3GUUA

X-ray structure of candida antarctica lipase a
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
431
structure length
431
Chain Sequence
AALPNPYDDPFYTTPSNIGTFAKGQVIQSRKVPTDIGNANNAASFQLQYRTTNTQNEAVADVATVWIPAKPASPPKIFSYQVYEDATALDCAPSYSYLTGLDQPNKVTAVLDTPIIIGWALQQGYYVVSSDHEGFKAAFIAGYEEGMAILDGIRALKNYQNLPSDSKVALEGYSGGAHATVWATSLAESYAPELNIVGASHGGTPVSAKDTFTFLNGGPFAGFALAGVSGLSLAHPDMESFIEARLNAKGQRTLKQIRGRGFCLPQVVLTYPFLNVFSLVNDTNLLNEAPIASILKQETVVQAEASYTVSVPKFPRFIWHAIPDEIVPYQPAATYVKEQCAKGANINFSPYPIAEHLTAEIFGLVPSLWFIKQAFDGTTPKVICGTPIPAIAGITTPSADQVLGSDLANQLRSLDGKQSAFGKPFGPITPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of Lipase A from Candida antarctica
rcsb
molecule tags Hydrolase
molecule keywords Lipase A
total genus 153
structure length 431
sequence length 431
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03583 LIP Secretory lipase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.130 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3guuA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3guuA01
3ZLVA 2VJBA 4QWWA 4X7BA 2HA7A 2CUTA 1ZI6A 4OB6A 1XRLA 1K5PA 5CXXA 1XZCA 3ESDA 1J07A 4BC1A 3FLEA 5IVHA 2PUHA 2G5TA 4X3CA 4BRZA 4ZXFA 2QXTA 2HL6A 2ORYA 1TCCA 4UBJA 1YR2A 3WZLA 1UWCA 2ZSHA 1QFMA 3AIMA 5AO9A 3IUJA 5A6VA 4QDOA 4BBZA 1XROA 3JWEA 4DMHA 3S8YA 2GYVA 4AN1A 2HA2A 1GZ7A 1FFAA 4OB7A 1Y37A 3ZI7A 4J0JA 3YASA 4BP8A 3D7RA 1WB6A 1OCEA 4E15A 1H23A 5C8VA 1G5FA 5A2GA 3WKBA 5K3BA 3HJUA 1CPYA 2VT7A 3FLBA 1QE3A 1XRRA 2JIDA 4E14A 1XZGA 2ROQA 2WFLB 1CR6A 4Q3KA 1XRPA 1KU6A 1PFQA 2Y6VA 4B82A 1QIIA 1X70A 4PSDA 4U2DA 5E4TA 1EK1A 4P92A 4C89A 5LZ8A 2DQZA 1YS2X 5BWCA 5JYCA 5H3HA 1KU0A 2JGLA 3P2MA 3ZV7A 5D3KA 2HU5A 4X97A 2WFLA 1TQHA 4B83A 2OCKA 3RK4A 3VKFA 3WWEA 2WG0A 3PDCA 3R41A 5HKBA 3PFCA 3BJRA 3HACA 4BYMA 2XMDA 2XE4A 1QGED 1SFRA 3R3VA 3W2TA 1TKRA 1ZJ5A 4G8CA 2BAGA 3IUMA 3C5WP 2G63A 1S8OA 3F96A 2PSHA 3I2KA 3C87A 5AI0A 4IHAA 4MYSA 2H9YA 1F0NA 4AXBA 4H7KA 3I2GA 3WWOA 1F8UA 3STYA 4FFWA 5ALZA 4AO7A 2BJHA 4I4CA 2WU3A 4ROTA 3K2IA 4UUQA 1JU3A 1T2NA 4Y2YA 4PNZA 1MAAA 1J2EA 1EB8A 5AKEA 3OURA 2PX6A 5HFAA 1AZWA 2DSNA 4G8DA 1QIFA 2ZYIA 1OXMA 1W6RA 4BVLA 2DFPA 4B6GA 2FX5A 2WIFA 5JAHA 3WWDA 5JZSA 1YAJA 2OCIA 5AIBA 2ZYSA 4M0EA 2WTMA 2QTBA 5AM0A 3FAKA 3JYHA 2V97A 3V1MA 3W9BA 4K6KA 4Y2TA 2X76A 1YS1X 3MGAA 1W1IA 5ALNA 2ZVDA 4BB0A 3V1LA 5D7BA 4Q82A 1PV1A 4O08A 1CUIA 4QWMA 4FDMA 4N8EA 4BE4A 3D2CA 2EEPA 2JEYA 2WTNA 5CT4A 4LXHA 4DGQA 1CUCA 4NS4A 4B9AA 1EVQA 4JNCA 3I1IA 2GBGA 3EBLA 5AHXA 2XQGA 1Q0ZA 3H2HA 1JMKC 4X94A 2VF2A 3ESBA 3AIKA 3ICVA 5AM4A 5ALGA 2D0DA 1AX9A 4H7DA 2BCEA 4AQDA 2B61A 2HA5A 2XUQA 3H2KA 1ZICA 5A71A 3FOBA 2BGNA 3AIOA 4MEAA 3UMJA 1R50A 1ODCA 5KWIA 1YB7A 1IZ8A 3RARA 3VDXA 1C4XA 1VXOA 1AURA 5ALWA 1THGA 3DS8A 1UXOA 4BATA 5AKHA 2OGSA 3FVRA 2WUDA 1YA8A 4H7IA 2OCGA 4OSEA 1CUSA 2Z8XA 4AMZA 5EGNA 1ZIYA 1IUPA 3BDVA 4Y2VA 5FLKA 5CMLA 1TRHA 4K2AA 3O4HA 3G0BA 4BVKA 4ITVA 1XQYA 3STVA 1Y7IA 4QZVA 1L7RA 1MX5A 5C8ZA 4Y2XA 4EZIA 4J0CA 2WFZA 4WJLA 3FSGD 1EDEA 2QVBA 5JARA 4GLBA 4ZI5A 1E8DA 5AI6A 1P0QA 5AI5A 4AZ3A 4F21A 5EHXA 3G9TA 2PKYX 2ZSIA 4X93A 5HK8A 1ACLA 1N5RA 2HU7A 2PU5A 2RIPA 1ZD3A 1H2WA 5FRDA 4S0XA 4L3WA 3D2AA 3R3YA 4YPVA 4YASA 5JAUA 1K6EA 4CI9A 1ISPA 3C45A 2XMSA 1N5MA 6YASA 1J06A 1EI9A 3E1GA 3SK0A 2YYSA 1LPNA 1ODSA 1EHYA 1G4HA 2AJLI 3UUFA 3HI4A 5E2IA 2WHRA 3V1NA 1XZBA 3Q0TA 2VA9A 4DYHA 3KOOA 3WIBA 3WA7A 1DX6A 2QT9A 3GROA 4Q34A 3F97A 3WKAA 3OM8A 1QIDA 3FSGA 1CUVA 4J0DA 1R9MA 3WYNA 3OPMA 4KACA 5JZ9A 4AO8A 3AILA 3IVMA 2XUGA 4OB8A 4UBKA 4UFNA 3BIXA 4QNNA 3G9UA 3H2IA 4X00A 2CB9A 4YK7A 5EFZA 3TEJA 2RONA 2Y1KA 1H22A 3QPDA 3PUIA 4XX1A 3RKSA 4A16A 1C7JA 1F6WA 4OU5A 4WY8A 3H19A 2XMQA 3BL8A 3SWWA 1I6WA 3GFFA 1BROA 2CMFA 1QLWA 4CCYA 3AUKA 4XVCA 3R3XA 3IIIA 1CVLA 1Q84A 5I8PA 2ACEA 5DYWA 1CUUA 4E11A 4PSUA 4BZZA 2H7YA 3LP5A 3L1IA 1HBJA 1WOMA 3R40A 2PUJA 4WDQA 4HZGA 1JKMA 1QONA 1E66A 4Q1VA 3HXKA 4LXGA 5I7UA 3G0GA 1PJAA 3B12A 4G5XA 4UPDA 5AI8A 3A2NA 1VE7A 3WL8A 5BV7A 1XLUA 2HA0A 3C5VA 3A2LA 3D0KA 2RHWA 1FSSA 2J4FA 1MAHA 2PBLA 2WQZA 5AOCA 1E3QA 1QIHA 5ALFA 4C6HA 2C0QA 5JAOA 3C8DA 1EH5A 1BN7A 2FJ0A 1RYYA 2W22A 3A70A 1QZ3A 1IUNA 1BU8A 3N2ZB 2XUAA 5AM2A 2CJPA 3M3DA 1CUFA 5SYMA 1JJBA 1YASA 1XFDA 1IZ7A 1NU6A 1E8MA 4A23A 5ALHA 4KAAA 1JT2A 2XUFA 5FKJA 3E4DA 5LYYA 3STWA 3FNBA 3WKCA 1UK6A 3MVEA 5ALXA 1QO9A 5HFNA 2XQKA 3O4JA 2JGJA 3O4IA 1JFRA 1D07A 1MNAA 2H1IA 2GBIA 4PSCA 5LZ7A 1K63A 1CIJA 2JEZA 1WHTA 5DTJA 2O2GA 4U2FA 3BF7A 3A6ZA 2WM2A 4B80A 4BP9A 4IH4A 4UHDA 2HFJA 1A7UA 4Q3OA 4CCYB 2J3DA 4FLMA 5KBYA 5CH5A 4CFSA 5JAPA 4DMFA 4OD0A 1IUOA 1U2EA 3ILSA 2GZRA 3I2IA 2XMZA 3U0VA 1XZKA 4YX9A 1GPNA 3AFIA 3JW8A 1ETHA 4JEIA 1AGYA 2BUCA 4H7FA 5AJHA 3VVLA 4UHEA 2GZSA 2WHQA 5AKYA 1UOQA 2QS9A 3HC7A 1CUYA 4MEBA 5HF6A 1CUZA 5ESRA 3G0DA 4V2IA 3W06A 5JIBA 3NGMA 5AK6A 1OILA 4CG1A 1LNSA 3O9MA 2I78A 2P8SA 4GBGA 2H7CA 5ALUA 2Y2VA 3FCYA 1DT5A 1CUDA 1ZGBA 3F67A 3O9VA 3ED1A 3CCBA 3R3UA 3R0VA 4B7ZA 4QE3A 1L7QA 3G0IA 4UBMA 2XUIA 3OOSA 4G1FA 3D5EA 2YH2A 4EY7A 5A62A 4HRXA 2O2HA 3FWHA 2XMBA 1UK7A 3VJLA 5CH8A 1SC9A 2PSJA 1MTZA 4DNQA 2Z3WA 4LHEA 5HKAA 4FTWA 1UFOA 1DQYA 1AMNA 4C4ZA 3QITA 1ZD5A 1R4ZA 1CUXA 1VJ5A 1LPMA 1Q0RA 4CIAA 1KEZA 3H0CA 2AJCA 5DNVA 5FUMA 3F9CA 3I1YA 4B84A 1GPKA 4H7EA 3FYTA 3PI6A 1XLVA 3ANSA 4TGLA 3L1HA 2BGRA 4ARBA 4H35A 4EY8A 4KR0A 4EY5A 1FFEA 1MX9A 5K5EA 4A5SA 3ESCA 1LBTA 3IUNA 5AH0A 5JATA 3DQZA 5FOQA 1HL7A 4CCWA 1W75A 2GBFA 1QIJA 2V98A 1FJ2A 1HLGA 1UKCA 3IULA 4JUIA 2VEOA 3FYUA 5ALIA 4EUSA 4N8DA 1CQZA 4FOLA 4M0MA 5AK3A 2BUAA 2JGMA 4TPKA 3H18A 5YASA 2B20A 4AB1A 4W1RA 3EIOA 3GUUA 1XZEA 4CIBA 1G66A 2FUKA 2WJ4A 3V9AA 4U2BA 4Y2UA 4TVKA 1H2ZA 3C8HA 1JMYA 1HPLA 3BE8A 3W05A 1FFCA 5AK5A 3HRHA 4C88A 2JF0A 2WHPB 4AZ0A 2PSDA 1XZJA 2HIHA 3STUA 4QDXA 1VZ2A 1Q83A 3EQ7A 1NU8A 1Z68A 2ZJ6A 2V96A 3WWPA 4BAUA 2HM7A 4FNGA 2HFKA 3ICWA 3AZPA 1EVEA 2RI6A 1GXSA 5BOVA 4F5ZA 2XQJA 4PV7A 3I2FA 4OPMA 2ZYRA 5LZ4A 3EF3A 3G0CA 3AINA 2VJCA 4K6GA 1ZOIA 5K3FB 4IQ4A 3DNMA 5CT5A 4QDTA 3STTA 4DM7A 4GWLA 3B3QA 4EBBA 1DINA 4J3JA 3HYSA 2O2IA 2G5PA 1LGYA 5ALYA 4GDMA 3FCXA 1A8QA 3ZLUA 2JGFA 4U2EA 2C5FA 2HA3A 4G4JA 1BCRA 3FYUB 3IA2A 4HTAA 1DWQA 2OLEA 1SCKA 4NMWA 1YAHA 4G9EA 1MJ5A 1H2XA 3DJYA 4H7HA 1B41A 2XLCA 3IBTA 3DOIA 4JYPA 3U1TA 3F98A 4IO0A 1CUWA 4P93A 1EA5A 3D3NA 3M81A 5C81A 2I03A 3WL6A 5DTIA 3C6YA 1TIBA 2EDCA 4G4IA 4F0JA 3CXUA 4EHBA 5EHZA 4ZRDA 4X6XA 4I19A 1BN6A 2WIKA 1JJIA 5A7FA 1DT3A 1ZI9A 5JADA 1SOMA 1HQDA 5ALJA 4JYMA 2HA6A 4BVJA 1U8EA 3QVMA 4G8BA 1WPRA 3WI7A 1EDDA 1TAHA 3AZOA 3I6MA 3EQ8A 3IUQA 1LPAB 1RP1A 3VVMA 2B9VA 2XLBA 1UK9A 3BWXA 4QDUA 4MQMA 3WK4A 3BJMA 3DKRA 2CZQA 4Z49A 2R11A 5CTAA 4W1QA 4UBOA 1QOZA 2JGKA 4X71A 3LLCA 1ODTC 5ALVA 4B9EA 3VISA 3DL7A 2QKYA 4KAJA 4PF1A 3WL5A 3V1KA 2OGZA 1E89A 4DNPA 4Q05A 3DL4A 2AJDA 4BDTA 1DX4A 5IH7A 3DCNA 3PF9A 2ES4A 1CV2A 1CUAA 3RLIA 3WKEA 1MO2A 2WIJA 1TCBA 2VATA 5AKGA 4CG3A 1UT6A 1LPPA 1UZAA 2ZJFA 4LYEA 3DOHA 5CURA 1YCDA 3R3WA 3EQ9A 3C70A 2WJ3A 4I3FA 3GZJA 1P0PA 2Q0XA 4BC0A 1UK8A 3FBWA 5ALKA 3KDAA 1CLEA 2PVSA 1R9NA 5KREA 4DSZA 1QFSA 1O6FA 3CN7A 4C4XA 2BFNA 5ALRA 2VAXA 2J3QA 3WK9A 5LZ2A 1YSCA 2UZ0A 5IVKA 4U2GA 4EY4A 1LBSA 4FNMA 4G9GA 1E5TA 2WILA 3WLAA 1G42A 3BXPA 3KWFA 4HXGA 4Y2RA 4BDSA 3WQHA 5BWBA 5HCUA 4WFJA 2FJPA 2V9ZA 3QMMA 2WHPA 4IH1A 5AM1A 1XQXA 5AKJA 1EXWA 1X2BA 5DYTA 2QOEA 2WUFA 4X6UA 2XUHA 3PUHA 3H2JA 5DYYA 5AKXA 4K6HA 5AOBA 1CQWA 4KE9A 2PSFA 4UBLA 4EY6A 3OC0A 4LKOA 5CH3A 3QPAA 4BCCA 2WU4A 3DYIA 5ALPA 3ZPXA 4KRYA 1A88A 3T52A 3L1JA 2W6CX 5ALMA 3AJAA 2CEKA 3A2MA 3OG9A 5K3FA 1XZFA 5CT8A 1MNQA 3QZUA 2HHAA 5D6OA 4M0FA 5FPQA 7YASA 1BRTA 5JD4A 3WMRA 4C4YA 1VOTA 1U4NA 1VLQA 1QIGA 2QJWA 2J4CA 3G8YA 3QBJA 5DNWA 1LZLA 1THTA 2QJRA 3WL7A 1GKLA 2BUBA 4E46A 1ZI8A 2DHEA 1CRLA 4HRYA 1YB6A 4MXDA 1U65A 4H77A 2XB6A 2Y2UA 2ECFA 5HF9A 2XUDA 5IKXA 1WB4A 4GHWA 4PW0A 4H18A 4X85A 2JBWA 1CUBA 4DLNA 1BEZA 1XZDA 3SC2A 5HK9A 2XDWA 1CUHA 2XQFA 3B5EA 4X92A 4KEAA 3FYUC 2O7VA 4AMYA 4IH9A 5AKIA 5LIPA 3BIWA 5CT6A 3SX4A 3QPCA 4W1SA 5KWJA 3GBSA 4HXFB 4WCVA 2XI4A 4RE5A 3STXA 4OU4A 3K6KA 3HEAA 1TK3A 5T4HA 5A7HA 5F4ZA 1XKTA 4LYDA 5AOAA 3C6BA 2C7BA 2WLSA 2WUGA 3UUEA 3FVTA 3PICA 1H2YA 3V48A 3DDUA 2R8BA 5A7GA 1CUJA 5IVIA 1MX1A 4FBLA 4D9JA 3FLAA 3X3HA 1UKAA 5T4FA 4OYLA 2WUEA 3QMVA 1NX9A 1J1IA 5T4BA 3W04A 4AN0A 1R1DA 1T4MA 1DTEA 4L72A 2DCMA 2OCLA 1CFJA 1QIKA 5T4EA 3R3ZA 2K2QB 2OAGA 3MUOA 4RE6A 3QMWA 1BS9A 5LZ9A 1GT6A 5JZBA 2QXUA 4Y2JA 1QO7A 4MYDA 2RHTA 1WM1A 3ZWQA 3NOXA 5AI9A 2AJ8A 5HF5A 3O4GA 3PF8A 5JD5A 3H2GA 4Y2SA 5CRIA 3VJMA 4XIIA 5JASA 2I3ZA 1AUOA 2XQIA 4RPCA 1WHSA 4J0HA 2PM8A 5ALEA 2X8BA 2HA4A 2QUBA 3CN9A 1HDEA 3I2JA 3LCRA 1DQZA 4UHCA 4FFVA 3QH4A 3IDAA 2CBGA 2I3DA 1LLFA 3DEAA 2ZYHA 4N8SA 5FPPA 5AIAA 5FXMA 4N5HX 1ORVA 1LPOA 1VZ3A 4FLEA 4UBIA 1TCAA 4WY5A 4H7JA 5AK4A 3I2HA 5FDFA 1UOOA 2B4KA 4BTLA 4W63A 3G9ZA 2IIVA 3G02A 1XZIA 4BAGA 1WB5A 3C43A 1LPSA 2Z3ZA 2AXEA 4BCBA 2WG1A 2GYWA 2O7RA 3HSSA 3O0DA 1GQSA 4CG2A 4Y9SA 5JD6A 5ALTA 1BE0A 4ZGBA 2C58A 3WK8A 5DNUA 2EDAA 1UKBA 3NWOA 2VTVA 2XT0A 2JGEA 1C7IA 3S2ZA 5LKAA 2VJAA 3DYVA 3WJ2A 4P9NA 4G4GA 1Y7HA 3Q8WA 3O95A 1MT3A 4XWGA 3WWCA 3NUZA 5AI4A 3G9XA 2HRRA 5AKKA 1P0IA 4F60A 1SCQA 4KAFA 4MWSA 2OPHA 3WIOA 4ZV7A 4PQEA 5C7YA 1X2EA 1QTRA 4ETWA 3CCCA 3TRDA 1AQLA 2QR5A 4ZREA 4L9AA 4Y7DA 5AKZA 5ALQA 2WIGA 5CBKA 4WFIA 5J3JA 4GW3A 4QEKA 4X91A 1BEEA 2GBCA 3KWJA 1JI3A 2XMGA 3M82A 2DR0A 2Z8ZA 2YASA 1USWA 2HDWA 3D2BA 2PPLA 4QA9A 3T4UA 2NW6A 4ZV9A 5I9IA 5DJ5A 4B0OA 2H7XA 4K5QA 3TGLA 4NZZA 5E4JA 4XJVA 3BF8A 2GYUA 2XUKA 4W9RA 3ESAA 1FFBA 4UHBA 1B6GA 3KXPA 3TJMA 5JALA 4GXNA 2XMCA 5LLSA 4B85A 5AP9A 1ZJ4A 3C6XA 4J0IA 2CKMA 5ALLA 3LS2A 2PSEA 4J0GA 3IB3A 4X95A 1MU0A 3WZMA 2QRUA 4UHHA 4ARAA 4U2CA 2IX9A 1AC5A 2Z5GA 2C4HA 2ZJ7A 4OCZA 3QM1A 1R88A 1O6GA 4J7AA 1DU4A 2DHDA 2HU8A 5HZGA 4EB0A 1HKHA 4C01A 5JANA 4P08A 1P0MA 2DHCA 2VAVA 1R3DA 3LIIA 4INZA 2E3JA 5LKRA 2VT6A 4UBNA 1VE6A 4QDZA 5AM3A 4L0CA 1XLWA 2DQYA 2Y6UA 5EIEA 2X5XA 1QIMA 4FMPA 4DMKA 2RAUA 3WK5A 3PE6A 1JU4A 3WA6A 2XMRA 3H1AA 4B81A 1EDBA 4HVTA 4MJ3A 4BTVA 3ZLTA 3H1BA 3RM3A 3GELA 4DSAA 4EA6A 1W52X 3F8SA 2QZPA 4BCDA 4LIPD 4PO3X 1VXRA 5DWDA 1XRQA 1XZAA 1WPXA 3N0TA 2HRQA 1XKLA 4ZWNA 2WG2A 5C8XA 4H0CA 3KSRA 3I6ZA 2BKLA 1MN6A 2XUPA 1A8UA 1QIEA 5FV4A 3I28A 4WFKA 4X6YA 3BDIA 1RWQA 3PFBA 1VA4A 1LPBB 4HS9A 1N1MA 1DWPA 4DIUA 5LZ5A 2XUOA 4OUKX 4OYYA 3C6ZA 2OG1A 2OXEA 4DNFA 2XUJA 4MQLA 3ANTA 1N8SA 4AO6A 1IMJA 4FHZA 1ZGCA 3KD2A 3M83A 5HQ3A 5CW2A 4BRSA 2VSQA 3I6YA 3VXKA 2IITA 4W1PA 2QUAA 5CXUA 3H04A 3IURA 4C87A 4UFPA 5K3CA 1K8QA 1GGVA 4DTCA 1L7AA 4FBMA 4KE6A 3WK6A 5LP1A 1FFDA 5ALDA 1ACJA 1K4YA 1MPXA 4J03A 4HAIA 4BZWA 5AM5A 2PU7A 4FWBA 3DLTA 3DD5A 2D5LA 4RNCA 3OTQA 1M33A 1QJ4A 5HQ3B 1EX9A 2ONCA 1EINA 1XRMA 5SYNA 4QLAA 1UOPA 3E3AA 4LXIA 4Q3LA 1XZHA 2OAEA 5DLPA 1XRNA 2RGUA 1AKNA 2OGTA 5EHNA 1CUEA 2OQIA 5FP0A 3WK7A 5K3AA 1YA4A 2VQ6A 1EB9A 2AJBA 1XQVA 1ZIXA 1JJFA 5ALSA 3AZQA 1GQRA 4DMCA 2C0PA 1EK2A 4UFOA 4RGYA 3QYJA 4KRXA 2QMQA 3GA7A 2WFMA 4GI1A 1LZKA 4KYVA 4KE7A 4HXEB 5E4YA 4NVRA 4BAZA 5EIHA 2HADA 3W9UA 1GPLA 1GKKA 5AKLA 1ORWA 5K3EA 1IVYA 5IVDA 1W4LA 2C5GA 2OQVA 5CT9A 4Y2PA 4KJXA 5K3DA 4JH0A 1XZMA 3WJ1A 1ZD4A 4UHFA 1DWOA 2ACKA 4GEGA 5ALOA 1ZD2P 4QLOA 3D59A 3HABA 1WCYA 3HZOA 1XQWA 2WSLA 1W76A 4GECA 1SCIA 3WKDA 1VKHA 5ISMA 4Y2QA 4AX4A 4X90A 2YXPX 3G7NA 3E0XA 5AICA 3MUNA 2WKWA 3HLKA 3K9BA 2G4LA 5EIAA 5EHQA 1VA5A 3H17A 1XZLA 1E8NA 4J0KA 4B0PA 4BE9A 3D4LA 4DNOA 1CEXA 4FKBA 1A8SA 5EI5A 4FLFA 4N5IX 1BCSA 3DKKA 5D3ZA 3VJKA 2QM0A 1F0PA 1CUGA 3WYDA 2VJDA 4WDRA 1QTIA 2WIDA 3LIPA 2PL5A 5HF8A 2JGIA 4KE8A 2LIPA 4MWTA 2WJ6A
chains in the Genus database with same CATH superfamily
3ELBA 4WNCA 1ANKA 4TXLA 1QH8A 4WN9A 2O5CA 2VJBA 1Z62A 2IYWA 3G8BA 3O31A 4QWWA 4WEQA 4X7BA 4X7RA 2AWNA 3ANNA 3SQDA 4S05A 4MS4B 1OXXK 1ZI6A 1F06A 2X41A 3C3BA 1K5PA 4JSTA 4WGFA 3R9WA 5EMKA 1RZVA 3F74A 3IJPA 4O2BF 2PSSA 1XC7A 1T0BA 3SQNA 1NSTA 3ZGXA 1GPBA 5KC9A 3KV3O 1X42A 3SJBA 3LY9A 1Z29A 2R44A 4IX9A 4MW6A 4ZXFA 3THXB 2ZKLA 1EU1A 3TBHA 5HM8A 1G38A 2AE1A 2H4HA 3BCRA 5CP8A 1I6MA 2QA5A 2B4AA 1X9IA 1YR2A 5TARA 1IUKA 4RLFA 3WZLA 5I7WA 3OC6A 3ONEA 4FE3A 2GF9A 2UKDA 4DCGA 4DDVA 2F2TA 3N9IA 1C5KA 1D8AA 2VRCA 1XA4A 3OQOA 5TX7A 2CBZA 2GM5A 2RJ3A 2ZSHA 5E1OA 2E4XA 1T5TA 2D00A 3QYFA 2YZNA 5AO9A 2EFDB 2Y27A 2ZIWB 3AV3A 2OE2A 1NRJB 2FSVA 3RBAA 4BBZA 3FI0A 1L9XA 4E1VA 2KQUA 1W96A 1N2XA 3FHLA 2FEXA 4JBYA 4Q4JB 4LDJA 3X1WA 4KR3A 1E4EA 1U1EA 3HBLA 3NTQA 5A04A 4AN1A 2HA2A 3TGPA 4MLDA 1E6WA 2AN3A 3WL3A 2Y3IA 5TC4A 4Y6GB 5CA0A 3QU4A 3GQVA 3UQYS 3CONA 4F4HA 4F92B 1Y37A 2DHQA 4JKYA 5JS2A 1VB3A 1ZSVA 3BIJA 4J0JA 3PTAA 3BWEA 3PZBA 4YO7A 4BP8A 1A96A 3CJTA 4ES6A 4CLRB 5TRTA 3OQ1A 1SIBE 3UH0A 4E15A 3X2SA 1KEWA 2UUCB 1MRNA 3NAQA 1VGVA 1EUZA 3C6KA 3WBKA 3KQLA 2P9HA 1KH3A 4G67A 3AKYA 3OPXA 3L8ZA 3TW0A 3EPHA 3RAFC 3M2PA 4R01A 4TZKA 5HIMA 5DW3A 3H5IA 3HHPA 4U02A 4HSEA 3W5UA 3A6PC 3P27A 2I62A 2YVUA 2QV7A 2IOHA 2PGNA 5I9LA 3DHNA 2Q99A 4G0WA 5EHGA 4BVBA 2JHGA 2ZRNA 3P0HA 2Q07A 2VDKB 3H1EA 3PFNA 4OQEA 3L6DA 5SICE 1IN8A 2HNAA 2ICPA 4R98A 3W2FA 4NZNA 4MGEA 3A10A 1Y6GA 3IQEA 1LFAA 1CR6A 1ZWLA 4KK4A 1UIMA 4PZAA 1D3AA 2CN1A 4QU5A 4F2GA 5JC1A 1NE7A 2Y6VA 2P0AA 3AUSA 4MQFA 4P7JA 4DXDA 4B82A 3SN6A 1QIIA 3EFBA 3LT2A 2VDLB 4NHEA 2HHJA 4ZD6A 3HVHA 4PSDA 5A5VA 1EHIA 4FMCF 1LTQA 4FOTA 5E4TA 1EK1A 1DAMA 4JL6A 2OXIA 1ZHOA 1T9KA 1QANA 4Y6SA 2P6RA 4JZYA 4WE3A 2QMEA 3PCTA 3K5HA 1E3TA 3WHIA 3VMFA 1KU0A 3K2EA 4EM6A 1XV5A 3NHKA 5BRNA 3O4RA 4K88A 4NOJA 1MJGM 2YHUA 1LMB3 1V5IA 2RGRA 3A8TA 3TDMA 3VKFA 4X20B 3WBFA 1E99A 2WG0A 3N2GB 3R41A 1G6OA 1VIMA 5IM4F 2KYRA 4RQTA 3HR4A 3C4JA 4NTZA 1NDQA 1YDMA 5IC6A 1P5HA 1JIXA 1M83A 2GTIA 3OCVA 3R7LA 3HACA 4GBJA 3GA0A 2A9JA 4TWRA 4KOEC 3WGJA 3WTBA 1Q0PA 5T64A 2O6LA 4RMNA 4PSVA 4X1IA 2XEXA 3ICCA 4WXPA 4Y8VA 5SZKB 3UPTA 4Z59A 3R3VA 4P7FA 1AY0A 3LUAA 3HB1A 2O8FA 4TV9F 5JWRA 2A94A 3L01A 3PNPA 1P0CA 1ZJ5A 2Q1SA 4MCXA 2FPPB 4GMGA 3C48A 3EDOA 1NWHA 4TL7A 3TRIA 2BAGA 4OQNA 1E9DA 5H59A 5TMEA 5K05A 1N8KA 2QRJA 3HYTA 4NULA 5CFRA 1QHEA 3GLFB 1S8OA 4DC1A 3TCKA 4QJ3A 1XGKA 2ZZKA 4K28A 5AI0A 1K0UA 4MI1A 5DNAA 2H1FA 4KSBA 4IHAA 5JFOA 4N4AA 2QPLA 3VDRA 4D9CA 3UW1A 2Q5OA 1RLTA 2IGBA 2AOWA 2Q6TA 2OLKA 3IDOA 3K0FB 3RRJA 5KYYA 1FLAA 3RVQA 2NTEA 2N0SA 1FU4A 4H7KA 2QNIA 2FMHA 3STYA 3SCFA 1E5LA 4LX0A 2P2LA 1ZUD1 3DE2X 3I23A 1YE5A 4X1KA 1IU9A 3LUJA 3P2OA 5ALZA 2OORC 3AHHA 1KC3A 5KKAA 3GEGA 1KY5A 1Z6GA 3R9KA 1RTTA 3OHSX 4LQ4A 2W42A 1SO8A 4CMEC 1UC4B 4LHVA 5K4AA 2OV3A 4Y2YA 3TQFA 2JJ1A 1JG4A 1W49A 3BD9A 1A8IA 1WB9A 4PWYA 2Z6QA 3PJEA 4P2BA 3O6VA 2Q50A 4QASA 5DF1A 5AQEA 4U9IS 3KL4A 1YV9A 2DC1A 2FOIA 4L73A 1LWOA 1EB8A 1F6DA 3EXHA 2PS1A 4POAA 4QQKA 1Y0BA 1N4DA 1Z3IX 3B7PA 4HADA 1A27A 5JSZA 2DSNA 2YWGA 4JBWA 1W87A 1L5ZA 1RXSA 2Q4DA 1BMTA 1OLSB 2G6TA 5TB5A 1FUUA 5B4VA 3D6MA 2IU0A 1X57A 1SD2A 2ZYIA 2GM4A 4YRQA 3O0TA 3UMSA 1OYWA 1SZCA 1Y7YA 1XWWA 5AQ1A 3JR7A 2O3UA 4JVLA 3ZN2A 2G40A 2OCIA 5AIBA 3DAHA 1R3UA 1U98A 4NV3A 3Q88A 4M0EA 3EXFA 5GONA 1CEEA 5HGXA 2AKEA 3G7SA 1ICIA 2V97A 4Y9RA 1UFVA 3NYIA 5A4DA 1AZLA 1S8AA 1FLVA 4Q03A 1U8AA 3KC2A 5TQ0B 5DNCA 2UYGA 5AHWA 2GBLA 1VLHA 2GN2A 4I99A 3PHLA 1LX6A 1G17A 4Y2TA 4BBJA 1G4UR 1DKMA 2GR9A 3MGAA 3W9SA 2X86A 4DDMA 4DT1B 5KNDA 1WBDA 1AE1A 4LJAA 3LX4A 1GP2A 4RK7A 3U7QB 4BO1A 4X65B 3DFKA 1N7GA 4BWGA 2ZVDA 2W6QA 4CWAA 1NYLA 2A0YA 1KI8A 3O3MB 4RKFA 5FD8A 4AN4A 5F3WB 1PV1A 3NGXA 4EECA 2JFVA 1GXSB 2LW7A 1UZMA 2ZXFA 4O08A 1HNZB 4GPAA 3CB4A 4IIJF 2IXEA 2WABA 3GPIA 4N8EA 3NVAA 4RZUA 5TQJA 4UD6A 2PIDA 5IJZA 2MQKA 5BR7A 3LHDA 1UXCA 1L4NA 4GZ6A 1N6PA 5JDIA 4DGQA 5JVDA 5FTLA 1H85A 3U44A 1N1GA 4ZRMA 1JLRA 2LYJA 1A5AB 1GL3A 1WVIA 2GBGA 3HM9A 1ZVQA 3EZ9A 1IY8A 5EWLA 2PUBA 5AHXA 3CLSC 3GYBA 3TRHA 4BGVA 5KNCH 5E95A 4Z2AA 4BMSA 4JCYA 2KM1A 4II3A 3ESBA 2RHMA 3P9KA 3RC9A 4JB8A 3S1AA 2JKZA 2BGWA 4Y42A 3VC3A 4BMVA 5B6IA 3OP4A 1Q0UA 2IXBA 4EFLA 3FOZA 3LPCA 4DLUA 1AX9A 3QPCA 2QPTA 4OFWA 3A37A 3E7PA 3V46A 1GL7A 3FUUA 4E5PA 4AQDA 4GKAA 4QUDA 2JFQA 3H2KA 1N9GA 4LNHA 1K9SA 1ZBQA 3MAJA 1H9CA 3GGDA 4B3RB 1C8VB 1E58A 3HP4A 2QTHA 2VBFA 1XXHA 3T5MA 4ZHSA 5SY4A 4F9TA 1X87A 4QBTA 1USGA 2VSFA 1FCJA 1PE0A 3AKCA 2C7VA 3CS3A 3DOCA 4DMRA 4MEAA 3T6KA 1R50A 3N0WA 1Q7CA 1RAIA 4F9GA 4O0LA 2AMJA 1FYVA 2E4YA 1JBKA 1C4XA 2WSYB 4BMZA 4BNIA 4DW8A 3MLFA 1O57A 2I99A 2QTZA 5EIOA 3IP9A 4LHWA 3MJVA 2ZB8A 5M34A 5LCXA 2YMLA 3BAFA 2JDIA 1EFVB 3BFJA 2IBMA 4E4TA 3H5TA 3WLLA 5E9QA 2Z6UA 4LRWA 4GKKB 1C2YA 3DMNA 3FCUB 5FWDA 3QI7A 3N8NA 2F1IA 4BATA 2BHLA 4QUHA 4MLCA 4IV8A 2G08A 2MDTA 2O8DA 3DV9A 1ZP6A 1P1HA 3WGTA 2Z8XA 1II8B 4GZ3A 2Q8PA 4LE1A 1KZHA 2XHEA 2RH9B 3BDVA 3EVAA 5NULA 1V11A 4O4IA 1W36D 5FLKA 4ZT7A 2HT6A 1YBVA 4ZVSA 3IE1A 1EVJA 1DAEA 4TS1A 1MD9A 2G8NA 1BG6A 1H2AS 4X1YB 2NXJA 1MC1A 3V4ZA 1PKEA 1N0UA 1HR0B 5FLXA 1O08A 2C9YA 3STVA 3ZD9A 3FVVA 2VZLA 1A9XB 2FWBA 4UAGA 4PZUA 1ECBA 3F3YA 2UVPA 3VR0A 4QDJA 2H6EA 3B60A 3N05A 2PWPA 4X45A 4EB6B 3KE8A 1I3CA 1XCOA 2B4TO 1ORIA 4KXMA 2WFZA 4H3SA 3FSGD 1EDEA 4KC0A 4OJQA 4V0NA 3KT3A 3TOSA 5CDGA 2ZTHA 3O4VA 3LU1A 1T6BY 1NY6A 2ZPAA 3L6OO 3P2IA 5AI6A 4CHTA 3S40A 5CIWA 2BEVB 2Y1LA 1JJ7A 1SIUA 3SJZA 4JENA 1Z34A 4MUFA 1TU0A 4AZ3A 4D3DA 4F21A 5K8VA 3FIUA 1KWGA 4X60A 3RSFA 5EE9A 3ZU2A 5IAAA 1YRAA 4PBRA 3V5NA 2J41A 1OUMA 1ADGA 3KQWA 3VO2A 4LPSA 4IEFB 3WB2A 3OEED 4PAMA 1OZHA 3IUEA 1ODFA 2DUJA 3CUYA 2Y1EA 4XQCA 1V1MB 2PU5A 2RIPA 5DZSA 4XARA 1H2WA 1RWPA 2D74A 1QR2A 1SXJD 5FRDA 3KSUA 2QYTA 3H75A 4GX1A 3OJFA 5ED4A 1AQUA 1UJ2A 3DP9A 4I1RA 3NIBA 1ZPDA 1E3SA 1OD6A 3EFOB 3R3YA 4DADA 4YPVA 1O96B 2I22A 4YCNA 4MUGA 4IDNA 2HD4A 4KPUA 3CX3A 4OA5A 5FUVA 1KHHA 3PRJA 1YHNA 1Z7BA 3T41A 2I91A 1JFLA 1M1YE 6YASA 3AR3A 3KPJA 5JNVA 2JFFA 3HLYA 3E1GA 3LOUA 2VXCA 1E0DA 4J91A 2OYCA 3WWZA 1Y5LA 3NBFA 5EE3A 3JPYA 3SK0A 2IXFA 5E4FA 3W8RA 4RKQA 4BBAA 5A4AA 3TPCA 4GOMD 3W5IA 1VHLA 2QGFA 1BTOA 4UEJA 4DIFA 3GFQA 1KZ1A 3L02A 1HOXA 5EYPA 1ODSA 1HSZA 4HH4A 1VDMA 4KQ6A 2W48A 2ZZNA 2R66A 3R09A 3Q3CA 1KQPA 5F5XA 2FVYA 1KDTA 4PLHA 4MKHA 3BWDD 1S1CA 2KEKA 3HN2A 4XWOA 3DM5A 1XZBA 1PIWA 2QTVB 1C0PA 4B4OA 4P4NA 1D2RA 2VA9A 1E3MA 2XY4A 2QT9A 2I4LA 3GROA 2KSQA 3WKAA 3CZ4A 4HLNA 3TZBA 4OATA 3F2IA 4L74A 5DX1A 5A4MS 3EVFA 1IBKB 5LP6A 2EF8A 1FEZA 3L8CA 2JJYA 4ENRA 1US8B 2C1XA 1TLTA 3ED5A 4M9ZA 1RYFA 3SHFA 5A03A 1DC8A 3Q6IA 2KEJA 1XCPA 3H16A 4JI2B 3VTZA 3ZIUA 2FA9A 3AF1A 4MP6A 1YH3A 1PEKE 2FN4A 3T4EA 4EFNA 3BXOA 4QGHA 2Q5JA 4FOSA 3CE9A 1A9QA 1R9GA 3BHNA 1YIDA 5J9FA 4J43A 5GAJA 1WP4A 2B1RA 3L0CA 4AO8A 4DUYB 2E9SA 4M88A 2J6BA 2B3DA 2DUNA 2PE5A 2I4NA 3IVMA 3K5WA 4EQ6A 1CF9A 5D5PA 4IGKA 1UBJS 4G89A 2NXCA 2GRLA 3I04M 4HAOA 4OB8A 2GA9A 4LZNA 4R1SA 4UBKA 1VBKA 2ZULA 4KNVA 3BIXA 1OLOA 2ZUEA 3QFHA 3OPVA 5DHUA 2D1FA 2KEIA 3DBHA 5HS4A 1XQ6A 3QX9A 3TEJA 1US8A 2NO0A 1E2GA 2Y1KA 3IXLA 4HOYA 3Q7QA 2XH8A 2H1VA 4PQGA 2IDKA 3HB4X 2F55A 4XB6B 2PY6A 2ZS9A 1JDBC 3RKSA 3UT5A 4A16A 4NJMB 1Z4LA 5KYVA 2KW5A 1R64A 3OZFA 1F6WA 5D2CA 2I6FA 3ROFA 3UGQA 2X9NA 3KPWA 4QPCA 4WY8A 2I6GA 3GFTA 4NE9A 4HNVA 1YE8A 2BFBB 3UV7A 3ND6A 1JLHA 2BEWB 4Z0HO 1F8GA 3K2QA 4KTTE 2W4IA 3SE0A 1A9SA 2H3HA 3O3CA 1RJEA 5AJZA 3L93A 4EYEA 5KVSA 1XF9A 4MDFA 4IVQA 3DH0A 2F4VB 4YRTA 5TF0A 3GFFA 3U1VA 1E6KA 4RK4A 4HRAA 1Q2UA 2AXQA 3EA4A 4M21A 1RWMA 1SXHA 3PXAA 4LHZA 5F1OA 3C2QA 1PK7A 1QRTA 3Q7SA 3F1LA 4HAUA 1Z06A 5G4KB 1CVLA 1Q84A 5I8PA 3REQB 1M6VB 1SNYA 3E1KA 1Y9QA 2NU8A 1JHOA 3LUHA 3PGKA 3GLHE 1J7JA 2OAQ1 1N2IA 5DYWA 2XDQB 2K4MA 3WY9A 2EBYA 1RWNA 5G3ZA 4E11A 3VR1A 4PSUA 2X77A 2H7YA 3LZDA 4ZJUA 1HBJA 4FP9A 4EHNA 4PX5A 1PAUA 2GF0A 1R7RA 1U7ZA 2VK1A 3KAKA 4KIFA 4G1CA 4ZI7F 5KTYA 1Y6FA 2BJVA 2WKRA 3GQBB 2B1IA 2QYSA 2X0RA 5ESDA 5I7SA 5KQLA 3U4QB 2B4QA 1JEYB 4J76A 3DAPA 3HXKA 1O5TA 2ZWPA 4IY1A 2MJLA 4GI2A 3WNDA 2YWDA 3PBKA 1ZPQA 5HR5A 3ETEA 5DEOA 3VWSA 2AOUB 3LVBA 1GNPA 4QBIA 3KTAB 3VQTA 2QTLA 4YRFA 3H1TA 1GTL1 3G0GA 4F4UA 2FPSA 4EZBA 4B71A 3MS4A 1PFGA 3HP7A 1QP8A 4KUEA 1NUSA 4GVPA 3ZE1B 3R8FA 3GX1A 5GVRA 3GZNA 5HJ7A 3F73A 4LGVA 1H2BA 4RF4A 1Q12A 3SLGA 2VJOA 3F5MA 2D2FA 4D8YA 2WWGA 3EXEB 1VMDA 2ZCVA 1FDOA 3QNMA 5ILQA 4BGIA 3CEHA 4BNWA 5BUQA 7MDHA 1CRWG 2NZYA 4NIMA 3D9QX 2V7WA 3RBXA 1VE7A 1TVCA 4MV6A 1ZJ6A 4ZQFA 5BV7A 1M34E 1XLUA 5D3MB 5M5BA 3HLTA 3OEHD 1O0CA 4I9NA 3V2HA 3IPAA 1RHRA 2J4FA 4IXDA 3AEUB 3DFUA 2PBLA 2WQZA 4YBAA 1IN4A 1KZYC 2CNKA 2ODQA 2DFNA 4JX9A 3AC0A 3MJRA 5ALFA 3IE0A 2B0CA 2VF5X 3OTOB 3P0IA 5JAOA 1LSUA 3I5XA 3OH8A 4B79A 4OTZA 1G7SA 2I6TA 1MXFA 2YJ4A 3JD3A 5DRYA 4CIVA 1RYYA 3A70A 4P54A 5JMTA 1Y42X 3KUUA 1BU8A 3N2ZB 1OBHA 3A4TA 1E7WA 2ZIVB 1G8JA 3NEAA 5MFZA 4F3KA 3IVPA 3E3MA 5LQRA 4ZJYA 2CJPA 2XE7A 4MB6A 2ZBGA 3S55A 1A76A 1PBNA 1WUKS 3VZPA 5SYMA 4J1XA 3WQBA 1P73A 2VP6A 4MVXA 1VI2A 1YASA 2PA3A 2IS2A 4YUWA 1LTKA 3VH3A 3QVKA 4A23A 5FAKA 5JJBA 3DM9B 1GGNA 2XUFA 1U6JA 3R8CA 2JH3A 3JXDL 3E4DA 3ID6C 2QEQA 3S68A 5JQGF 1O8BA 4H6VA 1SUDA 4JKIA 4RVUA 2I29A 1MJFA 1CNMA 1UK6A 3JZDA 3JVIA 4YR7A 2WJZB 4IV0A 4J9VA 4MUEA 1QO9A 1AF4A 1LXCA 3MBOA 2MCFA 3V55A 2IYEA 5B4TA 1WAMA 4W7IA 1I8TA 3QEOA 2Q3DA 3I5MA 4EUEA 3PB3A 1ZNXA 1JFRA 3KJHA 1M67A 5FULA 4YJHB 3KEOA 2A1UB 4ZCMA 2X58A 3FOEC 1KHTA 5EWMA 3P71T 4PSCA 5JISA 2V65A 3EIQA 2KLHA 4V0LA 3PCRB 2R7KA 5BOSB 4CKEB 1JSLA 1KRXA 5DTJA 1X38A 5BSFA 3WO0A 3TOCA 3C3XA 1W88A 3DZBA 4MRSA 1GSAA 3BF7A 3W2IA 4CM4A 1A9OA 4O29A 5WRFA 4E94A 3L8GA 1M6HA 1AB5A 3K32A 2GZHA 3CGWA 2O2ZA 3JQPA 2F59A 2WR8A 4C6RA 4DG9A 3ZIAA 4BP9A 3EIUA 8MHTA 4IQ0A 3MCAA 3RS4A 3PGVA 2YR0A 6ABPA 4JVSB 3FDIA 4Q3NA 4QTTB 1M6NA 1EAYA 1NVBA 1ZK2A 2P7HA 2ERYA 1NLZA 2HFJA 4EATA 2GVNA 3CRZA 4I6JA 4CCYB 1JALA 2QT0A 4MVJM 4MUNA 3F4KA 4HWKA 4M9UA 1KJJA 7ADHA 3ZWCA 4FBIA 2OOSA 2CFCA 1C1HA 5CH5A 4CQMD 4S12A 4XFJA 2V0NA 4KQHA 4ZTBA 1U3CA 2HMYB 2Q0SA 2TS1A 1ZL0A 1X7ZB 3QXJA 1GN9A 1WO8A 2GZRA 3DKVA 2SNIE 2P9GA 3JALA 3IMGA 3FHJA 4NEGA 2QLTA 3F0TA 4UMVA 3IEPA 4JEIA 1ETHA 1AGYA 1KP9A 2OCAA 2BKVA 3UWDA 1BC5A 1F3OA 4H7FA 2AL7A 3ZHZA 5FJIA 1AB6A 1M72A 4UHEA 3Q2OA 3QLEA 2P40A 2RK4A 3F47A 1X19A 1EBUA 3AM1A 1IC8A 4B8WA 3HC7A 1L4YA 2P9BA 4CM1A 2CD7A 4ZVNA 4Y0AA 1TKCA 2G07A 1GOTA 3HYCA 3PGJA 2HRCA 1NBIA 4LY6A 1K5GA 1C9MA 2AF3C 3W06A 1P75A 2BSAA 2BISA 2YJ6A 3E4CA 4IOJA 4P1ZA 3BMNB 5CAEB 1M1YB 4A1FA 2VF7A 3W2EA 1JLMA 1U2QA 2EHDA 4GKJB 2YXBA 1O97D 1C0LA 1Y89A 1AS0A 2I78A 2P8SA 1PUJA 2PT7A 5ALUA 3VHRA 3C16C 2P2ZA 1FFXB 2Y2VA 1BH2A 4JLWA 2H1WA 4ENVA 1T4DA 2I66A 1ZZBA 2WUSR 3U7QA 2V7TA 1YQDA 1XZPA 3F7NA 1CUDA 2ZE5A 3F67A 1C9KA 3ED1A 4OQMA 2H2WA 5GOTA 4D9KA 1BSVA 4A6DA 4EB8A 3C39A 5LN1A 1NN5A 2BKUA 2GZMA 3EXG1 5JCOC 2BVNA 2FW0A 1UC8A 1H05A 1SC4A 1DRVA 1ODKA 1T1IA 1W9HA 3QFCA 3R6TA 5JSYA 4BVAA 4DUGA 3B6MA 4JEMA 4TLEA 3V4OA 1U28C 1O94A 1YONA 1GILA 2PKXA 4N03A 4RK1A 4B4KA 2CNLA 1Z7YA 1CVIA 3I9OA 4NESA 3U44B 3GRFA 1BW9A 3WBJA 2ZRCA 4FGZA 2WA1A 1Q1EA 4F85A 4NENA 1JG7A 2IE0A 2Q2OA 1E1YA 3FVWA 4J29A 4NCNA 5JXGA 3MIIA 3FCAA 1V7CA 3H6KA 4IF6A 4G4SO 3D5EA 3N6RA 5C80A 3AJ8A 3CJRA 3LZ6A 1Y3HA 5BSKA 2WIAA 3TM4A 1E3EA 1QNFA 4IDBA 2XMBA 3FKSA 1NP7A 2GAJA 2Z9DA 5CH8A 3VJLA 6ADHA 5CD1A 1CZNA 3IAXA 4JAVC 1MB2A 2CVFA 3F3KA 4X61A 2PAAA 2PQ2A 3NANA 4QRHA 1RYNA 4AYTA 4DNQA 2NAFA 2XB9A 4RVFA 5DLEA 2PH3A 3S2EA 3DMDA 4NZ9A 4FX5A 2VBCA 1JH9A 4RD0A 4FPXA 4BE7B 4HNQA 1T5LA 2X0KA 2PZAA 2EP7A 3O8LA 3IFSA 4KQJA 4HX2A 3HCDA 3M3PA 4IGIA 4R7GA 4DARA 2FMTA 5KYXA 5C8YA 4WRRA 1CSEE 1PJRA 2LPMA 3QIAA 1PS8A 4DBLE 4K9RA 3D6AA 2VDRB 2COKA 4JGIA 4QXPA 4YCJA 1R0YA 2X5OA 4AZVA 1ZH4A 1WETA 4WXYB 5BSHA 4WZAA 4G24A 1ZCJA 2ZAIA 4YRJA 7REQB 1RCUA 3DB2A 1R4ZA 1CUXA 3TNDA 4Y1FA 2ETXA 3K1AA 4NBRA 4WACA 3Q9NA 4BV8A 1ECFA 3IT3A 4GR4A 4DIBA 1IZYA 1KEZA 3H0CA 4XIGS 2QW1A 3INYA 1NQVA 3T7SA 5DNVA 3MTAA 4DR1B 2DWQA 5EZYA 3F9CA 4UXHA 3LBYA 4HF7A 5DM0A 4D25A 4ZICA 1X1TA 3I1YA 5TE9A 2JVKA 1POUA 2ODPA 4LOHA 4RYDA 5IJ0A 1ECCA 1JMVA 1EQUA 3RSCA 1K98A 1PTJC 3ZZ1A 3FYTA 5AW9A 1Y9AA 3PI6A 2R97A 3ROZA 2J9XB 3TEPA 3ANSA 3QOWA 1M0SA 3DUWA 3ITEA 3L1HA 4CV1A 4Q4CA 4P98A 3S1LA 2P4UA 1DAKA 1VL2A 1NNEA 1AUQA 4OI1A 1CQPA 4G8JA 1XJQA 1ZBDA 1QYWA 1G8MA 2X42A 5H02A 1OFGA 1K97A 5JEDA 1T6XA 3G2IA 1L7OA 3U40A 3ABOB 2WY2D 2JG3A 4JA2A 5J4KA 3MINB 3OKCA 1R4AA 3NM4A 2P9YA 1RPTA 4G25A 3X1MA 2MSNA 3HMQA 1YJXA 1OC2A 5HUQA 5ITZB 1E32A 3CLTD 1Z6XA 5LLTA 3OAAA 5K3SA 4WTOA 4UAJA 5JATA 5ECYA 1FXWF 2PN1A 3DQZA 1CKEA 4O8CA 5FOQA 2ZI3A 4OHXA 2C5AA 3VDNB 3ZBTA 3ZH2A 1H0RA 4LXUA 2GBFA 1ZXBA 1IXRC 3OZVA 3WQSB 1I5RA 1QIJA 1YHYA 2V98A 2VRBA 5FFNA 3PD7A 4CKZA 5DLYA 4BV3A 5C2JB 3ZDBA 1XEXA 2I4TA 3OWOA 3EMVA 3T3PB 5IJ9B 2VEOA 4JFRA 3IUPA 3LUCA 1XI2A 1VTKA 5ALIA 3OQPA 1FTGA 3GARA 5AK3A 1CS0B 2Y4OA 2JGMA 3NBUA 2QLLA 4TX1A 5FI0B 4NJEA 2B20A 1R16A 1HT2E 1QS0B 4W1RA 3ZHYA 2O38A 3GUUA 4I5FA 4BLRA 3DL0A 5EJMA 4F1WA 5ES4B 2D2XA 3B52X 1HO3A 2IEZA 1I6LA 1Q77A 3TIFA 4PYJA 3NBKA 3IPRA 2EFHB 1HTBA 1IDOA 3HU1A 4F2PA 1WUIS 3OZBA 1PQPA 2OGUA 1LCIA 2QRNA 3O94A 2W43A 1KZ7B 2IEGA 1JMYA 3N8DA 4HX5A 2HCRA 1LJUA 5FHQA 4ETIA 3QVGA 2FWMX 3GJSA 1X15A 1NKVA 4R2HA 4AECA 3W05A 4HUQA 4TM7A 3T4PA 4P80A 2WNHA 1NUPA 1XX6A 3FSEA 4L7QA 5FUXA 1ST3A 1M2FA 4AP5A 4AZ0A 5FUWA 1QZUA 3I9LA 4OXQA 3SZGA 5KNBH 1NPTO 1ZY2A 3RCBA 1YF3A 2G83A 3D8BA 1HQYE 1U5BB 3BE5A 4ILEA 3EEOA 2AZXA 1Q6YA 2HIHA 5KI6A 4QDXA 3ROGA 3CRW1 3AVPA 1SQ8A 1GTMA 2I34A 1Q83A 1EFAA 2C0CA 3KV1A 5J63A 1BH6A 3EQ7A 1YJQA 1NU8A 1HLDA 3TQIA 1FMFA 5H81A 2JZCA 4YDSA 2C4TA 1MV5A 1CS4C 3V7NA 4BAUA 2EZTA 3E9NA 3LUKA 2WBLC 1J8VA 2HM7A 1KO7A 4K9OA 3IJRA 2HFKA 2BM8A 2WOJA 1EVEA 3BKXA 3QE2A 5CB4F 4HNTA 3FHTA 2JLVA 1OW3B 1Z0UA 3EMKA 1W4BA 2ON6A 1FQOA 4PV7A 3PQ7A 3I2FA 4OPMA 4MYHA 1TKBA 4MIEA 1Q1GA 2DKFA 4C05A 1AJEA 3WHLA 1W5BA 1CQJA 2I71A 2O05A 3HXTA 4HYEA 1SK9A 3NS7A 3A3KA 3TZEA 4BFSA 4XR4A 2WYIA 5ETJA 4D9FA 1R4MA 3A4MA 4LKRA 4YP0A 1LS6A 1LVGA 2Q9CA 4Q9JA 4FOOA 1QQ5A 1IB0A 4GLOA 1W0JA 4IQ4A 4TSFD 3E3LA 1SUIA 5CT5A 3QYPA 3PC2A 4QDTA 3STTA 3QEJA 2PHZA 4DM7A 1XXLA 2RI1A 4GWLA 1POWA 1GPYA 3B3QA 4R1PA 2ZIXA 1GFSA 3VOSA 3EW9A 4A10A 1AKRA 1C8KA 1E62A 1NUQA 2IEAA 4M36A 3TTXA 4M8KA 5ITZA 5KJ1A 2IS6A 1PJZA 1XO1A 2JARA 2Q4BA 3QHAA 3HL4A 4M98A 4LF5B 1KRWA 2G4VA 1VE5A 2Z2IA 2VUIB 1TEVA 3EUFA 4I2VA 1FP4B 4TMKA 2H63A 5I51A 4GDMA 1XTUA 5KCZA 1N5OX 4I1IA 4QECA 2Q2NA 4QYWA 5E9AA 2Q1TA 2XGMA 3DF9A 3NC4A 5K8CA 2P5TB 4JB0A 5IASA 2HPZA 5JYDA 3DZKA 1H4VB 1YNSA 1T2AA 2C5FA 2HA3A 3UNXA 1S5PA 2ORIA 4J07A 1PQWA 2PIJA 1NXVA 1JUDA 3IA2A 3OY2A 3DZHA 1H3EA 3F3SA 3CA8A 3PC6A 5K6AA 1P81A 1UIRA 1P1BA 2G71A 3SYRA 4NCAA 2NV2B 5E1DA 1E5VA 3GLIA 3A26A 3KZCA 5L8VA 4PLWA 3DC7A 3QG1A 1GTJ1 1J8YF 1FRNA 3HFSA 1MJ5A 1XMOB 1H2XA 4FBGA 1HGXA 3DJYA 2ZVPX 1P7VA 1REQA 3H2ZA 2XLCA 1I1OA 4QYXA 1N2CE 4CT4B 4DAOA 4Q9AA 3TUZC 2IH4A 4JYPA 3ZHXA 1EWVA 1NJ1A 4MW1A 4I14A 5J2TA 2BHSA 1MJGA 1SBTA 4H3HB 2G1JA 1EA5A 1W59A 4NKRA 4UCQA 2IH2A 4R6XA 2O4CA 4WCFC 5C81A 3FDJA 3HG7A 2GRJA 4IDPA 3GC6A 5GAGi 4N82A 3C6YA 2EDCA 4JU8A 3RUEA 3OP9A 2RH5A 3HVRA 3AJEA 4Q93A 2FVXA 3G68A 5JBNA 4FYVA 3PYLA 5F51A 3H5LA 2P77A 3OFJA 1YUBA 3QE0A 4L6AA 3TF5A 4C20A 4ZOLB 3O3NB 1HYGA 3IT2A 4X6XA 1O5OA 5KAPA 1BN6A 3G5TA 4GD3Q 4D26A 1JJIA 1JRLA 5CU7A 4EGAA 1BXKA 4UVHA 3HCBA 4OQDA 4MKIA 1ZI9A 4P82A 3RFXA 3ZHSA 5JADA 4CCAA 2F9FA 4EJSC 3C5HA 3KKZA 1XD8A 4JYMA 3RH0A 2QTAA 1U8EA 2VPYA 4IDOA 1C8BA 5EKXA 2P67A 1O4VA 3W3ZB 4UMDA 1PZHA 1ONNA 3URKA 4MGYR 4RXMA 1M0WA 3IIMA 4TYNA 1TAHA 3GLUA 2WK1A 3O9ZA 2IUYA 5HKKD 3IUQA 2JL1A 2QRVB 3EQ8A 4UVEA 1ZZ7A 3L6BA 2KX7A 3O8RA 3F5FA 5AVRA 4HLDA 1ZJYA 4F93B 4UU7A 2IW3A 1T5HX 2LYLA 3ETDA 2BM0A 3ASYA 3F5DA 4FI3F 3RS0A 2FRXA 5KU7A 3J7AC 3DKRA 4W8HA 1E2BA 5D5HA 3FLMA 5TS2A 4DIDA 1PV2A 1S3SA 2QORA 2V3VA 3JVUA 3DBIA 4WZBA 4XSGA 2D1SA 3T95A 4K7JA 1CHNA 1BDJA 3MSCA 4N0PA 3GBFA 4UBOA 4YJFA 2EBHX 1KVQA 4D45A 1ZK3A 1Z4PX 1GQYA 1K68A 1ULZA 2EBUA 3GV0A 2EFJA 2GK4A 3DL7A 4CDMA 2PTGA 4N54A 2UZAA 4ZOBA 4C7VA 1I3NA 3CUWA 3E58A 2YVKA 3IJEB 4PF1A 1E3IA 3WL5A 2FFAA 3SXJA 4EA9A 3THWB 2OGZA 1TMYA 1Y9EA 3HU3A 3LWBA 4V39A 4HQ6A 2DHRA 3ZXXA 1U8ZA 5LOVF 4I1VA 3BEOA 3AG6A 3DL4A 2CFTA 1GZSA 3OD5A 1DGQA 2GNOA 1MC4A 2G8LA 2GN6A 4YRBA 1S01A 3DCNA 1WSBA 1N0IA 4Y6PA 4RA9A 3D4BA 3GLHA 3PF9A 4BXOB 4ICIA 4JXXA 1K7EB 3JCZA 4IX1A 1JXOA 2VDWA 5HCIA 1PR5A 3K70D 3C3MA 3HFGA 3S44A 5FO1A 4E0BA 3TTWA 2P9FA 2QAIA 3RR2A 3F6PA 3K1JA 2CLCX 4MV8A 1KGDA 4OIMA 2NU9B 4WADA 1QBKC 1IDN1 1OGIA 1OZFA 2VH1A 3IQWA 3M6IA 1TZJA 4WN3A 4E4YA 2Z1NA 1GQOA 3DEIA 3LLMA 3OZSA 4MWZA 1MFPA 2OXRA 5KTTA 5CURA 3TRJA 1IN1A 2GHIA 3USES 2H65A 1FNNA 3BTOA 4QUIA 1FVHA 3FRIA 4MS3A 1EJ0A 4BO3A 2P65A 3IP5A 4CDNA 5C1DA 4D98A 2JIZD 4I3FA 3G5AA 4BC0A 4DA9A 3ZJTA 5CDUA 2PZGA 5JSQA 3VPXA 3Q98A 2TMDA 3HCNA 3THOA 3FBWA 2PT6A 4A0RA 1CLEA 2ZSDA 4YWJA 3FNHA 1NZDA 3E27A 1ZN2A 2QN1A 2OUIA 3GN1A 4UHJA 2NU6B 1E69A 3OMXA 3QKRB 4DSZA 1S3GA 1H1LB 2B69A 3WLMA 2HIAA 3K8OE 1TD1A 4NPAA 4PSAA 4MUXA 2YUTA 3H11A 3CN7A 4WLUA 4C4XA 5HTOA 1Q14A 3SVLA 1UKZA 4JLKA 5ALRA 5KVCA 4PE5B 2HDNB 4J90A 4GX2A 4L50A 3WK9A 5A4IS 4DA4A 1QRDA 1P2SA 4GC9A 2R4QA 1J5EB 4DBZA 5D87A 3AXTA 3B1FA 3ZHBA 1U7DA 5FYQA 1Y4ZA 3VOAA 5BPHA 5IVKA 4U2GA 4EY4A 4QGFA 4B6JA 3RK1A 1CJSA 3AB7A 3CPJB 4LI0A 3SC6A 1LBSA 4BNDB 4CUJA 4EI2A 4A92A 4CTNA 2JIOA 2XYQA 3ZVLA 4KNYA 2WILA 3WLAA 2J0SA 3C1AA 2HH9A 3GAZA 2W6NA 4GGPA 4H6PA 1YWGO 2TECE 5JLAA 2ISCA 3TDNA 3W5JA 3KWFA 3EYAA 3G59A 2EARA 4LHXA 2C83A 1W581 1RD4A 3BWYA 3FNIA 3ZW7A 1ZUWA 2DBQA 2IU4A 3QIVA 4ASUA 1RKQA 4BO9A 4LC9A 2FJPA 5LM3A 1SUEA 4HDSB 1P74A 2VP2A 1Q16A 5DYTA 2QOEA 2DUUA 2WUFA 2GEDA 1FXSA 3OLCX 1XNRB 2YHAA 3VJRA 1ZINA 1Y1TA 4N9WA 1BDMA 3SS9X 1G59A 5ECDA 4C5CA 5KQMA 2ZUFA 4QYSA 3EY4A 1SVNA 1T34A 1ZGGA 3G6WA 5LQCA 2JAPA 4MGZR 4AJJA 4OH1A 3HYNA 2C94A 2DKOA 4HAVA 2B30A 3HZHA 4OHWA 2V7PA 1DQSA 1JFFB 5COBA 2HMAA 4OYRA 4KTVE 3KJFA 3SBDA 2RFLA 5AW0A 2QQ0A 4KWHA 4K6HA 4TLBA 4CLOA 4KE9A 2PSFA 4JIGA 1YKSA 4KZPA 3NJ8A 1Q95A 3SF0A 1NZFA 1TJ4A 3SS8A 3A9TA 2W0SA 4GBED 4K26A 4NZPA 3P1JA 4H6WA 3OC0A 4KI0A 3QP9A 1RKXA 3EXAA 4MX8A 4DVGA 4EMUA 5AVXA 5JECA 4EHDA 1ZD8A 2R84A 2FK8A 2HXGA 4AJNA 4AWXA 3IQGX 3L7BA 4WBNB 3ECAA 1GLVA 2JW5A 1DJMA 4I8TA 5HZHA 3ZKAA 1VHJA 2Z30A 4J7CA 4BCCA 1E92A 3SLRA 3VR3A 2BGTA 3EZ2A 4LYFA 5ALPA 3ZS9A 4JVMA 3DBVO 2DBRA 2Y1CA 1JN0A 5AHRA 1LX7A 3V1UA 3CUTA 3PNSA 3PR3A 4CXMA 3ICPA 4ZQGA 1PK9A 3GVIA 1JF8A 4XW2A 2OQRA 2P4QA 1CR1A 2OKGA 4C4TA 3VC7A 3ZCRA 2R1JL 3QUAA 4JJAA 3RT7A 1PT7A 2C3UA 1LK0A 2I3BA 3ZI0A 1V16A 5BSGA 4XSVA 4YRRA 4OX9Y 3B85A 1B73A 1TGYA 2GCNA 2H51A 2PPVA 3ONWA 3PKZA 3SQWA 1L6IA 1II9A 1RQNA 1YL7A 4Q24A 4XH9B 2Q7OE 1OWOA 4ND4A 1XTJA 1EAMA 4EKGA 5EJAA 1OXBB 1E2PA 1X7WA 2A5YB 1L4EA 3KTDA 1XZFA 1KEUA 1YZLA 1VPVA 1JL3A 4ASUD 5BUCA 1K9VF 1UQTA 1Y98A 1MDFA 3LUBA 1XT6A 3ONNA 3QZUA 1NXWA 3NORA 1K2VN 3R3HA 4H4CA 2HHAA 5JO9A 3MK31 3TRKA 4BQOA 4COOA 4EDFA 5BN4A 4P0PB 3MWJA 4FN3A 1ZRSA 4OEHA 4CDRA 1D6SA 2FWNA 4YMUA 2ISSD 7REQA 3TXYA 5DNEA 3BGVA 7YASA 4RX1A 4QOGA 4L8LA 3WMRA 3AUFA 3D1JA 1KAEA 2H48A 2CY0A 1VOTA 1RS0A 3EY9A 2HK9A 4C4YA 5JVDF 2BFEB 2BFCA 2W6IA 4EKYA 5JLJA 2CXOA 1I0IA 2E87A 4HN4B 1GGFA 3TVYA 5KSOA 5KPJA 2BZ0A 3HCAA 4I9UA 2E1RA 5JAIA 1LC0A 2CE2X 4YT2A 2QJRA 3WL7A 3U4CA 2WZCA 3I73A 1VSUA 3ICOA 4KOAA 4QOJA 4P2GA 4CTJA 4ER0A 1ILWA 4N9QA 4TV8B 4F3YA 1CRLA 1NASA 1CRPA 2HBQA 4YV0A 3QBVA 3AEQB 1E1DA 1FYDA 2XB6A 3PT5A 1YJ5A 5KB3A 1JR6A 2P9ZA 1V3VA 1B7GO 5AUNB 4OL0A 3ORYA 8ATCA 2D7DA 1XPJA 4E31A 1CZHA 5J2UF 4PQFA 5IKXA 3K94A 1EE1A 3EULA 3QQPA 1WB4A 2QQEA 4PW0A 4X85A 4CL2A 1NF8A 2XCSB 1LW7A 4KFCA 1Z45A 2HO4A 2ZR8A 4NECA 2PXCA 4W5HA 1ZH0A 4A0FA 4CV3A 5BWMA 4YP7A 1PFUA 5HK9A 5L51A 4HLCA 4LC0A 1L1RA 4YP6A 2HAEA 2OXTA 3SYNA 1GV0A 2VXOA 1C4KA 5IARA 3RIGA 3WGIA 3VV2A 4QEZA 5CR9A 1KAMA 2R60A 2QMYA 4HQFA 4X92A 3T5BA 5ADVA 3L7DA 3B7GA 2A3RA 2QTGA 2OM6A 3P45A 4C0QC 3VZDA 1TAUA 2WPNA 1Y9DA 1QHHB 1M2VB 3CO5A 1WQ3A 4IH9A 5LIPA 2IYFA 2CUZA 4LZZA 1DIGA 4V1CI 2GKOA 2RH8A 3IKTA 3SX4A 2GRMA 2OB2A 1DZ3A 1FTSA 3FOCA 1KRHA 2I87A 1QV9A 1R0SA 1CJKC 1RU3A 2RAPA 4PLFA 3CKYA 4WKNA 3PQ2A 3HJRA 4ACBA 3K0AB 5A9SB 5JWOA 5K8LA 2F64A 2OCXA 3TW8A 5CEJA 5KOYA 1MO4A 4RE5A 4UUNA 1C1XA 4OU4A 3STXA 2XJ3A 3HNRA 1DTSA 1U3WA 3MTIA 2A33A 1KY4A 3JYOA 4HGPA 4PLGA 4MS4A 4Q9NA 2ARKA 2XAUA 3DLIA 4RY9A 1OSNA 3VUFA 5AW2A 3O26A 5JRZA 3AF6A 3TCNA 2JFWA 3E7XA 2LCQA 3ZWPA 1J2UA 1IBCA 1A8HA 2RGAA 4A2CA 2C7BA 5I4KA 5JPDA 3VUEA 1MXHA 1TRKA 4DDTA 2WLSA 3LW8A 4OVKA 2WUGA 4DDHA 1KK1A 1HFJA 1M2VA 1QG0A 4GI7A 2R8BA 4XRRA 1O9BA 4YACA 1DIRA 2A84A 3LDGA 5IVIA 5T3YA 4B2PA 4FHDA 2E4WA 1N5DA 2JGNA 3HCEA 2CSFA 4Y30A 1WIWA 5CJPA 1UKAA 2CLLB 5T4FA 3T8YA 5A9RA 4OYLA 3R9IA 2YXLA 1SVUA 1A9YA 1NX9A 1XJWA 4MUMA 4K9NA 4YMGA 1IWPB 5T6BA 1MB0A 3D3JA 3W04A 3EZYA 1P1IA 1R1DA 3KELA 3OX2A 4YRMA 4QG3A 4TTQA 1Q0TA 1IEWA 1P3DA 1PP4A 2K6GA 1QH8B 4WN9B 3I8SA 5BYBA 2FE4A 2OCLA 3RIEA 3PGXA 1P29A 1JDJA 1NLFA 4UJ3A 4HD8A 1KYYA 2DWOA 5BWLA 1LK7A 821PA 2ZRKA 5K98B 4F5EA 2M4HA 3C4VA 3HKCA 5CA0B 5H9VA 3OOWA 3HGTA 4NMLA 1L5LA 1A5BB 1EPUA 1YDGA 2D8AA 1BS9A 1R5NA 4QELA 4D57A 5LZ9A 1FQJA 4CKCA 1NW7A 4E7PA 5JZBA 2XXAA 3U5TA 3N2LA 1YR6A 2ZW9A 4ZYZA 1V9CA 3VRHA 1X74A 2ECPA 4XQ9A 4TVOA 4UUBA 5DGIA 2AN4A 2Y05A 1NE2A 5JC8A 2LWIA 4GSYA 1G8AA 2AJ8A 5HF5A 2Z2KA 2XRYA 3F7MA 3FMIA 2JK1A 3CCFA 3H2GA 2QRGA 3IS3A 3ZHMA 3GGJA 2FFQA 2XGGA 1RPNA 2C7GA 4M9CA 1QDEA 3I6BA 2PXHA 2C2ZA 1Z5UA 3CZAA 2Y71A 4U6SA 5H82A 4ZZ0A 1FPMA 1ZWKA 3EVNA 3SHVA 1JGTA 2F3SA 3D6TB 4RPCA 4X1OA 1W46A 1FLNA 1NQTA 2HZ7A 3ZU4A 2AZ4A 3T1VA 2C92A 2Y9MB 4Z0PA 4G2NA 5T3UA 3MRVA 5DIZA 2FR1A 1DLJA 3DNFA 3KOZA 1ZGJA 4QXOA 1OX4A 3OCCA 2PMEA 1MKYA 3GH1A 3SYMA 2VDPB 4AICA 3QVJA 4X44A 1C7QA 4CLEA 1JQBA 4Q9HA 4NZYA 3JALB 4LRQA 4C7OA 4OJYA 1EUYA 3BJZA 4N3AA 2ZSFA 1P17A 1DQZA 3GCGA 2Q5HA 2VNKA 5K8JB 4Q1AA 5JS6A 2GA8A 4UAUA 1CJCA 5KQPA 4PO1A 1BXRA 2X0NA 5DXFA 5LA6B 4FFVA 2WYUA 4XLLA 5GTDA 4JJ8A 3T1OA 2W2NA 1CTQA 3QH4A 2CBGA 4R0VA 2IHJA 3PC4A 4BY9E 2I3DA 5CK5A 3CRNA 1D0VA 3PQ5A 1P7ZA 3P0RA 2P0YA 4UMEA 1QYDA 4FW8A 1ID8A 1O6CA 1M8PA 3VGPA 1GCOA 1KVTA 4Y18A 3WTCA 3NP7A 1QBGA 1IBLB 1BMFA 1HMPA 1KS9A 2DZDA 2O3QA 2OBLA 3OZIA 1OXTA 1O7JA 5AIAA 3HSKA 4N5HX 1ORVA 1U1IA 2O7QA 3IP7A 4RGBA 1BWQA 2I80A 4FLEA 3HS3A 4WY5A 4H7JA 2VTEA 1XU4A 3N5CA 4UZEA 5IBQA 3WVNA 3AFOA 4AS3A 4EG0A 5C3MA 4KLNA 4MDYA 4AY6A 1Y3AA 4WAUA 3PC8C 1SY7A 4W63A 2PXUA 1PT6A 3T15A 4ZO4A 1XZIA 3DUFA 4BAGA 4IV5A 4YUXA 4WBXC 3UAGA 4DL9A 1GTZA 2V7EA 2EV9A 1QQAA 1EMDA 2FMFA 4X54A 4EJMA 8GPBA 1YFJA 1REQB 2EKQA 4ME6A 3VYSB 4TN1A 3UY4A 4E2FA 1FNMA 1L5OA 3TSYA 1U1CA 1UBMS 4Y9SA 5K3OA 2WM9B 3GRUA 4W99A 1GEGA 4B3CA 1R6BX 3HADA 1OC4A 3U31A 1E7SA 5FPTA 1NVAA 3K1ZA 4QHSA 3GY0A 1KMHA 5CBPA 4RKRA 2L49A 4YNBA 4KIJA 5IUKC 3A28A 4UNQA 2A9RA 2E1PA 3QKIA 4QUJA 3VAYA 3PX7A 4A2QA 1OA1A 3O74A 2MSWA 2IYLD 1C7IA 4QRDA 5F7OA 4X9XA 3RVDA 1XPOA 3FDFA 3PQ8A 4RFVA 1UJMA 2X7HA 2WT9A 5J4VA 5LKAA 4LQDA 2HK8A 4MUIA 4L78A 3MPOA 1WW8A 1PWYE 2XBMA 1RPJA 4I7EA 4L76A 1PI3A 4FFBA 4R84A 4P9NA 3VX4A 4G4GA 1T13A 3E70C 3PDHA 3CZQA 4RD1A 4RHCA 3PNQA 9ATCA 1LSOA 2P9CA 3GDHA 3OFND 1G21B 1QQ7A 1U3TA 1ZD1A 2DFTA 2FEOA 4ITUA 1V25A 4OHPA 2AB0A 4O3FA 4TV9B 4TRMA 4EPYA 2R9VA 3D8SA 3P9ZA 5CX1A 1MORA 1PX0A 2GI4A 2F00A 4JP2A 4J3NA 1WDLA 3AOGA 4J7XA 4YV7A 3BJIC 5GONB 1WR8A 2P6UA 3ELUA 1LDMA 4A0HA 2PQ0A 2QJOA 3JAKB 3LWZA 4N7RA 5KYXB 3B7HA 4JMLA 3U49A 1Z28A 2GMWA 3PTLA 4KXXA 5LJLA 2QK4A 1KDYA 5LMZA 4QHTA 1OT5A 3PPYA 4MGIR 4RAQA 4R7TA 2FCAA 1MGOA 4LOKA 3RYFA 4JT2A 1YZKA 5LYJF 3I76A 4P34A 2VUTA 4KAFA 1SBYA 3T7KA 2FUCA 1J9GA 1R8QA 1Q20A 2WKPA 2OO5C 3WIOA 2NXEA 4AJ4A 2IYPA 2H07A 3ML1A 4TWJA 4PQEA 3UJBA 1JPVA 3D81A 3E1SA 3B6JA 1N2SA 4BFLA 1JTEA 1UUFA 2Z2XA 1ZAKA 4OSOA 3Q12A 4B4DA 1AUPA 3CCCA 4P4TA 2IP1A 4L5CA 4RDCA 4M7PA 4XEHA 3TRDA 721PA 1MO6A 5E2BA 4MI6A 1K66A 4M87A 4Y7DA 3AYXB 3LGAA 4TXMA 5LXTA 4P4LA 4BEWA 1DELA 2BGMA 3JVDA 1M7BA 4NJMA 1ZOOA 3M5PA 1TPZA 1RPAA 3S70A 3K0CA 4REQB 1X1BA 3CM0A 1VG9B 4L5YA 4WI1A 5FUBA 4WVLA 2BFBA 2EU8A 3FB4A 4Y6RA 3KZVA 4U7TB 2X7XA 1FS4A 4B3DA 1NOJA 1BEEA 3EDQA 1C9YA 4MUKA 4EO4A 5F2KA 3MJTA 4WXHA 3JD2A 1NJGA 3KWJA 4OMCA 3MLEA 4FJ1A 5DB4A 1N34B 4R8LA 4JBXA 5F21A 3R7SA 4EW1A 2JHCA 1GN8A 2BONA 1JI3A 2HXSA 2WWTA 4BNNA 3LFPA 1GUZA 4MS3B 2FTKE 3G88A 4NNJA 3RD5A 1F3LA 4CHGA 4FZRA 3H5NA 1QVZA 3D6NB 3GFPA 4D74A 4G0UA 5D84A 2HDWA 5GQSA 4KLAA 3VZRA 2PPLA 2R8YA 5FO0A 4EPWA 3U3OA 2PR2A 1NQ5A 1O4WA 1EWRA 1VKRA 5F4BA 4QPJC 3BZBA 3ABQB 2J59A 2QAGA 3WISA 5I9IA 2QT1A 1CS0A 2V3CC 1X14A 5DGTA 2QX6A 3M6VA 3GVXA 1I80A 1N5LA 4IDGA 5DJ5A 3X1DA 5ICGA 2H7XA 4WWHA 3EG9B 2P11A 5HJ5A 1DP4A 5KKNB 4C6TB 5B55A 2VA8A 4PFQA 3BQNB 1KQ3A 3BFKA 2BMWA 3P9NA 4MHSA 1X3SA 3TJMA 2HCJB 4YI3A 4YXFA 5HKOA 5L7TA 1D2NA 1R2QA 4CQNA 3KKKA 3FN4A 5EXSA 4QOFA 4ZVVA 1RXWA 1DAIA 4FFSA 1JEAA 1MGPA 5AP9A 2VK8A 4ZEMA 2Y1OA 1UH5A 2UUAB 3EXEA 1LRKA 4IDFA 4QU0A 4YP1A 4PU8A 2ST1A 4PLYA 4N6OA 1AZSC 4GYWA 3LLVA 4JL5A 3LCUA 1T5OA 5EXEA 1DCTA 1J90A 1XCGB 4HDRA 1G63A 2CKDA 4RPHA 4D0LB 4RF5A 5CVCA 1WW2A 3QY9A 4K87A 2NSJA 2YW2A 3ETHA 3GJ3A 1PDWA 2PYDA 4QBFA 2QZ9A 4ARAA 2IWRA 5IHPA 5K01A 2FEAA 2OT3B 3CEMA 3L04A 4F06A 1HQCA 2C4HA 2ZJ7A 5K0LA 1VMKA 2FZKA 2XDAA 3QM1A 3OM9A 5GPBA 1R88A 2QE6A 1U0OC 3OP1A 2H1OA 1VG0B 5MF6A 3S1AB 2AVDA 5SY6A 4GNRA 3RW9A 1DU4A 2IIBA 4MVCA 3UHJA 4OJTA 1UPXA 1Z2PX 1BWSA 4UM9D 1UEIA 4D4MA 3MMSA 2HU8A 3TQSA 4DCMA 4Q9LA 4N7BA 3UN1A 2FDRA 4KG7A 1BOOA 1IPFA 4U7GA 2HQ1A 2CL0X 5JANA 1G9TA 5REQB 1FSFA 3GAMA 1G5TA 2PX8A 2WJGA 2APJA 4M7WA 1G8SA 3OZGA 3F2VA 4B48A 4ZAZA 3IT1A 3QA3E 4JNKA 1UBSB 1I4DD 2IFTA 2JH9A 1P72A 4YAIA 2QD1A 3OZCA 4UOZA 2SICE 1YHZA 3OJCA 3PLAE 1U3FA 2ZG6A 4L0CA 5E6UA 3DOUA 3KLNA 4HDAA 2R4TA 3CF2A 1GGKA 1RYDA 5DWVA 4CF3A 4ZVLA 2FGKA 3ZTYA 4F45A 1QOPB 3JVVA 3W8FA 3B9RA 3ND5A 2WYWA 2X5XA 4KWIA 3BAZA 2DT5A 3A6FA 3NONA 4MW0A 2AXZA 3KYIB 4DMKA 4EELA 1RI3A 3Q4GA 5K0CA 3EOAI 4FJ2A 2AW3A 4QUGA 4KQFA 3AHEA 4CE6A 1TOAA 3T99A 3PL5A 5CIYA 1RYMA 3UVEA 1HEIA 2X6RA 4GE0A 1D7AA 2QU8A 1WXHA 3MPUA 2C59A 5DNDA 4C0AC 1EDBA 4XQGA 5GGYA 1BHSA 1ULTA 2I7VA 4EUKA 4KPYA 1SZDA 2B8EA 2GDZA 2VZ0A 2D1QA 5K2OA 4DWWA 4EVIA 3N3AC 3VAAA 3TI7A 4HC4A 4MVJD 1TPYA 3UTDA 5AW1A 2ZJ1A 4PGFA 3H1BA 4WLVA 5ENDA 3KZXA 2YIJA 3NWBA 1KK0A 3GEDA 4KFTA 1SVWA 2EHJA 3NPAA 2WTAA 3GWGA 4BZXA 3MBIA 4NYJR 1TJPB 4HWPA 3CLCA 2W7TA 4ILKA 1AN0A 2ZT5A 1WTCA 5AVOA 4A8JC 3OX3A 1XK7A 2E5FA 1GZDA 4ZU6X 2Q2WA 3RS2A 3WRXA 1OASA 4I1PA 2ZTUA 3IBCA 2F3UA 1YVPA 5I8WA 2ORVA 2BF7A 4E5VA 2QL6A 3H5RA 2AFIE 4OM8A 5F2NA 1PL6A 2F1RA 6NULA 4FOPA 3OWQA 4PO3X 1VXRA 5A9TA 1KBOA 3CX8A 1CETA 1KJ8A 5DWDA 5DEIA 1TO1E 3TD6A 3M6LA 4S24A 4RKEA 5BV0A 3KS9A 4GT1A 1XZAA 5DXAA 3TH5A 5AW7A 1WPXA 3K8ZA 1K7SN 2HRQA 3ZE7A 5C8XA 2CHVA 5JNTA 2P1RA 4Y67A 1U04A 2NG1A 4OQPA 1JEDA 1WZIA 3GJ5A 1D2AA 1E3WA 1Z2NX 2R7NA 4L0MA 1I4LD 1MT0A 5CVEA 1AQNA 4X4CA 3FTDA 1W8DA 2BKLA 4EL0A 4UU8A 5K45A 2YJ5A 1XCMA 1QIEA 3CUSA 3H05A 5J5CA 4BYGA 5AVSA 5KWEA 1AF7A 1A2BA 4L9RA 4QNRA 3LYLA 4U7JA 4AJ1A 3VKUA 2EFYA 4JI0B 1FTYA 2Q3BA 1Y8AA 4LJLA 2AD5A 5JZOA 3BDIA 1RWQA 3B3JA 5TGTA 1GQQA 3WYAA 2VZ8A 1I14A 3LTEA 3WYGA 4BNDA 1O94C 1N1MA 1WUHS 1DWPA 1RW4A 3NM6B 3PJRA 1DB3A 3A36A 3SKXA 3KZKA 5G02A 4ID9A 1I51A 2H5JA 4IZOA 2XUOA 2IVGA 4G56A 4BE9A 1NBAA 4LHSA 4Q4HA 2XSZD 3GEBA 3W34A 1KI7A 2OXEA 4AXXA 4DNFA 2JIZA 1DKLA 1YVDA 1N8SA 1V71A 3BBPA 1JHYA 1PJTA 2YJ3A 1I2CA 5T5QA 2AUTA 1ZGCA 4AO6A 1KK2A 2VHXA 4XIYA 1N6HA 1OX6A 3EZLA 3KXDA 3BC1A 1PEDA 4DUGD 2C88A 5LJIA 4BRSA 2VSQA 3CKLA 4TLAA 3LGXA 2GKGA 4MR7A 1QPZA 3KZOA 4YT4A 4MW5A 4MDEA 2IITA 1J22A 2QVCA 1PQ4A 2QUAA 4AYXA 4OQYA 1XDDA 2OQ2A 3H04A 1B6SA 3B9QA 5EXTA 1ZZ8A 4FZ5A 4LJ6A 2IUEA 1VP3A 4UFPA 1RMYA 3VSCA 5FOTA 2VYCA 1NYQA 2WMDA 2ZQZA 3H6GA 2R5FA 5DCLA 1TM1E 1VECA 4GM0A 4FDAA 4US0R 4J0FA 2NO4A 4KE6A 4YQEA 5KINB 3ISJA 2I6UA 2PDAA 2V5VA 3PXCX 3WK6A 1FFDA 4XCVA 4N40A 4PZ0A 2EKBA 3R23A 3SI7A 3UWMA 2RK6A 2MTBA 3Q3GE 5AVWA 1IXYA 3CUEF 2J87A 4HAIA 1GDHA 2X9QA 4WK4B 4RA9B 5H83A 4WOJA 3IO3A 4BZWA 5AM5A 2Q5CA 2GPAA 2OILA 3MUFA 4FWBA 1DC5A 1D4FA 3FTFA 2EFEB 2QY6A 4IQFA 2A5GA 2DFDA 4UE2A 4KPFC 3MCUA 3MJEA 1TB4A 3B3FA 4Y1RB 2FSSA 2I3AA 2QM8A 5HQ3B 3IIKA 2H5EA 2ONCA 5EIHA 4KR9A 5AVZA 1EINA 2UUOA 1LNZA 3EXG2 4BVFA 3G8CA 1FP7A 1LJLA 1FMTA 1BS2A 1UKEA 3SC4A 1R4NA 3DZCA 4QLAA 1NXTA 4Q0MA 2WWRA 4XVHA 3C3PA 3IL2A 4C4AA 1N1DA 2O23A 4EF6A 5ER9A 1AXRA 4R2LA 4UTXA 2X6TA 1CT9A 4DNXA 3FD8A 1X7YB 4IHQA 5GM2A 1AKNA 2BTOA 2QG6A 1B8OA 1T3SA 1CUEA 5EHIA 5FP0A 2C4VA 2OEPA 1Q0LA 1IOVA 1KYQA 3RK0A 3KJGA 5L40A 3IC5A 3JATA 4A1OA 1J9EA 2XVMA 2VQ6A 3RIHA 2OOKA 1EB9A 2AJBA 4X3OA 2ZLBA 3Q85A 1ZHHA 1QK3A 1IBSA 1ZGZA 3GFBA 4RZ3A 4B17A 1JFTA 1FA9A 3N5KA 1NLYA 2C3OA 3IDSA 3LXXA 4K46A 4MGKR 4PYNA 1GQRA 4ZOEA 4E32A 3UJCA 4Z4CA 2J5RA 3KSZO 4YYEA 1V8FA 1PDVA 2IPXA 3J81A 3SSAA 2Q9UA 3KR0A 4G1BA 4MP8A 3CG4A 1GA1A 2O20A 3I92A 3WYBA 1NBEA 1G16A 2L17A 3HB9A 3LC7O 4EPTA 1OAOA 3AETA 3GA7A 5JCXA 4JU9A 2B4YA 1EFRD 2IOYA 2WFMA 3EPPA 3F90A 3Q9SA 1PZMA 3R5SA 2VSOA 1QZZA 4GI1A 4HFRA 3V34A 5L7WA 1JEEA 4IOLA 5AVTA 3AVVA 3HKBB 1MMFB 1P6UA 2C00A 2O2JA 3ENNA 4TMZA 2J85A 4X8HA 5DULA 5E4YA 4QG7A 3KWMA 4BLUA 5E6RA 1O58A 5JYEA 1EM6A 2HQSA 1D2CA 4BN5A 1UJBA 3FGZA 3P7MA 2C7RA 3W9UA 2W2QA 3OY7A 2IGTA 2WNIA 5KNCD 1CU1A 2CYAA 3F4LA 4B4WA 1IHYA 1N7HA 1ULSA 3K7EA 4JT4A 1ORWA 1A9ZA 4QJ4A 2P68A 5AKLA 2G76A 2HWYA 5EZSA 5K3EA 2DPHA 3QE3A 1YJAA 3WIEA 1VP9A 4PYLA 1IVYA 3IOYA 2NM0A 1E7MA 2FN8A 3K5PA 2NU7A 4IUDS 3JQ7A 4WASA 2GCGA 4RZXA 2CV2A 4XTRA 3H4TA 4RK5A 1JTVA 4KJXA 4PNHA 4I6UA 2H7VA 5HG0A 1VGQA 1RRMA 2WM3A 3TDKA 4F96A 3EFHA 2GWHA 1JX6A 2AI2A 3Q40A 5DYIA 2SKDA 3F7TA 1U1DA 4C4SA 3AVYA 2ACKA 3NHBA 3LT4A 3VSAA 5B1EA 1GZVA 1E2MA 2F48A 1NPYA 3MMNA 4BMDA 3RC7A 1OY1A 4E70A 1HX7A 2RGWA 3K9NA 2VPZ