1W8GA 2UY3A 4FNSA 2ISSA 3I65A 1JVNA 1TV3A 3MB9A 1OVDA 3H2AA 3A3XA 4PMRA 7A3HA 3TU9A 5A8GA 2E6FA 3PJWA 5DN1A 3EKGA 3W7HA 2FTPA 4NZCA 4NJHA 1P6WA 4U2ZA 2JKPA 3B4UA 4GUJA 4CNNA 4PUUA 3DC0A 2FYMA 1K8ZA 2WZEA 3RDKA 4AHQA 2NT1A 4B3LA 3B4YA 3FEQA 1HKIA 3D3AA 2DH3A 3TCSA 1TPH1 2PLKA 2ZUTA 4TU1A 1KCLA 1ZQ5A 4YL2A 5JU6A 3W24A 2DDXA 4HOZA 4HPJA 1HP4A 1J0IA 2DEPA 2J6VA 4AFYA 4M7SA 2I7GA 3DFPA 1C8YA 1F61A 2HBVA 3K5XA 5LA1A 2DZUA 4JTDA 3CZ8A 4RDZA 3URAA 1NARA 5BW6A 3AZTA 1PB0A 5HJXA 3UD6A 3UXAA 3GXMA 1QAPA 2E77A 3DYOA 3GR8A 4DJED 5A6JA 4DO4A 1DKWA 2TRSA 1LF1A 4JTUA 1H41A 5CLWA 4FLQA 4HNNA 1XBXA 5AC6A 3ME3A 2GDQA 3MW7A 3CC1A 3TQ0A 2TMDA 5E9XA 1H1NA 2PWDA 3PULA 3E5PA 4WKFA 2GGEA 4I5XA 4FR1A 1EOMA 2W91A 2CLHA 5LIWX 4ZA0A 2PDLA 2PTDA 2Y70A 1JD7A 2PE4A 4M6UA 2Q3OA 4P2VA 2VO5A 4HT3A 2V38A 2XISA 1US3A 3UBPC 2A6LA 3RRAA 3ZM8A 1VJSA 3LRMA 3HGOA 4M6PA 2IW0A 1ZAHA 4JTEA 4EP8C 1A4MA 3ZQ9A 5FJOA 2WHLA 1HF6A 3L5MA 3KVMA 4LUSA 4DF2A 2YDRA 3K8LA 5G1YA 5C70A 1TSIA 3M0YA 1UMYA 2Y61A 2X0YA 4NYUA 2E68A 1VPXA 3MP5A 1UWUA 4AZCB 5FIPA 2HVMA 3TTQA 4C6PA 3WJYA 1R86A 2VQUA 3LHWA 1L6YA 5MKGA 1JI1A 4MB3A 4DZ5A 4J2MA 4X2RA 4AU0A 3TC7A 3GTFA 2VX5A 5IDIA 1D9EA 3VD5A 1YXCA 5CSRA 2EPKX 5CGTA 1DIOA 1DWJM 3NM3A 1GONA 3IIOA 3GVVA 5D9OA 1Z6KA 3SIZA 2NV9A 4GY7A 3B8VA 3ABQA 3OBEA 1E55A 3EWWA 3M64A 2J9XA 3QPZA 5AYYA 2DSZA 3LQGA 3N25A 1MDRA 2PDBA 5IM51 4O53A 4C7GA 4OHQA 4R27A 1KFKA 3VKAA 4B9ZA 1KM3A 2IPJA 4IGSA 1PKLA 1ZFJA 1K4GA 4J27A 5FKYA 2QAPA 4GH3A 4C6QA 1TPDA 3GG8A 3RM4A 2CCRA 1JUEA 4LVDA 1DJNA 1SJCA 4RNJA 2W0UA 3TTYA 1BEUA 3F5KA 3O16A 3AC0A 3QPYA 1A5AA 4DM2A 5D2VA 4HQVA 2CW6A 4MAZA 3V35A 4FNUA 4Q32A 3T07A 4LUJA 1QK2A 3B9EA 4ATLA 1WZLA 3WF4A 3LENA 1R8LA 1F6KA 4NUWA 5FL1A 2VEGA 3IVTA 5FJUA 4L5ZA 3N1AA 3VFLA 2CXEA 1VFLA 3T2OA 1W6TA 5ENLA 2XGZA 1JCLA 2DT1A 1CGVA 1V0MA 3VIPA 3O0FA 1A5SA 1DXEA 3EZ4A 3RX3A 3PR2A 5E09A 2XUCA 1E1CA 1AW1A 6XIMA 3B40A 5BU6A 3TJXA 1UUOA 5J5RA 1S3HA 1FCQA 3KHDA 1NU5A 5D32A 4EVZA 2QJJA 3ANUA 2GVGA 1GOOA 3UXDA 1VPYA 3I6EA 1JYXA 4QAWA 3L0GA 2R1NA 4H7CA 4BQ4A 4S23A 2B81A 2OQYA 4GFIA 3L2LA 2DSKA 1LBFA 2QS8A 1XC4A 3T2QA 4KT2A 3ZLHA 1TVNA 3S6OA 4MZ8A 4BQ3A 1LL6A 1KC7A 2PTYA 3GC2A 3WJXA 1TV7A 1DOSA 1TPVA 2C15A 2P53A 5AECA 4US5D 4PCFA 5A6LA 2XSXA 3MC5A 1KB3A 4XTDA 4HN8A 2DT2A 4Y8FA 3LRKA 1AD4A 3VMPA 1NM9A 3UPWA 2ZC8A 5E6ZA 5DY3A 3LLDA 1X38A 1ZL1A 3VKJA 4ZGYA 3G6LA 4IICA 3CV1A 3TNBA 4AD1A 1ICSA 2EGZA 3WJZA 3PZIA 1KGXA 3NQ8A 4QIUA 1SQ7A 2O4QA 3DGRA 4IL0A 2VQTA 3IJLA 5AC4A 5D2WA 3DHUA 1V7AA 4HK5A 2Y89A 2CWXA 3DEQA 3AYTA 5B7ZA 1Q6OA 1UC5A 4BHYA 3U5UA 1X1ZA 3KTXA 3WNNA 1ZBWA 2OFJA 3W75A 1OG6A 1EP2A 1GYLA 3AIRA 4H8UA 2FFIA 1JXKA 1OFOA 3QN3A 5TQLA 5E9AA 2GVJA 4PCPA 1YW1A 3L4UA 4GINA 3KAOA 4MADA 5I79A 3HMCA 4O13A 3WQ6A 1V3IA 4GKLA 1YE4A 3RITA 3VIIA 4V27A 4MLRA 2ACUA 3TEVA 1BKHA 3CPGA 1EXBA 2X30A 2CBUA 1B2YA 3SCWA 3MANA 3BCJA 4XB3A 3S1UA 1CGUA 1UIPA 3STPA 3JW7A 4U4MA 3DZ1A 4YTRA 2C1HA 4G2DA 4B3KA 3QH2A 1E72M 3CHEA 3UVAA 3WQEA 2WHKA 1E6QM 3TZFA 4OWGA 4C6CA 3MDWA 2V5CA 4GYPC 4ZOEA 1J0ZA 4JDYA 5I3DA 3UPMA 3GD6A 4ZENA 5D02A 2BWGA 4EKJA 3VGGA 3TLQA 3QSTA 4A2RA 2VWTA 5JH1A 1Q4NX 5T9CE 1YKWA 3MA8A 3L2MA 2J66A 3T81A 2WZHA 2O7QA 8XIAA 3BO9A 4HU8A 3CUJA 3O2LA 3W2KA 2WJFA 1O5QA 3M43A 3AYRA 1LL7A 4ZO8A 5AYZA 4GJJA 1XBVA 3A4WA 3WYZA 3SRKA 3NAVA 1AVAA 1CPUA 1IXQA 3IGUA 4PSPA 3PWGA 3STCA 4WLCA 5CJNA 2VFDA 3I7SA 1EKOA 4XAGA 2YBTA 1GOKA 2TAAA 5HDRA 1YLVA 3WDPP 4JNYA 2DY3A 1ZRQA 5A6SA 1D8CA 3W1NA 1LRTA 3PSWA 3VDBA 3E0FA 1R85A 4C65A 4MJMA 1BFNA 3W1UA 3DFHA 4DAIA 1Q13A 1CLXA 3ARTA 2CBJA 1TRIA 2PDQA 2W9MA 1J2WA 2YW3A 4AEFA 2O7SA 3UGRA 7PTDA 1FFRA 2EPOA 1LQAA 3PPGA 2Z00A 4S3BA 1UHVA 3MP3A 5DELA 4P8VA 2VDHA 3S2CA 3OW1A 4J3ZA 2I5QA 3G5EA 4PMQA 2JK2A 1HVXA 1K1DA 4IGMA 1H5VA 3WO8A 4LAUA 2PDUA 1OHLA 1NH6A 4GNVA 3N2MA 3EB3A 4TO8A 1RV8A 3G8EA 3W76A 4WDTA 4GPNA 3IV3A 3FNDA 3DFYA 3BLIA 1PZ3A 2NVDA 4JTJA 3L65A 2RUSA 4KESA 3WCZA 2YL8A 3R1ZA 4WIWA 4CQBA 1PZ2A 3LLXA 4WJEA 3O3RA 4OV4A 1R9XA 3GIPA 1TVLA 1AJ2A 3EAUA 4MYXA 4R5EA 4HKPA 1JIBA 3AS0A 4ZEPA 3NSMA 3RLGA 3UWQA 3FY1A 3W7IA 2Q8LA 2WKLA 3ZR5A 4N02A 4QBXA 1UR0A 1G94A 2JEQA 4KCTA 4QDPA 2HV5A 3LX9A 4W85A 2QDEA 5A8OA 3LCHA 4CNPA 3MCOA 3MI3A 3LTYA 1ONXA 1ISVA 2VUYA 1JGIA 2VCCA 1JGMA 3VGEA 3M5ZA 3VNYA 2VD9A 1FHLA 1Q6LA 1SM9A 3CASA 3IUIA 1WKFA 1XHGA 1FHDA 3HPXA 5LGZA 5H2ZA 4ICNA 2CITA 3MV11 2HXUA 1MI3A 4IMFA 2A2IA 2W27A 3GY1A 2FB2A 3CL8A 1BAGA 3NQEA 5G4EA 4H8HA 3LRLA 4QLKA 3OQ8A 1KFJA 1DJQA 2J47A 5DXYA 1WV2A 3OLGA 5FF3A 5I0DA 2OYLA 2WPGA 1DYSA 3QR1A 4JTGA 1VFUA 3TXZA 3W3OA 3KOXA 3C52A 1J18A 3TV8A 3FAXA 1CWYA 3G2GA 4D6EA 3UXIA 3ITCA 1E71M 3OLDA 4JIQA 4PFMA 1GQLA 1MEIA 1ESWA 3KCJA 5E93A 4ADSA 1N82A 1VQTA 1GNXA 1I2OA 4DELA 2XIQA 4K7VA 1V02E 4GIRA 4BY3A 2OXNA 1U1JA 1XSIA 2HROA 2BVDA 3WJSA 2YZRA 3FV9A 3H2EA 4HBKA 4W7UA 4JN8A 5EL1A 1GTEA 1Y8BA 3DUGA 4GX9A 3K4AA 2OGJA 3CQKA 1ZU8A 3RCMA 4ONVA 1S5NA 3C6CA 1TTJA 2VI0A 4RE3A 5C9RA 1PS9A 2V69A 4O11A 4JHMA 3E2RA 2FTWA 1B3YA 1OCBA 3WLQA 4FALA 4RL3A 1P1XA 4Q7BA 2YL6A 3GK0A 2AAMA 1V8EA 3M6YA 4C60A 1ICQA 3MBDA 3WLSA 2B7NA 3PF3A 3CU2A 4B4FA 2J62A 1EC9A 2E40A 1G69A 1TZ9A 2GSJA 2WSQA 2XVLA 1XW8A 4C1LA 3ICJA 4JIIX 4XVDA 4PBFA 3NQ2A 2I14A 4OFCA 1UD2A 1PTAA 3ZR4A 4IPNB 3S47A 4V1YA 2VX6A 3CAKA 2C13A 4O1AA 2X40A 1KR1A 3SM0A 1VIWA 1TV4A 4ECLA 3SUSA 1P4CA 3MMWA 1SU5A 2AOSA 2YB1A 4RZBA 2NQ9A 1G7UA 3VNDA 4ZQPA 3KWXA 4RDYA 1OBAA 3LB0A 1IEWA 2FHFA 4ICMA 2VOMA 2Z7KA 4RX0A 5HA7A 2FZ8A 1H7OA 3IIVA 5HULA 4IQEA 4A3HA 2CKSA 2BOFX 3RMJA 3O6CA 2A3HA 3G1YA 3WFZA 2ZZ7A 1J4EA 4GZJA 3DFNA 2C79A 4GC4A 3WLPA 4D9PA 1HJSA 2XYLA 3TWBA 4H83A 4PFHA 5G4HC 2GQ8A 1LLOA 3TROA 3IRDA 3VM7A 4Z1YA 2NWSA 3LPPA 1T41A 4DWSA 4U5KA 2DP3A 1GHSA 2DZVA 2RDWA 3U7BA 1YPXA 4QSFA 1SYTA 4M81A 4PA8A 3PN8A 3F03K 3C8FA 2CNCA 5KZMA 1Q3NA 4IIEA 4O0QA 2Y7FA 3CQHA 3VNLA 5FJJA 3ZO9A 7ENLA 2WQPA 5J04A 4O8AA 2XH0A 4IJRA 4Q8MA 1C8XA 4DIAA 3CV6A 1X7IA 2QDDA 3OVPA 1M7XA 2QKFA 4HOWA 3D6NA 1AZ2A 4WD0A 5FF0A 4GXWA 4ADTA 1XFBA 3GS6A 2WJZA 2Q6ZA 3EOLA 2I5GA 5FL0A 5JUVA 4W87A 4HMDA 3AOFA 3LN3A 1A80A 1KTCA 1SO4A 4F79A 3NEVA 1EJVC 5I3HA 4H7ZA 2GPTA 3QTGA 2Z1BA 5LYRA 1XGEA 5B80A 4GABA 2H3BA 1UZHA 4F2UA 4PB3A 1RZMA 1DQXA 2PRLA 5F2MA 4IJCA 2EAWA 3KE0A 3PBVA 4J9JA 1Q8AA 1ME9A 1VCFA 4CD8A 1G1YA 3MI2A 1SZRA 1ISXA 4JFWA 3NPVA 2VHLA 1CENA 1EJXC 4RZ4A 3A3HA 4MUPA 1MW3A 3ARUA 2PWHA 4E2DA 5LIYX 1V6UA 1RLCL 1V77A 3QM3A 3TXVA 3G1AA 1W37A 3SCRA 1XWYA 4QCEA 1EEPA 4UTTA 2QXWA 1M04A 4JS3A 4MOZA 4JL1A 3W01A 3GXDA 3B0VC 4LCSA 5IFTA 1BYCA 2JF7A 3E0IA 3FJLA 3LCFA 4QITA 3O15A 1X6UA 3GXPA 2V3EA 1BYBA 3FA4A 1W2PA 5C9WA 1IXNA 2VNCA 3AIUA 5I09A 3UWVA 3OVRA 1CB2A 3TC3A 2QCNA 1K7EA 2C14A 3BK0A 2A0NA 2XG9A 2ZZ6A 3U2CA 2CXGA 2DQWA 3CWHA 2OVLA 4N9DA 4GQ0A 1OY0A 1RP8A 3VU2A 5I23A 1IZCA 2CYGA 2E9MA 3SQSA 2HEJA 4QTGA 3C2YA 4HN4A 2R6OA 1G01A 1OC5A 4PODA 3PZUA 4BF7A 5HMFA 1TJ0A 1HKVA 3WUFA 2BVYA 3W6MA 1KRMA 5LNUA 1FWAC 4PC8A 2QGHA 2YXOA 3LHUA 3F1QA 4I8YA 2CHOA 3VE7A 1WXYA 3VGHA 1SFSA 1PE1A 3KLKA 3ZMRA 3R11A 3B8WA 1UC4A 3B8IA 3BXWA 4ENLA 4A05A 3NQFA 4RXFA 5F1VA 1Z42A 3BG5A 2G96A 3C2RA 3KWSA 4PB5A 1NY1A 5I3GA 4QG6A 2ADAA 1V6VA 1LL4A 4O4VA 3BAIA 3QHOA 4Z2GA 1GZJA 3R89A 1TE6A 4PUWA 6REQA 3R58A 1MWOA 3IAQA 1WA3A 3R8RA 3B03A 2INFA 3AXKA 3O9NA 3NL2A 4ADUA 4LY8A 1P6BA 1REQA 1EO5A 2W3ZA 4OV9A 1XDMA 4NZ4A 1QWKA 1EOKA 2YKKA 1H09A 4JYFA 1S5TA 2NSOA 4IUOA 4YCPA 1UYQA 1XIMA 3H6OA 3T8LA 4Q6JA 3TYAA 3MCNA 1TWSA 3GLCA 1PKMA 4LX4A 1TR9A 1YYAA 1PZ0A 3ZOAA 4PCSA 2XFWA 5DANA 3BUVA 1XBYA 1VGAA 1F2JA 5MKGB 3II1A 3NO1A 3G1FA 2NV2A 3ECQA 3MBFA 1E6NA 6PTDA 4YHGA 5BRQA 5LHFA 1VFHA 2IXUA 3PSVA 3T4WA 1FVPA 1G9HA 4UFIA 2YYUA 3DG7A 3WNLA 1Y65A 3HQ1A 1MYRA 3NCOA 4KWUA 3LCIA 1MSSA 2PDCA 4W93A 3RRXA 3UU0A 5HUPA 1IYXA 1XCWA 4IX2A 3SUWA 4IMDA 1M3UA 1T8QA 8TIMA 1BGAA 3O06A 3VIJA 2HMCA 4FHAA 2AAAA 3N34A 4UTIA 2WC4A 3BDKA 1GZ1A 4LW7A 1ECQA 2DZPA 3TYBA 2OKTA 4ZQOA 4CQDA 3WDIA 3AS2A 1CB7B 3RU6A 4GQQA 1NJJA 2FDMA 1BGGA 2GFTA 3CNYA 3ZJ6A 1TJRA 2GJXA 1M7PA 3H21A 1VBHA 2EPHA 3FN9A 3N18A 1OYCA 1Q7QA 4PE8A 3OYZA 1R3TA 1JF5A 3RR4A 1KFBA 4PRRA 2PUZA 4JPGA 1E1CB 2EQDA 1O12A 2WNZA 2X2GA 4LEFA 5A6KA 2YXGA 3W37A 3KM8A 3M5VA 3IJIA 4GZIA 3EB4A 2A3EA 4KCUA 1GVYA 1RCOB 1OD8A 3BVJA 1FKXA 4GD0A 3ES7A 4L6DA 1JPDX 3WBEA 3LHTA 4TVCA 4CUCA 2X2YA 1QR7A 2YFOA 3VZYA 2Y85A 3EWCA 1EEXA 3MDUA 3VKDA 3LYEA 1OC6A 1LRQA 1I4NA 2BGSA 1C8VA 3EOUA 4CD6A 3VKCA 3T7VA 2VXNA 4ZCWA 3H2NA 4GHRA 3RCNA 1TWZA 1EGZA 1ALDA 1FWIC 3WLKX 4HU4A 2QJGA 1KGUA 2IMRA 3VOCA 5G2IA 3W02A 4XQ6A 4N9CA 3OO2A 1HG3A 4PUDA 4S3GA 1EJWC 5ABFB 4Z0SA 2Z1VA 1OINA 3A6OA 3UF9A 3A12A 3BV7A 4JKMA 1S46A 5RUBA 4UQEA 4AZBA 2GVYA 4H7VA 1W1TA 1XRSA 3V36A 1O5KA 2C1GA 3ZR6A 1DJIA 1J11A 3UJEA 2WANA 3F4VA 3WH9A 2J6XA 3ONBA 4HZ7A 3S3GA 1W0MA 2PDHA 3CIXA 4DQWA 2DSVA 1YBQB 4AYSA 1J96A 2J74A 4QROA 4FX7A 4AD2A 2CBVA 2XGIA 5D03A 5JMUA 3K4DA 5EB8A 2XGBA 4P8WA 3OZYA 5CZJA 4LNYA 3AWNA 1ME8A 2WAGA 2AL2A 2YA2A 3OGSA 3WLHA 1IZJA 1LOLA 4GVGA 2D73A 4KIEA 4JNMA 2QUUA 5JBFA 4NZ5A 3WQGA 1N8WA 4NZFA 3THQA 1OK6A 4L1WA 3D0CA 5BZAA 4JFUA 1E1EA 4GGHA 2WW5A 2G3IA 2VZUA 5L6UA 3S5OA 3NOYA 2OSXA 1CCWB 2NUYA 2ZA3A 1C91A 4ERGA 4ZR8A 1OFQA 2GOUA 1XUUA 2IQ0A 4GVFA 3H24A 2O4MA 2NWRA 4EPKA 3T9PA 1IR2A 1LROA 3MPGA 3MSRA 5H8UA 4UMCA 5EPDA 4BI5A 4IT1A 1DWIM 4RE0A 4EPBC 3ATYA 3LZ5A 1XUZA 1NAL1 4F0LA 1IEVA 2BY2A 3L7RA 4UR8A 3GU2A 1EJTC 5EMJA 2J24A 4NT0A 3KBVA 1M65A 1ZENA 4QEHA 3ZJ8A 3B8UA 3PNZA 3NQ7A 2CLFA 5D9NA 2ZX5A 4JN7A 4QS6A 3M0XA 4LBUA 4KETA 3TZNA 2PGEA 3P81A 3BZJA 1JDEA 3DG6A 4NASA 1TTPA 1DTUA 4C91A 3M41A 1BVWA 4IQLA 3NQGA 1GWJA 4B5WA 4XZNX 1J0HA 2YFNA 1IR1A 2XM2A 3KFTA 5DX7A 1PWLA 2VC5A 4BF9A 1JUBA 4GUHA 3PM6A 3N2CA 5HK4A 1LWIA 4JN6A 4LY4A 5BMWA 1KV8A 1GZGA 2HCVA 2VDIA 3UZXA 1FTXA 1IXOA 3OGVA 2GQAA 2X8RA 2ZZ3A 1TO3A 2J8TA 4TR9A 4PCTA 4PB4A 5A8PA 4DO6A 3CAQA 1PJ9A 2QCHA 4QJ5B 1IIGA 4WOZA 4MWAC 2B4GA 3EMCA 5D2TA 4AH7A 1XH0A 4HPNA 2BG5A 3G8RA 1MQQA 3ZT5A 3WEZA 3LD5A 4WQ6A 3NQMA 5CSYA 1TVPA 1OCNA 2V2HA 4JEQA 4TMBA 2QCGA 4LS2A 1EF2A 3T09A 4WVXA 2W61A 4UCFA 2ESCA 4HSHA 4XZLX 1UKTA 4Y90A 2Z2UA 4WX2A 3E96A 7REQA 4C6NA 1LUCB 1V3JA 1RALA 2IKIA 1CXKA 4PTDA 1JDCA 3EEZA 4WY0B 1NP2A 2V5BA 5C2XA 1WBHA 2PD9A 3VZZA 2WM0A 4HHLA 1F73A 4CQ8A 1ZY9A 3MU7A 1SO5A 1HGYA 3WBYA 3G1VA 4M24A 4E6MA 1ZP3A 4UTWA 2J7BA 4UTKA 3MMUA 1TYGA 3ITXA 2ZBTA 1YEYA 1KD0A 4QJ1A 4O1DA 1UKQA 1F7BA 1XKJA 4UOJA 3EOOA 3TJLA 5AC7A 5J5DA 1K02A 2WMHA 3O05A 3WQ5A 3VE9A 1NWUA 4MF4A 4XD5A 1LYXA 1Q63A 4NILA 1E6PA 1UJQA 4JY8A 5IBXC 3ITVA 2QDHA 1BYDA 4YVPA 2YCIX 2J7DA 3GX9A 1A5KC 4GMEA 3ONCA 1FFQA 4KCVA 4MWAE 3BW3A 4AY7A 3KTSA 4WCJA 2AKZA 2PAJA 3OP2A 1ME7A 2WLYA 4W89A 5A6BA 1FDZA 4RKAA 1F3XA 3TR2A 2QPSA 4LUTA 2WMIA 1TELA 3IGSA 1QATA 2QJHA 3L4YA 4AZ5A 2QV4A 4DX3A 5E0KA 4LYQA 1H50A 1SW7A 2OJPA 1JYWA 3W1TA 1XSJA 1OQFA 2POTA 1LORA 1EX5A 4DBEA 4GCAA 2ZZ2A 2Q8XA 5EA9A 1OEPA 3BV4A 2CZDA 3GVGA 2Q01A 4UC5A 1D7KA 1K8CA 3WUGA 3SGGA 2VMFA 4XZ9A 3P3BA 2XFRA 1OGGA 4UNIA 3AHTA 2R14A 3F4NA 4GY1A 4ZOCA 4XVEA 1O95A 3OVQA 1R5YA 4ZE5A 1K77A 4NAFA 5GNXA 1ZUAX 2GUUA 1VLIA 1RR2A 1A5UA 2BXZA 3DFTA 4JQ3A 3NZ1A 2W5FA 1U83A 1ZS2A 4UTUA 3QFWA 4LJ3A 1K9FA 5FD0A 4DB7A 3U57A 3NM1A 1TPC1 1UKPA 4XSLA 3IJ6A 5JH2A 3LM7A 1HUVA 5IOBA 1M41A 4NVTA 7TAAA 4DVOA 4WJXA 1VPQA 4S3DA 1QBAA 4RZ5A 4EAYA 5M3WA 2C16A 5DMNA 4PSRA 2WBGA 4AXKA 4IG2B 3MP4A 3G1HA 4LBRA 1DIDA 3SGUA 3PZVA 4EPDC 2YL5A 1WAWA 2BY1A 1NDVA 2X1SA 3QOMA 2FIQA 4HU3A 5D37A 1RQHA 1UR8A 4GQBA 2XSAA 1QW8A 1KXVA 2F6UA 3PVFA 3W72A 1CI1A 1P1MA 3E3HA 2OSWA 4RW5A 1E6XM 1V4YA 1US0A 3EXRA 4JX5A 3WSUA 4B5XA 2JALA 1PCWA 4D1IA 1N7KA 5HANA 3BANA 2PZNA 3THAA 4ILSA 1A50A 9CGTA 1XP3A 6ALDA 3XINA 1YTKA 1W1ZA 1XDJA 1CXLA 3OU8A 1Z8AA 2ZVRA 4DHGA 3QRHA 4PMUA 4M56A 3UJFA 1K8XA 5BU9A 1BHGA 5CPSA 5D9PA 3V5OA 3E0WA 3MSDA 5EMLA 3VXGA 1XIHA 3WMBA 5LGXA 1JDFA 2YR1A 4PEKA 3L4VA 4UTFA 2HVNA 1EX1A 3TYZA 1H7WA 1WDRA 2DT0A 2V68A 1CLVA 4AX7A 1JYVA 3CPRA 2PGRA 3QLLA 1B3OA 5HPOA 2H8XA 3VX1A 1P0EA 3KRZA 4ZO6A 4YTSA 2AMGA 4R85A 2QUNA 1BLIA 5DCBA 1KV5A 4DF0A 4TXEA 4F0MA 3M0MA 2QHAA 4I6VA 1FWEC 1XYMA 4UOZA 3EX3A 3L12A 1XICA 4I8DA 3I3DA 3L4XA 4W5ZA 1DEDA 1E4NA 2D2GA 2DSWA 3R0DA 4B2DA 1QTWA 3MYPA 4EWJA 3AMLA 5CG7A 2UV8G 1MFUA 1JCNA 1WAUA 3EWBX 3SB0A 5F4SA 4DJDA 3DKJA 4DBWA 5I6SA 4AZCA 5EMYA 4JKLA 4IP7A 5AYIA 4FSAA 1KLYA 3QOKA 3S1VA 3KHJA 1QOXA 3VOHA 4B5NA 2V5LA 5BRPA 4AC1X 5LNVA 1C8QA 3GAYA 3THDA 1HKMA 3THUA 4RK8A 3HG3A 4QJ3B 1W5QA 5DBTA 4HOXA 2AQVA 1DJZA 1O94A 2NVCA 4I9AA 3QY6A 3HOJA 4E3TA 4URIA 1CT5A 4AQLA 1XL9A 4UQDA 1XR2A 5KINA 1G4TA 2HTMA 1JF6A 3S5YA 3CTTA 5CSSA 1DWGM 1LG2A 3VKBA 3GYCA 3W74A 3V4BA 1QBBA 5HMEA 3KBWA 1KFEA 1PCKA 1RJRA 3NNTA 3HTWA 2BODX 4M6QA 4GOAA 3VFCA 1N55A 1FH8A 3UZZA 3QQ1A 4S3AA 1W5NA 4HA0A 1FWHC 2QIIA 3APTA 3T42A 2FMOA 1H2JA 3GHTA 1DPMA 3VD9A 4L6HA 3STFA 3P2VA 4JZ5A 1G4PA 3FW6A 5H6HA 4Z17A 3W7PA 3LG3A 1S2CA 5CGMA 3QC3A 1WZAA 1ADSA 1EPXA 2ISVA 3CMGA 4JNZA 2RFGA 3QR0A 4JTAA 4IIFA 3L4WA 4IPIA 2J78A 1ECEA 2X09A 2GOKA 5AHEA 4FB7A 3KVJA 2V2CA 4YTQA 3TQKA 3WJWA 3AUOA 3OQEA 3S8HA 3EPMA 1A0EA 3CUGA 1FWRA 5DFAA 4B5UA 1H0IA 1GORA 4FNRA 3GNRA 3W2LA 2ZA2A 4AXNA 5HR6A 2GSHA 2WMGA 2Z2BA 3L23A 5B7YA 5DO8A 1SVDA 2H9AB 4CCEA 1PO9A 2G0WA 4TOQA 5AHMA 4JYEA 4UBPC 1FOBA 3FIGA 1MQPA 1CIUA 4MAVA 4LCRA 1EC7A 1UWAA 1QPOA 3QHNA 4DM1A 4C5ZA 2VGGA 3GRIA 3LHYA 4NIRA 4IP4A 3DESA 1V3KA 1JZ5A 1Q2RA 3ES8A 2GGGA 4LF2A 1VENA 1UUMA 4HYWA 3VMNA 2PC8A 3V0TA 4Q4MA 3F4WA 5D30A 3F4DA 2Y7DA 1QHOA 1TPEA 1SJAA 2JKAA 1V6WA 1KTBA 4KKXA 1OX4A 3UXKA 2PTXA 1JG9A 4AYGA 3EPOA 1BF6A 2FH8A 3BQ6A 4TIMA 2ZTJA 3PPFA 5GVJA 3I7QA 3WK0A 4CD7A 1UCWA 1RBAA 3E12A 4NNAA 5FEXA 4IGHA 5AB3A 2P10A 1Q6GA 3W1LA 1GPFA 3AS3A 2OWCA 3W7DA 4H9UA 3U9IA 5HOSA 2DQXA 1E51A 2F6XA 3HA1A 2CU0A 3CPUA 1JCTA 2GYIA 2RHGA 4DBSA 3IARA 3G0UA 2HNHA 2OT1A 3MWAA 2E8YA 5M2FX 1PVNA 3NPWA 3LV6A 2P88A 3TN5A 2YA1A 2CWNA 4IFRA 3ARPA 3QEZA 3QMTA 2D0GA 3DN5A 1TTQA 1SSGA 1XYBA 1J01A 2E9BA 1E1FA 1J0JA 1H63A 2J13A 1PDZA 2Z27A 1BG9A 1LOQA 2X42A 1D3CA 3T1GA 2EJAA 4NRSA 1UWRA 1BWKA 2OYMA 3QJAA 4NI8A 2PP0A 3C2OA 4E3VA 3HGSA 3BLOA 1DTNA 1V79A 3IJ7A 2J7EA 3A4XA 3FYPA 3TMLA 3FVDA 2OSYA 5ABGA 1OCJA 1KA9F 3I4KA 4JGDA 3B04A 3DFQA 2RJGA 1DIEA 2E3ZA 4CN1A 2EBNA 4AF0B 4K1WA 3AIEA 1XQLA 3BOFA 2YBUA 4AEOA 3UGVA 3L5AA 1HW6A 3ZVHB 1T5AA 1IF2A 4XIAA 3KL3A 4A4AA 4GK8A 2QUVA 3BJFA 3GTNA 4P7LA 4N9EA 3SJ3A 1V6XA 3GU9A 3GZ3A 2Y8KA 3MUCA 1WZMA 3RIKA 4X9YA 2Q02A 3NZRA 1RH9A 4V1XA 1U2YA 5A2AA 4PMDA 1UA3A 3BLDA 2A3AA 3H2CA 4Q8UA 3TP4A 4DY1A 4CCDA 4XD3A 1DXIA 3AHVA 1SO6A 2GQ9A 1QNQA 3MQTA 1GUVA 3B9DA 2J79A 4LFYA 1V7YA 3AXXA 3APGA 2YOCA 1XPGA 1DBTA 4JX4A 1BTMA 2VGBA 2GZXA 3COTA 4CU7A 1VC4A 1E9IA 1RLDA 3W7MA 1XINA 3PBYA 1I2RA 1B0IA 1XD0A 4AD5A 5M5DA 2DZSA 3RU8X 3W27A 5ABHA 3PZQA 2J77A 1CXHA 3MMDA 1FH7A 2FGZA 2BXYA 3EOEA 4G5DA 1WOBA 4MFDA 2C0HA 3ZYZA 1XRVA 3CIVA 4ZE4A 5I24A 4PL2A 3EDJA 4EK7A 1LQ2A 1VFTA 1HFBA 3S5SA 1QW9A 3ZT6A 1A3WA 1VS1A 2NLIA 3OG3A 3K1DA 4FNPA 2QAFA 3HGJA 4UNLA 3NXFA 3V5CA 1XLCA 4LVGA 3FOKA 4ZL1A 3OGRA 5T26A 4L4LA 1B4KA 3BG9A 1UR9A 3MJMA 3WLIA 2J88A 2XU2A 2P50A 3TX9A 4ZSUA 5EU9A 1CLKA 2WLZA 2GWNA 5C6MA 3OG2A 1DP0A 3ISIX 4KFPA 4KEZA 3WLNA 1EP1A 2YPIA 2IUZA 4YVXA 3SEPA 3CZEA 3SQLA 3C2FA 1FWSA 3C56A 2C8NA 3LSBA 3QW4B 1FHUA 1B3ZA 1J6OA 2BDQA 3QW3A 3AISA 2PBOA 2NUWA 2ZWYA 1E9YB 5I3KA 3WNOA 3CM4A 2BGQA 2VVSA 4JQAA 4A35A 4Q8TA 2XH4A 2YCJA 2DH2A 1AMYA 3IUHA 8RUCA 3MHUA 4PTVA 4XUGA 4C6IA 6TAAA 3EMQA 2PD5A 2R1KA 3PFMA 3QYSA 1L6FA 1WZKA 4EANA 4Q8PA 3QQ0A 5CPQA 3MUIA 4YMZA 5J8LA 2ZTKA 4A3RA 1E6SM 2ZUVA 4LS0A 4M6VA 3W2NA 2Z1XA 4PMXA 3PUEA 2VFEA 1I60A 4B5TA 1TE1A 3PTKA 4AISA 2Z24A 3HFTA 2AGKA 3ITTA 3LI1A 3R12A 1IGSA 4MIMA 3THCA 4LS1A 2J7HA 3Q45A 2GGJA 4PULA 3KVLA 3UJSA 4ZTXA 4J3WA 4DJEA 2ISWA 1UASA 1JZ6A 3O0KA 1QHZA 1LLWA 3AIBA 5HQLA 3FA5A 1T8XA 2NUXA 1PSCA 5E0FA 3CXOA 1SW3A 3VUPA 4C5YA 1UD4A 3M7SA 3LZ3A 4DRSA 4YN5A 4NJIA 5LZLA 1YDOA 2PDGA 1MXSA 4A8NA 1V0KA 4UZSA 3T8QA 1HT6A 3NL5A 4F9JA 4HHMA 1ITXA 1EWEA 4FMVA 4HVXA 3CV2A 5I00A 1TIWA 3RN6A 1J9YA 3HJZA 1QPRA 1LRNA 3HN3A 4IFKA 4ZTYA 3E2SA 2DZWA 1CXEA 4GA8A 4DPPA 4O12A 3VD3A