3GUXA

Crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
298
structure length
247
Chain Sequence
EVIKAPEFDADSAYQYIQVQADFGPRVPNTQAHKECGEYLAGQLEKFGAKVYNQYADLIAYDGTILKSRNIIGAYKPESKKRILLCAHWDSRPGASGVGVLLEIARQIQKEQPALGIDIVFFDSEDYQDTWCLGSQYWARTPHVQNYNARYGILLDMVGGKDATFYYEGYSARTARSEMKKIWKKAHELGYGKYFVKEDGGETVDDHIYVNKLARIPCVDIINYDNIDRNTLKAVGQTVMDVIYNEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative Zn-dependent exopeptidase (YP_001298628.1) from Bacteroides vulgatus ATCC 8482 at 1.80 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Hydrolase
molecule keywords putative Zn-dependent exopeptidase
total genus 80
structure length 247
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3guxA00
3BI0A 4NFRA 1HDUA 3PB7X 4CPAA 3WC5A 5F09A 4NGQA 2AFOA 2PJBA 4PXBA 5THWA 5HVGA 3FMCA 1CPSA 2GLJA 3DGVA 1YMEA 2PIYA 3KL9A 4MCQA 5LRKA 2AFUA 3NH4A 1LOKA 1BPNA 2ZEGA 2C6GA 4JYWA 2V77A 1NSAA 2DEAA 4P4EA 2RB7A 2PJAA 4MXUA 3FH4A 3FEDA 3D7GA 2ZELA 1HDQA 3PRTA 5CPAA 3RAMA 4DUKA 4MHPA 4P4DA 5K8NA 2JBJA 3RBUA 2V8DA 4MHNA 2Q43A 2XEIA 1ZG9A 5HXDA 1ZLIA 4BD9A 4PQAA 5JM6A 3FEEA 4KSIA 3WT4A 2PJ2A 3MN8A 1PCAA 5CBMA 2ZENA 4A94A 2NSMA 3CDXA 4MMOA 4P4JA 5K8MA 3SJGA 2PJ0A 3LMSA 2XEJA 3NH8A 4A39A 4YWYA 4LQGA 2CF4A 3SJEA 2PJ1A 3KR4A 2BCOA 2PJ7A 3PEIA 4OC2A 3IWWA 3DLJA 1ELLP 3KQZA 3L2NA 4MRIA 2V8VA 4OC0A 3VH9A 1LFWA 4OIDA 5JH9A 2PIZA 3PB9X 2PJ5A 3B35A 4OMEA 2ZOFA 3CPAA 4X2TA 2PJ3A 2NYQA 4X3RA 4MCRA 8CPAA 3QNVA 2EK9A 3B2YA 4MCSA 3D7HA 4YU9A 3FECA 3NFZA 4NGRA 3IC1A 4DYOA 2C6PA 1LAMA 4R8FA 1LAPA 4EFDA 1TKHA 4WWVA 3D7FA 4A37A 3MRUA 2JBKA 7CPAA 2PVVA 4AXVA 3VATA 5HVHA 1RTQA 4K3NA 4MCPA 3D4UA 2PVWA 4UEZA 2PJ4A 1DE4C 4FBEA 2PJ9A 3FVLA 4MHZA 1ARLA 4UF4A 2IQ6A 1XJOA 5LYDA 3KASA 1F57A 2G9DA 1TKJA 4F9VA 3D67A 1DTDA 5IB9A 2QJ8A 5I4MA 3VARA 2VL1A 1R43A 4OC3A 2GREA 3IIBA 3PB8X 4P4FA 3SI1A 5HVFA 5LYIA 1H8LA 1YLOA 4R76A 2QYVA 2ZEFA 1JQGA 2ZEOA 3D7DA 1UWYA 3H8EA 4JZ0A 2IJZA 4NJQA 5K8PA 3B3TA 4F8ZA 1M4LA 3S9MA 1CX8A 2OR4A 4P4BA 1XBUA 1Q7LA 2C1CA 4ZX9A 4NGTA 3GLJA 4NGMA 1IGBA 4OC4A 5DS0A 1FNOA 4OC1A 1LCPA 4MHYA 3NH5A 2WYRA 2Q51A 1VHEA 3FX6A 1YW4A 5J1QA 4TWEA 3IO1A 3IEHA 4ZY1A 4WJBA 2OOTA 2GU2A 2HB6A 4IK2A 2ZEMA 4IHMA 2V8GA 3ISXA 5LYFA 4OKOA 3PB6X 2ABZA 3B3WA 2WZNA 2CTBA 1R3NA 4W9YA 4RUHA 2AFZA 4PXEA 3HUVA 1Z5RA 2PJ6A 1CP7A 2FVGA 1CP6A 3T8WA 1EE3P 4H2KA 1ARMA 1ZLHA 3RZAA 1IY7A 2HC9A 4R6TA 3K9TA 1ZG8A 4PXDA 3V7ZA 3SI0A 3V38A 2F7VA 5JGFA 1Z8LA 1CPXA 4UIAA 4UIBA 3CPXA 2O53A 1YSJA 3IJ3A 4ZX8A 4GM5A 4IAVA 3TC8A 1F2PA 4FUUA 3ISZA 2AFWA 5LRJA 4FWUA 1HEEA 1TKFA 1XMBA 3N5FA 4Z65A 3WC6A 2PJ8A 3SJXA 4TNUA 4UEFA 4PPZA 1XFOA 3KHZA 4NGSA 4F9UA 3KQXA 1TF8A 5LRGA 4PXCA 3KZWA 4OC5A 1QMUA 2QVPA 3H8FA 1PYTB 2XEGA 2ZOGA 2JEWA 3SI2A 3JRUA 2ZEHA 3CT9A 2PRQA 4A38A 4ZI6A 1CG2A 4ONWA 1BLLE 5D29A 2BO9A 5K8OA 2AFSA 3WC7A 4UEEA 4OP4A 3PBBA 2ANPA 1BPMA 1TF9A 2ZEEA 3GB0A 2GLFA 3PBEA 3BHXA 3SJFA 2I3CA 4P6YA 3B3VA 4X8IA 2C6CA 6CPAA 2AFMA 2ZEPA 3LWUA 1TXRA 3HLPA 1AMPA 3KI9A 5LYLA 2XEFA 3D68A 1Y0YA 4P44A 2RFHA 1OBRA 4FAIA 1Y7EA 4B6ZA 3B7IA 2J9AA 2PJCA 4EMEA 2CTCA 3PFEA 3BXMA 1ELMP 1QQ9A 2IMOA 4NJRA 3D66A 4NGNA 5D8NA 4G1PA 4P10A 2F8HA 1AYEA 4OIWA 4O23A 1XRYA 1VHOA 4EWTA 3FJUA 3KGQA 4NGPA 4DJLA 2PCUA 4Q7AA 1VIXA 2AFXA 3PFOA 1LANA 3KR5A 4P4IA 3TX8A 1GYTA 1ZG7A 4ZY2A 3GUXA 3H8GA 2EK8A 3B3CA 3I1UA 4ZY0A 2O4HA 3PB4X 2EWBA 3K2KA 4P45A 3NA6A 1KWMA 1Y0RA 4R7MA 3WABA 3S9LA 1F2OA 4ZYQA 2BOAA 1CBXA 2CIJA 2POKA 2PE3A 2V8HA 1FT7A 3IFEA 1VGYA 1YW6A 3FF3A 1BAVA 3S9NA 2Q4ZA 3BI1A 1Z2LA 5ELYA 3KHXA 2ZEDA 3B3SA
chains in the Genus database with same CATH superfamily
3BI0A 4NFRA 1HDUA 5F49A 3PB7X 4CPAA 4M85A 3WC5A 1GHEA 4MFQA 4NGQA 2AFOA 3W91A 5F09A 2PJBA 4PXBA 5THWA 5HVGA 1M4DA 1CPSA 3FMCA 2J8MA 4OAEA 2GLJA 2ZW5A 1YMEA 3DGVA 2PIYA 3KL9A 2EO8A 1TIQA 2AFUA 3NH4A 1A2ZA 1LOKA 4MCQA 4A2ZA 5LRKA 2VQYA 1BPNA 2ZEGA 4UFXA 2C6GA 4Q38A 3FXTA 4JYWA 2V77A 1NSAA 5JPHA 2DEAA 3D8PA 4FD7A 4PSXA 4P4EA 1I1DA 2RB7A 2ARHA 2PJAA 4ORFA 4MXUA 4MBUA 3FH4A 3FEDA 2PR1A 4QVTA 3D7GA 2ZELA 4B5PA 3VWDA 3D2PA 3EY5A 4AB7A 1HDQA 3PRTA 2R8VA 5CPAA 2JEVA 3RAMA 2Z3PA 3NE8A 2B3UA 4DUKA 4MHPA 4P4DA 5K8NA 3D3SA 2JBJA 4JXQA 4QBJA 3KHXA 3RBUA 2V8DA 4MHNA 2Q43A 2ODFA 2XEIA 4JWPA 4BINA 1ZG9A 2BEIA 5F48A 5HXDA 1L0CA 2B5GB 1ZLIA 4BD9A 4PQAA 5JM6A 1X12A 3V8IA 2FIWA 3FEEA 4KSIA 1M44A 3EXNA 3WT4A 3W6SA 3OWCA 2PJ2A 1NSLA 4XPDC 3MN8A 1PCAA 3NE7A 5CBMA 2FT0A 4CRYB 2ZENA 5A27A 2CNSA 4U9ZA 4XNHB 4A94A 4B5OA 5KTCA 1PU9A 1Z8WA 2NSMA 3CDXA 3IU1A 4LX9A 3LD2A 4DNCA 4MMOA 5KTDA 2JDCA 1Z4EA 4PSWA 2X7BA 4P4JA 3S6GA 5K8MA 3SJGA 2PJ0A 3LMSA 2XEJA 4YRHA 3RYOA 2YNCC 2K5TA 3NH8A 3EFAA 4A39A 4YWYA 4LQGA 2CF4A 3FBUA 3SJEA 3R95A 1Z8XA 2PJ1A 2Q44A 3KR4A 4HPSA 2YNDA 4B11A 2WUUA 1IICA 1K4JA 2BCOA 3IGRA 2PJ7A 1R57A 4UFVA 1XMTA 3PGPA 3PEIA 2AJ6A 2OZGA 2FIAA 1Y9KA 3IWEA 4OC2A 3IWWA 3DLJA 3G8WA 1ELLP 3KQZA 3L2NA 4F0YA 2QECA 1QSTA 4CGNA 3DDDA 4B14A 4CYQA 5IV0A 3BJ7A 4MRIA 1Z8TA 2V8VA 4OC0A 3VH9A 1LFWA 2FCKA 4KUAA 4II9A 4OIDA 5JH9A 2PIZA 4KOVA 3S6KA 2Q0YA 3FYNA 2D4PA 3PB9X 2PJ5A 3B35A 4X5KA 4ONUA 3WR7A 5J8CA 1XOVA 3EO4A 4KORA 3SXNA 1SQHA 2BL1A 4OMEA 5GCNA 4CGLA 3GY9A 2H5MA 2Z3LA 2ZOFA 3CPAA 3RNZA 4X2TA 4KSAA 4AVAA 4B5PB 2FS5A 2PJ3A 3P2FA 2NYQA 4X3RA 4MCRA 4C2XA 8CPAA 2EK9A 3QNVA 4C2ZA 4YFJA 1YREA 2Y0MA 1S7NA 3TE4A 1YK3A 2AE6A 2PDOA 4M6GA 3B2YA 3JTKA 1B6BA 3H5ZA 1WK4A 4MCSA 3D7HA 2FL4A 3QAYA 2P6EA 4R87A 4A30A 1M4IA 4YU9A 4OADA 3FECA 3NFZA 2O28A 4B12A 2B4BA 3TO7A 4KVXA 2HQYA 4NGRA 3IC1A 2R7HA 4F6AA 4DYOA 2C6PA 1BOBA 1CJWA 2DXQA 2BSWA 1LAMA 4R8FA 4XPLA 1LAPA 4EFDA 2OH1A 1TKHA 3BLNA 1M1DA 3D7FA 2VI7A 4WWVA 4C2YA 4MY0A 4U5YA 2Z3KA 1YGHA 3MRUA 4A37A 4CYNA 4CYOA 2JBKA 4L8AA 3H4QA 7CPAA 1NE9A 2PVVA 5C88A 4OLLA 4AXVA 3VATA 4Q36A 3SHPA 5HVHA 4IUSA 1RTQA 2FSRA 4K3NA 4MCPA 3FIXA 4HNXB 4ZGYB 4GS4A 2VEZA 3D4UA 2PVWA 1JWQA 2EUIA 4JJXA 4MFZA 4UEZA 4CGMA 2ATRA 2PJ4A 1DE4C 4FBEA 2Q7SA 5G1ZA 2G0BA 2PJ9A 4U9YA 3FVLA 1QSOA 4MHZA 1ARLA 4UF4A 3R96A 2B58A 1BO4A 2IQ6A 1XJOA 4KOWA 4R3LA 3K9UA 3KASA 5LYDA 1AUGA 4CRZB 1F57A 4NF1A 4A31A 4AG9A 3TT2A 2G9DA 1TKJA 4F9VA 3D67A 3B8GA 4KLVA 1DTDA 4HKFA 2KCWA 2C27A 5IB9A 4E8OA 4I49A 2QJ8A 1FY7A 1Y9WA 5I4MA 3VARA 4R3KA 2VL1A 5EBVA 1R43A 2F5IA 4FD4A 2Q7BA 5F46A 4OC3A 1LRZA 5DWNA 2GREA 3IIBA 3PB8X 2I00A 4P4FA 2Z3NA 3ZJ0A 3SI1A 1IYKA 5J8FA 5HVFA 5LYIA 1H8LA 2P6FA 4PK2A 1YLOA 4R76A 2Q4YA 2D4OA 1ON0A 3TFYA 2QYVA 2ZEFA 4MFPA 4C68A 4CAEA 4A32A 1JQGA 2ZEOA 2CY2A 3D7DA 1UWYA 2ZW4A 3R9GA 3H8EA 4JZ0A 2IJZA 4NJQA 3VWEA 5K8PA 3B3TA 2Z3OA 2EBJA 1M4LA 5H86A 3F8KA 4FD5A 4F8ZA 3S9MA 4CGPA 5IX3A 1CX8A 3FRMA 2OR4A 2PQ8A 3F0AA 4KS9A 4P4BA 1XBUA 1Q7LA 2B5GA 4BBHA 2YGWA 3P2HA 2C1CA 2PR8A 3LODA 4NGTA 4ZX9A 1KZFA 2Q4VA 3GLJA 4NGMA 1IGBA 1S7KA 4H6ZA 2VBQA 2OB0A 4A33A 3CZXA 4HNWB 4OC4A 2VZZA 5DS0A 1IOFA 5DWMA 1FNOA 1Q2YA 2B4DB 4OC1A 4E0AA 1LCPA 1M4GA 1YR0A 4MHYA 4KOSA 3NH5A 2WYRA 4RS2A 1P4NA 3GKRA 3R9FA 5C82A 2Q51A 1VHEA 3FX6A 1YW4A 3PP9A 4CAFA 5J1QA 4TWEA 3IO1A 3IEHA 4MJ8A 4ZY1A 4WJBA 2ZW6A 4NXYA 4Y49C 5G20A 2OOTA 2GU2A 2R1IA 3D2MA 5ISVA 4UBRA 2HB6A 4IK2A 2IL4A 2ZEMA 4IHMA 2V8GA 3ISXA 5LYFA 4OKOA 3PB6X 2Q04A 3ZZIA 2ABZA 4KZTA 3B3WA 4LQ6A 2WZNA 4KOTA 4GXHA 2CXAA 5IB0A 2CTBA 5F47A 1R3NA 1UFHA 3DNSA 3I9SA 4W9YA 3TTHA 4RUHA 3T90A 5CNPA 4J3GA 1MK4A 3CXPA 3DR8A 3LACA 2AFZA 4PXEA 3HUVA 4E2AA 1Z5RA 2PJ6A 1CP7A 1Q2DA 1CP6A 1YVOA 2FVGA 2Z0ZA 3T8WA 1EE3P 4H2KA 4CGOA 4KLWA 4MHDA 1ARMA 1ZLHA 2P6GA 3R1KA 1Y7RA 4UWJA 3RZAA 1VHSA 1IY7A 1ZO0A 2HC9A 4R6TA 3K9TA 3UY5A 3TOBA 5E96A 3W6XA 1WWZA 1RO5A 4ZBGA 1ZG8A 4PXDA 3V7ZA 2GE3A 2Z10A 3SI0A 4C7IA 3V38A 2F7VA 5JGFA 5EMIA 5AG7A 5JQ4A 3EC4A 1XIXA 1Z8LA 1IIDA 5BWAB 2CNMA 2I79A 4KVME 5HH1A 1YLEA 5G22A 2OZHA 1CPXA 2VXKA 3TOAA 4UIAA 4C7HA 4MFLA 5FVJA 1KUYA 4UIBA 4KOUA 5AGEA 3CPXA 1MJBA 2O53A 2VZYA 4JXRA 2ZEDA 1YSJA 3IJ3A 4ZX8A 4GM5A 1YVKA 5EC4A 4JLYA 4IAVA 3TC8A 1F2PA 3MGDA 2JLMA 4FUUA 3ISZA 3N7ZA 4UA3A 2GIVA 2AFWA 4EVYA 2HUZA 5LRJA 1QSMA 1HEEA 1TKFA 4FWUA 4XPKA 4AG7A 1XMBA 2YNEA 3N5FA 4RN7A 4Z65A 3WC6A 2PJ8A 4KVOE 4NEXA 3IWGA 4H6UA 5H84A 3SJXA 1KUVA 4AVCA 4TNUA 1RXTA 4UEFA 4NSQA 3F5BA 4PPZA 1XFOA 2DPSA 3KHZA 4NGSA 3KQXA 1IYLA 4F9UA 1TF8A 2A4NA 1Q2CA 3PZJA 4A95A 4BMHA 5LRGA 4MI4A 4M6IA 4CS0B 2NMTA 4PXCA 3KZWA 1N71A 2CNTA 2R98A 4QC6A 1IU8A 2WSAA 4OC5A 1QMUA 2QVPA 2DPTA 3H8FA 1PYTB 2XEGA 2ZOGA 2REEA 1I21A 2JEWA 2P0WA 3SI2A 4CAWA 4MFKA 2G3TA 3IU2A 2WPWA 2G3AA 1MJ9A 3JRUA 4JD6A 2ZEHA 3CT9A 2PRQA 4KSFA 4PV6A 4A38A 1CG2A 1BLLE 1PUAA 4ONWA 5D29A 4ZI6A 3KKWA 2REFA 2BO9A 1B87A 5K8OA 4XNHC 5AG4A 2AFSA 4KUBA 4KOXA 3WC7A 3I3GA 2FXFA 4UEEA 1CM0A 2HV2A 4OP4A 4UCPA 1S7FA 3PBBA 2YNCA 4R57A 2ANPA 1BPMA 3GIUA 1TF9A 2ZXVA 4PK3A 2BUEA 2ZEEA 3GB0A 2GLFA 3FNCA 3PBEA 3BHXA 3SJFA 1P0HA 2GFQA 2I3CA 1J4JA 3DR6A 4F0XA 2PRBA 4P6YA 5KTAA 3S6FA 3B3VA 4X8IA 2C6CA 6CPAA 4HNYB 1YQEA 2AFMA 2ZEPA 4KOYA 3LWUA 2QMLA 4AVBA 3CXSA 1TXRA 3HLPA 1AMPA 3KI9A 5LYLA 5HMNA 4IF5A 2JDDA 2XEFA 3D68A 3TO6A 1XE4A 1Y0YA 4P44A 2RFHA 1OBRA 4FAIA 1Y7EA 4UCMA 1XF8A 5AG6A 4B6ZA 3B7IA 2J9AA 4B10A 2B3VA 3G3SA 2PJCA 3A9LA 4EMEA 4YGOA 2CTCA 1QSRA 2WPXA 3PFEA 3BXMA 1ELMP 3GYAA 1QQ9A 1MJAA 1VKCA 2IMOA 4M6HA 5ELYA 2GANA 2Z3MA 1S7LA 5I0CA 3DSBA 4NJRA 4UCNA 1XEBA 1Z9UA 3D66A 4NGNA 4R9MA 4G1PA 5D8NA 1IOIA 4MY3A 1U6MA 4UFWA 4P10A 1QSNA 2F8HA 1AYEA 4UWIA 4QB9A 4B13A 3QB8A 4OIWA 4O23A 3QAHA 1XRYA 1Z4RA 3E0KA 2Z11A 4RI1A 4CYPA 1VHOA 4EWTA 3FJUA 3T9YA 3KGQA 4NGPA 1I12A 4MFJA 4H89A 4DJLA 2PCUA 5A28A 2OZUA 4Q7AA 1S60A 1VIXA 2ZW7A 2AFXA 4XPDB 1X10A 4LUAA 3PFOA 1LANA 3KR5A 4K30A 3SXOA 1S5KA 2J8NA 4CAVA 3RO0A 4P4IA 3TX8A 1GYTA 1IB1E 1ZG7A 4ZY2A 3GUXA 2ZPAA 3H8GA 1S3ZA 2EK8A 3B3CA 3I1UA 3S6HA 1OZPA 1V0CA 4M3SA 2J8RA 5G21A 3TCVA 3JUWA 4ZY0A 3R9EA 2O4HA 3PB4X 4QUSA 4Y49B 2EWBA 2PSWA 3C26A 1KUXA 2EVNA 5AG5A 3K2KA 4L89A 4P45A 3NA6A 1KWMA 1Y0RA 4R7MA 3WABA 3S9LA 1F2OA 3JVNA 2BOAA 3CXQA 2B4DA 4ZYQA 1CBXA 2CIJA 1YX0A 4FD6A 3BJ8A 2FE7A 2POKA 2PC1A 2PE3A 2V8HA 4NCZA 1FT7A 2RC4A 3IFEA 1VGYA 1YW6A 4CAXA 3FF3A 2OU2A 1BAVA 3S9NA 2Q4ZA 1NMTA 3BI1A 1Z2LA 3FB3A 2QIRA 2DF5A 3TO9A 3B3SA
chains in the Genus database with same CATH topology
3BI0A 4NFRA 1HDUA 3PB7X 4CPAA 3WC5A 5F09A 4NGQA 2AFOA 2PJBA 4PXBA 5THWA 5HVGA 3FMCA 1CPSA 2GLJA 3DGVA 1YMEA 2PIYA 3KL9A 4MCQA 5LRKA 2AFUA 3NH4A 1LOKA 1BPNA 2ZEGA 2C6GA 4JYWA 2V77A 1NSAA 2DEAA 4P4EA 2RB7A 2PJAA 4MXUA 3FH4A 3FEDA 3D7GA 2ZELA 1HDQA 3PRTA 5CPAA 3RAMA 4DUKA 4MHPA 4P4DA 5K8NA 2JBJA 3RBUA 2V8DA 4MHNA 2Q43A 2XEIA 1ZG9A 5HXDA 1ZLIA 4BD9A 4PQAA 5JM6A 3FEEA 4KSIA 3WT4A 2PJ2A 3MN8A 1PCAA 5CBMA 2ZENA 4A94A 2NSMA 3CDXA 4MMOA 4P4JA 5K8MA 3SJGA 2PJ0A 3LMSA 2XEJA 3NH8A 4A39A 4YWYA 4LQGA 2CF4A 3SJEA 2PJ1A 3KR4A 2BCOA 2PJ7A 3PEIA 4OC2A 3IWWA 3DLJA 1ELLP 3KQZA 3L2NA 4MRIA 2V8VA 4OC0A 3VH9A 1LFWA 4OIDA 5JH9A 2PIZA 3PB9X 2PJ5A 3B35A 4OMEA 2ZOFA 3CPAA 4X2TA 2PJ3A 2NYQA 4X3RA 4MCRA 8CPAA 3QNVA 2EK9A 3B2YA 4MCSA 3D7HA 4YU9A 3FECA 3NFZA 4NGRA 3IC1A 4DYOA 2C6PA 1LAMA 4R8FA 1LAPA 4EFDA 1TKHA 4WWVA 3D7FA 4A37A 3MRUA 2JBKA 7CPAA 2PVVA 4AXVA 3VATA 5HVHA 1RTQA 4K3NA 4MCPA 3D4UA 2PVWA 4UEZA 2PJ4A 1DE4C 4FBEA 2PJ9A 3FVLA 4MHZA 1ARLA 4UF4A 2IQ6A 1XJOA 5LYDA 3KASA 1F57A 2G9DA 1TKJA 4F9VA 3D67A 1DTDA 5IB9A 2QJ8A 5I4MA 3VARA 2VL1A 1R43A 4OC3A 2GREA 3IIBA 3PB8X 4P4FA 3SI1A 5HVFA 5LYIA 1H8LA 1YLOA 4R76A 2QYVA 2ZEFA 1JQGA 2ZEOA 3D7DA 1UWYA 3H8EA 4JZ0A 2IJZA 4NJQA 5K8PA 3B3TA 4F8ZA 1M4LA 3S9MA 1CX8A 2OR4A 4P4BA 1XBUA 1Q7LA 2C1CA 4ZX9A 4NGTA 3GLJA 4NGMA 1IGBA 4OC4A 5DS0A 1FNOA 4OC1A 1LCPA 4MHYA 3NH5A 2WYRA 2Q51A 1VHEA 3FX6A 1YW4A 5J1QA 4TWEA 3IO1A 3IEHA 4ZY1A 4WJBA 2OOTA 2GU2A 2HB6A 4IK2A 2ZEMA 4IHMA 2V8GA 3ISXA 5LYFA 4OKOA 3PB6X 2ABZA 3B3WA 2WZNA 2CTBA 1R3NA 4W9YA 4RUHA 2AFZA 4PXEA 3HUVA 1Z5RA 2PJ6A 1CP7A 2FVGA 1CP6A 3T8WA 1EE3P 4H2KA 1ARMA 1ZLHA 3RZAA 1IY7A 2HC9A 4R6TA 3K9TA 1ZG8A 4PXDA 3V7ZA 3SI0A 3V38A 2F7VA 5JGFA 1Z8LA 1CPXA 4UIAA 4UIBA 3CPXA 2O53A 1YSJA 3IJ3A 4ZX8A 4GM5A 4IAVA 3TC8A 1F2PA 4FUUA 3ISZA 2AFWA 5LRJA 4FWUA 1HEEA 1TKFA 1XMBA 3N5FA 4Z65A 3WC6A 2PJ8A 3SJXA 4TNUA 4UEFA 4PPZA 1XFOA 3KHZA 4NGSA 4F9UA 3KQXA 1TF8A 5LRGA 4PXCA 3KZWA 4OC5A 1QMUA 2QVPA 3H8FA 1PYTB 2XEGA 2ZOGA 2JEWA 3SI2A 3JRUA 2ZEHA 3CT9A 2PRQA 4A38A 4ZI6A 1CG2A 4ONWA 1BLLE 5D29A 2BO9A 5K8OA 2AFSA 3WC7A 4UEEA 4OP4A 3PBBA 2ANPA 1BPMA 1TF9A 2ZEEA 3GB0A 2GLFA 3PBEA 3BHXA 3SJFA 2I3CA 4P6YA 3B3VA 4X8IA 2C6CA 6CPAA 2AFMA 2ZEPA 3LWUA 1TXRA 3HLPA 1AMPA 3KI9A 5LYLA 2XEFA 3D68A 1Y0YA 4P44A 2RFHA 1OBRA 4FAIA 1Y7EA 4B6ZA 3B7IA 2J9AA 2PJCA 4EMEA 2CTCA 3PFEA 3BXMA 1ELMP 1QQ9A 2IMOA 4NJRA 3D66A 4NGNA 5D8NA 4G1PA 4P10A 2F8HA 1AYEA 4OIWA 4O23A 1XRYA 1VHOA 4EWTA 3FJUA 3KGQA 4NGPA 4DJLA 2PCUA 4Q7AA 1VIXA 2AFXA 3PFOA 1LANA 3KR5A 4P4IA 3TX8A 1GYTA 1ZG7A 4ZY2A 3GUXA 3H8GA 2EK8A 3B3CA 3I1UA 4ZY0A 2O4HA 3PB4X 2EWBA 3K2KA 4P45A 3NA6A 1KWMA 1Y0RA 4R7MA 3WABA 3S9LA 1F2OA 4ZYQA 2BOAA 1CBXA 2CIJA 2POKA 2PE3A 2V8HA 1FT7A 3IFEA 1VGYA 1YW6A 3FF3A 1BAVA 3S9NA 2Q4ZA 3BI1A 1Z2LA 5ELYA 3KHXA 2ZEDA 3B3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BI0 A;  4NFR A;  1HDU A;  3PB7 X;  4CPA A;  3WC5 A;  5F09 A;  4NGQ A;  2AFO A;  2PJB A;  4PXB A;  5THW A;  5HVG A;  3FMC A;  1CPS A;  2GLJ A;  3DGV A;  1YME A;  2PIY A;  3KL9 A;  4MCQ A;  5LRK A;  2AFU A;  3NH4 A;  1LOK A;  1BPN A;  2ZEG A;  2C6G A;  4JYW A;  2V77 A;  1NSA A;  2DEA A;  4P4E A;  2RB7 A;  2PJA A;  4MXU A;  3FH4 A;  3FED A;  3D7G A;  2ZEL A;  1HDQ A;  3PRT A;  5CPA A;  3RAM A;  4DUK A;  4MHP A;  4P4D A;  5K8N A;  2JBJ A;  3RBU A;  2V8D A;  4MHN A;  2Q43 A;  2XEI A;  1ZG9 A;  5HXD A;  1ZLI A;  4BD9 A;  4PQA A;  5JM6 A;  3FEE A;  4KSI A;  3WT4 A;  2PJ2 A;  3MN8 A;  1PCA A;  5CBM A;  2ZEN A;  4A94 A;  2NSM A;  3CDX A;  4MMO A;  4P4J A;  5K8M A;  3SJG A;  2PJ0 A;  3LMS A;  2XEJ A;  3NH8 A;  4A39 A;  4YWY A;  4LQG A;  2CF4 A;  3SJE A;  2PJ1 A;  3KR4 A;  2BCO A;  2PJ7 A;  3PEI A;  4OC2 A;  3IWW A;  3DLJ A;  1ELL P;  3KQZ A;  3L2N A;  4MRI A;  2V8V A;  4OC0 A;  3VH9 A;  1LFW A;  4OID A;  5JH9 A;  2PIZ A;  3PB9 X;  2PJ5 A;  3B35 A;  4OME A;  2ZOF A;  3CPA A;  4X2T A;  2PJ3 A;  2NYQ A;  4X3R A;  4MCR A;  8CPA A;  3QNV A;  2EK9 A;  3B2Y A;  4MCS A;  3D7H A;  4YU9 A;  3FEC A;  3NFZ A;  4NGR A;  3IC1 A;  4DYO A;  2C6P A;  1LAM A;  4R8F A;  1LAP A;  4EFD A;  1TKH A;  4WWV A;  3D7F A;  4A37 A;  3MRU A;  2JBK A;  7CPA A;  2PVV A;  4AXV A;  3VAT A;  5HVH A;  1RTQ A;  4K3N A;  4MCP A;  3D4U A;  2PVW A;  4UEZ A;  2PJ4 A;  1DE4 C;  4FBE A;  2PJ9 A;  3FVL A;  4MHZ A;  1ARL A;  4UF4 A;  2IQ6 A;  1XJO A;  5LYD A;  3KAS A;  1F57 A;  2G9D A;  1TKJ A;  4F9V A;  3D67 A;  1DTD A;  5IB9 A;  2QJ8 A;  5I4M A;  3VAR A;  2VL1 A;  1R43 A;  4OC3 A;  2GRE A;  3IIB A;  3PB8 X;  4P4F A;  3SI1 A;  5HVF A;  5LYI A;  1H8L A;  1YLO A;  4R76 A;  2QYV A;  2ZEF A;  1JQG A;  2ZEO A;  3D7D A;  1UWY A;  3H8E A;  4JZ0 A;  2IJZ A;  4NJQ A;  5K8P A;  3B3T A;  4F8Z A;  1M4L A;  3S9M A;  1CX8 A;  2OR4 A;  4P4B A;  1XBU A;  1Q7L A;  2C1C A;  4ZX9 A;  4NGT A;  3GLJ A;  4NGM A;  1IGB A;  4OC4 A;  5DS0 A;  1FNO A;  4OC1 A;  1LCP A;  4MHY A;  3NH5 A;  2WYR A;  2Q51 A;  1VHE A;  3FX6 A;  1YW4 A;  5J1Q A;  4TWE A;  3IO1 A;  3IEH A;  4ZY1 A;  4WJB A;  2OOT A;  2GU2 A;  2HB6 A;  4IK2 A;  2ZEM A;  4IHM A;  2V8G A;  3ISX A;  5LYF A;  4OKO A;  3PB6 X;  2ABZ A;  3B3W A;  2WZN A;  2CTB A;  1R3N A;  4W9Y A;  4RUH A;  2AFZ A;  4PXE A;  3HUV A;  1Z5R A;  2PJ6 A;  1CP7 A;  2FVG A;  1CP6 A;  3T8W A;  1EE3 P;  4H2K A;  1ARM A;  1ZLH A;  3RZA A;  1IY7 A;  2HC9 A;  4R6T A;  3K9T A;  1ZG8 A;  4PXD A;  3V7Z A;  3SI0 A;  3V38 A;  2F7V A;  5JGF A;  1Z8L A;  1CPX A;  4UIA A;  4UIB A;  3CPX A;  2O53 A;  1YSJ A;  3IJ3 A;  4ZX8 A;  4GM5 A;  4IAV A;  3TC8 A;  1F2P A;  4FUU A;  3ISZ A;  2AFW A;  5LRJ A;  4FWU A;  1HEE A;  1TKF A;  1XMB A;  3N5F A;  4Z65 A;  3WC6 A;  2PJ8 A;  3SJX A;  4TNU A;  4UEF A;  4PPZ A;  1XFO A;  3KHZ A;  4NGS A;  4F9U A;  3KQX A;  1TF8 A;  5LRG A;  4PXC A;  3KZW A;  4OC5 A;  1QMU A;  2QVP A;  3H8F A;  1PYT B;  2XEG A;  2ZOG A;  2JEW A;  3SI2 A;  3JRU A;  2ZEH A;  3CT9 A;  2PRQ A;  4A38 A;  4ZI6 A;  1CG2 A;  4ONW A;  1BLL E;  5D29 A;  2BO9 A;  5K8O A;  2AFS A;  3WC7 A;  4UEE A;  4OP4 A;  3PBB A;  2ANP A;  1BPM A;  1TF9 A;  2ZEE A;  3GB0 A;  2GLF A;  3PBE A;  3BHX A;  3SJF A;  2I3C A;  4P6Y A;  3B3V A;  4X8I A;  2C6C A;  6CPA A;  2AFM A;  2ZEP A;  3LWU A;  1TXR A;  3HLP A;  1AMP A;  3KI9 A;  5LYL A;  2XEF A;  3D68 A;  1Y0Y A;  4P44 A;  2RFH A;  1OBR A;  4FAI A;  1Y7E A;  4B6Z A;  3B7I A;  2J9A A;  2PJC A;  4EME A;  2CTC A;  3PFE A;  3BXM A;  1ELM P;  1QQ9 A;  2IMO A;  4NJR A;  3D66 A;  4NGN A;  5D8N A;  4G1P A;  4P10 A;  2F8H A;  1AYE A;  4OIW A;  4O23 A;  1XRY A;  1VHO A;  4EWT A;  3FJU A;  3KGQ A;  4NGP A;  4DJL A;  2PCU A;  4Q7A A;  1VIX A;  2AFX A;  3PFO A;  1LAN A;  3KR5 A;  4P4I A;  3TX8 A;  1GYT A;  1ZG7 A;  4ZY2 A;  3GUX A;  3H8G A;  2EK8 A;  3B3C A;  3I1U A;  4ZY0 A;  2O4H A;  3PB4 X;  2EWB A;  3K2K A;  4P45 A;  3NA6 A;  1KWM A;  1Y0R A;  4R7M A;  3WAB A;  3S9L A;  1F2O A;  4ZYQ A;  2BOA A;  1CBX A;  2CIJ A;  2POK A;  2PE3 A;  2V8H A;  1FT7 A;  3IFE A;  1VGY A;  1YW6 A;  3FF3 A;  1BAV A;  3S9N A;  2Q4Z A;  3BI1 A;  1Z2L A;  5ELY A;  3KHX A;  2ZED A;  3B3S A; 
#chains in the Genus database with same CATH topology
 3BI0 A;  4NFR A;  1HDU A;  5F49 A;  3PB7 X;  4CPA A;  4M85 A;  3WC5 A;  1GHE A;  4MFQ A;  4NGQ A;  2AFO A;  3W91 A;  5F09 A;  2PJB A;  4PXB A;  5THW A;  5HVG A;  1M4D A;  1CPS A;  3FMC A;  2J8M A;  4OAE A;  2GLJ A;  2ZW5 A;  1YME A;  3DGV A;  2PIY A;  3KL9 A;  2EO8 A;  1TIQ A;  2AFU A;  3NH4 A;  1A2Z A;  1LOK A;  4MCQ A;  4A2Z A;  5LRK A;  2VQY A;  1BPN A;  2ZEG A;  4UFX A;  2C6G A;  4Q38 A;  3FXT A;  4JYW A;  2V77 A;  1NSA A;  5JPH A;  2DEA A;  3D8P A;  4FD7 A;  4PSX A;  4P4E A;  1I1D A;  2RB7 A;  2ARH A;  2PJA A;  4ORF A;  4MXU A;  4MBU A;  3FH4 A;  3FED A;  2PR1 A;  4QVT A;  3D7G A;  2ZEL A;  4B5P A;  3VWD A;  3D2P A;  3EY5 A;  4AB7 A;  1HDQ A;  3PRT A;  2R8V A;  5CPA A;  2JEV A;  3RAM A;  2Z3P A;  3NE8 A;  2B3U A;  4DUK A;  4MHP A;  4P4D A;  5K8N A;  3D3S A;  2JBJ A;  4JXQ A;  4QBJ A;  3KHX A;  3RBU A;  2V8D A;  4MHN A;  2Q43 A;  2ODF A;  2XEI A;  4JWP A;  4BIN A;  1ZG9 A;  2BEI A;  5F48 A;  5HXD A;  1L0C A;  2B5G B;  1ZLI A;  4BD9 A;  4PQA A;  5JM6 A;  1X12 A;  3V8I A;  2FIW A;  3FEE A;  4KSI A;  1M44 A;  3EXN A;  3WT4 A;  3W6S A;  3OWC A;  2PJ2 A;  1NSL A;  4XPD C;  3MN8 A;  1PCA A;  3NE7 A;  5CBM A;  2FT0 A;  4CRY B;  2ZEN A;  5A27 A;  2CNS A;  4U9Z A;  4XNH B;  4A94 A;  4B5O A;  5KTC A;  1PU9 A;  1Z8W A;  2NSM A;  3CDX A;  3IU1 A;  4LX9 A;  3LD2 A;  4DNC A;  4MMO A;  5KTD A;  2JDC A;  1Z4E A;  4PSW A;  2X7B A;  4P4J A;  3S6G A;  5K8M A;  3SJG A;  2PJ0 A;  3LMS A;  2XEJ A;  4YRH A;  3RYO A;  2YNC C;  2K5T A;  3NH8 A;  3EFA A;  4A39 A;  4YWY A;  4LQG A;  2CF4 A;  3FBU A;  3SJE A;  3R95 A;  1Z8X A;  2PJ1 A;  2Q44 A;  3KR4 A;  4HPS A;  2YND A;  4B11 A;  2WUU A;  1IIC A;  1K4J A;  2BCO A;  3IGR A;  2PJ7 A;  1R57 A;  4UFV A;  1XMT A;  3PGP A;  3PEI A;  2AJ6 A;  2OZG A;  2FIA A;  1Y9K A;  3IWE A;  4OC2 A;  3IWW A;  3DLJ A;  3G8W A;  1ELL P;  3KQZ A;  3L2N A;  4F0Y A;  2QEC A;  1QST A;  4CGN A;  3DDD A;  4B14 A;  4CYQ A;  5IV0 A;  3BJ7 A;  4MRI A;  1Z8T A;  2V8V A;  4OC0 A;  3VH9 A;  1LFW A;  2FCK A;  4KUA A;  4II9 A;  4OID A;  5JH9 A;  2PIZ A;  4KOV A;  3S6K A;  2Q0Y A;  3FYN A;  2D4P A;  3PB9 X;  2PJ5 A;  3B35 A;  4X5K A;  4ONU A;  3WR7 A;  5J8C A;  1XOV A;  3EO4 A;  4KOR A;  3SXN A;  1SQH A;  2BL1 A;  4OME A;  5GCN A;  4CGL A;  3GY9 A;  2H5M A;  2Z3L A;  2ZOF A;  3CPA A;  3RNZ A;  4X2T A;  4KSA A;  4AVA A;  4B5P B;  2FS5 A;  2PJ3 A;  3P2F A;  2NYQ A;  4X3R A;  4MCR A;  4C2X A;  8CPA A;  2EK9 A;  3QNV A;  4C2Z A;  4YFJ A;  1YRE A;  2Y0M A;  1S7N A;  3TE4 A;  1YK3 A;  2AE6 A;  2PDO A;  4M6G A;  3B2Y A;  3JTK A;  1B6B A;  3H5Z A;  1WK4 A;  4MCS A;  3D7H A;  2FL4 A;  3QAY A;  2P6E A;  4R87 A;  4A30 A;  1M4I A;  4YU9 A;  4OAD A;  3FEC A;  3NFZ A;  2O28 A;  4B12 A;  2B4B A;  3TO7 A;  4KVX A;  2HQY A;  4NGR A;  3IC1 A;  2R7H A;  4F6A A;  4DYO A;  2C6P A;  1BOB A;  1CJW A;  2DXQ A;  2BSW A;  1LAM A;  4R8F A;  4XPL A;  1LAP A;  4EFD A;  2OH1 A;  1TKH A;  3BLN A;  1M1D A;  3D7F A;  2VI7 A;  4WWV A;  4C2Y A;  4MY0 A;  4U5Y A;  2Z3K A;  1YGH A;  3MRU A;  4A37 A;  4CYN A;  4CYO A;  2JBK A;  4L8A A;  3H4Q A;  7CPA A;  1NE9 A;  2PVV A;  5C88 A;  4OLL A;  4AXV A;  3VAT A;  4Q36 A;  3SHP A;  5HVH A;  4IUS A;  1RTQ A;  2FSR A;  4K3N A;  4MCP A;  3FIX A;  4HNX B;  4ZGY B;  4GS4 A;  2VEZ A;  3D4U A;  2PVW A;  1JWQ A;  2EUI A;  4JJX A;  4MFZ A;  4UEZ A;  4CGM A;  2ATR A;  2PJ4 A;  1DE4 C;  4FBE A;  2Q7S A;  5G1Z A;  2G0B A;  2PJ9 A;  4U9Y A;  3FVL A;  1QSO A;  4MHZ A;  1ARL A;  4UF4 A;  3R96 A;  2B58 A;  1BO4 A;  2IQ6 A;  1XJO A;  4KOW A;  4R3L A;  3K9U A;  3KAS A;  5LYD A;  1AUG A;  4CRZ B;  1F57 A;  4NF1 A;  4A31 A;  4AG9 A;  3TT2 A;  2G9D A;  1TKJ A;  4F9V A;  3D67 A;  3B8G A;  4KLV A;  1DTD A;  4HKF A;  2KCW A;  2C27 A;  5IB9 A;  4E8O A;  4I49 A;  2QJ8 A;  1FY7 A;  1Y9W A;  5I4M A;  3VAR A;  4R3K A;  2VL1 A;  5EBV A;  1R43 A;  2F5I A;  4FD4 A;  2Q7B A;  5F46 A;  4OC3 A;  1LRZ A;  5DWN A;  2GRE A;  3IIB A;  3PB8 X;  2I00 A;  4P4F A;  2Z3N A;  3ZJ0 A;  3SI1 A;  1IYK A;  5J8F A;  5HVF A;  5LYI A;  1H8L A;  2P6F A;  4PK2 A;  1YLO A;  4R76 A;  2Q4Y A;  2D4O A;  1ON0 A;  3TFY A;  2QYV A;  2ZEF A;  4MFP A;  4C68 A;  4CAE A;  4A32 A;  1JQG A;  2ZEO A;  2CY2 A;  3D7D A;  1UWY A;  2ZW4 A;  3R9G A;  3H8E A;  4JZ0 A;  2IJZ A;  4NJQ A;  3VWE A;  5K8P A;  3B3T A;  2Z3O A;  2EBJ A;  1M4L A;  5H86 A;  3F8K A;  4FD5 A;  4F8Z A;  3S9M A;  4CGP A;  5IX3 A;  1CX8 A;  3FRM A;  2OR4 A;  2PQ8 A;  3F0A A;  4KS9 A;  4P4B A;  1XBU A;  1Q7L A;  2B5G A;  4BBH A;  2YGW A;  3P2H A;  2C1C A;  2PR8 A;  3LOD A;  4NGT A;  4ZX9 A;  1KZF A;  2Q4V A;  3GLJ A;  4NGM A;  1IGB A;  1S7K A;  4H6Z A;  2VBQ A;  2OB0 A;  4A33 A;  3CZX A;  4HNW B;  4OC4 A;  2VZZ A;  5DS0 A;  1IOF A;  5DWM A;  1FNO A;  1Q2Y A;  2B4D B;  4OC1 A;  4E0A A;  1LCP A;  1M4G A;  1YR0 A;  4MHY A;  4KOS A;  3NH5 A;  2WYR A;  4RS2 A;  1P4N A;  3GKR A;  3R9F A;  5C82 A;  2Q51 A;  1VHE A;  3FX6 A;  1YW4 A;  3PP9 A;  4CAF A;  5J1Q A;  4TWE A;  3IO1 A;  3IEH A;  4MJ8 A;  4ZY1 A;  4WJB A;  2ZW6 A;  4NXY A;  4Y49 C;  5G20 A;  2OOT A;  2GU2 A;  2R1I A;  3D2M A;  5ISV A;  4UBR A;  2HB6 A;  4IK2 A;  2IL4 A;  2ZEM A;  4IHM A;  2V8G A;  3ISX A;  5LYF A;  4OKO A;  3PB6 X;  2Q04 A;  3ZZI A;  2ABZ A;  4KZT A;  3B3W A;  4LQ6 A;  2WZN A;  4KOT A;  4GXH A;  2CXA A;  5IB0 A;  2CTB A;  5F47 A;  1R3N A;  1UFH A;  3DNS A;  3I9S A;  4W9Y A;  3TTH A;  4RUH A;  3T90 A;  5CNP A;  4J3G A;  1MK4 A;  3CXP A;  3DR8 A;  3LAC A;  2AFZ A;  4PXE A;  3HUV A;  4E2A A;  1Z5R A;  2PJ6 A;  1CP7 A;  1Q2D A;  1CP6 A;  1YVO A;  2FVG A;  2Z0Z A;  3T8W A;  1EE3 P;  4H2K A;  4CGO A;  4KLW A;  4MHD A;  1ARM A;  1ZLH A;  2P6G A;  3R1K A;  1Y7R A;  4UWJ A;  3RZA A;  1VHS A;  1IY7 A;  1ZO0 A;  2HC9 A;  4R6T A;  3K9T A;  3UY5 A;  3TOB A;  5E96 A;  3W6X A;  1WWZ A;  1RO5 A;  4ZBG A;  1ZG8 A;  4PXD A;  3V7Z A;  2GE3 A;  2Z10 A;  3SI0 A;  4C7I A;  3V38 A;  2F7V A;  5JGF A;  5EMI A;  5AG7 A;  5JQ4 A;  3EC4 A;  1XIX A;  1Z8L A;  1IID A;  5BWA B;  2CNM A;  2I79 A;  4KVM E;  5HH1 A;  1YLE A;  5G22 A;  2OZH A;  1CPX A;  2VXK A;  3TOA A;  4UIA A;  4C7H A;  4MFL A;  5FVJ A;  1KUY A;  4UIB A;  4KOU A;  5AGE A;  3CPX A;  1MJB A;  2O53 A;  2VZY A;  4JXR A;  2ZED A;  1YSJ A;  3IJ3 A;  4ZX8 A;  4GM5 A;  1YVK A;  5EC4 A;  4JLY A;  4IAV A;  3TC8 A;  1F2P A;  3MGD A;  2JLM A;  4FUU A;  3ISZ A;  3N7Z A;  4UA3 A;  2GIV A;  2AFW A;  4EVY A;  2HUZ A;  5LRJ A;  1QSM A;  1HEE A;  1TKF A;  4FWU A;  4XPK A;  4AG7 A;  1XMB A;  2YNE A;  3N5F A;  4RN7 A;  4Z65 A;  3WC6 A;  2PJ8 A;  4KVO E;  4NEX A;  3IWG A;  4H6U A;  5H84 A;  3SJX A;  1KUV A;  4AVC A;  4TNU A;  1RXT A;  4UEF A;  4NSQ A;  3F5B A;  4PPZ A;  1XFO A;  2DPS A;  3KHZ A;  4NGS A;  3KQX A;  1IYL A;  4F9U A;  1TF8 A;  2A4N A;  1Q2C A;  3PZJ A;  4A95 A;  4BMH A;  5LRG A;  4MI4 A;  4M6I A;  4CS0 B;  2NMT A;  4PXC A;  3KZW A;  1N71 A;  2CNT A;  2R98 A;  4QC6 A;  1IU8 A;  2WSA A;  4OC5 A;  1QMU A;  2QVP A;  2DPT A;  3H8F A;  1PYT B;  2XEG A;  2ZOG A;  2REE A;  1I21 A;  2JEW A;  2P0W A;  3SI2 A;  4CAW A;  4MFK A;  2G3T A;  3IU2 A;  2WPW A;  2G3A A;  1MJ9 A;  3JRU A;  4JD6 A;  2ZEH A;  3CT9 A;  2PRQ A;  4KSF A;  4PV6 A;  4A38 A;  1CG2 A;  1BLL E;  1PUA A;  4ONW A;  5D29 A;  4ZI6 A;  3KKW A;  2REF A;  2BO9 A;  1B87 A;  5K8O A;  4XNH C;  5AG4 A;  2AFS A;  4KUB A;  4KOX A;  3WC7 A;  3I3G A;  2FXF A;  4UEE A;  1CM0 A;  2HV2 A;  4OP4 A;  4UCP A;  1S7F A;  3PBB A;  2YNC A;  4R57 A;  2ANP A;  1BPM A;  3GIU A;  1TF9 A;  2ZXV A;  4PK3 A;  2BUE A;  2ZEE A;  3GB0 A;  2GLF A;  3FNC A;  3PBE A;  3BHX A;  3SJF A;  1P0H A;  2GFQ A;  2I3C A;  1J4J A;  3DR6 A;  4F0X A;  2PRB A;  4P6Y A;  5KTA A;  3S6F A;  3B3V A;  4X8I A;  2C6C A;  6CPA A;  4HNY B;  1YQE A;  2AFM A;  2ZEP A;  4KOY A;  3LWU A;  2QML A;  4AVB A;  3CXS A;  1TXR A;  3HLP A;  1AMP A;  3KI9 A;  5LYL A;  5HMN A;  4IF5 A;  2JDD A;  2XEF A;  3D68 A;  3TO6 A;  1XE4 A;  1Y0Y A;  4P44 A;  2RFH A;  1OBR A;  4FAI A;  1Y7E A;  4UCM A;  1XF8 A;  5AG6 A;  4B6Z A;  3B7I A;  2J9A A;  4B10 A;  2B3V A;  3G3S A;  2PJC A;  3A9L A;  4EME A;  4YGO A;  2CTC A;  1QSR A;  2WPX A;  3PFE A;  3BXM A;  1ELM P;  3GYA A;  1QQ9 A;  1MJA A;  1VKC A;  2IMO A;  4M6H A;  5ELY A;  2GAN A;  2Z3M A;  1S7L A;  5I0C A;  3DSB A;  4NJR A;  4UCN A;  1XEB A;  1Z9U A;  3D66 A;  4NGN A;  4R9M A;  4G1P A;  5D8N A;  1IOI A;  4MY3 A;  1U6M A;  4UFW A;  4P10 A;  1QSN A;  2F8H A;  1AYE A;  4UWI A;  4QB9 A;  4B13 A;  3QB8 A;  4OIW A;  4O23 A;  3QAH A;  1XRY A;  1Z4R A;  3E0K A;  2Z11 A;  4RI1 A;  4CYP A;  1VHO A;  4EWT A;  3FJU A;  3T9Y A;  3KGQ A;  4NGP A;  1I12 A;  4MFJ A;  4H89 A;  4DJL A;  2PCU A;  5A28 A;  2OZU A;  4Q7A A;  1S60 A;  1VIX A;  2ZW7 A;  2AFX A;  4XPD B;  1X10 A;  4LUA A;  3PFO A;  1LAN A;  3KR5 A;  4K30 A;  3SXO A;  1S5K A;  2J8N A;  4CAV A;  3RO0 A;  4P4I A;  3TX8 A;  1GYT A;  1IB1 E;  1ZG7 A;  4ZY2 A;  3GUX A;  2ZPA A;  3H8G A;  1S3Z A;  2EK8 A;  3B3C A;  3I1U A;  3S6H A;  1OZP A;  1V0C A;  4M3S A;  2J8R A;  5G21 A;  3TCV A;  3JUW A;  4ZY0 A;  3R9E A;  2O4H A;  3PB4 X;  4QUS A;  4Y49 B;  2EWB A;  2PSW A;  3C26 A;  1KUX A;  2EVN A;  5AG5 A;  3K2K A;  4L89 A;  4P45 A;  3NA6 A;  1KWM A;  1Y0R A;  4R7M A;  3WAB A;  3S9L A;  1F2O A;  3JVN A;  2BOA A;  3CXQ A;  2B4D A;  4ZYQ A;  1CBX A;  2CIJ A;  1YX0 A;  4FD6 A;  3BJ8 A;  2FE7 A;  2POK A;  2PC1 A;  2PE3 A;  2V8H A;  4NCZ A;  1FT7 A;  2RC4 A;  3IFE A;  1VGY A;  1YW6 A;  4CAX A;  3FF3 A;  2OU2 A;  1BAV A;  3S9N A;  2Q4Z A;  1NMT A;  3BI1 A;  1Z2L A;  3FB3 A;  2QIR A;  2DF5 A;  3TO9 A;  3B3S A; 
#chains in the Genus database with same CATH homology
 3BI0 A;  4NFR A;  1HDU A;  3PB7 X;  4CPA A;  3WC5 A;  5F09 A;  4NGQ A;  2AFO A;  2PJB A;  4PXB A;  5THW A;  5HVG A;  3FMC A;  1CPS A;  2GLJ A;  3DGV A;  1YME A;  2PIY A;  3KL9 A;  4MCQ A;  5LRK A;  2AFU A;  3NH4 A;  1LOK A;  1BPN A;  2ZEG A;  2C6G A;  4JYW A;  2V77 A;  1NSA A;  2DEA A;  4P4E A;  2RB7 A;  2PJA A;  4MXU A;  3FH4 A;  3FED A;  3D7G A;  2ZEL A;  1HDQ A;  3PRT A;  5CPA A;  3RAM A;  4DUK A;  4MHP A;  4P4D A;  5K8N A;  2JBJ A;  3RBU A;  2V8D A;  4MHN A;  2Q43 A;  2XEI A;  1ZG9 A;  5HXD A;  1ZLI A;  4BD9 A;  4PQA A;  5JM6 A;  3FEE A;  4KSI A;  3WT4 A;  2PJ2 A;  3MN8 A;  1PCA A;  5CBM A;  2ZEN A;  4A94 A;  2NSM A;  3CDX A;  4MMO A;  4P4J A;  5K8M A;  3SJG A;  2PJ0 A;  3LMS A;  2XEJ A;  3NH8 A;  4A39 A;  4YWY A;  4LQG A;  2CF4 A;  3SJE A;  2PJ1 A;  3KR4 A;  2BCO A;  2PJ7 A;  3PEI A;  4OC2 A;  3IWW A;  3DLJ A;  1ELL P;  3KQZ A;  3L2N A;  4MRI A;  2V8V A;  4OC0 A;  3VH9 A;  1LFW A;  4OID A;  5JH9 A;  2PIZ A;  3PB9 X;  2PJ5 A;  3B35 A;  4OME A;  2ZOF A;  3CPA A;  4X2T A;  2PJ3 A;  2NYQ A;  4X3R A;  4MCR A;  8CPA A;  3QNV A;  2EK9 A;  3B2Y A;  4MCS A;  3D7H A;  4YU9 A;  3FEC A;  3NFZ A;  4NGR A;  3IC1 A;  4DYO A;  2C6P A;  1LAM A;  4R8F A;  1LAP A;  4EFD A;  1TKH A;  4WWV A;  3D7F A;  4A37 A;  3MRU A;  2JBK A;  7CPA A;  2PVV A;  4AXV A;  3VAT A;  5HVH A;  1RTQ A;  4K3N A;  4MCP A;  3D4U A;  2PVW A;  4UEZ A;  2PJ4 A;  1DE4 C;  4FBE A;  2PJ9 A;  3FVL A;  4MHZ A;  1ARL A;  4UF4 A;  2IQ6 A;  1XJO A;  5LYD A;  3KAS A;  1F57 A;  2G9D A;  1TKJ A;  4F9V A;  3D67 A;  1DTD A;  5IB9 A;  2QJ8 A;  5I4M A;  3VAR A;  2VL1 A;  1R43 A;  4OC3 A;  2GRE A;  3IIB A;  3PB8 X;  4P4F A;  3SI1 A;  5HVF A;  5LYI A;  1H8L A;  1YLO A;  4R76 A;  2QYV A;  2ZEF A;  1JQG A;  2ZEO A;  3D7D A;  1UWY A;  3H8E A;  4JZ0 A;  2IJZ A;  4NJQ A;  5K8P A;  3B3T A;  4F8Z A;  1M4L A;  3S9M A;  1CX8 A;  2OR4 A;  4P4B A;  1XBU A;  1Q7L A;  2C1C A;  4ZX9 A;  4NGT A;  3GLJ A;  4NGM A;  1IGB A;  4OC4 A;  5DS0 A;  1FNO A;  4OC1 A;  1LCP A;  4MHY A;  3NH5 A;  2WYR A;  2Q51 A;  1VHE A;  3FX6 A;  1YW4 A;  5J1Q A;  4TWE A;  3IO1 A;  3IEH A;  4ZY1 A;  4WJB A;  2OOT A;  2GU2 A;  2HB6 A;  4IK2 A;  2ZEM A;  4IHM A;  2V8G A;  3ISX A;  5LYF A;  4OKO A;  3PB6 X;  2ABZ A;  3B3W A;  2WZN A;  2CTB A;  1R3N A;  4W9Y A;  4RUH A;  2AFZ A;  4PXE A;  3HUV A;  1Z5R A;  2PJ6 A;  1CP7 A;  2FVG A;  1CP6 A;  3T8W A;  1EE3 P;  4H2K A;  1ARM A;  1ZLH A;  3RZA A;  1IY7 A;  2HC9 A;  4R6T A;  3K9T A;  1ZG8 A;  4PXD A;  3V7Z A;  3SI0 A;  3V38 A;  2F7V A;  5JGF A;  1Z8L A;  1CPX A;  4UIA A;  4UIB A;  3CPX A;  2O53 A;  1YSJ A;  3IJ3 A;  4ZX8 A;  4GM5 A;  4IAV A;  3TC8 A;  1F2P A;  4FUU A;  3ISZ A;  2AFW A;  5LRJ A;  4FWU A;  1HEE A;  1TKF A;  1XMB A;  3N5F A;  4Z65 A;  3WC6 A;  2PJ8 A;  3SJX A;  4TNU A;  4UEF A;  4PPZ A;  1XFO A;  3KHZ A;  4NGS A;  4F9U A;  3KQX A;  1TF8 A;  5LRG A;  4PXC A;  3KZW A;  4OC5 A;  1QMU A;  2QVP A;  3H8F A;  1PYT B;  2XEG A;  2ZOG A;  2JEW A;  3SI2 A;  3JRU A;  2ZEH A;  3CT9 A;  2PRQ A;  4A38 A;  4ZI6 A;  1CG2 A;  4ONW A;  1BLL E;  5D29 A;  2BO9 A;  5K8O A;  2AFS A;  3WC7 A;  4UEE A;  4OP4 A;  3PBB A;  2ANP A;  1BPM A;  1TF9 A;  2ZEE A;  3GB0 A;  2GLF A;  3PBE A;  3BHX A;  3SJF A;  2I3C A;  4P6Y A;  3B3V A;  4X8I A;  2C6C A;  6CPA A;  2AFM A;  2ZEP A;  3LWU A;  1TXR A;  3HLP A;  1AMP A;  3KI9 A;  5LYL A;  2XEF A;  3D68 A;  1Y0Y A;  4P44 A;  2RFH A;  1OBR A;  4FAI A;  1Y7E A;  4B6Z A;  3B7I A;  2J9A A;  2PJC A;  4EME A;  2CTC A;  3PFE A;  3BXM A;  1ELM P;  1QQ9 A;  2IMO A;  4NJR A;  3D66 A;  4NGN A;  5D8N A;  4G1P A;  4P10 A;  2F8H A;  1AYE A;  4OIW A;  4O23 A;  1XRY A;  1VHO A;  4EWT A;  3FJU A;  3KGQ A;  4NGP A;  4DJL A;  2PCU A;  4Q7A A;  1VIX A;  2AFX A;  3PFO A;  1LAN A;  3KR5 A;  4P4I A;  3TX8 A;  1GYT A;  1ZG7 A;  4ZY2 A;  3GUX A;  3H8G A;  2EK8 A;  3B3C A;  3I1U A;  4ZY0 A;  2O4H A;  3PB4 X;  2EWB A;  3K2K A;  4P45 A;  3NA6 A;  1KWM A;  1Y0R A;  4R7M A;  3WAB A;  3S9L A;  1F2O A;  4ZYQ A;  2BOA A;  1CBX A;  2CIJ A;  2POK A;  2PE3 A;  2V8H A;  1FT7 A;  3IFE A;  1VGY A;  1YW6 A;  3FF3 A;  1BAV A;  3S9N A;  2Q4Z A;  3BI1 A;  1Z2L A;  5ELY A;  3KHX A;  2ZED A;  3B3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...