3GUSA

Crystal strcture of human pi class glutathione s-transferase gstp1-1 in complex with 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (nbdhex)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Structural basis for the binding of the anticancer compound 6-(7-nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol to human glutathione s-transferases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3gusA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gusA01
5KN3A 1AAZA 2ES7A 4ZBAA 5ECRB 4ZBBA 3CTGA 2QGVA 5ECLB 5AIXA 2VIMA 2JZRA 2K18A 4MLYA 3D5JA 1YEPA 3DVXA 3FR6A 4F82A 3IPZA 1JZDA 2N5BA 1FHEA 3I6AA 5DAKB 5C04A 1VF3A 4KDYA 2H71A 2IWTA 2P5RA 3GYKA 2XHFA 1K3YA 3Q6OA 1X5EA 4XHMA 1VGLA 5IO0A 3TKSC 2HSMB 1JFUA 2H1BA 4L0UA 2QC7A 3DIEA 1XWGA 5D9XA 5ID2A 2L6DA 1T4ZA 1ZCPA 2CVKA 2C3TA 1BEDA 1ST9A 5J9CA 2WZ9A 1SL2B 2HQTA 4ZB9A 4HI7A 1B4PA 4GQFA 2VL3A 4LL1B 1O8XA 1GLPA 3CRTA 1V2AA 3EINA 4HU7A 2VCQA 3G7JA 3E9JB 1RK4A 2LJAA 2GSQA 4LLRA 5BMUA 4PNFA 1W89A 5DCGA 1PX6A 4TXVA 5G5EA 1G7EA 1BAYA 5GAPD 5DALB 2H1DA 3GTUA 3F9UA 4BL7B 1MEKA 1Q98A 3EE2A 4O32A 1TK8B 3HA9A 4MJAA 3L4NA 1C72A 5HR2A 4F9ZA 4LA1A 1A23A 2IFQB 3HYPA 3RPNA 2HRKA 1SL0B 3W8JA 5ELGA 5EPFA 1DSBA 8GSSA 3IC8A 1QQ2A 3HJOA 1GSQA 2X8CA 3D0ZA 1V40A 2KLXA 3P8WA 4BVXB 1Z9HA 1WJKA 5HFGA 3GSTA 5FWGA 4PTSA 1V9WA 2G0FA 4N0VA 3EU4A 5J41A 4O7HA 2HZEA 2VD1A 1X0RA 2LV3A 3D22A 4IKHA 2O8VB 3D21A 2KP2A 1ZMAA 1GTAA 4K7OA 3QAVA 2PUKC 1B4QA 3UJ1A 4FO5A 2KHPA 4MJBA 3VWWA 3F0IA 3UIWA 2JSYA 1EEMA 3ZVJD 4ISDA 2E2GA 1TU8A 3F4TA 4IP1A 4HDEA 1O7UA 4BVYA 5JWQB 4KE3A 3LSZA 2A2RA 3EYTA 4WBRD 3DGQA 3UVHA 1OC8A 2HSYA 3QR6A 4WF4A 2MZCA 2YV9A 1M2DA 3A2WA 5GZZB 1HNAA 4YH2A 3P7XA 1WIKA 4H86A 5IIZA 3F3RA 5ECKB 3TJBA 4JE1A 4MF7A 3TOUA 2YZUA 3UVTA 2H1AA 3EWLA 3FZ5A 5FHIA 1FOVA 1WPIA 3H4KA 1M2AA 1GULA 3KMOA 3F6DA 4K0NA 2PN8A 3BCIA 1PMTA 3QAWA 4MA9A 5JCGA 2VL2C 3IR4A 2K8SA 1HQOA 2HNLA 3FW2A 1FAAA 4ZBDA 2F9SA 2GDRA 2DJ3A 1U88A 1XZOA 2EIRA 2YANA 1EOHA 1CQHA 3TDGA 4ZILA 18GSA 5GSSA 3GRXA 5ECNB 1WMJA 3A2XA 2C0DA 1JZOA 5LD0A 1K0CA 2ON5A 4POLA 3GH6A 1GSDA 2P31A 4MP4A 5KN1A 1SL1B 4WR5A 2L5LA 2QKEA 1QK8A 1FO5A 2JADA 4PQIA 1ZYEA 1WP0A 1A2JA 4WXTA 1NM3A 1URMA 2VLTA 1SYXA 2HZFA 3LEFA 2L59A 1GSYA 3WT1A 3ME7A 3IE3A 2YCDA 3IOSA 2I9HA 4L0WA 1AUCA 3GA4A 2H76A 4BL7A 1ZL9A 2KP1A 3KIJA 3CRUA 4IBPA 4ZL8A 2C3NA 2K8VA 2YNXA 4ZB8A 2LEGA 1BYEA 3MWHA 2R2JA 1PSQA 1GUMA 3WYWA 4PQHA 1I9DA 4GSNA 2CQ9A 19GSA 1U3AA 3BD2A 3HDCA 4OWYA 1OC9B 5KEJA 1DE1A 1K0MA 3HVVA 4PXOA 2MMZA 2HLSA 4V2LA 3KM6A 3IHQA 5G31A 1J08A 2F8AA 1YEXA 3EVIA 1E6BA 3LXTA 4IQ1A 1T3BA 2I81A 2X8GA 1HD2A 2X99A 5CRDA 2H75A 2A2SA 3TCOA 5B7CA 3GIXA 4WEYA 2PERA 4TW5A 4HZ4A 2MYGA 4XIHA 1V98A 3QPMA 5CNWA 4O92A 4TR1A 5A5KA 4N0ZA 3ZMLA 4MPFA 2NBSA 3W6GA 4I97A 3ZRDA 11GSA 5IQYA 1GUKA 1EP8A 2YOIA 3ZMKA 1CQGA 2JSZA 2C0FA 1N8JA 1TTZA 2HRAA 5DVBA 1SD9A 3TRPA 4MK3A 3P90A 1Z6MA 5IMFA 1JLVA 3ED3A 1PGTA 2FWEA 2GT6A 4X43A 5G1LA 3GN3A 3ISOA 1A8YA 3UMAA 2MMAA 1TRWA 5DQYA 4YAVA 1TJDA 4MJEA 3DMLA 1J9BA 2H19A 2C3QA 3VWVA 2C1YA 1EWXA 3HJPA 2YP6A 4XRAA 4XS4A 1TXXA 4EXJA 2YZHA 2LRTA 2DJ2A 4K7NA 3BCKA 2BJXA 1YQ1A 4GF0A 1H75A 1GTIA 2H6YA 2H6XA 1F6MC 3KH9A 1TDIA 3GMFA 3CBUA 4DSSB 2E7PA 2IMEA 1YF0A 1EGRA 3G7YA 2LRNA 1VF4A 5HR1A 2JZSA 5D9WA 2LRCA 5F0GA 3O76A 1MDIA 2WJUA 3IDVA 1B8XA 1SU9A 3APSA 4QL7A 1XW9A 6GSTA 2YJ7A 4ULXA 1PL2A 1SD8A 4KX4A 4Q5NA 3KTBA 2X64A 2N5FA 4NV5A 2LSTA 4MF5A 4K8MA 2CVBA 1TI1A 3G9BA 1SK2A 3VLNA 4IGJA 2F8FA 3CTFA 4GXZA 3ZZXA 1PQNA 4NHWA 1ON4A 4L5OA 3CSHA 4MZCA 4EUYA 1QUWA 5C00A 3TJGA 2GSSA 4DEJA 2X8HA 5CYYA 1OVNA 2H30A 3E3EA 1R7HA 1OE8A 5J3RA 2CV4A 3KCMA 1MDKA 3FZAA 4MCUA 1V57A 2WS2A 2H0IA 2PVOC 2FA8A 1F9MA 1G7OA 5LCZA 1ACVA 1YDKA 4F2IA 5ECPB 2CZ2A 1F37A 2JACA 3EMPA 2OE3A 2IMIA 3SWLA 4J2FA 1PA3A 1AQWA 1S3AA 3LG6A 1GSFA 3L0HA 1TW9A 5F07A 3KP9A 1GTUA 4XS6A 4G19A 2AJQB 3R3EA 1DE2A 5DJLA 2DMLA 2PWJA 1QFNA 1FVKA 4IP6A 4MH3A 3QFAC 4G0IA 5J4UA 1LBKA 6GSSA 5H5RA 2OADA 1XIYA 3VI7A 3CSJA 5A4VA 4N10A 3UL3A 5DDLA 3IXRA 2EIQA 2O89A 2V1MA 1XOAA 3RHBA 3DYRA 4JZQA 1X5DA 3C7MA 3TRXA 2G2QA 3QCPA 4EF0A 3TJJA 2FNOA 2VAFA 2HRNA 1ZZYA 3C1SA 3O3TA 1XPVA 3FY7A 4BPYA 4NAXA 5ECSA 4AGSA 4GLTA 3TKSA 5ECIB 2ZUPA 4OCFA 1F3AA 4EL1A 3APQA 4TOPA 4HS1A 3M9JA 2AB6A 4MJCA 1NSWA 4KDUA 4RUVA 5COHA 2FWFA 4F03A 3GL5A 2HE3A 5IMCA 2B3SA 5D96A 4NWYA 4DSSA 5DBQA 2I1UA 1U3IA 2IL3A 3GNJA 4JEDA 2HRFA 1FB0A 2V32A 4ILFA 2MBTA 2Z9SA 1XXUA 4AF2A 1O73A 1U6TA 4G9HA 4HJMA 1H4OA 2RM6A 4AJ8A 3ERWA 1YJ6A 2HYXA 5D9VA 4XS1A 4BWQA 5CP1A 1RW1A 1GTBA 4GRFA 3KGKA 1XWAA 3UBKA 1K0BA 3UOMA 4J57E 3F4SA 4TXOA 4KB3A 4WBJA 1KTEA 1XWBA 4ZL7A 3GKNA 2C4JA 1R5AA 3LXZA 3GURA 1GL8A 3WGXA 2F3MA 4E8HA 4GQCA 4G0LA 5AIVA 4KGIA 1O6JA 2GQKA 2F51A 2I4AA 1FB6A 2B1LA 2OACA 2L4CA 4JU5A 4ID0A 2K9FA 2EIOA 4OD7A 4MF6A 5EVOA 1X5CA 1PN9A 2FWHA 4IHUA 2GSTA 5D8IA 1O85A 1VF2A 2LNTA 3D4MA 1VRSD 1BQ7A 3HD5A 3IV4A 4FYUA 4POKA 4TN8A 1Z3EA 2GT5A 2DJJA 2OA7A 3QFBC 3IRAA 3ME8A 2CX3A 1GSEA 12GSA 3QDNA 4RQRA 3FKFA 3KJYA 3TRQA 5ENUA 4IW9A 1NHYA 4HZ2A 6GSXA 5IMAA 1TKDB 1M9BA 2UZ8A 3MNGA 3KEBA 4F0BA 3A2VA 3GL3A 1THXA 3ZFBA 5DAKA 2KOKA 2GQLA 2REMA 3DD3A 1ERUA 2DJ0A 1O8WA 4HU9A 1GH2A 2VM2A 1OAZA 4KA0A 2OE1A 2HSMA 4N11A 3IK9A 2OJLA 2OBKA 2IMKA 4TR3A 3CSIA 1S3DA 5ECHB 4GCIA 2R37A 3WGEA 4EE0A 1OKDA 20GSA 1FVJA 1XVQA 1HYUA 2LJRA 1HNCA 1AQXA 3ZREA 4LMWA 1NW2A 2C8UA 2R5GA 1XFLA 3HVSA 1JZWA 1K3LA 4E8EA 2LQQA 4I2TA 5DALA 3JCML 5ECQB 2O87A 3J7Yk 2GLRA 1Z7PA 2YWMA 5JWRB 4TRXA 1GLQA 4QQ7A 4IN0A 2LTKA 2LJKA 2VUPA 3H93A 3C8EA 2C0EA 2PBJA 1DUGA 4IELA 4TR0A 6GSWA 2IFQA 4AJ6A 3F6FA 3Q18A 4Q5QA 1A0FA 2L6CA 4JRRA 4RQXA 3MAKA 3TGZA 3OR5A 5INYA 1JZRA 6GSYA 4K6XA 1KEBA 4X0XA 6GSUA 4N30A 4FIWA 3MDKA 4BVXA 2V6KA 2D2ZA 5IMZA 1XBSA 1QGVA 4POMA 3PPUA 5CREA 4IQAA 1G6YA 3G7IA 2IMDA 3I69A 1MDJA 1AW9A 16GSA 1YKCA 3QAGA 3QMXA 2B5XA 4PX1A 2YJHA 1EEJA 2AYTA 2VOCA 10GSA 4MDCA 4KCAA 1N2AA 4K9ZA 1USBA 3P2AA 1K0AA 1OYJA 4YQMA 1EZKA 3D4TA 4PGTA 4K0GA 3HHVA 5CRWA 2DC5A 4YAPA 2VCXA 2BTOT 3PINA 4I6XA 1GSUA 1BJXA 2H01A 3H79A 5IO2A 4PURA 1PRXA 1PL1A 2GTUA 1M2BA 1PX7A 1TRVA 2O85A 1A2LA 2XC2A 3C1RA 2V2GA 2L57A 1SKWB 2L4QA 5H5SA 4QL9A 1K3OA 1RQMA 4YQUA 1SJ6A 1PKWA 4IJ3A 3GX0A 5DQSA 2DMMA 1M9AA 1SK1A 3TJKA 4NV2A 4YQVA 1UA5A 3GTUB 3IAM2 1ZYQB 3KXOA 1I5GA 5G2ZA 2VM1A 4V1Ap 1WOUA 1ZOFA 2DLXA 1W4VA 5G5FA 2YWIA 1MTCA 2ZCTA 2CAIA 4OFNA 1R5PA 3H1NA 3I43A 3LGCA 3TKQA 4MPGA 2HRKB 2OE0A 4BWSA 1UN2A 1G0TA 4L5LA 1OE7A 2CA8A 5G30A 4OMVA 3KTLA 3S9FA 1A8LA 5F8BA 4WF5A 1M0UA 3Q19A 4G0KA 2WGRA 3PR8A 4FYCA 1T7PB 5B6NA 4DSQA 1MD3A 2HZEB 2IMFA 3U5RE 1SKSB 2AV4A 2JL4A 3RHCA 2RLIA 1FW1A 1TRSA 4GSTA 2JZTA 4NXIA 3Q74A 3NIVA 2M72A 3VPQA 3DWVA 1TI3A 1ABAA 4ECCA 4EDYA 1XOBA 2H0GA 2IPAA 3M3MA 4JR6A 2XBQA 4HJ2A 3TKRA 1YKAA 5J9BA 4BVYB 2HFDA 3ZYWA 6GSVA 4OFTA 3NZNA 4DSRA 2H1GA 1AIUA 1OC9A 2JU5A 3IA1A 2IJYA 2PPTA 3PH9A 3LYPA 1UVZA 3HKRA 4ECJA 1TK5B 1LU4A 2NDOA 4AJ7A 4MABA 4NPBA 4ZXGA 2H6ZA 3EMXA 4PQ1A 5CRGA 2HSHA 4KUNA 2P0GA 2LS5A 3ZITA 1GRXA 2PMTA 3RDWA 4I5QA 4K2DA 3UARA 2RUFA 2J9HA 5IMDA 2H8LA 1ML6A 5AN1A 3GH9A 4ZIJA 4G10A 2E0QA 3RAZA 2P5QA 2PGTA 1T8EB 3GUSA 4EKZA 2H73A 4KAEA 2DSAA 3ERFA 4KH7A 4X1UA 5E4WA 4I8BA 2MMOA 3GKMA 2MBSA 2E2MA 3GKKA 3LYKA 3H8QA 3VWXA 5HFKA 1YF1A 2NPBA 1T00A 5AGYA 2V41A 2B7JA 4I2UA 4ZL9A 3RPPA 5JCWA 2GQMA 4RI6A 2KUCA 3I9V2 2AUVA 1Y25A 1MD4A 1Y6EA 2FWGA 1PKZA 1SK0A 1ERVA 1A0RP 4IJIA 2V6OA 4Q5FA 1EP7A 1THOA 1SYRA 2O7KA 1GSSA 2H66A 2R4VA 5B6MA 1F3BA 5KN2A 2XPEA 1AC1A 4OCEA 3TJFA 4J56E 22GSA 4EC0A 5A4WA 4WETA 3CMIA 2IN3A 4MZBA 3APOA 2I3YA 4V1Ag 1GNEA 2FGXA 1HNBA 4IS0A 2OKAA 3A5WA 1IYIA 1M99A 2GS3A 1T1VA 13GSA 5IOXA 2YPMA 1R26A 1M7TA 2XBIA 4IVFA 4LL4B 4HOJA 3KP8A 3F4RA 2YWOA 1EGOA 2FLSA 4XTSA 1J0FA 3L78A 4JR4A 2OBIA 1E2YA 4FQUA 5HQPA 1GUHA 5GSTA 1XCCA 4WKWA 1Z7RA 3DEXA 4KSMA 2RUEA 2FD3A 2WB9A 4WR4A 1ERWA 3M1GA 5EL8A 1A2MA 4KCEA 1TP9A 2B5YA 2DBCA 5L71A 4ML1A 3AY8A 2VLUA 3TKSE 2DIYA 2CVDA 5B8AA 3C73A 2HSNB 4K7IA 3IK7A 4XCSA 1JLWA 1O81A 3ZL5A 2LNSA 1KNGA 3DVWA 4D73B 2MMNA 3TOTA 4TVEA 4TR1B 3ZIJA 1SKRB 4FYBA 14GSA 2WFCA 4ECBA 2GGTA 1G6WA 5B8BA 2TIRA 1B48A 5D73A 5ECMB 2NVLA 1EOGA 2K6VA 3CXGA 3LORA 2HT9A 3A3TA 3M9KA 3US3A 2AAWA 3ZLPA 1ILOA 3D6IA 1A24A 3IBHA 4JBBA 2CAQA 3HZ4A 4CW9A 5E59A 4RI7A 5HR3A 5ABRA 4P3YB 1LJRA 3HXSA 2H74A 3C71A 1AQVA 2ALBA 4EO3A 4KSOA 3VI5A 3DKSA 5IPGA 3HVXA 3K8NA 4PUAA 4XS4B 2C80A 4V2NA 1FG4A 2YN1A 2YV7A 1X9MB 2FA4A 2VCTA 2B1KA 4NMUA 3HY2A 5FT3A 1S3CA 3KD0A 2GZZA 3L9VA 3LFLA 3L9UA 3ZIVA 3TB2A 3VWUA 3EURA 1QMVA 3DXBA 4OO5A 17GSA 4POBA 4ML6A 3VURA 2H70A 2XPDA 4TR4A 9GSSA 1SENA 3FZ9A 3L9SA 5D9TA 2A4VA 5JCUA 4O5RA 3LQ7A 1F2EA 5HFIA 2RM5A 2HI7A 4OFMA 2VL2A 5AISA 5ECOB 2AHEA 4FH8A 3GV1A 1DBYA 3IC4A 4DVCA 2GSRA 3GSSA 5GAND 3WGDA 3WT2A 1WWJA 1SJZA 1IYHA 1X9SB 4HQSA 3J7Yb 1XWCA 3W8SA 1Q4JA 2NTOA 2IIYA 1V58A 1GP1A 5IM9A 5IPHA 3F63A 3VFIA 3TUEA 3V1WA 1TK0B 3BOAA 4KF9A 3FRCA 1EV9A 1KBNA 3CYNA 1Z5YE 3DRNA 2CX4A 3FR9A 4L8EA 2VCZA 4MMMA 5KN0A 4CHSA 3GX8A 3UEMA 2VCVA 3ZTLA 5G1KA 3KZQA 2L5OA 3SBCA 4EVMA 4OO4A 3FZ4A 5DCHA 5JWOB 4TKYA 3HJMA 1VF1A 1WRYA 3FK8A 3MSZA 2R6KA 4KDXA 4G2EA 2M46A 3HZ8A 5LNKe 2J23A 2QSIA 2FHEA 3BJ5A 5CRHA 2LUSA 3PGTA 4Z7XA 2PU9C 2CT6A 1GNWA 2PVQA 4D73A 1NHOA 1XW5A 3WD6A 4ZB6A 5IMVA 4GTUA 4PNGA 5H5QA 2VD0A 4MH2A 3ERGA 4PUFC 3FR3A 2C0GA 5ID2B 2HXKA 3RBTA 3M8NA 2EC4A 3M0FA 2VLVA 3F8UA 1OKTA 4BA7A 1X9WB 5F05A 3IAS2 2WULA 4HUAA 2WRTA 4NHZA 3QD9A 2N5AA 3ZFLA 4USSA 1Z6NA 4F0CA 2VO4A 3VK9A 3GKXA 4KW6A 5CAXA 3LWAA 2WDUA 1TOFA 2BMXA 5D93A 1SJIA 2WCIA 1UC7A 3BBYA 1BG5A 2DIZA 3EU3A 4Q5RA 4K1FA 3TKPA 1QXHA 3N9JA 1K0OA 3VPTA 3FEUA 2DJKA 4EDZA 3QOUA 1WE0A 1U87A 1YZXA 2YWNA 1ZGNA 2LKUA 1BX9A 4LMVA 5F06A 2FCHA 3ZVJA 1JHBA 2LQOA 2CZ3A 1K0NA 5EY6A 1ERTA 2DJ1A 4ECIA 1T4YA 3F3QA 2ON7A 3KH7A 3R2QA 4GWRA 4V2MA 1XW6A 4HEA2 2GVPA 1B9XC 5J5NA 2RIIA 5A4UA 3FHKA 2VL9A 2TRXA 3U6VA 2M80A 3KMNA 2B7KA 3HCZA 2VCWA 4KNDA 2FY6A 1AXDA 5CO3A 4GSSA 4TXOB 1R4WA 1XWKA 5IOWA 4CDOA 2R3XA 5DJMA 3NOFA 2GZPA 3N5OA 3LJRA 2FUG2 3UBLA 1OC3A 1YY7A 3GFKA 4ACSA 3EC3A 5ELAA 2B5EA 1XVWA 2H0HA 1GWCA 3E0UA 1EV4A 2H72A 3FYGA 3O6TA 4XRDA 2GZYA 4HQZA 1B9YC 2TRCP 1PD21 5HR0A 7GSSA 1K0DA 1TRUA 1TU7A 2ZNMA 3GHAA 3UAPA 2B6MA 4MZWA
chains in the Genus database with same CATH superfamily
5KN3A 1AAZA 2ES7A 4ZBAA 5ECRB 4ZBBA 3CTGA 3HMJG 2QGVA 5ECLB 5AIXA 3EPTA 2VIMA 2JZRA 2K18A 4MLYA 3D5JA 1YEPA 3DVXA 3FR6A 4F82A 3IPZA 1JZDA 2N5BA 1FHEA 3I6AA 5DAKB 1S3RA 5C04A 1VF3A 4KDYA 2H71A 2IWTA 2P5RA 3GYKA 2XHFA 1K3YA 3Q6OA 1X5EA 4XHMA 1VGLA 5IO0A 3TKSC 2HSMB 1JFUA 2H1BA 4L0UA 2QC7A 3DIEA 1XWGA 5D9XA 5ID2A 2L6DA 1T4ZA 1ZCPA 2CVKA 2C3TA 1BEDA 1ST9A 5J9CA 2WZ9A 1SL2B 2HQTA 4ZB9A 4HI7A 1B4PA 4GQFA 2VL3A 4LL1B 1O8XA 1GLPA 3CRTA 1V2AA 3EINA 4HU7A 4ICYA 2VCQA 3G7JA 3E9JB 1RK4A 2LJAA 2GSQA 4LLRA 5BMUA 4PNFA 1W89A 5DCGA 1PX6A 4TXVA 5G5EA 1G7EA 1BAYA 5GAPD 5DALB 2H1DA 3GTUA 3F9UA 4BL7B 1MEKA 1Q98A 3EE2A 4CY8A 4O32A 1TK8B 3HA9A 4MJAA 3L4NA 1C72A 5HR2A 4F9ZA 4LA1A 4GDFA 1A23A 2IFQB 3HYPA 3RPNA 2HRKA 1SL0B 3W8JA 5ELGA 5EPFA 1DSBA 8GSSA 3IC8A 4AKGA 1QQ2A 3HJOA 1GSQA 2X8CA 3D0ZA 1V40A 2KLXA 3P8WA 4BVXB 1Z9HA 1WJKA 5HFGA 3GSTA 5FWGA 4PTSA 1V9WA 2G0FA 4N0VA 3EU4A 5J41A 4O7HA 2HZEA 2VD1A 1X0RA 2LV3A 3D22A 4IKHA 2O8VB 3D21A 2KP2A 1ZMAA 3RFRC 1GTAA 4K7OA 3QAVA 2PUKC 1B4QA 3UJ1A 4FO5A 2WW0A 2KHPA 4MJBA 4AI6A 3VWWA 3F0IA 3UIWA 2JSYA 1EEMA 3RGBC 3ZVJD 4ISDA 2E2GA 4AKIA 1TU8A 3F4TA 4IP1A 4HDEA 1O7UA 4BVYA 5JWQB 4KE3A 3LSZA 2A2RA 3EYTA 4WBRD 3DGQA 3UVHA 1OC8A 1BF5A 2HSYA 3QR6A 4WF4A 2MZCA 2YV9A 1M2DA 3A2WA 5GZZB 1HNAA 4YH2A 3P7XA 1WIKA 4H86A 5IIZA 3F3RA 5ECKB 3TJBA 4JE1A 4MF7A 3TOUA 2YZUA 3UVTA 2H1AA 1I1IP 3EWLA 3FZ5A 5FHIA 1FOVA 1WPIA 3H4KA 1M2AA 1GULA 3KMOA 5BRTA 3F6DA 4K0NA 2PN8A 3BCIA 1PMTA 3QAWA 4MA9A 5JCGA 2VL2C 3IR4A 2K8SA 1HQOA 2HNLA 3FW2A 1FAAA 4ZBDA 2F9SA 2GDRA 2DJ3A 1U88A 1XZOA 2EIRA 2YANA 1EOHA 1CQHA 3TDGA 4ZILA 18GSA 5GSSA 3GRXA 5ECNB 1WMJA 3A2XA 2C0DA 1JZOA 5LD0A 1K0CA 2ON5A 4POLA 3GH6A 1GSDA 1SVOA 2P31A 4MP4A 5KN1A 1SL1B 4WR5A 2L5LA 2QKEA 1QK8A 1FO5A 4PI0C 2JADA 4PQIA 1ZYEA 1WP0A 1A2JA 4WXTA 1NM3A 1URMA 2VLTA 1SYXA 2HZFA 3LEFA 2L59A 1GSYA 3WT1A 3ME7A 3IE3A 2YCDA 3IOSA 2I9HA 4L0WA 1AUCA 3GA4A 1ZYPA 2H76A 4BL7A 1ZL9A 2KP1A 3KIJA 3CRUA 4IBPA 4ZL8A 3CWGA 2C3NA 2K8VA 2YNXA 4ZB8A 2LEGA 1BYEA 3MWHA 2R2JA 3CHXC 1PSQA 4CY6A 2OT3A 1GUMA 3WYWA 4PQHA 1I9DA 4GSNA 2CQ9A 4G01A 19GSA 1U3AA 3BD2A 3HDCA 4OWYA 1OC9B 5KEJA 1DE1A 1K0MA 3HVVA 4PXOA 2MMZA 2HLSA 4V2LA 3KM6A 2QA1A 3IHQA 5G31A 1J08A 2F8AA 1YEXA 3EVIA 1E6BA 3LXTA 4IQ1A 1T3BA 2I81A 2X8GA 1HD2A 2X99A 5CRDA 2H75A 2A2SA 1YEWC 3TCOA 5B7CA 3GIXA 4WEYA 2PERA 4TW5A 4HZ4A 2MYGA 4XIHA 1V98A 3QPMA 5CNWA 4O92A 4TR1A 5A5KA 4N0ZA 2QA2A 3ZMLA 4MPFA 2NBSA 3W6GA 4I97A 3ZRDA 11GSA 5IQYA 1GUKA 1EP8A 2YOIA 3ZMKA 1CQGA 2JSZA 2C0FA 1N8JA 1TTZA 2HRAA 5DVBA 1SD9A 3TRPA 4MK3A 3P90A 1Z6MA 5IMFA 1JLVA 3ED3A 1PGTA 4Z2UA 2FWEA 2GT6A 4X43A 5G1LA 3GN3A 3ISOA 1A8YA 3UMAA 2MMAA 1TRWA 5DQYA 4YAVA 2X49A 1TJDA 4MJEA 3DMLA 1XG8A 1J9BA 2H19A 2C3QA 3VWVA 5A5HB 2C1YA 1EWXA 3HJPA 2YP6A 4XRAA 4XS4A 1TXXA 4EXJA 2YZHA 2LRTA 1TXUA 2DJ2A 4K7NA 3BCKA 2BJXA 4K2XA 1YQ1A 4GF0A 1H75A 1GTIA 2H6YA 2H6XA 1F6MC 3KH9A 1TDIA 3GMFA 3CBUA 1SVLA 4DSSB 2E7PA 2IMEA 1YF0A 3MYDA 1EGRA 3G7YA 2LRNA 1VF4A 5HR1A 2JZSA 5D9WA 2LRCA 5F0GA 3O76A 1MDIA 2WJUA 3IDVA 1B8XA 1SU9A 3APSA 4QL7A 1XW9A 6GSTA 2YJ7A 4ULXA 4K5SA 1PL2A 1SD8A 4KX4A 4Q5NA 3KTBA 2X64A 2N5FA 4NV5A 2LSTA 4MF5A 4K8MA 2CVBA 4YKFA 1TI1A 3G9BA 1SK2A 3VLNA 4IGJA 5J40A 2F8FA 3CTFA 4GXZA 3ZZXA 1PQNA 4NHWA 1ON4A 4L5OA 3CSHA 4MZCA 4EUYA 1QUWA 5C00A 3TJGA 2GSSA 4DEJA 2X8HA 5CYYA 1OVNA 2WVXA 2H30A 3E3EA 1R7HA 1OE8A 5J3RA 2CV4A 3KCMA 1MDKA 3FZAA 4MCUA 1V57A 2WS2A 2H0IA 2PVOC 2FA8A 1F9MA 1G7OA 1SVMA 5LCZA 1ACVA 1YDKA 4F2IA 5ECPB 2CZ2A 1F37A 2JACA 3EMPA 4BIKA 5A1NA 2OE3A 2IMIA 3SWLA 4J2FA 1PA3A 1AQWA 1S3AA 3LG6A 4K5RA 1GSFA 3L0HA 1TW9A 4X4JA 5F07A 3KP9A 1GTUA 4XS6A 4G19A 2AJQB 3R3EA 1DE2A 5DJLA 2DMLA 2PWJA 1QFNA 1FVKA 4IP6A 3CQFA 4MH3A 3QFAC 4G0IA 5J4UA 1LBKA 6GSSA 5H5RA 2OADA 1XIYA 3VI7A 3CSJA 5A4VA 4N10A 3UL3A 5DDLA 4Z2TA 3IXRA 2EIQA 2O89A 2V1MA 1XOAA 3RHBA 3DYRA 4JZQA 1X5DA 3C7MA 3TRXA 2G2QA 3QCPA 4EF0A 3TJJA 2FNOA 2VAFA 2HRNA 1ZZYA 3C1SA 3O3TA 1XPVA 3FY7A 4BPYA 4NAXA 5ECSA 4AGSA 4GLTA 3TKSA 5ECIB 2ZUPA 4OCFA 2O5VA 1F3AA 4EL1A 3APQA 4TOPA 4HS1A 3M9JA 2AB6A 4MJCA 1NSWA 4KDUA 4RUVA 5COHA 2FWFA 4F03A 3GL5A 2HE3A 5IMCA 2B3SA 5D96A 4NWYA 4DSSA 5DBQA 2I1UA 1U3IA 2IL3A 3GNJA 3LW9A 4JEDA 2HRFA 1M3JA 1FB0A 2V32A 4ILFA 2MBTA 2Z9SA 1XXUA 4AF2A 1O73A 1U6TA 4G9HA 4HJMA 1H4OA 2RM6A 4AJ8A 3ERWA 1YJ6A 2HYXA 5D9VA 4AKXB 2EFEA 4XS1A 4BWQA 5CP1A 1RW1A 1GTBA 4GRFA 3KGKA 1XWAA 3UBKA 1K0BA 3UOMA 4J57E 3F4SA 4TXOA 4KB3A 4WBJA 1KTEA 1XWBA 4ZL7A 4PI2C 3GKNA 2C4JA 1R5AA 3LXZA 3GURA 1GL8A 3WGXA 2F3MA 4E8HA 4GQCA 4G0LA 5AIVA 3MIXA 4KGIA 1O6JA 2GQKA 2F51A 2I4AA 1FB6A 2B1LA 2OACA 2L4CA 4JU5A 4ID0A 2K9FA 2EIOA 4OD7A 1BG1A 4MF6A 5EVOA 1X5CA 1PN9A 2FWHA 4IHUA 2GSTA 5D8IA 1O85A 1VF2A 2LNTA 3D4MA 1VRSD 1BQ7A 3HD5A 3IV4A 4FYUA 4POKA 4TN8A 1Z3EA 2GT5A 2DJJA 2DKIA 2OA7A 3QFBC 3IRAA 3ME8A 2CX3A 1GSEA 12GSA 3QDNA 4RQRA 3FKFA 3KJYA 3TRQA 5ENUA 4IW9A 1NHYA 4HZ2A 6GSXA 5IMAA 1TKDB 1M9BA 2UZ8A 3KEBA 3A2VA 4F0BA 3GL3A 3MNGA 1THXA 3ZFBA 5DAKA 2KOKA 2GQLA 2REMA 3DD3A 1ERUA 2DJ0A 1O8WA 4HU9A 1GH2A 2VM2A 1OAZA 4KA0A 2OE1A 2HSMA 4N11A 3IK9A 2OJLA 2OBKA 2IMKA 4TR3A 3CSIA 1S3DA 5ECHB 4GCIA 2R37A 3WGEA 4EE0A 1OKDA 20GSA 1FVJA 1XVQA 1HYUA 2LJRA 1HNCA 2WW3A 1AQXA 4W66A 3ZREA 4LMWA 1NW2A 2C8UA 2R5GA 1XFLA 3HVSA 5KOXA 1JZWA 1K3LA 4E8EA 2LQQA 4I2TA 5DALA 5J4YA 3JCML 5ECQB 1YVLA 2O87A 3J7Yk 2WW1A 2GLRA 1Z7PA 2YWMA 5JWRB 4TRXA 1GLQA 4QQ7A 4IN0A 2LTKA 2LJKA 2VUPA 3H93A 3C8EA 2C0EA 2PBJA 1DUGA 4IELA 4TR0A 6GSWA 2IFQA 4AJ6A 3F6FA 3Q18A 4Q5QA 1A0FA 2L6CA 4JRRA 4RQXA 3MAKA 3TGZA 3OR5A 5INYA 4O5QA 4YKGA 1JZRA 5A34B 6GSYA 4K6XA 1KEBA 4X0XA 6GSUA 4N30A 4FIWA 3MDKA 4BVXA 2V6KA 2D2ZA 5IMZA 1XBSA 1QGVA 4POMA 3PPUA 5CREA 4IQAA 1G6YA 3G7IA 2IMDA 3I69A 1MDJA 1AW9A 16GSA 1YKCA 3QAGA 3QMXA 2B5XA 4PX1A 2YJHA 1EEJA 2AYTA 2VOCA 10GSA 4MDCA 4KCAA 1N2AA 4K9ZA 1USBA 3P2AA 1K0AA 1OYJA 4YQMA 1EZKA 2R0PA 3D4TA 4PGTA 4K0GA 3HHVA 5CRWA 2DC5A 2WVYA 4YAPA 2VCXA 2BTOT 3PINA 4I6XA 2H1LA 1GSUA 1BJXA 2H01A 3H79A 5IO2A 4PURA 1PRXA 1PL1A 4EIQA 2GTUA 1M2BA 1PX7A 3IHGA 1TRVA 2O85A 1A2LA 2XC2A 3C1RA 2V2GA 2L57A 1SKWB 2L4QA 5H5SA 4QL9A 1K3OA 1RQMA 4YQUA 1SJ6A 1PKWA 4IJ3A 3GX0A 5DQSA 5BMUB 2DMMA 1M9AA 1SK1A 3TJKA 4NV2A 4YQVA 1UA5A 3GTUB 3IAM2 1ZYQB 3KXOA 1I5GA 5G2ZA 2VM1A 4V1Ap 1WOUA 1ZOFA 2DLXA 1W4VA 5G5FA 2YWIA 1MTCA 2A4HA 2ZCTA 2CAIA 4OFNA 1R5PA 3H1NA 3I43A 3LGCA 3TKQA 4MPGA 2WW2A 2HRKB 2OE0A 4BWSA 1UN2A 4EIPA 1G0TA 4HSCX 4L5LA 1OE7A 2A2PA 2CA8A 5G30A 4OMVA 3KTLA 3S9FA 1A8LA 5F8BA 4WF5A 1M0UA 3Q19A 4AKHA 4G0KA 2WGRA 3PR8A 4FYCA 1T7PB 5B6NA 2O3EA 4DSQA 1MD3A 2HZEB 2IMFA 3U5RE 1SKSB 2AV4A 2JL4A 2DKHA 3RHCA 2RLIA 1FW1A 1TRSA 4GSTA 2JZTA 4NXIA 3Q74A 3NIVA 2M72A 3VPQA 3DWVA 1TI3A 1N25A 1ABAA 1PFOA 2O36A 4ECCA 2UV8G 4EDYA 1XOBA 2H0GA 2IPAA 3M3MA 4JR6A 2XBQA 4HJ2A 3TKRA 1YKAA 5J9BA 4BVYB 2HFDA 3ZYWA 6GSVA 4OFTA 3NZNA 3TU3B 4DSRA 2H1GA 1S4BP 1AIUA 1OC9A 2JU5A 3IA1A 2IJYA 2PPTA 3PH9A 3LYPA 1UVZA 3HKRA 4ECJA 1TK5B 1LU4A 2NDOA 4AJ7A 4MABA 4NPBA 4ZXGA 2H6ZA 3EMXA 4PQ1A 5CRGA 2HSHA 4KUNA 2P0GA 2LS5A 3ZITA 1GRXA 4QMKA 2PMTA 3RDWA 4I5QA 4K2DA 3UARA 2RUFA 2J9HA 5IMDA 2H8LA 1ML6A 5AN1A 3GH9A 4ZIJA 4G10A 2E0QA 3RAZA 2P5QA 2PGTA 1T8EB 3GUSA 4EKZA 2H73A 4KAEA 2DSAA 3ERFA 4KH7A 4X1UA 5E4WA 4I8BA 2VKZG 2MMOA 3GKMA 2MBSA 2E2MA 3GKKA 3LYKA 3H8QA 3VWXA 5HFKA 1YF1A 4FXYP 2NPBA 1T00A 5AGYA 2V41A 2B7JA 4I2UA 4ZL9A 3RPPA 5JCWA 2GQMA 4RI6A 2KUCA 3I9V2 2AUVA 1Y25A 1MD4A 1Y6EA 2FWGA 1PKZA 1SK0A 1ERVA 1A0RP 4IJIA 2V6OA 4Q5FA 1EP7A 1THOA 1SYRA 2O7KA 1GSSA 2H66A 2R4VA 5B6MA 1F3BA 5KN2A 2XPEA 5A5HA 1AC1A 4PHZC 4OCEA 3TJFA 4J56E 22GSA 4EC0A 5A4WA 4WETA 3CMIA 2IN3A 4MZBA 3APOA 2I3YA 4V1Ag 1GNEA 2FGXA 1HNBA 4IS0A 2OKAA 3A5WA 1IYIA 1M99A 2GS3A 1T1VA 13GSA 5IOXA 2YPMA 1R26A 1M7TA 2XBIA 4IVFA 4LL4B 5KOWA 4HOJA 3KP8A 3F4RA 2YWOA 1EGOA 2FLSA 4XTSA 1J0FA 3L78A 4JR4A 2WVZA 2OBIA 1E2YA 4FQUA 5HQPA 1GUHA 5GSTA 1XCCA 4WKWA 1Z7RA 3DEXA 4KSMA 2RUEA 2FD3A 2WB9A 4WR4A 1ERWA 3M1GA 5EL8A 1A2MA 4KCEA 1TP9A 2B5YA 2DBCA 5L71A 4ML1A 3AY8A 2VLUA 3TKSE 2DIYA 2CVDA 5B8AA 3C73A 2HSNB 4K7IA 3IK7A 4XCSA 1JLWA 1O81A 3ZL5A 2LNSA 1KNGA 3DVWA 4D73B 2MMNA 3TOTA 4TVEA 4TR1B 3ZIJA 1SKRB 4FYBA 14GSA 2WFCA 4ECBA 2GGTA 1G6WA 5B8BA 2TIRA 1B48A 5D73A 5ECMB 2NVLA 1EOGA 2K6VA 3CXGA 3LORA 2HT9A 3A3TA 3M9KA 3US3A 2AAWA 3ZLPA 1ILOA 3D6IA 1A24A 3IBHA 4JBBA 2CAQA 3HZ4A 4CW9A 5E59A 2EFDA 4RI7A 5HR3A 5ABRA 4P3YB 1LJRA 3HXSA 2H74A 3C71A 1AQVA 1FOHA 3HVNA 2ALBA 4EO3A 4KSOA 3VI5A 3DKSA 5IPGA 3HVXA 3K8NA 4PUAA 4XS4B 2C80A 4V2NA 1FG4A 2YN1A 2YV7A 1X9MB 2FA4A 2VCTA 2B1KA 4NMUA 3HY2A 5FT3A 1S3CA 3KD0A 2GZZA 3L9VA 3LFLA 3L9UA 3ZIVA 3TB2A 3VWUA 3EURA 1QMVA 3DXBA 4OO5A 17GSA 1M3IA 4POBA 4ML6A 4ZB7A 3VURA 2H70A 2XPDA 4A5PA 4TR4A 1Y1UA 9GSSA 1SENA 5J47A 3FZ9A 3L9SA 5D9TA 2A4VA 5JCUA 4O5RA 3LQ7A 1F2EA 5HFIA 2RM5A 2HI7A 4OFMA 2VL2A 5AISA 5ECOB 2AHEA 4FH8A 3GV1A 1DBYA 3IC4A 4DVCA 2GSRA 3GSSA 3FMWA 5GAND 3WGDA 3WT2A 1WWJA 1SJZA 2R0GA 1IYHA 1X9SB 4HQSA 3J7Yb 1XWCA 3W8SA 2IIYA 1Q4JA 2NTOA 1V58A 1GP1A 2WVXB 5IM9A 5IPHA 4MNNA 3F63A 3VFIA 3TUEA 3V1WA 1TK0B 3BOAA 4KF9A 3FRCA 1EV9A 1KBNA 3CYNA 1Z5YE 3DRNA 2CX4A 3FR9A 4L8EA 2VCZA 4MMMA 5KN0A 4CHSA 3GX8A 3UEMA 2VCVA 3ZTLA 5G1KA 3KZQA 2L5OA 3SBCA 2EFCA 4EVMA 4OO4A 3FZ4A 5DCHA 5JWOB 4TKYA 3HJMA 1VF1A 1WRYA 3FK8A 5A1NB 3MSZA 2R6KA 4KDXA 4G2EA 2M46A 3HZ8A 5LNKe 2J23A 2QSIA 2FHEA 2HSNA 3BJ5A 5CRHA 2LUSA 3PGTA 4E68A 4Z7XA 2PU9C 2CT6A 1GNWA 2PVQA 4D73A 1NHOA 1XW5A 3WD6A 4ZB6A 5IMVA 4GTUA 4PNGA 5H5QA 2VD0A 4MH2A 3ERGA 4PUFC 3FR3A 2C0GA 5ID2B 2HXKA 3RBTA 3M8NA 2EC4A 3M0FA 2VLVA 5J4VA 1OKTA 3F8UA 4BA7A 1X9WB 5F05A 3IAS2 2WULA 4HUAA 2WRTA 4NHZA 3QD9A 2N5AA 3ZFLA 4USSA 1Z6NA 4F0CA 2VO4A 3VK9A 3GKXA 4KW6A 5CAXA 3LWAA 2WDUA 1TOFA 2BMXA 5D93A 1SJIA 2WCIA 4O5UA 1UC7A 3BBYA 1BG5A 2DIZA 3EU3A 4Q5RA 4K1FA 3TKPA 1QXHA 3N9JA 1K0OA 3VPTA 1PN0A 3FEUA 2DJKA 4EDZA 3QOUA 1WE0A 1U87A 1YZXA 2YWNA 1ZGNA 2LKUA 1BX9A 4LMVA 5F06A 2X4AA 2FCHA 3ZVJA 1JHBA 2LQOA 2CZ3A 1K0NA 5EY6A 1ERTA 2DJ1A 4ECIA 1T4YA 3F3QA 2ON7A 3KH7A 3R2QA 4GWRA 4V2MA 1XW6A 4HEA2 2GVPA 4Z2RA 1B9XC 5J5NA 2RIIA 5A4UA 3FHKA 2VL9A 2TRXA 3U6VA 2M80A 3KMNA 2B7KA 3HCZA 2VCWA 4KNDA 2FY6A 1AXDA 5CO3A 2EFHA 4GSSA 4TXOB 1R4WA 1XWKA 5IOWA 4CDOA 2R3XA 5DJMA 3NOFA 2GZPA 3N5OA 3LJRA 2FUG2 3UBLA 1OC3A 1YY7A 2WZSA 3GFKA 4ACSA 3EC3A 5ELAA 2B5EA 1XVWA 4N3ZA 2H0HA 1GWCA 3E0UA 1EV4A 5A34A 2H72A 2R0CA 3FYGA 3O6TA 4XRDA 2GZYA 4HQZA 1B9YC 2TRCP 1PD21 5HR0A 7GSSA 1K0DA 1TRUA 1TU7A 2ZNMA 3GHAA 3UAPA 3A5IA 1ZYNA 2B6MA 4MZWA
chains in the Genus database with same CATH topology
5KN3A 1AAZA 2ES7A 4ZBAA 5ECRB 4ZBBA 3CTGA 3HMJG 2QGVA 5ECLB 5AIXA 3EPTA 2VIMA 2JZRA 2K18A 4MLYA 3D5JA 1YEPA 3DVXA 3FR6A 4F82A 3IPZA 1JZDA 2N5BA 1FHEA 3I6AA 5DAKB 5C04A 1VF3A 4KDYA 2H71A 2IWTA 2P5RA 3GYKA 2XHFA 1K3YA 3Q6OA 1X5EA 4XHMA 1VGLA 5IO0A 3TKSC 2HSMB 1JFUA 2H1BA 4L0UA 2QC7A 3DIEA 1XWGA 5D9XA 5ID2A 2L6DA 1T4ZA 1ZCPA 2CVKA 2C3TA 1BEDA 1ST9A 5J9CA 2WZ9A 1SL2B 2HQTA 4ZB9A 4HI7A 1B4PA 4GQFA 2VL3A 4LL1B 1O8XA 1GLPA 3CRTA 1V2AA 3EINA 4HU7A 4ICYA 2VCQA 3G7JA 3E9JB 1RK4A 2LJAA 2GSQA 4LLRA 5BMUA 4PNFA 1W89A 5DCGA 1PX6A 4TXVA 5G5EA 1G7EA 1BAYA 5GAPD 5DALB 2H1DA 3GTUA 3F9UA 4BL7B 1MEKA 1Q98A 3EE2A 4CY8A 4O32A 1TK8B 3HA9A 4MJAA 3L4NA 1C72A 5HR2A 4F9ZA 4LA1A 4GDFA 1A23A 2IFQB 3HYPA 3RPNA 2HRKA 1SL0B 3W8JA 5ELGA 5EPFA 1DSBA 8GSSA 3IC8A 4AKGA 1QQ2A 3HJOA 1GSQA 2X8CA 3D0ZA 1V40A 2KLXA 3P8WA 4BVXB 1Z9HA 1WJKA 5HFGA 3GSTA 5FWGA 4PTSA 1V9WA 2G0FA 4N0VA 3EU4A 5J41A 4O7HA 2HZEA 2VD1A 1X0RA 2LV3A 3D22A 4IKHA 2O8VB 3D21A 2KP2A 1ZMAA 1GTAA 4K7OA 3QAVA 2PUKC 1B4QA 3UJ1A 4FO5A 2KHPA 4MJBA 4AI6A 3VWWA 3F0IA 3UIWA 2JSYA 1EEMA 3ZVJD 4ISDA 2E2GA 4AKIA 1TU8A 3F4TA 4IP1A 4HDEA 1O7UA 4BVYA 5JWQB 4KE3A 3LSZA 2A2RA 3EYTA 4WBRD 3DGQA 3UVHA 1OC8A 1BF5A 2HSYA 3QR6A 4WF4A 2MZCA 2YV9A 1M2DA 3A2WA 5GZZB 1HNAA 4YH2A 3P7XA 1WIKA 4H86A 5IIZA 3F3RA 5ECKB 3TJBA 4JE1A 4MF7A 3TOUA 2YZUA 3UVTA 2H1AA 3EWLA 3FZ5A 5FHIA 1FOVA 1WPIA 3H4KA 1M2AA 1GULA 3KMOA 5BRTA 3F6DA 4K0NA 2PN8A 3BCIA 1PMTA 3QAWA 4MA9A 5JCGA 2VL2C 3IR4A 2K8SA 1HQOA 2HNLA 3FW2A 1FAAA 4ZBDA 2F9SA 2GDRA 2DJ3A 1U88A 1XZOA 2EIRA 2YANA 1EOHA 1CQHA 3TDGA 4ZILA 18GSA 5GSSA 3GRXA 5ECNB 1WMJA 3A2XA 2C0DA 1JZOA 5LD0A 1K0CA 2ON5A 4POLA 3GH6A 1GSDA 1SVOA 2P31A 4MP4A 5KN1A 1SL1B 4WR5A 2L5LA 2QKEA 1QK8A 1FO5A 2JADA 4PQIA 1ZYEA 1WP0A 1A2JA 4WXTA 1NM3A 1URMA 2VLTA 1SYXA 2HZFA 3LEFA 2L59A 1GSYA 3WT1A 3ME7A 3IE3A 2YCDA 3IOSA 2I9HA 4L0WA 1AUCA 3GA4A 1ZYPA 2H76A 4BL7A 1ZL9A 2KP1A 3KIJA 3CRUA 4IBPA 4ZL8A 3CWGA 2C3NA 2K8VA 2YNXA 4ZB8A 2LEGA 1BYEA 3MWHA 2R2JA 1PSQA 4CY6A 2OT3A 1GUMA 3WYWA 4PQHA 1I9DA 4GSNA 2CQ9A 4G01A 19GSA 1U3AA 3BD2A 3HDCA 4OWYA 1OC9B 5KEJA 1DE1A 1K0MA 3HVVA 4PXOA 2MMZA 2HLSA 4V2LA 3KM6A 2QA1A 3IHQA 5G31A 1J08A 2F8AA 1YEXA 3EVIA 1E6BA 3LXTA 4IQ1A 1T3BA 2I81A 2X8GA 1HD2A 2X99A 5CRDA 2H75A 2A2SA 3TCOA 5B7CA 3GIXA 4WEYA 2PERA 4TW5A 4HZ4A 2MYGA 4XIHA 1V98A 3QPMA 5CNWA 4O92A 4TR1A 5A5KA 4N0ZA 2QA2A 3ZMLA 4MPFA 2NBSA 3W6GA 4I97A 3ZRDA 11GSA 5IQYA 1GUKA 1EP8A 2YOIA 3ZMKA 1CQGA 2JSZA 2C0FA 1N8JA 1TTZA 2HRAA 5DVBA 1SD9A 3TRPA 4MK3A 3P90A 1Z6MA 5IMFA 1JLVA 3ED3A 1PGTA 4Z2UA 2FWEA 2GT6A 4X43A 5G1LA 3GN3A 3ISOA 1A8YA 3UMAA 2MMAA 1TRWA 5DQYA 4YAVA 2X49A 1TJDA 4MJEA 3DMLA 1J9BA 2H19A 2C3QA 3VWVA 5A5HB 2C1YA 1EWXA 3HJPA 2YP6A 4XRAA 4XS4A 1TXXA 4EXJA 2YZHA 2LRTA 1TXUA 2DJ2A 4K7NA 3BCKA 2BJXA 4K2XA 1YQ1A 4GF0A 1H75A 1GTIA 2H6YA 2H6XA 1F6MC 3KH9A 1TDIA 3GMFA 3CBUA 1SVLA 4DSSB 2E7PA 2IMEA 1YF0A 3MYDA 1EGRA 3G7YA 2LRNA 1VF4A 5HR1A 2JZSA 5D9WA 2LRCA 5F0GA 3O76A 1MDIA 2WJUA 3IDVA 1B8XA 1SU9A 3APSA 4QL7A 1XW9A 6GSTA 2YJ7A 4ULXA 4K5SA 1PL2A 1SD8A 4KX4A 4Q5NA 3KTBA 2X64A 2N5FA 4NV5A 2LSTA 4MF5A 4K8MA 2CVBA 4YKFA 1TI1A 3G9BA 1SK2A 3VLNA 4IGJA 5J40A 2F8FA 3CTFA 4GXZA 3ZZXA 1PQNA 4NHWA 1ON4A 4L5OA 3CSHA 4MZCA 4EUYA 1QUWA 5C00A 3TJGA 2GSSA 4DEJA 2X8HA 5CYYA 1OVNA 2H30A 3E3EA 1R7HA 1OE8A 5J3RA 2CV4A 3KCMA 1MDKA 3FZAA 4MCUA 1V57A 2WS2A 2H0IA 2PVOC 2FA8A 1F9MA 1G7OA 1SVMA 5LCZA 1ACVA 1YDKA 4F2IA 5ECPB 2CZ2A 1F37A 2JACA 3EMPA 5A1NA 2OE3A 2IMIA 3SWLA 4J2FA 1PA3A 1AQWA 1S3AA 3LG6A 4K5RA 1GSFA 3L0HA 1TW9A 4X4JA 5F07A 3KP9A 1GTUA 4XS6A 4G19A 2AJQB 3R3EA 1DE2A 5DJLA 2DMLA 2PWJA 1QFNA 1FVKA 4IP6A 4MH3A 3QFAC 4G0IA 5J4UA 1LBKA 6GSSA 5H5RA 2OADA 1XIYA 3VI7A 3CSJA 5A4VA 4N10A 3UL3A 5DDLA 4Z2TA 3IXRA 2EIQA 2O89A 2V1MA 1XOAA 3RHBA 3DYRA 4JZQA 1X5DA 3C7MA 3TRXA 2G2QA 3QCPA 4EF0A 3TJJA 2FNOA 2VAFA 2HRNA 1ZZYA 3C1SA 3O3TA 1XPVA 3FY7A 4BPYA 4NAXA 5ECSA 4AGSA 4GLTA 3TKSA 5ECIB 2ZUPA 4OCFA 2O5VA 1F3AA 4EL1A 3APQA 4TOPA 4HS1A 3M9JA 2AB6A 4MJCA 1NSWA 4KDUA 4RUVA 5COHA 2FWFA 4F03A 3GL5A 2HE3A 5IMCA 2B3SA 5D96A 4NWYA 4DSSA 5DBQA 2I1UA 1U3IA 2IL3A 3GNJA 3LW9A 4JEDA 2HRFA 1FB0A 2V32A 4ILFA 2MBTA 2Z9SA 1XXUA 4AF2A 1O73A 1U6TA 4G9HA 4HJMA 1H4OA 2RM6A 4AJ8A 3ERWA 1YJ6A 2HYXA 5D9VA 4AKXB 2EFEA 4XS1A 4BWQA 5CP1A 1RW1A 1GTBA 4GRFA 3KGKA 1XWAA 3UBKA 1K0BA 3UOMA 4J57E 3F4SA 4TXOA 4KB3A 4WBJA 1KTEA 1XWBA 4ZL7A 3GKNA 2C4JA 1R5AA 3LXZA 3GURA 1GL8A 3WGXA 2F3MA 4E8HA 4GQCA 4G0LA 5AIVA 3MIXA 4KGIA 1O6JA 2GQKA 2F51A 2I4AA 1FB6A 2B1LA 2OACA 2L4CA 4JU5A 4ID0A 2K9FA 2EIOA 4OD7A 1BG1A 4MF6A 5EVOA 1X5CA 1PN9A 2FWHA 4IHUA 2GSTA 5D8IA 1O85A 1VF2A 2LNTA 3D4MA 1VRSD 1BQ7A 3HD5A 3IV4A 4FYUA 4POKA 4TN8A 1Z3EA 2GT5A 2DJJA 2DKIA 2OA7A 3QFBC 3IRAA 3ME8A 2CX3A 1GSEA 12GSA 3QDNA 4RQRA 3FKFA 3KJYA 3TRQA 5ENUA 4IW9A 1NHYA 4HZ2A 6GSXA 5IMAA 1TKDB 1M9BA 2UZ8A 3MNGA 3KEBA 4F0BA 3A2VA 3GL3A 1THXA 3ZFBA 5DAKA 2KOKA 2GQLA 2REMA 3DD3A 1ERUA 2DJ0A 1O8WA 4HU9A 1GH2A 2VM2A 1OAZA 4KA0A 2OE1A 2HSMA 4N11A 3IK9A 2OJLA 2OBKA 2IMKA 4TR3A 3CSIA 1S3DA 5ECHB 4GCIA 2R37A 3WGEA 4EE0A 1OKDA 20GSA 1FVJA 1XVQA 1HYUA 2LJRA 1HNCA 1AQXA 4W66A 3ZREA 4LMWA 1NW2A 2C8UA 2R5GA 1XFLA 3HVSA 5KOXA 1JZWA 1K3LA 4E8EA 2LQQA 4I2TA 5DALA 5J4YA 3JCML 5ECQB 1YVLA 2O87A 3J7Yk 2GLRA 1Z7PA 2YWMA 5JWRB 4TRXA 1GLQA 4QQ7A 4IN0A 2LTKA 2LJKA 2VUPA 3H93A 3C8EA 2C0EA 2PBJA 1DUGA 4IELA 4TR0A 6GSWA 2IFQA 4AJ6A 3F6FA 3Q18A 4Q5QA 1A0FA 2L6CA 4JRRA 4RQXA 3MAKA 3TGZA 3OR5A 5INYA 4O5QA 4YKGA 1JZRA 5A34B 6GSYA 4K6XA 1KEBA 4X0XA 6GSUA 4N30A 4FIWA 3MDKA 4BVXA 2V6KA 2D2ZA 5IMZA 1XBSA 1QGVA 4POMA 3PPUA 5CREA 4IQAA 1G6YA 3G7IA 2IMDA 3I69A 1MDJA 1AW9A 16GSA 1YKCA 3QAGA 3QMXA 2B5XA 4PX1A 2YJHA 1EEJA 2AYTA 2VOCA 10GSA 4MDCA 4KCAA 1N2AA 4K9ZA 1USBA 3P2AA 1K0AA 1OYJA 4YQMA 1EZKA 2R0PA 3D4TA 4PGTA 4K0GA 3HHVA 5CRWA 2DC5A 4YAPA 2VCXA 2BTOT 3PINA 4I6XA 2H1LA 1GSUA 1BJXA 2H01A 3H79A 5IO2A 4PURA 1PRXA 1PL1A 4EIQA 2GTUA 1M2BA 1PX7A 3IHGA 1TRVA 2O85A 1A2LA 2XC2A 3C1RA 2V2GA 2L57A 1SKWB 2L4QA 5H5SA 4QL9A 1K3OA 1RQMA 4YQUA 1SJ6A 1PKWA 4IJ3A 3GX0A 5DQSA 5BMUB 2DMMA 1M9AA 1SK1A 3TJKA 4NV2A 4YQVA 1UA5A 3GTUB 3IAM2 1ZYQB 3KXOA 1I5GA 5G2ZA 2VM1A 4V1Ap 1WOUA 1ZOFA 2DLXA 1W4VA 5G5FA 2YWIA 1MTCA 2A4HA 2ZCTA 2CAIA 4OFNA 1R5PA 3H1NA 3I43A 3LGCA 3TKQA 4MPGA 2HRKB 2OE0A 4BWSA 1UN2A 4EIPA 1G0TA 4L5LA 1OE7A 2A2PA 2CA8A 5G30A 4OMVA 3KTLA 3S9FA 1A8LA 5F8BA 4WF5A 1M0UA 3Q19A 4AKHA 4G0KA 2WGRA 3PR8A 4FYCA 1T7PB 5B6NA 4DSQA 1MD3A 2HZEB 2IMFA 3U5RE 1SKSB 2AV4A 2JL4A 2DKHA 3RHCA 2RLIA 1FW1A 1TRSA 4GSTA 2JZTA 4NXIA 3Q74A 3NIVA 2M72A 3VPQA 3DWVA 1TI3A 1N25A 1ABAA 4ECCA 2UV8G 4EDYA 1XOBA 2H0GA 2IPAA 3M3MA 4JR6A 2XBQA 4HJ2A 3TKRA 1YKAA 5J9BA 4BVYB 2HFDA 3ZYWA 6GSVA 4OFTA 3NZNA 3TU3B 4DSRA 2H1GA 1AIUA 1OC9A 2JU5A 3IA1A 2IJYA 2PPTA 3PH9A 3LYPA 1UVZA 3HKRA 4ECJA 1TK5B 1LU4A 2NDOA 4AJ7A 4MABA 4NPBA 4ZXGA 2H6ZA 3EMXA 4PQ1A 5CRGA 2HSHA 4KUNA 2P0GA 2LS5A 3ZITA 1GRXA 4QMKA 2PMTA 3RDWA 4I5QA 4K2DA 3UARA 2RUFA 2J9HA 5IMDA 2H8LA 1ML6A 5AN1A 3GH9A 4ZIJA 4G10A 2E0QA 3RAZA 2P5QA 2PGTA 1T8EB 3GUSA 4EKZA 2H73A 4KAEA 2DSAA 3ERFA 4KH7A 4X1UA 5E4WA 4I8BA 2VKZG 2MMOA 3GKMA 2MBSA 2E2MA 3GKKA 3LYKA 3H8QA 3VWXA 5HFKA 1YF1A 2NPBA 1T00A 5AGYA 2V41A 2B7JA 4I2UA 4ZL9A 3RPPA 5JCWA 2GQMA 4RI6A 2KUCA 3I9V2 2AUVA 1Y25A 1MD4A 1Y6EA 2FWGA 1PKZA 1SK0A 1ERVA 1A0RP 4IJIA 2V6OA 4Q5FA 1EP7A 1THOA 1SYRA 2O7KA 1GSSA 2H66A 2R4VA 5B6MA 1F3BA 5KN2A 2XPEA 5A5HA 1AC1A 4OCEA 3TJFA 4J56E 22GSA 4EC0A 5A4WA 4WETA 3CMIA 2IN3A 4MZBA 3APOA 2I3YA 4V1Ag 1GNEA 2FGXA 1HNBA 4IS0A 2OKAA 3A5WA 1IYIA 1M99A 2GS3A 1T1VA 13GSA 5IOXA 2YPMA 1R26A 1M7TA 2XBIA 4IVFA 4LL4B 5KOWA 4HOJA 3KP8A 3F4RA 2YWOA 1EGOA 2FLSA 4XTSA 1J0FA 3L78A 4JR4A 2OBIA 1E2YA 4FQUA 5HQPA 1GUHA 5GSTA 1XCCA 4WKWA 1Z7RA 3DEXA 4KSMA 2RUEA 2FD3A 2WB9A 4WR4A 1ERWA 3M1GA 5EL8A 1A2MA 4KCEA 1TP9A 2B5YA 2DBCA 5L71A 4ML1A 3AY8A 2VLUA 3TKSE 2DIYA 2CVDA 5B8AA 3C73A 2HSNB 4K7IA 3IK7A 4XCSA 1JLWA 1O81A 3ZL5A 2LNSA 1KNGA 3DVWA 4D73B 2MMNA 3TOTA 4TVEA 4TR1B 3ZIJA 1SKRB 4FYBA 14GSA 2WFCA 4ECBA 2GGTA 1G6WA 5B8BA 2TIRA 1B48A 5D73A 5ECMB 2NVLA 1EOGA 2K6VA 3CXGA 3LORA 2HT9A 3A3TA 3M9KA 3US3A 2AAWA 3ZLPA 1ILOA 3D6IA 1A24A 3IBHA 4JBBA 2CAQA 3HZ4A 4CW9A 5E59A 2EFDA 4RI7A 5HR3A 5ABRA 4P3YB 1LJRA 3HXSA 2H74A 3C71A 1AQVA 1FOHA 2ALBA 4EO3A 4KSOA 3VI5A 3DKSA 5IPGA 3HVXA 3K8NA 4PUAA 4XS4B 2C80A 4V2NA 1FG4A 2YN1A 2YV7A 1X9MB 2FA4A 2VCTA 2B1KA 4NMUA 3HY2A 5FT3A 1S3CA 3KD0A 2GZZA 3L9VA 3LFLA 3L9UA 3ZIVA 3TB2A 3VWUA 3EURA 1QMVA 3DXBA 4OO5A 17GSA 4POBA 4ML6A 4ZB7A 3VURA 2H70A 2XPDA 4A5PA 4TR4A 1Y1UA 9GSSA 1SENA 5J47A 3FZ9A 3L9SA 5D9TA 2A4VA 5JCUA 4O5RA 3LQ7A 1F2EA 5HFIA 2RM5A 2HI7A 4OFMA 2VL2A 5AISA 5ECOB 2AHEA 4FH8A 3GV1A 1DBYA 3IC4A 4DVCA 2GSRA 3GSSA 3FMWA 5GAND 3WGDA 3WT2A 1WWJA 1SJZA 2R0GA 1IYHA 1X9SB 4HQSA 3J7Yb 1XWCA 3W8SA 2IIYA 1Q4JA 2NTOA 1V58A 1GP1A 5IM9A 5IPHA 4MNNA 3F63A 3VFIA 3TUEA 3V1WA 1TK0B 3BOAA 4KF9A 3FRCA 1EV9A 1KBNA 3CYNA 1Z5YE 3DRNA 2CX4A 3FR9A 4L8EA 2VCZA 4MMMA 5KN0A 4CHSA 3GX8A 3UEMA 2VCVA 3ZTLA 5G1KA 3KZQA 2L5OA 3SBCA 2EFCA 4EVMA 4OO4A 3FZ4A 5DCHA 5JWOB 4TKYA 3HJMA 1VF1A 1WRYA 3FK8A 5A1NB 3MSZA 2R6KA 4KDXA 4G2EA 2M46A 3HZ8A 5LNKe 2J23A 2QSIA 2FHEA 2HSNA 3BJ5A 5CRHA 2LUSA 3PGTA 4E68A 4Z7XA 2PU9C 2CT6A 1GNWA 2PVQA 4D73A 1NHOA 1XW5A 3WD6A 4ZB6A 5IMVA 4GTUA 4PNGA 5H5QA 2VD0A 4MH2A 3ERGA 4PUFC 3FR3A 2C0GA 5ID2B 2HXKA 3RBTA 3M8NA 2EC4A 3M0FA 2VLVA 5J4VA 1OKTA 3F8UA 4BA7A 1X9WB 5F05A 3IAS2 2WULA 4HUAA 2WRTA 4NHZA 3QD9A 2N5AA 3ZFLA 4USSA 1Z6NA 4F0CA 2VO4A 3VK9A 3GKXA 4KW6A 5CAXA 3LWAA 2WDUA 1TOFA 2BMXA 5D93A 1SJIA 2WCIA 4O5UA 1UC7A 3BBYA 1BG5A 2DIZA 3EU3A 4Q5RA 4K1FA 3TKPA 1QXHA 3N9JA 1K0OA 3VPTA 1PN0A 3FEUA 2DJKA 4EDZA 3QOUA 1WE0A 1U87A 1YZXA 2YWNA 1ZGNA 2LKUA 1BX9A 4LMVA 5F06A 2X4AA 2FCHA 3ZVJA 1JHBA 2LQOA 2CZ3A 1K0NA 5EY6A 1ERTA 2DJ1A 4ECIA 1T4YA 3F3QA 2ON7A 3KH7A 3R2QA 4GWRA 4V2MA 1XW6A 4HEA2 2GVPA 4Z2RA 1B9XC 5J5NA 2RIIA 5A4UA 3FHKA 2VL9A 2TRXA 3U6VA 2M80A 3KMNA 2B7KA 3HCZA 2VCWA 4KNDA 2FY6A 1AXDA 5CO3A 2EFHA 4GSSA 4TXOB 1R4WA 1XWKA 5IOWA 4CDOA 2R3XA 5DJMA 3NOFA 2GZPA 3N5OA 3LJRA 2FUG2 3UBLA 1OC3A 1YY7A 3GFKA 4ACSA 3EC3A 5ELAA 2B5EA 1XVWA 4N3ZA 2H0HA 1GWCA 3E0UA 1EV4A 5A34A 2H72A 2R0CA 3FYGA 3O6TA 4XRDA 2GZYA 4HQZA 1B9YC 2TRCP 1PD21 5HR0A 7GSSA 1K0DA 1TRUA 1TU7A 2ZNMA 3GHAA 3UAPA 3A5IA 1ZYNA 2B6MA 4MZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KN3 A;  1AAZ A;  2ES7 A;  4ZBA A;  5ECR B;  4ZBB A;  3CTG A;  2QGV A;  5ECL B;  5AIX A;  2VIM A;  2JZR A;  2K18 A;  4MLY A;  3D5J A;  1YEP A;  3DVX A;  3FR6 A;  4F82 A;  3IPZ A;  1JZD A;  2N5B A;  1FHE A;  3I6A A;  5DAK B;  5C04 A;  1VF3 A;  4KDY A;  2H71 A;  2IWT A;  2P5R A;  3GYK A;  2XHF A;  1K3Y A;  3Q6O A;  1X5E A;  4XHM A;  1VGL A;  5IO0 A;  3TKS C;  2HSM B;  1JFU A;  2H1B A;  4L0U A;  2QC7 A;  3DIE A;  1XWG A;  5D9X A;  5ID2 A;  2L6D A;  1T4Z A;  1ZCP A;  2CVK A;  2C3T A;  1BED A;  1ST9 A;  5J9C A;  2WZ9 A;  1SL2 B;  2HQT A;  4ZB9 A;  4HI7 A;  1B4P A;  4GQF A;  2VL3 A;  4LL1 B;  1O8X A;  1GLP A;  3CRT A;  1V2A A;  3EIN A;  4HU7 A;  2VCQ A;  3G7J A;  3E9J B;  1RK4 A;  2LJA A;  2GSQ A;  4LLR A;  5BMU A;  4PNF A;  1W89 A;  5DCG A;  1PX6 A;  4TXV A;  5G5E A;  1G7E A;  1BAY A;  5GAP D;  5DAL B;  2H1D A;  3GTU A;  3F9U A;  4BL7 B;  1MEK A;  1Q98 A;  3EE2 A;  4O32 A;  1TK8 B;  3HA9 A;  4MJA A;  3L4N A;  1C72 A;  5HR2 A;  4F9Z A;  4LA1 A;  1A23 A;  2IFQ B;  3HYP A;  3RPN A;  2HRK A;  1SL0 B;  3W8J A;  5ELG A;  5EPF A;  1DSB A;  8GSS A;  3IC8 A;  1QQ2 A;  3HJO A;  1GSQ A;  2X8C A;  3D0Z A;  1V40 A;  2KLX A;  3P8W A;  4BVX B;  1Z9H A;  1WJK A;  5HFG A;  3GST A;  5FWG A;  4PTS A;  1V9W A;  2G0F A;  4N0V A;  3EU4 A;  5J41 A;  4O7H A;  2HZE A;  2VD1 A;  1X0R A;  2LV3 A;  3D22 A;  4IKH A;  2O8V B;  3D21 A;  2KP2 A;  1ZMA A;  1GTA A;  4K7O A;  3QAV A;  2PUK C;  1B4Q A;  3UJ1 A;  4FO5 A;  2KHP A;  4MJB A;  3VWW A;  3F0I A;  3UIW A;  2JSY A;  1EEM A;  3ZVJ D;  4ISD A;  2E2G A;  1TU8 A;  3F4T A;  4IP1 A;  4HDE A;  1O7U A;  4BVY A;  5JWQ B;  4KE3 A;  3LSZ A;  2A2R A;  3EYT A;  4WBR D;  3DGQ A;  3UVH A;  1OC8 A;  2HSY A;  3QR6 A;  4WF4 A;  2MZC A;  2YV9 A;  1M2D A;  3A2W A;  5GZZ B;  1HNA A;  4YH2 A;  3P7X A;  1WIK A;  4H86 A;  5IIZ A;  3F3R A;  5ECK B;  3TJB A;  4JE1 A;  4MF7 A;  3TOU A;  2YZU A;  3UVT A;  2H1A A;  3EWL A;  3FZ5 A;  5FHI A;  1FOV A;  1WPI A;  3H4K A;  1M2A A;  1GUL A;  3KMO A;  3F6D A;  4K0N A;  2PN8 A;  3BCI A;  1PMT A;  3QAW A;  4MA9 A;  5JCG A;  2VL2 C;  3IR4 A;  2K8S A;  1HQO A;  2HNL A;  3FW2 A;  1FAA A;  4ZBD A;  2F9S A;  2GDR A;  2DJ3 A;  1U88 A;  1XZO A;  2EIR A;  2YAN A;  1EOH A;  1CQH A;  3TDG A;  4ZIL A;  18GS A;  5GSS A;  3GRX A;  5ECN B;  1WMJ A;  3A2X A;  2C0D A;  1JZO A;  5LD0 A;  1K0C A;  2ON5 A;  4POL A;  3GH6 A;  1GSD A;  2P31 A;  4MP4 A;  5KN1 A;  1SL1 B;  4WR5 A;  2L5L A;  2QKE A;  1QK8 A;  1FO5 A;  2JAD A;  4PQI A;  1ZYE A;  1WP0 A;  1A2J A;  4WXT A;  1NM3 A;  1URM A;  2VLT A;  1SYX A;  2HZF A;  3LEF A;  2L59 A;  1GSY A;  3WT1 A;  3ME7 A;  3IE3 A;  2YCD A;  3IOS A;  2I9H A;  4L0W A;  1AUC A;  3GA4 A;  2H76 A;  4BL7 A;  1ZL9 A;  2KP1 A;  3KIJ A;  3CRU A;  4IBP A;  4ZL8 A;  2C3N A;  2K8V A;  2YNX A;  4ZB8 A;  2LEG A;  1BYE A;  3MWH A;  2R2J A;  1PSQ A;  1GUM A;  3WYW A;  4PQH A;  1I9D A;  4GSN A;  2CQ9 A;  19GS A;  1U3A A;  3BD2 A;  3HDC A;  4OWY A;  1OC9 B;  5KEJ A;  1DE1 A;  1K0M A;  3HVV A;  4PXO A;  2MMZ A;  2HLS A;  4V2L A;  3KM6 A;  3IHQ A;  5G31 A;  1J08 A;  2F8A A;  1YEX A;  3EVI A;  1E6B A;  3LXT A;  4IQ1 A;  1T3B A;  2I81 A;  2X8G A;  1HD2 A;  2X99 A;  5CRD A;  2H75 A;  2A2S A;  3TCO A;  5B7C A;  3GIX A;  4WEY A;  2PER A;  4TW5 A;  4HZ4 A;  2MYG A;  4XIH A;  1V98 A;  3QPM A;  5CNW A;  4O92 A;  4TR1 A;  5A5K A;  4N0Z A;  3ZML A;  4MPF A;  2NBS A;  3W6G A;  4I97 A;  3ZRD A;  11GS A;  5IQY A;  1GUK A;  1EP8 A;  2YOI A;  3ZMK A;  1CQG A;  2JSZ A;  2C0F A;  1N8J A;  1TTZ A;  2HRA A;  5DVB A;  1SD9 A;  3TRP A;  4MK3 A;  3P90 A;  1Z6M A;  5IMF A;  1JLV A;  3ED3 A;  1PGT A;  2FWE A;  2GT6 A;  4X43 A;  5G1L A;  3GN3 A;  3ISO A;  1A8Y A;  3UMA A;  2MMA A;  1TRW A;  5DQY A;  4YAV A;  1TJD A;  4MJE A;  3DML A;  1J9B A;  2H19 A;  2C3Q A;  3VWV A;  2C1Y A;  1EWX A;  3HJP A;  2YP6 A;  4XRA A;  4XS4 A;  1TXX A;  4EXJ A;  2YZH A;  2LRT A;  2DJ2 A;  4K7N A;  3BCK A;  2BJX A;  1YQ1 A;  4GF0 A;  1H75 A;  1GTI A;  2H6Y A;  2H6X A;  1F6M C;  3KH9 A;  1TDI A;  3GMF A;  3CBU A;  4DSS B;  2E7P A;  2IME A;  1YF0 A;  1EGR A;  3G7Y A;  2LRN A;  1VF4 A;  5HR1 A;  2JZS A;  5D9W A;  2LRC A;  5F0G A;  3O76 A;  1MDI A;  2WJU A;  3IDV A;  1B8X A;  1SU9 A;  3APS A;  4QL7 A;  1XW9 A;  6GST A;  2YJ7 A;  4ULX A;  1PL2 A;  1SD8 A;  4KX4 A;  4Q5N A;  3KTB A;  2X64 A;  2N5F A;  4NV5 A;  2LST A;  4MF5 A;  4K8M A;  2CVB A;  1TI1 A;  3G9B A;  1SK2 A;  3VLN A;  4IGJ A;  2F8F A;  3CTF A;  4GXZ A;  3ZZX A;  1PQN A;  4NHW A;  1ON4 A;  4L5O A;  3CSH A;  4MZC A;  4EUY A;  1QUW A;  5C00 A;  3TJG A;  2GSS A;  4DEJ A;  2X8H A;  5CYY A;  1OVN A;  2H30 A;  3E3E A;  1R7H A;  1OE8 A;  5J3R A;  2CV4 A;  3KCM A;  1MDK A;  3FZA A;  4MCU A;  1V57 A;  2WS2 A;  2H0I A;  2PVO C;  2FA8 A;  1F9M A;  1G7O A;  5LCZ A;  1ACV A;  1YDK A;  4F2I A;  5ECP B;  2CZ2 A;  1F37 A;  2JAC A;  3EMP A;  2OE3 A;  2IMI A;  3SWL A;  4J2F A;  1PA3 A;  1AQW A;  1S3A A;  3LG6 A;  1GSF A;  3L0H A;  1TW9 A;  5F07 A;  3KP9 A;  1GTU A;  4XS6 A;  4G19 A;  2AJQ B;  3R3E A;  1DE2 A;  5DJL A;  2DML A;  2PWJ A;  1QFN A;  1FVK A;  4IP6 A;  4MH3 A;  3QFA C;  4G0I A;  5J4U A;  1LBK A;  6GSS A;  5H5R A;  2OAD A;  1XIY A;  3VI7 A;  3CSJ A;  5A4V A;  4N10 A;  3UL3 A;  5DDL A;  3IXR A;  2EIQ A;  2O89 A;  2V1M A;  1XOA A;  3RHB A;  3DYR A;  4JZQ A;  1X5D A;  3C7M A;  3TRX A;  2G2Q A;  3QCP A;  4EF0 A;  3TJJ A;  2FNO A;  2VAF A;  2HRN A;  1ZZY A;  3C1S A;  3O3T A;  1XPV A;  3FY7 A;  4BPY A;  4NAX A;  5ECS A;  4AGS A;  4GLT A;  3TKS A;  5ECI B;  2ZUP A;  4OCF A;  1F3A A;  4EL1 A;  3APQ A;  4TOP A;  4HS1 A;  3M9J A;  2AB6 A;  4MJC A;  1NSW A;  4KDU A;  4RUV A;  5COH A;  2FWF A;  4F03 A;  3GL5 A;  2HE3 A;  5IMC A;  2B3S A;  5D96 A;  4NWY A;  4DSS A;  5DBQ A;  2I1U A;  1U3I A;  2IL3 A;  3GNJ A;  4JED A;  2HRF A;  1FB0 A;  2V32 A;  4ILF A;  2MBT A;  2Z9S A;  1XXU A;  4AF2 A;  1O73 A;  1U6T A;  4G9H A;  4HJM A;  1H4O A;  2RM6 A;  4AJ8 A;  3ERW A;  1YJ6 A;  2HYX A;  5D9V A;  4XS1 A;  4BWQ A;  5CP1 A;  1RW1 A;  1GTB A;  4GRF A;  3KGK A;  1XWA A;  3UBK A;  1K0B A;  3UOM A;  4J57 E;  3F4S A;  4TXO A;  4KB3 A;  4WBJ A;  1KTE A;  1XWB A;  4ZL7 A;  3GKN A;  2C4J A;  1R5A A;  3LXZ A;  3GUR A;  1GL8 A;  3WGX A;  2F3M A;  4E8H A;  4GQC A;  4G0L A;  5AIV A;  4KGI A;  1O6J A;  2GQK A;  2F51 A;  2I4A A;  1FB6 A;  2B1L A;  2OAC A;  2L4C A;  4JU5 A;  4ID0 A;  2K9F A;  2EIO A;  4OD7 A;  4MF6 A;  5EVO A;  1X5C A;  1PN9 A;  2FWH A;  4IHU A;  2GST A;  5D8I A;  1O85 A;  1VF2 A;  2LNT A;  3D4M A;  1VRS D;  1BQ7 A;  3HD5 A;  3IV4 A;  4FYU A;  4POK A;  4TN8 A;  1Z3E A;  2GT5 A;  2DJJ A;  2OA7 A;  3QFB C;  3IRA A;  3ME8 A;  2CX3 A;  1GSE A;  12GS A;  3QDN A;  4RQR A;  3FKF A;  3KJY A;  3TRQ A;  5ENU A;  4IW9 A;  1NHY A;  4HZ2 A;  6GSX A;  5IMA A;  1TKD B;  1M9B A;  2UZ8 A;  3MNG A;  3KEB A;  4F0B A;  3A2V A;  3GL3 A;  1THX A;  3ZFB A;  5DAK A;  2KOK A;  2GQL A;  2REM A;  3DD3 A;  1ERU A;  2DJ0 A;  1O8W A;  4HU9 A;  1GH2 A;  2VM2 A;  1OAZ A;  4KA0 A;  2OE1 A;  2HSM A;  4N11 A;  3IK9 A;  2OJL A;  2OBK A;  2IMK A;  4TR3 A;  3CSI A;  1S3D A;  5ECH B;  4GCI A;  2R37 A;  3WGE A;  4EE0 A;  1OKD A;  20GS A;  1FVJ A;  1XVQ A;  1HYU A;  2LJR A;  1HNC A;  1AQX A;  3ZRE A;  4LMW A;  1NW2 A;  2C8U A;  2R5G A;  1XFL A;  3HVS A;  1JZW A;  1K3L A;  4E8E A;  2LQQ A;  4I2T A;  5DAL A;  3JCM L;  5ECQ B;  2O87 A;  3J7Y k;  2GLR A;  1Z7P A;  2YWM A;  5JWR B;  4TRX A;  1GLQ A;  4QQ7 A;  4IN0 A;  2LTK A;  2LJK A;  2VUP A;  3H93 A;  3C8E A;  2C0E A;  2PBJ A;  1DUG A;  4IEL A;  4TR0 A;  6GSW A;  2IFQ A;  4AJ6 A;  3F6F A;  3Q18 A;  4Q5Q A;  1A0F A;  2L6C A;  4JRR A;  4RQX A;  3MAK A;  3TGZ A;  3OR5 A;  5INY A;  1JZR A;  6GSY A;  4K6X A;  1KEB A;  4X0X A;  6GSU A;  4N30 A;  4FIW A;  3MDK A;  4BVX A;  2V6K A;  2D2Z A;  5IMZ A;  1XBS A;  1QGV A;  4POM A;  3PPU A;  5CRE A;  4IQA A;  1G6Y A;  3G7I A;  2IMD A;  3I69 A;  1MDJ A;  1AW9 A;  16GS A;  1YKC A;  3QAG A;  3QMX A;  2B5X A;  4PX1 A;  2YJH A;  1EEJ A;  2AYT A;  2VOC A;  10GS A;  4MDC A;  4KCA A;  1N2A A;  4K9Z A;  1USB A;  3P2A A;  1K0A A;  1OYJ A;  4YQM A;  1EZK A;  3D4T A;  4PGT A;  4K0G A;  3HHV A;  5CRW A;  2DC5 A;  4YAP A;  2VCX A;  2BTO T;  3PIN A;  4I6X A;  1GSU A;  1BJX A;  2H01 A;  3H79 A;  5IO2 A;  4PUR A;  1PRX A;  1PL1 A;  2GTU A;  1M2B A;  1PX7 A;  1TRV A;  2O85 A;  1A2L A;  2XC2 A;  3C1R A;  2V2G A;  2L57 A;  1SKW B;  2L4Q A;  5H5S A;  4QL9 A;  1K3O A;  1RQM A;  4YQU A;  1SJ6 A;  1PKW A;  4IJ3 A;  3GX0 A;  5DQS A;  2DMM A;  1M9A A;  1SK1 A;  3TJK A;  4NV2 A;  4YQV A;  1UA5 A;  3GTU B;  3IAM 2;  1ZYQ B;  3KXO A;  1I5G A;  5G2Z A;  2VM1 A;  4V1A p;  1WOU A;  1ZOF A;  2DLX A;  1W4V A;  5G5F A;  2YWI A;  1MTC A;  2ZCT A;  2CAI A;  4OFN A;  1R5P A;  3H1N A;  3I43 A;  3LGC A;  3TKQ A;  4MPG A;  2HRK B;  2OE0 A;  4BWS A;  1UN2 A;  1G0T A;  4L5L A;  1OE7 A;  2CA8 A;  5G30 A;  4OMV A;  3KTL A;  3S9F A;  1A8L A;  5F8B A;  4WF5 A;  1M0U A;  3Q19 A;  4G0K A;  2WGR A;  3PR8 A;  4FYC A;  1T7P B;  5B6N A;  4DSQ A;  1MD3 A;  2HZE B;  2IMF A;  3U5R E;  1SKS B;  2AV4 A;  2JL4 A;  3RHC A;  2RLI A;  1FW1 A;  1TRS A;  4GST A;  2JZT A;  4NXI A;  3Q74 A;  3NIV A;  2M72 A;  3VPQ A;  3DWV A;  1TI3 A;  1ABA A;  4ECC A;  4EDY A;  1XOB A;  2H0G A;  2IPA A;  3M3M A;  4JR6 A;  2XBQ A;  4HJ2 A;  3TKR A;  1YKA A;  5J9B A;  4BVY B;  2HFD A;  3ZYW A;  6GSV A;  4OFT A;  3NZN A;  4DSR A;  2H1G A;  1AIU A;  1OC9 A;  2JU5 A;  3IA1 A;  2IJY A;  2PPT A;  3PH9 A;  3LYP A;  1UVZ A;  3HKR A;  4ECJ A;  1TK5 B;  1LU4 A;  2NDO A;  4AJ7 A;  4MAB A;  4NPB A;  4ZXG A;  2H6Z A;  3EMX A;  4PQ1 A;  5CRG A;  2HSH A;  4KUN A;  2P0G A;  2LS5 A;  3ZIT A;  1GRX A;  2PMT A;  3RDW A;  4I5Q A;  4K2D A;  3UAR A;  2RUF A;  2J9H A;  5IMD A;  2H8L A;  1ML6 A;  5AN1 A;  3GH9 A;  4ZIJ A;  4G10 A;  2E0Q A;  3RAZ A;  2P5Q A;  2PGT A;  1T8E B;  3GUS A;  4EKZ A;  2H73 A;  4KAE A;  2DSA A;  3ERF A;  4KH7 A;  4X1U A;  5E4W A;  4I8B A;  2MMO A;  3GKM A;  2MBS A;  2E2M A;  3GKK A;  3LYK A;  3H8Q A;  3VWX A;  5HFK A;  1YF1 A;  2NPB A;  1T00 A;  5AGY A;  2V41 A;  2B7J A;  4I2U A;  4ZL9 A;  3RPP A;  5JCW A;  2GQM A;  4RI6 A;  2KUC A;  3I9V 2;  2AUV A;  1Y25 A;  1MD4 A;  1Y6E A;  2FWG A;  1PKZ A;  1SK0 A;  1ERV A;  1A0R P;  4IJI A;  2V6O A;  4Q5F A;  1EP7 A;  1THO A;  1SYR A;  2O7K A;  1GSS A;  2H66 A;  2R4V A;  5B6M A;  1F3B A;  5KN2 A;  2XPE A;  1AC1 A;  4OCE A;  3TJF A;  4J56 E;  22GS A;  4EC0 A;  5A4W A;  4WET A;  3CMI A;  2IN3 A;  4MZB A;  3APO A;  2I3Y A;  4V1A g;  1GNE A;  2FGX A;  1HNB A;  4IS0 A;  2OKA A;  3A5W A;  1IYI A;  1M99 A;  2GS3 A;  1T1V A;  13GS A;  5IOX A;  2YPM A;  1R26 A;  1M7T A;  2XBI A;  4IVF A;  4LL4 B;  4HOJ A;  3KP8 A;  3F4R A;  2YWO A;  1EGO A;  2FLS A;  4XTS A;  1J0F A;  3L78 A;  4JR4 A;  2OBI A;  1E2Y A;  4FQU A;  5HQP A;  1GUH A;  5GST A;  1XCC A;  4WKW A;  1Z7R A;  3DEX A;  4KSM A;  2RUE A;  2FD3 A;  2WB9 A;  4WR4 A;  1ERW A;  3M1G A;  5EL8 A;  1A2M A;  4KCE A;  1TP9 A;  2B5Y A;  2DBC A;  5L71 A;  4ML1 A;  3AY8 A;  2VLU A;  3TKS E;  2DIY A;  2CVD A;  5B8A A;  3C73 A;  2HSN B;  4K7I A;  3IK7 A;  4XCS A;  1JLW A;  1O81 A;  3ZL5 A;  2LNS A;  1KNG A;  3DVW A;  4D73 B;  2MMN A;  3TOT A;  4TVE A;  4TR1 B;  3ZIJ A;  1SKR B;  4FYB A;  14GS A;  2WFC A;  4ECB A;  2GGT A;  1G6W A;  5B8B A;  2TIR A;  1B48 A;  5D73 A;  5ECM B;  2NVL A;  1EOG A;  2K6V A;  3CXG A;  3LOR A;  2HT9 A;  3A3T A;  3M9K A;  3US3 A;  2AAW A;  3ZLP A;  1ILO A;  3D6I A;  1A24 A;  3IBH A;  4JBB A;  2CAQ A;  3HZ4 A;  4CW9 A;  5E59 A;  4RI7 A;  5HR3 A;  5ABR A;  4P3Y B;  1LJR A;  3HXS A;  2H74 A;  3C71 A;  1AQV A;  2ALB A;  4EO3 A;  4KSO A;  3VI5 A;  3DKS A;  5IPG A;  3HVX A;  3K8N A;  4PUA A;  4XS4 B;  2C80 A;  4V2N A;  1FG4 A;  2YN1 A;  2YV7 A;  1X9M B;  2FA4 A;  2VCT A;  2B1K A;  4NMU A;  3HY2 A;  5FT3 A;  1S3C A;  3KD0 A;  2GZZ A;  3L9V A;  3LFL A;  3L9U A;  3ZIV A;  3TB2 A;  3VWU A;  3EUR A;  1QMV A;  3DXB A;  4OO5 A;  17GS A;  4POB A;  4ML6 A;  3VUR A;  2H70 A;  2XPD A;  4TR4 A;  9GSS A;  1SEN A;  3FZ9 A;  3L9S A;  5D9T A;  2A4V A;  5JCU A;  4O5R A;  3LQ7 A;  1F2E A;  5HFI A;  2RM5 A;  2HI7 A;  4OFM A;  2VL2 A;  5AIS A;  5ECO B;  2AHE A;  4FH8 A;  3GV1 A;  1DBY A;  3IC4 A;  4DVC A;  2GSR A;  3GSS A;  5GAN D;  3WGD A;  3WT2 A;  1WWJ A;  1SJZ A;  1IYH A;  1X9S B;  4HQS A;  3J7Y b;  1XWC A;  3W8S A;  1Q4J A;  2NTO A;  2IIY A;  1V58 A;  1GP1 A;  5IM9 A;  5IPH A;  3F63 A;  3VFI A;  3TUE A;  3V1W A;  1TK0 B;  3BOA A;  4KF9 A;  3FRC A;  1EV9 A;  1KBN A;  3CYN A;  1Z5Y E;  3DRN A;  2CX4 A;  3FR9 A;  4L8E A;  2VCZ A;  4MMM A;  5KN0 A;  4CHS A;  3GX8 A;  3UEM A;  2VCV A;  3ZTL A;  5G1K A;  3KZQ A;  2L5O A;  3SBC A;  4EVM A;  4OO4 A;  3FZ4 A;  5DCH A;  5JWO B;  4TKY A;  3HJM A;  1VF1 A;  1WRY A;  3FK8 A;  3MSZ A;  2R6K A;  4KDX A;  4G2E A;  2M46 A;  3HZ8 A;  5LNK e;  2J23 A;  2QSI A;  2FHE A;  3BJ5 A;  5CRH A;  2LUS A;  3PGT A;  4Z7X A;  2PU9 C;  2CT6 A;  1GNW A;  2PVQ A;  4D73 A;  1NHO A;  1XW5 A;  3WD6 A;  4ZB6 A;  5IMV A;  4GTU A;  4PNG A;  5H5Q A;  2VD0 A;  4MH2 A;  3ERG A;  4PUF C;  3FR3 A;  2C0G A;  5ID2 B;  2HXK A;  3RBT A;  3M8N A;  2EC4 A;  3M0F A;  2VLV A;  3F8U A;  1OKT A;  4BA7 A;  1X9W B;  5F05 A;  3IAS 2;  2WUL A;  4HUA A;  2WRT A;  4NHZ A;  3QD9 A;  2N5A A;  3ZFL A;  4USS A;  1Z6N A;  4F0C A;  2VO4 A;  3VK9 A;  3GKX A;  4KW6 A;  5CAX A;  3LWA A;  2WDU A;  1TOF A;  2BMX A;  5D93 A;  1SJI A;  2WCI A;  1UC7 A;  3BBY A;  1BG5 A;  2DIZ A;  3EU3 A;  4Q5R A;  4K1F A;  3TKP A;  1QXH A;  3N9J A;  1K0O A;  3VPT A;  3FEU A;  2DJK A;  4EDZ A;  3QOU A;  1WE0 A;  1U87 A;  1YZX A;  2YWN A;  1ZGN A;  2LKU A;  1BX9 A;  4LMV A;  5F06 A;  2FCH A;  3ZVJ A;  1JHB A;  2LQO A;  2CZ3 A;  1K0N A;  5EY6 A;  1ERT A;  2DJ1 A;  4ECI A;  1T4Y A;  3F3Q A;  2ON7 A;  3KH7 A;  3R2Q A;  4GWR A;  4V2M A;  1XW6 A;  4HEA 2;  2GVP A;  1B9X C;  5J5N A;  2RII A;  5A4U A;  3FHK A;  2VL9 A;  2TRX A;  3U6V A;  2M80 A;  3KMN A;  2B7K A;  3HCZ A;  2VCW A;  4KND A;  2FY6 A;  1AXD A;  5CO3 A;  4GSS A;  4TXO B;  1R4W A;  1XWK A;  5IOW A;  4CDO A;  2R3X A;  5DJM A;  3NOF A;  2GZP A;  3N5O A;  3LJR A;  2FUG 2;  3UBL A;  1OC3 A;  1YY7 A;  3GFK A;  4ACS A;  3EC3 A;  5ELA A;  2B5E A;  1XVW A;  2H0H A;  1GWC A;  3E0U A;  1EV4 A;  2H72 A;  3FYG A;  3O6T A;  4XRD A;  2GZY A;  4HQZ A;  1B9Y C;  2TRC P;  1PD2 1;  5HR0 A;  7GSS A;  1K0D A;  1TRU A;  1TU7 A;  2ZNM A;  3GHA A;  3UAP A;  2B6M A;  4MZW A; 
#chains in the Genus database with same CATH topology
 5KN3 A;  1AAZ A;  2ES7 A;  4ZBA A;  5ECR B;  4ZBB A;  3CTG A;  3HMJ G;  2QGV A;  5ECL B;  5AIX A;  3EPT A;  2VIM A;  2JZR A;  2K18 A;  4MLY A;  3D5J A;  1YEP A;  3DVX A;  3FR6 A;  4F82 A;  3IPZ A;  1JZD A;  2N5B A;  1FHE A;  3I6A A;  5DAK B;  1S3R A;  5C04 A;  1VF3 A;  4KDY A;  2H71 A;  2IWT A;  2P5R A;  3GYK A;  2XHF A;  1K3Y A;  3Q6O A;  1X5E A;  4XHM A;  1VGL A;  5IO0 A;  3TKS C;  2HSM B;  1JFU A;  2H1B A;  4L0U A;  2QC7 A;  3DIE A;  1XWG A;  5D9X A;  5ID2 A;  2L6D A;  1T4Z A;  1ZCP A;  2CVK A;  2C3T A;  1BED A;  1ST9 A;  5J9C A;  2WZ9 A;  1SL2 B;  2HQT A;  4ZB9 A;  4HI7 A;  1B4P A;  4GQF A;  2VL3 A;  4LL1 B;  1O8X A;  1GLP A;  3CRT A;  1V2A A;  3EIN A;  4HU7 A;  4ICY A;  2VCQ A;  3G7J A;  3E9J B;  1RK4 A;  2LJA A;  2GSQ A;  4LLR A;  5BMU A;  4PNF A;  1W89 A;  5DCG A;  1PX6 A;  4TXV A;  5G5E A;  1G7E A;  1BAY A;  5GAP D;  5DAL B;  2H1D A;  3GTU A;  3F9U A;  4BL7 B;  1MEK A;  1Q98 A;  3EE2 A;  4CY8 A;  4O32 A;  1TK8 B;  3HA9 A;  4MJA A;  3L4N A;  1C72 A;  5HR2 A;  4F9Z A;  4LA1 A;  4GDF A;  1A23 A;  2IFQ B;  3HYP A;  3RPN A;  2HRK A;  1SL0 B;  3W8J A;  5ELG A;  5EPF A;  1DSB A;  8GSS A;  3IC8 A;  4AKG A;  1QQ2 A;  3HJO A;  1GSQ A;  2X8C A;  3D0Z A;  1V40 A;  2KLX A;  3P8W A;  4BVX B;  1Z9H A;  1WJK A;  5HFG A;  3GST A;  5FWG A;  4PTS A;  1V9W A;  2G0F A;  4N0V A;  3EU4 A;  5J41 A;  4O7H A;  2HZE A;  2VD1 A;  1X0R A;  2LV3 A;  3D22 A;  4IKH A;  2O8V B;  3D21 A;  2KP2 A;  1ZMA A;  3RFR C;  1GTA A;  4K7O A;  3QAV A;  2PUK C;  1B4Q A;  3UJ1 A;  4FO5 A;  2WW0 A;  2KHP A;  4MJB A;  4AI6 A;  3VWW A;  3F0I A;  3UIW A;  2JSY A;  1EEM A;  3RGB C;  3ZVJ D;  4ISD A;  2E2G A;  4AKI A;  1TU8 A;  3F4T A;  4IP1 A;  4HDE A;  1O7U A;  4BVY A;  5JWQ B;  4KE3 A;  3LSZ A;  2A2R A;  3EYT A;  4WBR D;  3DGQ A;  3UVH A;  1OC8 A;  1BF5 A;  2HSY A;  3QR6 A;  4WF4 A;  2MZC A;  2YV9 A;  1M2D A;  3A2W A;  5GZZ B;  1HNA A;  4YH2 A;  3P7X A;  1WIK A;  4H86 A;  5IIZ A;  3F3R A;  5ECK B;  3TJB A;  4JE1 A;  4MF7 A;  3TOU A;  2YZU A;  3UVT A;  2H1A A;  1I1I P;  3EWL A;  3FZ5 A;  5FHI A;  1FOV A;  1WPI A;  3H4K A;  1M2A A;  1GUL A;  3KMO A;  5BRT A;  3F6D A;  4K0N A;  2PN8 A;  3BCI A;  1PMT A;  3QAW A;  4MA9 A;  5JCG A;  2VL2 C;  3IR4 A;  2K8S A;  1HQO A;  2HNL A;  3FW2 A;  1FAA A;  4ZBD A;  2F9S A;  2GDR A;  2DJ3 A;  1U88 A;  1XZO A;  2EIR A;  2YAN A;  1EOH A;  1CQH A;  3TDG A;  4ZIL A;  18GS A;  5GSS A;  3GRX A;  5ECN B;  1WMJ A;  3A2X A;  2C0D A;  1JZO A;  5LD0 A;  1K0C A;  2ON5 A;  4POL A;  3GH6 A;  1GSD A;  1SVO A;  2P31 A;  4MP4 A;  5KN1 A;  1SL1 B;  4WR5 A;  2L5L A;  2QKE A;  1QK8 A;  1FO5 A;  4PI0 C;  2JAD A;  4PQI A;  1ZYE A;  1WP0 A;  1A2J A;  4WXT A;  1NM3 A;  1URM A;  2VLT A;  1SYX A;  2HZF A;  3LEF A;  2L59 A;  1GSY A;  3WT1 A;  3ME7 A;  3IE3 A;  2YCD A;  3IOS A;  2I9H A;  4L0W A;  1AUC A;  3GA4 A;  1ZYP A;  2H76 A;  4BL7 A;  1ZL9 A;  2KP1 A;  3KIJ A;  3CRU A;  4IBP A;  4ZL8 A;  3CWG A;  2C3N A;  2K8V A;  2YNX A;  4ZB8 A;  2LEG A;  1BYE A;  3MWH A;  2R2J A;  3CHX C;  1PSQ A;  4CY6 A;  2OT3 A;  1GUM A;  3WYW A;  4PQH A;  1I9D A;  4GSN A;  2CQ9 A;  4G01 A;  19GS A;  1U3A A;  3BD2 A;  3HDC A;  4OWY A;  1OC9 B;  5KEJ A;  1DE1 A;  1K0M A;  3HVV A;  4PXO A;  2MMZ A;  2HLS A;  4V2L A;  3KM6 A;  2QA1 A;  3IHQ A;  5G31 A;  1J08 A;  2F8A A;  1YEX A;  3EVI A;  1E6B A;  3LXT A;  4IQ1 A;  1T3B A;  2I81 A;  2X8G A;  1HD2 A;  2X99 A;  5CRD A;  2H75 A;  2A2S A;  1YEW C;  3TCO A;  5B7C A;  3GIX A;  4WEY A;  2PER A;  4TW5 A;  4HZ4 A;  2MYG A;  4XIH A;  1V98 A;  3QPM A;  5CNW A;  4O92 A;  4TR1 A;  5A5K A;  4N0Z A;  2QA2 A;  3ZML A;  4MPF A;  2NBS A;  3W6G A;  4I97 A;  3ZRD A;  11GS A;  5IQY A;  1GUK A;  1EP8 A;  2YOI A;  3ZMK A;  1CQG A;  2JSZ A;  2C0F A;  1N8J A;  1TTZ A;  2HRA A;  5DVB A;  1SD9 A;  3TRP A;  4MK3 A;  3P90 A;  1Z6M A;  5IMF A;  1JLV A;  3ED3 A;  1PGT A;  4Z2U A;  2FWE A;  2GT6 A;  4X43 A;  5G1L A;  3GN3 A;  3ISO A;  1A8Y A;  3UMA A;  2MMA A;  1TRW A;  5DQY A;  4YAV A;  2X49 A;  1TJD A;  4MJE A;  3DML A;  1XG8 A;  1J9B A;  2H19 A;  2C3Q A;  3VWV A;  5A5H B;  2C1Y A;  1EWX A;  3HJP A;  2YP6 A;  4XRA A;  4XS4 A;  1TXX A;  4EXJ A;  2YZH A;  2LRT A;  1TXU A;  2DJ2 A;  4K7N A;  3BCK A;  2BJX A;  4K2X A;  1YQ1 A;  4GF0 A;  1H75 A;  1GTI A;  2H6Y A;  2H6X A;  1F6M C;  3KH9 A;  1TDI A;  3GMF A;  3CBU A;  1SVL A;  4DSS B;  2E7P A;  2IME A;  1YF0 A;  3MYD A;  1EGR A;  3G7Y A;  2LRN A;  1VF4 A;  5HR1 A;  2JZS A;  5D9W A;  2LRC A;  5F0G A;  3O76 A;  1MDI A;  2WJU A;  3IDV A;  1B8X A;  1SU9 A;  3APS A;  4QL7 A;  1XW9 A;  6GST A;  2YJ7 A;  4ULX A;  4K5S A;  1PL2 A;  1SD8 A;  4KX4 A;  4Q5N A;  3KTB A;  2X64 A;  2N5F A;  4NV5 A;  2LST A;  4MF5 A;  4K8M A;  2CVB A;  4YKF A;  1TI1 A;  3G9B A;  1SK2 A;  3VLN A;  4IGJ A;  5J40 A;  2F8F A;  3CTF A;  4GXZ A;  3ZZX A;  1PQN A;  4NHW A;  1ON4 A;  4L5O A;  3CSH A;  4MZC A;  4EUY A;  1QUW A;  5C00 A;  3TJG A;  2GSS A;  4DEJ A;  2X8H A;  5CYY A;  1OVN A;  2WVX A;  2H30 A;  3E3E A;  1R7H A;  1OE8 A;  5J3R A;  2CV4 A;  3KCM A;  1MDK A;  3FZA A;  4MCU A;  1V57 A;  2WS2 A;  2H0I A;  2PVO C;  2FA8 A;  1F9M A;  1G7O A;  1SVM A;  5LCZ A;  1ACV A;  1YDK A;  4F2I A;  5ECP B;  2CZ2 A;  1F37 A;  2JAC A;  3EMP A;  4BIK A;  5A1N A;  2OE3 A;  2IMI A;  3SWL A;  4J2F A;  1PA3 A;  1AQW A;  1S3A A;  3LG6 A;  4K5R A;  1GSF A;  3L0H A;  1TW9 A;  4X4J A;  5F07 A;  3KP9 A;  1GTU A;  4XS6 A;  4G19 A;  2AJQ B;  3R3E A;  1DE2 A;  5DJL A;  2DML A;  2PWJ A;  1QFN A;  1FVK A;  4IP6 A;  3CQF A;  4MH3 A;  3QFA C;  4G0I A;  5J4U A;  1LBK A;  6GSS A;  5H5R A;  2OAD A;  1XIY A;  3VI7 A;  3CSJ A;  5A4V A;  4N10 A;  3UL3 A;  5DDL A;  4Z2T A;  3IXR A;  2EIQ A;  2O89 A;  2V1M A;  1XOA A;  3RHB A;  3DYR A;  4JZQ A;  1X5D A;  3C7M A;  3TRX A;  2G2Q A;  3QCP A;  4EF0 A;  3TJJ A;  2FNO A;  2VAF A;  2HRN A;  1ZZY A;  3C1S A;  3O3T A;  1XPV A;  3FY7 A;  4BPY A;  4NAX A;  5ECS A;  4AGS A;  4GLT A;  3TKS A;  5ECI B;  2ZUP A;  4OCF A;  2O5V A;  1F3A A;  4EL1 A;  3APQ A;  4TOP A;  4HS1 A;  3M9J A;  2AB6 A;  4MJC A;  1NSW A;  4KDU A;  4RUV A;  5COH A;  2FWF A;  4F03 A;  3GL5 A;  2HE3 A;  5IMC A;  2B3S A;  5D96 A;  4NWY A;  4DSS A;  5DBQ A;  2I1U A;  1U3I A;  2IL3 A;  3GNJ A;  3LW9 A;  4JED A;  2HRF A;  1M3J A;  1FB0 A;  2V32 A;  4ILF A;  2MBT A;  2Z9S A;  1XXU A;  4AF2 A;  1O73 A;  1U6T A;  4G9H A;  4HJM A;  1H4O A;  2RM6 A;  4AJ8 A;  3ERW A;  1YJ6 A;  2HYX A;  5D9V A;  4AKX B;  2EFE A;  4XS1 A;  4BWQ A;  5CP1 A;  1RW1 A;  1GTB A;  4GRF A;  3KGK A;  1XWA A;  3UBK A;  1K0B A;  3UOM A;  4J57 E;  3F4S A;  4TXO A;  4KB3 A;  4WBJ A;  1KTE A;  1XWB A;  4ZL7 A;  4PI2 C;  3GKN A;  2C4J A;  1R5A A;  3LXZ A;  3GUR A;  1GL8 A;  3WGX A;  2F3M A;  4E8H A;  4GQC A;  4G0L A;  5AIV A;  3MIX A;  4KGI A;  1O6J A;  2GQK A;  2F51 A;  2I4A A;  1FB6 A;  2B1L A;  2OAC A;  2L4C A;  4JU5 A;  4ID0 A;  2K9F A;  2EIO A;  4OD7 A;  1BG1 A;  4MF6 A;  5EVO A;  1X5C A;  1PN9 A;  2FWH A;  4IHU A;  2GST A;  5D8I A;  1O85 A;  1VF2 A;  2LNT A;  3D4M A;  1VRS D;  1BQ7 A;  3HD5 A;  3IV4 A;  4FYU A;  4POK A;  4TN8 A;  1Z3E A;  2GT5 A;  2DJJ A;  2DKI A;  2OA7 A;  3QFB C;  3IRA A;  3ME8 A;  2CX3 A;  1GSE A;  12GS A;  3QDN A;  4RQR A;  3FKF A;  3KJY A;  3TRQ A;  5ENU A;  4IW9 A;  1NHY A;  4HZ2 A;  6GSX A;  5IMA A;  1TKD B;  1M9B A;  2UZ8 A;  3KEB A;  3A2V A;  4F0B A;  3GL3 A;  3MNG A;  1THX A;  3ZFB A;  5DAK A;  2KOK A;  2GQL A;  2REM A;  3DD3 A;  1ERU A;  2DJ0 A;  1O8W A;  4HU9 A;  1GH2 A;  2VM2 A;  1OAZ A;  4KA0 A;  2OE1 A;  2HSM A;  4N11 A;  3IK9 A;  2OJL A;  2OBK A;  2IMK A;  4TR3 A;  3CSI A;  1S3D A;  5ECH B;  4GCI A;  2R37 A;  3WGE A;  4EE0 A;  1OKD A;  20GS A;  1FVJ A;  1XVQ A;  1HYU A;  2LJR A;  1HNC A;  2WW3 A;  1AQX A;  4W66 A;  3ZRE A;  4LMW A;  1NW2 A;  2C8U A;  2R5G A;  1XFL A;  3HVS A;  5KOX A;  1JZW A;  1K3L A;  4E8E A;  2LQQ A;  4I2T A;  5DAL A;  5J4Y A;  3JCM L;  5ECQ B;  1YVL A;  2O87 A;  3J7Y k;  2WW1 A;  2GLR A;  1Z7P A;  2YWM A;  5JWR B;  4TRX A;  1GLQ A;  4QQ7 A;  4IN0 A;  2LTK A;  2LJK A;  2VUP A;  3H93 A;  3C8E A;  2C0E A;  2PBJ A;  1DUG A;  4IEL A;  4TR0 A;  6GSW A;  2IFQ A;  4AJ6 A;  3F6F A;  3Q18 A;  4Q5Q A;  1A0F A;  2L6C A;  4JRR A;  4RQX A;  3MAK A;  3TGZ A;  3OR5 A;  5INY A;  4O5Q A;  4YKG A;  1JZR A;  5A34 B;  6GSY A;  4K6X A;  1KEB A;  4X0X A;  6GSU A;  4N30 A;  4FIW A;  3MDK A;  4BVX A;  2V6K A;  2D2Z A;  5IMZ A;  1XBS A;  1QGV A;  4POM A;  3PPU A;  5CRE A;  4IQA A;  1G6Y A;  3G7I A;  2IMD A;  3I69 A;  1MDJ A;  1AW9 A;  16GS A;  1YKC A;  3QAG A;  3QMX A;  2B5X A;  4PX1 A;  2YJH A;  1EEJ A;  2AYT A;  2VOC A;  10GS A;  4MDC A;  4KCA A;  1N2A A;  4K9Z A;  1USB A;  3P2A A;  1K0A A;  1OYJ A;  4YQM A;  1EZK A;  2R0P A;  3D4T A;  4PGT A;  4K0G A;  3HHV A;  5CRW A;  2DC5 A;  2WVY A;  4YAP A;  2VCX A;  2BTO T;  3PIN A;  4I6X A;  2H1L A;  1GSU A;  1BJX A;  2H01 A;  3H79 A;  5IO2 A;  4PUR A;  1PRX A;  1PL1 A;  4EIQ A;  2GTU A;  1M2B A;  1PX7 A;  3IHG A;  1TRV A;  2O85 A;  1A2L A;  2XC2 A;  3C1R A;  2V2G A;  2L57 A;  1SKW B;  2L4Q A;  5H5S A;  4QL9 A;  1K3O A;  1RQM A;  4YQU A;  1SJ6 A;  1PKW A;  4IJ3 A;  3GX0 A;  5DQS A;  5BMU B;  2DMM A;  1M9A A;  1SK1 A;  3TJK A;  4NV2 A;  4YQV A;  1UA5 A;  3GTU B;  3IAM 2;  1ZYQ B;  3KXO A;  1I5G A;  5G2Z A;  2VM1 A;  4V1A p;  1WOU A;  1ZOF A;  2DLX A;  1W4V A;  5G5F A;  2YWI A;  1MTC A;  2A4H A;  2ZCT A;  2CAI A;  4OFN A;  1R5P A;  3H1N A;  3I43 A;  3LGC A;  3TKQ A;  4MPG A;  2WW2 A;  2HRK B;  2OE0 A;  4BWS A;  1UN2 A;  4EIP A;  1G0T A;  4HSC X;  4L5L A;  1OE7 A;  2A2P A;  2CA8 A;  5G30 A;  4OMV A;  3KTL A;  3S9F A;  1A8L A;  5F8B A;  4WF5 A;  1M0U A;  3Q19 A;  4AKH A;  4G0K A;  2WGR A;  3PR8 A;  4FYC A;  1T7P B;  5B6N A;  2O3E A;  4DSQ A;  1MD3 A;  2HZE B;  2IMF A;  3U5R E;  1SKS B;  2AV4 A;  2JL4 A;  2DKH A;  3RHC A;  2RLI A;  1FW1 A;  1TRS A;  4GST A;  2JZT A;  4NXI A;  3Q74 A;  3NIV A;  2M72 A;  3VPQ A;  3DWV A;  1TI3 A;  1N25 A;  1ABA A;  1PFO A;  2O36 A;  4ECC A;  2UV8 G;  4EDY A;  1XOB A;  2H0G A;  2IPA A;  3M3M A;  4JR6 A;  2XBQ A;  4HJ2 A;  3TKR A;  1YKA A;  5J9B A;  4BVY B;  2HFD A;  3ZYW A;  6GSV A;  4OFT A;  3NZN A;  3TU3 B;  4DSR A;  2H1G A;  1S4B P;  1AIU A;  1OC9 A;  2JU5 A;  3IA1 A;  2IJY A;  2PPT A;  3PH9 A;  3LYP A;  1UVZ A;  3HKR A;  4ECJ A;  1TK5 B;  1LU4 A;  2NDO A;  4AJ7 A;  4MAB A;  4NPB A;  4ZXG A;  2H6Z A;  3EMX A;  4PQ1 A;  5CRG A;  2HSH A;  4KUN A;  2P0G A;  2LS5 A;  3ZIT A;  1GRX A;  4QMK A;  2PMT A;  3RDW A;  4I5Q A;  4K2D A;  3UAR A;  2RUF A;  2J9H A;  5IMD A;  2H8L A;  1ML6 A;  5AN1 A;  3GH9 A;  4ZIJ A;  4G10 A;  2E0Q A;  3RAZ A;  2P5Q A;  2PGT A;  1T8E B;  3GUS A;  4EKZ A;  2H73 A;  4KAE A;  2DSA A;  3ERF A;  4KH7 A;  4X1U A;  5E4W A;  4I8B A;  2VKZ G;  2MMO A;  3GKM A;  2MBS A;  2E2M A;  3GKK A;  3LYK A;  3H8Q A;  3VWX A;  5HFK A;  1YF1 A;  4FXY P;  2NPB A;  1T00 A;  5AGY A;  2V41 A;  2B7J A;  4I2U A;  4ZL9 A;  3RPP A;  5JCW A;  2GQM A;  4RI6 A;  2KUC A;  3I9V 2;  2AUV A;  1Y25 A;  1MD4 A;  1Y6E A;  2FWG A;  1PKZ A;  1SK0 A;  1ERV A;  1A0R P;  4IJI A;  2V6O A;  4Q5F A;  1EP7 A;  1THO A;  1SYR A;  2O7K A;  1GSS A;  2H66 A;  2R4V A;  5B6M A;  1F3B A;  5KN2 A;  2XPE A;  5A5H A;  1AC1 A;  4PHZ C;  4OCE A;  3TJF A;  4J56 E;  22GS A;  4EC0 A;  5A4W A;  4WET A;  3CMI A;  2IN3 A;  4MZB A;  3APO A;  2I3Y A;  4V1A g;  1GNE A;  2FGX A;  1HNB A;  4IS0 A;  2OKA A;  3A5W A;  1IYI A;  1M99 A;  2GS3 A;  1T1V A;  13GS A;  5IOX A;  2YPM A;  1R26 A;  1M7T A;  2XBI A;  4IVF A;  4LL4 B;  5KOW A;  4HOJ A;  3KP8 A;  3F4R A;  2YWO A;  1EGO A;  2FLS A;  4XTS A;  1J0F A;  3L78 A;  4JR4 A;  2WVZ A;  2OBI A;  1E2Y A;  4FQU A;  5HQP A;  1GUH A;  5GST A;  1XCC A;  4WKW A;  1Z7R A;  3DEX A;  4KSM A;  2RUE A;  2FD3 A;  2WB9 A;  4WR4 A;  1ERW A;  3M1G A;  5EL8 A;  1A2M A;  4KCE A;  1TP9 A;  2B5Y A;  2DBC A;  5L71 A;  4ML1 A;  3AY8 A;  2VLU A;  3TKS E;  2DIY A;  2CVD A;  5B8A A;  3C73 A;  2HSN B;  4K7I A;  3IK7 A;  4XCS A;  1JLW A;  1O81 A;  3ZL5 A;  2LNS A;  1KNG A;  3DVW A;  4D73 B;  2MMN A;  3TOT A;  4TVE A;  4TR1 B;  3ZIJ A;  1SKR B;  4FYB A;  14GS A;  2WFC A;  4ECB A;  2GGT A;  1G6W A;  5B8B A;  2TIR A;  1B48 A;  5D73 A;  5ECM B;  2NVL A;  1EOG A;  2K6V A;  3CXG A;  3LOR A;  2HT9 A;  3A3T A;  3M9K A;  3US3 A;  2AAW A;  3ZLP A;  1ILO A;  3D6I A;  1A24 A;  3IBH A;  4JBB A;  2CAQ A;  3HZ4 A;  4CW9 A;  5E59 A;  2EFD A;  4RI7 A;  5HR3 A;  5ABR A;  4P3Y B;  1LJR A;  3HXS A;  2H74 A;  3C71 A;  1AQV A;  1FOH A;  3HVN A;  2ALB A;  4EO3 A;  4KSO A;  3VI5 A;  3DKS A;  5IPG A;  3HVX A;  3K8N A;  4PUA A;  4XS4 B;  2C80 A;  4V2N A;  1FG4 A;  2YN1 A;  2YV7 A;  1X9M B;  2FA4 A;  2VCT A;  2B1K A;  4NMU A;  3HY2 A;  5FT3 A;  1S3C A;  3KD0 A;  2GZZ A;  3L9V A;  3LFL A;  3L9U A;  3ZIV A;  3TB2 A;  3VWU A;  3EUR A;  1QMV A;  3DXB A;  4OO5 A;  17GS A;  1M3I A;  4POB A;  4ML6 A;  4ZB7 A;  3VUR A;  2H70 A;  2XPD A;  4A5P A;  4TR4 A;  1Y1U A;  9GSS A;  1SEN A;  5J47 A;  3FZ9 A;  3L9S A;  5D9T A;  2A4V A;  5JCU A;  4O5R A;  3LQ7 A;  1F2E A;  5HFI A;  2RM5 A;  2HI7 A;  4OFM A;  2VL2 A;  5AIS A;  5ECO B;  2AHE A;  4FH8 A;  3GV1 A;  1DBY A;  3IC4 A;  4DVC A;  2GSR A;  3GSS A;  3FMW A;  5GAN D;  3WGD A;  3WT2 A;  1WWJ A;  1SJZ A;  2R0G A;  1IYH A;  1X9S B;  4HQS A;  3J7Y b;  1XWC A;  3W8S A;  2IIY A;  1Q4J A;  2NTO A;  1V58 A;  1GP1 A;  2WVX B;  5IM9 A;  5IPH A;  4MNN A;  3F63 A;  3VFI A;  3TUE A;  3V1W A;  1TK0 B;  3BOA A;  4KF9 A;  3FRC A;  1EV9 A;  1KBN A;  3CYN A;  1Z5Y E;  3DRN A;  2CX4 A;  3FR9 A;  4L8E A;  2VCZ A;  4MMM A;  5KN0 A;  4CHS A;  3GX8 A;  3UEM A;  2VCV A;  3ZTL A;  5G1K A;  3KZQ A;  2L5O A;  3SBC A;  2EFC A;  4EVM A;  4OO4 A;  3FZ4 A;  5DCH A;  5JWO B;  4TKY A;  3HJM A;  1VF1 A;  1WRY A;  3FK8 A;  5A1N B;  3MSZ A;  2R6K A;  4KDX A;  4G2E A;  2M46 A;  3HZ8 A;  5LNK e;  2J23 A;  2QSI A;  2FHE A;  2HSN A;  3BJ5 A;  5CRH A;  2LUS A;  3PGT A;  4E68 A;  4Z7X A;  2PU9 C;  2CT6 A;  1GNW A;  2PVQ A;  4D73 A;  1NHO A;  1XW5 A;  3WD6 A;  4ZB6 A;  5IMV A;  4GTU A;  4PNG A;  5H5Q A;  2VD0 A;  4MH2 A;  3ERG A;  4PUF C;  3FR3 A;  2C0G A;  5ID2 B;  2HXK A;  3RBT A;  3M8N A;  2EC4 A;  3M0F A;  2VLV A;  5J4V A;  1OKT A;  3F8U A;  4BA7 A;  1X9W B;  5F05 A;  3IAS 2;  2WUL A;  4HUA A;  2WRT A;  4NHZ A;  3QD9 A;  2N5A A;  3ZFL A;  4USS A;  1Z6N A;  4F0C A;  2VO4 A;  3VK9 A;  3GKX A;  4KW6 A;  5CAX A;  3LWA A;  2WDU A;  1TOF A;  2BMX A;  5D93 A;  1SJI A;  2WCI A;  4O5U A;  1UC7 A;  3BBY A;  1BG5 A;  2DIZ A;  3EU3 A;  4Q5R A;  4K1F A;  3TKP A;  1QXH A;  3N9J A;  1K0O A;  3VPT A;  1PN0 A;  3FEU A;  2DJK A;  4EDZ A;  3QOU A;  1WE0 A;  1U87 A;  1YZX A;  2YWN A;  1ZGN A;  2LKU A;  1BX9 A;  4LMV A;  5F06 A;  2X4A A;  2FCH A;  3ZVJ A;  1JHB A;  2LQO A;  2CZ3 A;  1K0N A;  5EY6 A;  1ERT A;  2DJ1 A;  4ECI A;  1T4Y A;  3F3Q A;  2ON7 A;  3KH7 A;  3R2Q A;  4GWR A;  4V2M A;  1XW6 A;  4HEA 2;  2GVP A;  4Z2R A;  1B9X C;  5J5N A;  2RII A;  5A4U A;  3FHK A;  2VL9 A;  2TRX A;  3U6V A;  2M80 A;  3KMN A;  2B7K A;  3HCZ A;  2VCW A;  4KND A;  2FY6 A;  1AXD A;  5CO3 A;  2EFH A;  4GSS A;  4TXO B;  1R4W A;  1XWK A;  5IOW A;  4CDO A;  2R3X A;  5DJM A;  3NOF A;  2GZP A;  3N5O A;  3LJR A;  2FUG 2;  3UBL A;  1OC3 A;  1YY7 A;  2WZS A;  3GFK A;  4ACS A;  3EC3 A;  5ELA A;  2B5E A;  1XVW A;  4N3Z A;  2H0H A;  1GWC A;  3E0U A;  1EV4 A;  5A34 A;  2H72 A;  2R0C A;  3FYG A;  3O6T A;  4XRD A;  2GZY A;  4HQZ A;  1B9Y C;  2TRC P;  1PD2 1;  5HR0 A;  7GSS A;  1K0D A;  1TRU A;  1TU7 A;  2ZNM A;  3GHA A;  3UAP A;  3A5I A;  1ZYN A;  2B6M A;  4MZW A; 
#chains in the Genus database with same CATH homology
 5KN3 A;  1AAZ A;  2ES7 A;  4ZBA A;  5ECR B;  4ZBB A;  3CTG A;  3HMJ G;  2QGV A;  5ECL B;  5AIX A;  3EPT A;  2VIM A;  2JZR A;  2K18 A;  4MLY A;  3D5J A;  1YEP A;  3DVX A;  3FR6 A;  4F82 A;  3IPZ A;  1JZD A;  2N5B A;  1FHE A;  3I6A A;  5DAK B;  5C04 A;  1VF3 A;  4KDY A;  2H71 A;  2IWT A;  2P5R A;  3GYK A;  2XHF A;  1K3Y A;  3Q6O A;  1X5E A;  4XHM A;  1VGL A;  5IO0 A;  3TKS C;  2HSM B;  1JFU A;  2H1B A;  4L0U A;  2QC7 A;  3DIE A;  1XWG A;  5D9X A;  5ID2 A;  2L6D A;  1T4Z A;  1ZCP A;  2CVK A;  2C3T A;  1BED A;  1ST9 A;  5J9C A;  2WZ9 A;  1SL2 B;  2HQT A;  4ZB9 A;  4HI7 A;  1B4P A;  4GQF A;  2VL3 A;  4LL1 B;  1O8X A;  1GLP A;  3CRT A;  1V2A A;  3EIN A;  4HU7 A;  4ICY A;  2VCQ A;  3G7J A;  3E9J B;  1RK4 A;  2LJA A;  2GSQ A;  4LLR A;  5BMU A;  4PNF A;  1W89 A;  5DCG A;  1PX6 A;  4TXV A;  5G5E A;  1G7E A;  1BAY A;  5GAP D;  5DAL B;  2H1D A;  3GTU A;  3F9U A;  4BL7 B;  1MEK A;  1Q98 A;  3EE2 A;  4CY8 A;  4O32 A;  1TK8 B;  3HA9 A;  4MJA A;  3L4N A;  1C72 A;  5HR2 A;  4F9Z A;  4LA1 A;  4GDF A;  1A23 A;  2IFQ B;  3HYP A;  3RPN A;  2HRK A;  1SL0 B;  3W8J A;  5ELG A;  5EPF A;  1DSB A;  8GSS A;  3IC8 A;  4AKG A;  1QQ2 A;  3HJO A;  1GSQ A;  2X8C A;  3D0Z A;  1V40 A;  2KLX A;  3P8W A;  4BVX B;  1Z9H A;  1WJK A;  5HFG A;  3GST A;  5FWG A;  4PTS A;  1V9W A;  2G0F A;  4N0V A;  3EU4 A;  5J41 A;  4O7H A;  2HZE A;  2VD1 A;  1X0R A;  2LV3 A;  3D22 A;  4IKH A;  2O8V B;  3D21 A;  2KP2 A;  1ZMA A;  1GTA A;  4K7O A;  3QAV A;  2PUK C;  1B4Q A;  3UJ1 A;  4FO5 A;  2KHP A;  4MJB A;  4AI6 A;  3VWW A;  3F0I A;  3UIW A;  2JSY A;  1EEM A;  3ZVJ D;  4ISD A;  2E2G A;  4AKI A;  1TU8 A;  3F4T A;  4IP1 A;  4HDE A;  1O7U A;  4BVY A;  5JWQ B;  4KE3 A;  3LSZ A;  2A2R A;  3EYT A;  4WBR D;  3DGQ A;  3UVH A;  1OC8 A;  1BF5 A;  2HSY A;  3QR6 A;  4WF4 A;  2MZC A;  2YV9 A;  1M2D A;  3A2W A;  5GZZ B;  1HNA A;  4YH2 A;  3P7X A;  1WIK A;  4H86 A;  5IIZ A;  3F3R A;  5ECK B;  3TJB A;  4JE1 A;  4MF7 A;  3TOU A;  2YZU A;  3UVT A;  2H1A A;  3EWL A;  3FZ5 A;  5FHI A;  1FOV A;  1WPI A;  3H4K A;  1M2A A;  1GUL A;  3KMO A;  5BRT A;  3F6D A;  4K0N A;  2PN8 A;  3BCI A;  1PMT A;  3QAW A;  4MA9 A;  5JCG A;  2VL2 C;  3IR4 A;  2K8S A;  1HQO A;  2HNL A;  3FW2 A;  1FAA A;  4ZBD A;  2F9S A;  2GDR A;  2DJ3 A;  1U88 A;  1XZO A;  2EIR A;  2YAN A;  1EOH A;  1CQH A;  3TDG A;  4ZIL A;  18GS A;  5GSS A;  3GRX A;  5ECN B;  1WMJ A;  3A2X A;  2C0D A;  1JZO A;  5LD0 A;  1K0C A;  2ON5 A;  4POL A;  3GH6 A;  1GSD A;  1SVO A;  2P31 A;  4MP4 A;  5KN1 A;  1SL1 B;  4WR5 A;  2L5L A;  2QKE A;  1QK8 A;  1FO5 A;  2JAD A;  4PQI A;  1ZYE A;  1WP0 A;  1A2J A;  4WXT A;  1NM3 A;  1URM A;  2VLT A;  1SYX A;  2HZF A;  3LEF A;  2L59 A;  1GSY A;  3WT1 A;  3ME7 A;  3IE3 A;  2YCD A;  3IOS A;  2I9H A;  4L0W A;  1AUC A;  3GA4 A;  1ZYP A;  2H76 A;  4BL7 A;  1ZL9 A;  2KP1 A;  3KIJ A;  3CRU A;  4IBP A;  4ZL8 A;  3CWG A;  2C3N A;  2K8V A;  2YNX A;  4ZB8 A;  2LEG A;  1BYE A;  3MWH A;  2R2J A;  1PSQ A;  4CY6 A;  2OT3 A;  1GUM A;  3WYW A;  4PQH A;  1I9D A;  4GSN A;  2CQ9 A;  4G01 A;  19GS A;  1U3A A;  3BD2 A;  3HDC A;  4OWY A;  1OC9 B;  5KEJ A;  1DE1 A;  1K0M A;  3HVV A;  4PXO A;  2MMZ A;  2HLS A;  4V2L A;  3KM6 A;  2QA1 A;  3IHQ A;  5G31 A;  1J08 A;  2F8A A;  1YEX A;  3EVI A;  1E6B A;  3LXT A;  4IQ1 A;  1T3B A;  2I81 A;  2X8G A;  1HD2 A;  2X99 A;  5CRD A;  2H75 A;  2A2S A;  3TCO A;  5B7C A;  3GIX A;  4WEY A;  2PER A;  4TW5 A;  4HZ4 A;  2MYG A;  4XIH A;  1V98 A;  3QPM A;  5CNW A;  4O92 A;  4TR1 A;  5A5K A;  4N0Z A;  2QA2 A;  3ZML A;  4MPF A;  2NBS A;  3W6G A;  4I97 A;  3ZRD A;  11GS A;  5IQY A;  1GUK A;  1EP8 A;  2YOI A;  3ZMK A;  1CQG A;  2JSZ A;  2C0F A;  1N8J A;  1TTZ A;  2HRA A;  5DVB A;  1SD9 A;  3TRP A;  4MK3 A;  3P90 A;  1Z6M A;  5IMF A;  1JLV A;  3ED3 A;  1PGT A;  4Z2U A;  2FWE A;  2GT6 A;  4X43 A;  5G1L A;  3GN3 A;  3ISO A;  1A8Y A;  3UMA A;  2MMA A;  1TRW A;  5DQY A;  4YAV A;  2X49 A;  1TJD A;  4MJE A;  3DML A;  1J9B A;  2H19 A;  2C3Q A;  3VWV A;  5A5H B;  2C1Y A;  1EWX A;  3HJP A;  2YP6 A;  4XRA A;  4XS4 A;  1TXX A;  4EXJ A;  2YZH A;  2LRT A;  1TXU A;  2DJ2 A;  4K7N A;  3BCK A;  2BJX A;  4K2X A;  1YQ1 A;  4GF0 A;  1H75 A;  1GTI A;  2H6Y A;  2H6X A;  1F6M C;  3KH9 A;  1TDI A;  3GMF A;  3CBU A;  1SVL A;  4DSS B;  2E7P A;  2IME A;  1YF0 A;  3MYD A;  1EGR A;  3G7Y A;  2LRN A;  1VF4 A;  5HR1 A;  2JZS A;  5D9W A;  2LRC A;  5F0G A;  3O76 A;  1MDI A;  2WJU A;  3IDV A;  1B8X A;  1SU9 A;  3APS A;  4QL7 A;  1XW9 A;  6GST A;  2YJ7 A;  4ULX A;  4K5S A;  1PL2 A;  1SD8 A;  4KX4 A;  4Q5N A;  3KTB A;  2X64 A;  2N5F A;  4NV5 A;  2LST A;  4MF5 A;  4K8M A;  2CVB A;  4YKF A;  1TI1 A;  3G9B A;  1SK2 A;  3VLN A;  4IGJ A;  5J40 A;  2F8F A;  3CTF A;  4GXZ A;  3ZZX A;  1PQN A;  4NHW A;  1ON4 A;  4L5O A;  3CSH A;  4MZC A;  4EUY A;  1QUW A;  5C00 A;  3TJG A;  2GSS A;  4DEJ A;  2X8H A;  5CYY A;  1OVN A;  2H30 A;  3E3E A;  1R7H A;  1OE8 A;  5J3R A;  2CV4 A;  3KCM A;  1MDK A;  3FZA A;  4MCU A;  1V57 A;  2WS2 A;  2H0I A;  2PVO C;  2FA8 A;  1F9M A;  1G7O A;  1SVM A;  5LCZ A;  1ACV A;  1YDK A;  4F2I A;  5ECP B;  2CZ2 A;  1F37 A;  2JAC A;  3EMP A;  5A1N A;  2OE3 A;  2IMI A;  3SWL A;  4J2F A;  1PA3 A;  1AQW A;  1S3A A;  3LG6 A;  4K5R A;  1GSF A;  3L0H A;  1TW9 A;  4X4J A;  5F07 A;  3KP9 A;  1GTU A;  4XS6 A;  4G19 A;  2AJQ B;  3R3E A;  1DE2 A;  5DJL A;  2DML A;  2PWJ A;  1QFN A;  1FVK A;  4IP6 A;  4MH3 A;  3QFA C;  4G0I A;  5J4U A;  1LBK A;  6GSS A;  5H5R A;  2OAD A;  1XIY A;  3VI7 A;  3CSJ A;  5A4V A;  4N10 A;  3UL3 A;  5DDL A;  4Z2T A;  3IXR A;  2EIQ A;  2O89 A;  2V1M A;  1XOA A;  3RHB A;  3DYR A;  4JZQ A;  1X5D A;  3C7M A;  3TRX A;  2G2Q A;  3QCP A;  4EF0 A;  3TJJ A;  2FNO A;  2VAF A;  2HRN A;  1ZZY A;  3C1S A;  3O3T A;  1XPV A;  3FY7 A;  4BPY A;  4NAX A;  5ECS A;  4AGS A;  4GLT A;  3TKS A;  5ECI B;  2ZUP A;  4OCF A;  2O5V A;  1F3A A;  4EL1 A;  3APQ A;  4TOP A;  4HS1 A;  3M9J A;  2AB6 A;  4MJC A;  1NSW A;  4KDU A;  4RUV A;  5COH A;  2FWF A;  4F03 A;  3GL5 A;  2HE3 A;  5IMC A;  2B3S A;  5D96 A;  4NWY A;  4DSS A;  5DBQ A;  2I1U A;  1U3I A;  2IL3 A;  3GNJ A;  3LW9 A;  4JED A;  2HRF A;  1FB0 A;  2V32 A;  4ILF A;  2MBT A;  2Z9S A;  1XXU A;  4AF2 A;  1O73 A;  1U6T A;  4G9H A;  4HJM A;  1H4O A;  2RM6 A;  4AJ8 A;  3ERW A;  1YJ6 A;  2HYX A;  5D9V A;  4AKX B;  2EFE A;  4XS1 A;  4BWQ A;  5CP1 A;  1RW1 A;  1GTB A;  4GRF A;  3KGK A;  1XWA A;  3UBK A;  1K0B A;  3UOM A;  4J57 E;  3F4S A;  4TXO A;  4KB3 A;  4WBJ A;  1KTE A;  1XWB A;  4ZL7 A;  3GKN A;  2C4J A;  1R5A A;  3LXZ A;  3GUR A;  1GL8 A;  3WGX A;  2F3M A;  4E8H A;  4GQC A;  4G0L A;  5AIV A;  3MIX A;  4KGI A;  1O6J A;  2GQK A;  2F51 A;  2I4A A;  1FB6 A;  2B1L A;  2OAC A;  2L4C A;  4JU5 A;  4ID0 A;  2K9F A;  2EIO A;  4OD7 A;  1BG1 A;  4MF6 A;  5EVO A;  1X5C A;  1PN9 A;  2FWH A;  4IHU A;  2GST A;  5D8I A;  1O85 A;  1VF2 A;  2LNT A;  3D4M A;  1VRS D;  1BQ7 A;  3HD5 A;  3IV4 A;  4FYU A;  4POK A;  4TN8 A;  1Z3E A;  2GT5 A;  2DJJ A;  2DKI A;  2OA7 A;  3QFB C;  3IRA A;  3ME8 A;  2CX3 A;  1GSE A;  12GS A;  3QDN A;  4RQR A;  3FKF A;  3KJY A;  3TRQ A;  5ENU A;  4IW9 A;  1NHY A;  4HZ2 A;  6GSX A;  5IMA A;  1TKD B;  1M9B A;  2UZ8 A;  3MNG A;  3KEB A;  4F0B A;  3A2V A;  3GL3 A;  1THX A;  3ZFB A;  5DAK A;  2KOK A;  2GQL A;  2REM A;  3DD3 A;  1ERU A;  2DJ0 A;  1O8W A;  4HU9 A;  1GH2 A;  2VM2 A;  1OAZ A;  4KA0 A;  2OE1 A;  2HSM A;  4N11 A;  3IK9 A;  2OJL A;  2OBK A;  2IMK A;  4TR3 A;  3CSI A;  1S3D A;  5ECH B;  4GCI A;  2R37 A;  3WGE A;  4EE0 A;  1OKD A;  20GS A;  1FVJ A;  1XVQ A;  1HYU A;  2LJR A;  1HNC A;  1AQX A;  4W66 A;  3ZRE A;  4LMW A;  1NW2 A;  2C8U A;  2R5G A;  1XFL A;  3HVS A;  5KOX A;  1JZW A;  1K3L A;  4E8E A;  2LQQ A;  4I2T A;  5DAL A;  5J4Y A;  3JCM L;  5ECQ B;  1YVL A;  2O87 A;  3J7Y k;  2GLR A;  1Z7P A;  2YWM A;  5JWR B;  4TRX A;  1GLQ A;  4QQ7 A;  4IN0 A;  2LTK A;  2LJK A;  2VUP A;  3H93 A;  3C8E A;  2C0E A;  2PBJ A;  1DUG A;  4IEL A;  4TR0 A;  6GSW A;  2IFQ A;  4AJ6 A;  3F6F A;  3Q18 A;  4Q5Q A;  1A0F A;  2L6C A;  4JRR A;  4RQX A;  3MAK A;  3TGZ A;  3OR5 A;  5INY A;  4O5Q A;  4YKG A;  1JZR A;  5A34 B;  6GSY A;  4K6X A;  1KEB A;  4X0X A;  6GSU A;  4N30 A;  4FIW A;  3MDK A;  4BVX A;  2V6K A;  2D2Z A;  5IMZ A;  1XBS A;  1QGV A;  4POM A;  3PPU A;  5CRE A;  4IQA A;  1G6Y A;  3G7I A;  2IMD A;  3I69 A;  1MDJ A;  1AW9 A;  16GS A;  1YKC A;  3QAG A;  3QMX A;  2B5X A;  4PX1 A;  2YJH A;  1EEJ A;  2AYT A;  2VOC A;  10GS A;  4MDC A;  4KCA A;  1N2A A;  4K9Z A;  1USB A;  3P2A A;  1K0A A;  1OYJ A;  4YQM A;  1EZK A;  2R0P A;  3D4T A;  4PGT A;  4K0G A;  3HHV A;  5CRW A;  2DC5 A;  4YAP A;  2VCX A;  2BTO T;  3PIN A;  4I6X A;  2H1L A;  1GSU A;  1BJX A;  2H01 A;  3H79 A;  5IO2 A;  4PUR A;  1PRX A;  1PL1 A;  4EIQ A;  2GTU A;  1M2B A;  1PX7 A;  3IHG A;  1TRV A;  2O85 A;  1A2L A;  2XC2 A;  3C1R A;  2V2G A;  2L57 A;  1SKW B;  2L4Q A;  5H5S A;  4QL9 A;  1K3O A;  1RQM A;  4YQU A;  1SJ6 A;  1PKW A;  4IJ3 A;  3GX0 A;  5DQS A;  5BMU B;  2DMM A;  1M9A A;  1SK1 A;  3TJK A;  4NV2 A;  4YQV A;  1UA5 A;  3GTU B;  3IAM 2;  1ZYQ B;  3KXO A;  1I5G A;  5G2Z A;  2VM1 A;  4V1A p;  1WOU A;  1ZOF A;  2DLX A;  1W4V A;  5G5F A;  2YWI A;  1MTC A;  2A4H A;  2ZCT A;  2CAI A;  4OFN A;  1R5P A;  3H1N A;  3I43 A;  3LGC A;  3TKQ A;  4MPG A;  2HRK B;  2OE0 A;  4BWS A;  1UN2 A;  4EIP A;  1G0T A;  4L5L A;  1OE7 A;  2A2P A;  2CA8 A;  5G30 A;  4OMV A;  3KTL A;  3S9F A;  1A8L A;  5F8B A;  4WF5 A;  1M0U A;  3Q19 A;  4AKH A;  4G0K A;  2WGR A;  3PR8 A;  4FYC A;  1T7P B;  5B6N A;  4DSQ A;  1MD3 A;  2HZE B;  2IMF A;  3U5R E;  1SKS B;  2AV4 A;  2JL4 A;  2DKH A;  3RHC A;  2RLI A;  1FW1 A;  1TRS A;  4GST A;  2JZT A;  4NXI A;  3Q74 A;  3NIV A;  2M72 A;  3VPQ A;  3DWV A;  1TI3 A;  1N25 A;  1ABA A;  4ECC A;  2UV8 G;  4EDY A;  1XOB A;  2H0G A;  2IPA A;  3M3M A;  4JR6 A;  2XBQ A;  4HJ2 A;  3TKR A;  1YKA A;  5J9B A;  4BVY B;  2HFD A;  3ZYW A;  6GSV A;  4OFT A;  3NZN A;  3TU3 B;  4DSR A;  2H1G A;  1AIU A;  1OC9 A;  2JU5 A;  3IA1 A;  2IJY A;  2PPT A;  3PH9 A;  3LYP A;  1UVZ A;  3HKR A;  4ECJ A;  1TK5 B;  1LU4 A;  2NDO A;  4AJ7 A;  4MAB A;  4NPB A;  4ZXG A;  2H6Z A;  3EMX A;  4PQ1 A;  5CRG A;  2HSH A;  4KUN A;  2P0G A;  2LS5 A;  3ZIT A;  1GRX A;  4QMK A;  2PMT A;  3RDW A;  4I5Q A;  4K2D A;  3UAR A;  2RUF A;  2J9H A;  5IMD A;  2H8L A;  1ML6 A;  5AN1 A;  3GH9 A;  4ZIJ A;  4G10 A;  2E0Q A;  3RAZ A;  2P5Q A;  2PGT A;  1T8E B;  3GUS A;  4EKZ A;  2H73 A;  4KAE A;  2DSA A;  3ERF A;  4KH7 A;  4X1U A;  5E4W A;  4I8B A;  2VKZ G;  2MMO A;  3GKM A;  2MBS A;  2E2M A;  3GKK A;  3LYK A;  3H8Q A;  3VWX A;  5HFK A;  1YF1 A;  2NPB A;  1T00 A;  5AGY A;  2V41 A;  2B7J A;  4I2U A;  4ZL9 A;  3RPP A;  5JCW A;  2GQM A;  4RI6 A;  2KUC A;  3I9V 2;  2AUV A;  1Y25 A;  1MD4 A;  1Y6E A;  2FWG A;  1PKZ A;  1SK0 A;  1ERV A;  1A0R P;  4IJI A;  2V6O A;  4Q5F A;  1EP7 A;  1THO A;  1SYR A;  2O7K A;  1GSS A;  2H66 A;  2R4V A;  5B6M A;  1F3B A;  5KN2 A;  2XPE A;  5A5H A;  1AC1 A;  4OCE A;  3TJF A;  4J56 E;  22GS A;  4EC0 A;  5A4W A;  4WET A;  3CMI A;  2IN3 A;  4MZB A;  3APO A;  2I3Y A;  4V1A g;  1GNE A;  2FGX A;  1HNB A;  4IS0 A;  2OKA A;  3A5W A;  1IYI A;  1M99 A;  2GS3 A;  1T1V A;  13GS A;  5IOX A;  2YPM A;  1R26 A;  1M7T A;  2XBI A;  4IVF A;  4LL4 B;  5KOW A;  4HOJ A;  3KP8 A;  3F4R A;  2YWO A;  1EGO A;  2FLS A;  4XTS A;  1J0F A;  3L78 A;  4JR4 A;  2OBI A;  1E2Y A;  4FQU A;  5HQP A;  1GUH A;  5GST A;  1XCC A;  4WKW A;  1Z7R A;  3DEX A;  4KSM A;  2RUE A;  2FD3 A;  2WB9 A;  4WR4 A;  1ERW A;  3M1G A;  5EL8 A;  1A2M A;  4KCE A;  1TP9 A;  2B5Y A;  2DBC A;  5L71 A;  4ML1 A;  3AY8 A;  2VLU A;  3TKS E;  2DIY A;  2CVD A;  5B8A A;  3C73 A;  2HSN B;  4K7I A;  3IK7 A;  4XCS A;  1JLW A;  1O81 A;  3ZL5 A;  2LNS A;  1KNG A;  3DVW A;  4D73 B;  2MMN A;  3TOT A;  4TVE A;  4TR1 B;  3ZIJ A;  1SKR B;  4FYB A;  14GS A;  2WFC A;  4ECB A;  2GGT A;  1G6W A;  5B8B A;  2TIR A;  1B48 A;  5D73 A;  5ECM B;  2NVL A;  1EOG A;  2K6V A;  3CXG A;  3LOR A;  2HT9 A;  3A3T A;  3M9K A;  3US3 A;  2AAW A;  3ZLP A;  1ILO A;  3D6I A;  1A24 A;  3IBH A;  4JBB A;  2CAQ A;  3HZ4 A;  4CW9 A;  5E59 A;  2EFD A;  4RI7 A;  5HR3 A;  5ABR A;  4P3Y B;  1LJR A;  3HXS A;  2H74 A;  3C71 A;  1AQV A;  1FOH A;  2ALB A;  4EO3 A;  4KSO A;  3VI5 A;  3DKS A;  5IPG A;  3HVX A;  3K8N A;  4PUA A;  4XS4 B;  2C80 A;  4V2N A;  1FG4 A;  2YN1 A;  2YV7 A;  1X9M B;  2FA4 A;  2VCT A;  2B1K A;  4NMU A;  3HY2 A;  5FT3 A;  1S3C A;  3KD0 A;  2GZZ A;  3L9V A;  3LFL A;  3L9U A;  3ZIV A;  3TB2 A;  3VWU A;  3EUR A;  1QMV A;  3DXB A;  4OO5 A;  17GS A;  4POB A;  4ML6 A;  4ZB7 A;  3VUR A;  2H70 A;  2XPD A;  4A5P A;  4TR4 A;  1Y1U A;  9GSS A;  1SEN A;  5J47 A;  3FZ9 A;  3L9S A;  5D9T A;  2A4V A;  5JCU A;  4O5R A;  3LQ7 A;  1F2E A;  5HFI A;  2RM5 A;  2HI7 A;  4OFM A;  2VL2 A;  5AIS A;  5ECO B;  2AHE A;  4FH8 A;  3GV1 A;  1DBY A;  3IC4 A;  4DVC A;  2GSR A;  3GSS A;  3FMW A;  5GAN D;  3WGD A;  3WT2 A;  1WWJ A;  1SJZ A;  2R0G A;  1IYH A;  1X9S B;  4HQS A;  3J7Y b;  1XWC A;  3W8S A;  2IIY A;  1Q4J A;  2NTO A;  1V58 A;  1GP1 A;  5IM9 A;  5IPH A;  4MNN A;  3F63 A;  3VFI A;  3TUE A;  3V1W A;  1TK0 B;  3BOA A;  4KF9 A;  3FRC A;  1EV9 A;  1KBN A;  3CYN A;  1Z5Y E;  3DRN A;  2CX4 A;  3FR9 A;  4L8E A;  2VCZ A;  4MMM A;  5KN0 A;  4CHS A;  3GX8 A;  3UEM A;  2VCV A;  3ZTL A;  5G1K A;  3KZQ A;  2L5O A;  3SBC A;  2EFC A;  4EVM A;  4OO4 A;  3FZ4 A;  5DCH A;  5JWO B;  4TKY A;  3HJM A;  1VF1 A;  1WRY A;  3FK8 A;  5A1N B;  3MSZ A;  2R6K A;  4KDX A;  4G2E A;  2M46 A;  3HZ8 A;  5LNK e;  2J23 A;  2QSI A;  2FHE A;  2HSN A;  3BJ5 A;  5CRH A;  2LUS A;  3PGT A;  4E68 A;  4Z7X A;  2PU9 C;  2CT6 A;  1GNW A;  2PVQ A;  4D73 A;  1NHO A;  1XW5 A;  3WD6 A;  4ZB6 A;  5IMV A;  4GTU A;  4PNG A;  5H5Q A;  2VD0 A;  4MH2 A;  3ERG A;  4PUF C;  3FR3 A;  2C0G A;  5ID2 B;  2HXK A;  3RBT A;  3M8N A;  2EC4 A;  3M0F A;  2VLV A;  5J4V A;  1OKT A;  3F8U A;  4BA7 A;  1X9W B;  5F05 A;  3IAS 2;  2WUL A;  4HUA A;  2WRT A;  4NHZ A;  3QD9 A;  2N5A A;  3ZFL A;  4USS A;  1Z6N A;  4F0C A;  2VO4 A;  3VK9 A;  3GKX A;  4KW6 A;  5CAX A;  3LWA A;  2WDU A;  1TOF A;  2BMX A;  5D93 A;  1SJI A;  2WCI A;  4O5U A;  1UC7 A;  3BBY A;  1BG5 A;  2DIZ A;  3EU3 A;  4Q5R A;  4K1F A;  3TKP A;  1QXH A;  3N9J A;  1K0O A;  3VPT A;  1PN0 A;  3FEU A;  2DJK A;  4EDZ A;  3QOU A;  1WE0 A;  1U87 A;  1YZX A;  2YWN A;  1ZGN A;  2LKU A;  1BX9 A;  4LMV A;  5F06 A;  2X4A A;  2FCH A;  3ZVJ A;  1JHB A;  2LQO A;  2CZ3 A;  1K0N A;  5EY6 A;  1ERT A;  2DJ1 A;  4ECI A;  1T4Y A;  3F3Q A;  2ON7 A;  3KH7 A;  3R2Q A;  4GWR A;  4V2M A;  1XW6 A;  4HEA 2;  2GVP A;  4Z2R A;  1B9X C;  5J5N A;  2RII A;  5A4U A;  3FHK A;  2VL9 A;  2TRX A;  3U6V A;  2M80 A;  3KMN A;  2B7K A;  3HCZ A;  2VCW A;  4KND A;  2FY6 A;  1AXD A;  5CO3 A;  2EFH A;  4GSS A;  4TXO B;  1R4W A;  1XWK A;  5IOW A;  4CDO A;  2R3X A;  5DJM A;  3NOF A;  2GZP A;  3N5O A;  3LJR A;  2FUG 2;  3UBL A;  1OC3 A;  1YY7 A;  3GFK A;  4ACS A;  3EC3 A;  5ELA A;  2B5E A;  1XVW A;  4N3Z A;  2H0H A;  1GWC A;  3E0U A;  1EV4 A;  5A34 A;  2H72 A;  2R0C A;  3FYG A;  3O6T A;  4XRD A;  2GZY A;  4HQZ A;  1B9Y C;  2TRC P;  1PD2 1;  5HR0 A;  7GSS A;  1K0D A;  1TRU A;  1TU7 A;  2ZNM A;  3GHA A;  3UAP A;  3A5I A;  1ZYN A;  2B6M A;  4MZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...