3GUXA

Crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
298
structure length
247
Chain Sequence
EVIKAPEFDADSAYQYIQVQADFGPRVPNTQAHKECGEYLAGQLEKFGAKVYNQYADLIAYDGTILKSRNIIGAYKPESKKRILLCAHWDSRPGASGVGVLLEIARQIQKEQPALGIDIVFFDSEDYQDTWCLGSQYWARTPHVQNYNARYGILLDMVGGKDATFYYEGYSARTARSEMKKIWKKAHELGYGKYFVKEDGGETVDDHIYVNKLARIPCVDIINYDNIDRNTLKAVGQTVMDVIYNEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Zn-dependent exopeptidase
publication title Crystal structure of putative Zn-dependent exopeptidase (YP_001298628.1) from Bacteroides vulgatus ATCC 8482 at 1.80 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Hydrolase
total genus 80
structure length 247
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3guxA00
2ABZA 4MCQA 2Q4ZA 1AMPA 4PXBA 2NYQA 5HXDA 1BAVA 1CP6A 2ZOFA 4UEFA 3DLJA 3B2YA 2IQ6A 5LYIA 2BO9A 4A39A 2ZEGA 1ZG9A 1ZG8A 5K8OA 1F2PA 1H8LA 4MMOA 2ZENA 4OIWA 1GYTA 5K8PA 1Y0YA 5JM6A 4JZ0A 3SJGA 1PYTB 4OMEA 2WYRA 2C6GA 2PJAA 4ZY1A 4IK2A 3NH4A 2ZEDA 6CPAA 1BPNA 2HB6A 5LYDA 4FWUA 3FMCA 3KI9A 3PEIA 4P6YA 4ONWA 1DTDA 3IWWA 3PBEA 3GUXA 3S9LA 1NSAA 2C1CA 2F7VA 2IMOA 1JQGA 4NGNA 1LAPA 3PB4X 4P4EA 3FF3A 3N5FA 4OC2A 4W9YA 4UEEA 1UWYA 3T8WA 1LAMA 4B6ZA 5CPAA 1FNOA 2EWBA 4P4IA 2C6PA 4Q7AA 2OOTA 4F9UA 2GLJA 2ZEOA 1AYEA 4NGRA 2V8GA 1HEEA 2BCOA 2I3CA 4YWYA 3B3CA 3GB0A 2JBJA 3KL9A 3H8FA 3BI1A 2PJ1A 3SI2A 4MCRA 1HDQA 3S9MA 3FECA 3D7GA 3LWUA 2PCUA 1CG2A 3CPAA 2PJ4A 2QYVA 1LANA 2ZEMA 3WC5A 4H2KA 5LRKA 3KZWA 1VHOA 3CDXA 2RB7A 3IO1A 1Q7LA 4EFDA 1VIXA 4R8FA 4OIDA 4IHMA 1Y0RA 4YU9A 3PB8X 3WC7A 4RUHA 3KQZA 3KR4A 3NH8A 3B3VA 4O23A 3NFZA 2GLFA 1YW6A 3SJXA 1IY7A 4IAVA 2BOAA 5LYLA 1XRYA 1Y7EA 3VH9A 3FX6A 1VGYA 1ZG7A 2GREA 3IIBA 1ELLP 3WABA 4MCPA 2V8HA 3IJ3A 3PB6X 1F57A 2QVPA 4FAIA 4A38A 4WJBA 4EMEA 2EK8A 4OC5A 3KHZA 1F2OA 1Z2LA 2ZEFA 4PXCA 4X2TA 5JGFA 2ZEPA 3ISZA 2ZEEA 2PE3A 1ZLHA 4P4BA 2JEWA 4P10A 3PBBA 2J9AA 5I4MA 1PCAA 3GLJA 1YW4A 4X8IA 3TX8A 3HUVA 4WWVA 4MHNA 2Q51A 3VATA 2PJ8A 1LOKA 3DGVA 3BHXA 3PFEA 4BD9A 3SI1A 4NJRA 3D7HA 4K3NA 2XEIA 2GU2A 1FT7A 2EK9A 3KQXA 2XEFA 3B3SA 3D7DA 4UIAA 4NGMA 1Z8LA 4DUKA 4P4DA 3MRUA 4P4FA 2PVVA 2PJ7A 1CPXA 5LRJA 5HVFA 4MHYA 4TNUA 2ANPA 3S9NA 3PRTA 1XMBA 4LQGA 5HVHA 4MHPA 4A94A 4Z65A 2V8VA 1EE3P 2PJ6A 3D68A 1CPSA 3IC1A 3NA6A 4TWEA 3D67A 2PIYA 1QQ9A 2PIZA 2CIJA 3D66A 1TF9A 1TKFA 1ZLIA 5D29A 1R3NA 3HLPA 3PB7X 5K8NA 5IB9A 2ZOGA 4ZY2A 4OP4A 3B3TA 3FEDA 4CPAA 4KSIA 2AFOA 1TKJA 1RTQA 2PJ5A 3K2KA 4PXEA 4MHZA 3KR5A 5LRGA 4PXDA 2Q43A 2FVGA 2XEJA 3SI0A 1XBUA 2XEGA 2AFWA 3B3WA 3VARA 3D7FA 3PFOA 2WZNA 2PJCA 1CP7A 1M4LA 4GM5A 3V7ZA 2O53A 3SJEA 3L2NA 3CT9A 4X3RA 2AFSA 5HVGA 4OC1A 3FH4A 3KGQA 3NH5A 1CX8A 4FBEA 2OR4A 3LMSA 4OC3A 3RZAA 2JBKA 2PJ3A 4MXUA 4ZYQA 3TC8A 2RFHA 3CPXA 1BLLE 4NFRA 4ZX8A 1QMUA 3JRUA 3FVLA 4UEZA 4F9VA 5DS0A 2PJ0A 4MRIA 3BI0A 3ISXA 1R43A 1Z5RA 3H8EA 4OKOA 4P4JA 1KWMA 2PRQA 2PVWA 2F8HA 2VL1A 2HC9A 3IFEA 1TKHA 3MN8A 5THWA 4DYOA 3IEHA 3SJFA 4ZI6A 1ARLA 3FJUA 2PJBA 2AFMA 2V8DA 5D8NA 3FEEA 4NJQA 5J1QA 4UIBA 2V77A 4EWTA 4G1PA 4NGSA 1YMEA 1LCPA 4PPZA 2ZELA 2G9DA 3K9TA 1TXRA 2POKA 4NGQA 3RBUA 3I1UA 1CBXA 3KASA 4F8ZA 1HDUA 2CTBA 4R7MA 1OBRA 3PB9X 5K8MA 2O4HA 4ZX9A 4OC4A 4MCSA 2IJZA 2NSMA 1VHEA 4NGPA 2ZEHA 3WC6A 4R6TA 4UF4A 3WT4A 2DEAA 4P45A 2AFXA 4R76A 1YSJA 5F09A 3B7IA 4NGTA 5ELYA 4A37A 1XJOA 4PQAA 5CBMA 3B35A 2AFUA 3H8GA 8CPAA 5JH9A 2CF4A 2C6CA 5LYFA 2QJ8A 1DE4C 3KHXA 3RAMA 2CTCA 1ARMA 4AXVA 1LFWA 2PJ2A 3D4UA 1YLOA 3V38A 4OC0A 4P44A 1TF8A 7CPAA 1XFOA 1IGBA 2AFZA 3BXMA 4FUUA 4DJLA 1ELMP 4JYWA 4ZY0A 3QNVA 1BPMA 2PJ9A
chains in the Genus database with same CATH superfamily
1S7KA 4KOVA 4U9ZA 2B5GA 1QSOA 2ABZA 3VWDA 4MCQA 1I21A 2B4DA 2Q4ZA 3F5BA 3IGRA 3SXOA 2QMLA 1AMPA 3D8PA 4PXBA 4R9MA 3I9SA 3FRMA 1CJWA 4M6GA 2NYQA 5HXDA 3W91A 1NMTA 1U6MA 3CZXA 1TIQA 4HPSA 4NXYA 1IB1E 3V8IA 1QSNA 1BAVA 3R9EA 4M3SA 2Z3OA 2ZW6A 4CGNA 1CP6A 2ZOFA 4UEFA 3DLJA 4PK2A 5F48A 5ISVA 3B2YA 5G1ZA 2IQ6A 2JLMA 3N7ZA 5LYIA 1Q2DA 2BO9A 4AB7A 4A39A 1X12A 2ZEGA 2FIAA 3TOBA 1ZG9A 4B5PB 1Z4EA 1ZG8A 5K8OA 5G21A 1F2PA 1H8LA 1Z9UA 4UCPA 4MMOA 4AVAA 2ZENA 2Y0MA 1PUAA 4KSFA 4OIWA 1GYTA 1I12A 4X5KA 2G0BA 5K8PA 1Y0YA 5JM6A 4JZ0A 2CY2A 4PSXA 3SJGA 3W6SA 1PYTB 4OMEA 2WYRA 2C6GA 2PJAA 4ZY1A 2RC4A 4MY0A 5KTAA 4IK2A 3WR7A 2P6EA 2ZEDA 3NH4A 6CPAA 1BPNA 2VZYA 2HB6A 5LYDA 2Z3NA 1N71A 2P6FA 3FMCA 4FWUA 4MFJA 4E2AA 4BINA 3KI9A 3FXTA 3PEIA 4P6YA 2PR1A 1WK4A 2REEA 4ONWA 1DTDA 2B3VA 3IWWA 3PBEA 3GUXA 3S9LA 4KOSA 4LQ6A 4NSQA 1NSAA 5HH1A 2C1CA 2F7VA 4QBJA 1M44A 2IMOA 2DF5A 1JQGA 4NGNA 4AG7A 1LAPA 1M4IA 3PB4X 3DSBA 1YVOA 4P4EA 4F0XA 1IOFA 3FF3A 4A31A 3N5FA 4B10A 4OC2A 3EFAA 4W9YA 2G3AA 4UEEA 2BSWA 1UWYA 1MJAA 4KZTA 2Z3KA 2YNCA 1LAMA 2Z3PA 3QAHA 3T8WA 4B6ZA 2JDCA 3T9YA 5CPAA 4J3GA 1FNOA 5F46A 2GE3A 1B6BA 2EWBA 2J8RA 2ZW7A 3SXNA 4P4IA 2C6PA 4CAFA 4Q7AA 2OOTA 4F9UA 4E8OA 2GLJA 2ZEOA 1AYEA 4NGRA 2V8GA 4LX9A 4KS9A 1CM0A 1HEEA 2BCOA 2I3CA 2J8MA 2P0WA 2G3TA 2Z10A 4YWYA 4CYPA 5DWNA 3RO0A 4OAEA 3B3CA 3GB0A 4MFQA 2FSRA 2JBJA 2B3UA 3KL9A 3H8FA 3BI1A 2PJ1A 3SI2A 4U5YA 4MCRA 2I00A 1HDQA 3S9MA 4KORA 3FECA 4C2XA 3D2PA 3D7GA 2EBJA 3LWUA 4FD6A 2PCUA 4KVME 4L89A 4AVCA 4PK3A 3ZJ0A 1CG2A 3CPAA 4B5PA 1Z8WA 2K5TA 1SQHA 2GFQA 2PJ4A 2QYVA 3D2MA 3F0AA 4HNWB 1LANA 2ZEMA 3WC5A 2WPXA 4YFJA 4H2KA 4NEXA 5LRKA 3KZWA 1VHOA 3CDXA 4QVTA 2RB7A 3P2FA 3FB3A 3IO1A 1Q7LA 4M6HA 4EFDA 1VIXA 4R8FA 4OIDA 4IHMA 1Y0RA 5AG5A 1B87A 2Q4YA 1BO4A 4JJXA 4YU9A 4B11A 3PB8X 1Q2YA 3WC7A 4RUHA 1R57A 1YGHA 3KQZA 2AE6A 3KR4A 2VEZA 4II9A 3NH8A 2BEIA 1VKCA 3B3VA 1Z4RA 4CAXA 3LD2A 4O23A 5IX3A 3IU1A 3JTKA 2EUIA 3R1KA 1S7NA 3NFZA 2GLFA 4QB9A 4PV6A 1YW6A 4BBHA 3SJXA 1IY7A 4IAVA 4KVXA 5E96A 1Y7RA 2BOAA 2R98A 3TT2A 5LYLA 1XRYA 1Y7EA 1S60A 3I3GA 4L8AA 2Q0YA 1NSLA 2ODFA 3VH9A 1YR0A 3FX6A 1M4GA 3C26A 1VGYA 3FNCA 4KVOE 1ZG7A 2GREA 1GHEA 3IIBA 1K4JA 1Y9WA 1IIDA 2D4PA 1ELLP 1L0CA 3G8WA 1Z8TA 2PR8A 3WABA 4MCPA 3DR6A 1VHSA 4CS0B 3TOAA 4XPLA 3EXNA 2V8HA 2EVNA 2FCKA 2PQ8A 3EC4A 3IJ3A 3PB6X 4U9YA 1F57A 1A2ZA 4H89A 4ORFA 1KUYA 2QVPA 2NMTA 4FAIA 1J4JA 4A38A 2ZW5A 4WJBA 5EC4A 4EMEA 2EK8A 4OC5A 3KHZA 1F2OA 1Z2LA 2ZEFA 4PXCA 4X2TA 4Q38A 5JGFA 2ZEPA 2ATRA 1XF8A 3ISZA 4CAWA 3G3SA 2ZEEA 2VZZA 2PE3A 2VXKA 2Z3MA 1ZLHA 4P4BA 4UWJA 5AG6A 2JEWA 4C2ZA 3DDDA 3PBBA 4P10A 2J9AA 4A95A 5I4MA 3R9GA 1PCAA 3GLJA 1YW4A 3NE7A 3BLNA 4X8IA 3ZZIA 1S7FA 3SHPA 3TX8A 3HUVA 2VBQA 1UFHA 3QAYA 4UA3A 4WWVA 2O28A 4M6IA 2Q51A 4MHNA 3PZJA 1KZFA 3BJ7A 3VATA 2FXFA 2PJ8A 2Q4VA 1LOKA 3DGVA 4Y49C 3BHXA 3RYOA 2PRBA 3PFEA 4BD9A 4OLLA 3SI1A 4NJRA 3D7HA 1XOVA 4GXHA 2EO8A 4K3NA 2XEIA 2GU2A 1FT7A 2EK9A 4FD7A 4ONUA 4KUBA 3KQXA 5H86A 4AVBA 2WUUA 2XEFA 3B3SA 3D7DA 5JQ4A 5BWAB 4UIAA 4NGMA 2B58A 1Z8LA 1QSRA 3PGPA 4HNYB 3FBUA 3IWEA 2BUEA 4DUKA 4IF5A 4YGOA 4CGMA 1S7LA 4I49A 3W6XA 4P4DA 3P2HA 4QUSA 2OU2A 3MRUA 1RO5A 2DPTA 4BMHA 3UY5A 1RXTA 5HMNA 4P4FA 2PVVA 2PJ7A 1CPXA 3S6HA 5LRJA 4CGOA 1P4NA 3A9LA 5HVFA 4MHYA 2B5GB 2OZHA 4TNUA 2ANPA 3S9NA 3PRTA 2VI7A 1XMBA 3E0KA 4LQGA 3TCVA 2B4DB 5HVHA 3BJ8A 4JXQA 4MHPA 1QSTA 4A94A 3DNSA 4Z65A 2OZUA 2V8VA 2ARHA 2PDOA 5F49A 1EE3P 2PJ6A 5EBVA 2FL4A 2FT0A 3D68A 1CPSA 1S5KA 1YVKA 2Q04A 3OWCA 3IC1A 4FD5A 4CYQA 4UCMA 1Y9KA 4A32A 3NA6A 5G20A 4Y49B 2R8VA 4TWEA 4MJ8A 3D67A 2Z0ZA 3RNZA 2PIYA 1QQ9A 2PIZA 2PSWA 4OADA 2CIJA 4CYOA 3D66A 2HV2A 4CRZB 1TF9A 1TKFA 5A28A 2I79A 1ZLIA 2A4NA 1R3NA 2CNMA 3HLPA 3PB7X 5D29A 5K8NA 5AGEA 5IB9A 2ZOGA 4ZY2A 3S6FA 4OP4A 3B3TA 3FEDA 4B12A 4CPAA 1Z8XA 4KSIA 2BL1A 2AFOA 1TKJA 5EMIA 1RTQA 2PJ5A 1PU9A 4KOWA 4FD4A 3D3SA 3K2KA 2HUZA 2QIRA 4PXEA 4MHZA 4JLYA 3KR5A 5LRGA 3S6GA 4PXDA 2Q43A 1XIXA 1FY7A 4CGLA 2FVGA 2CNTA 2XEJA 3SI0A 1XBUA 2CNSA 2XEGA 2AFWA 3B3WA 4F6AA 3PP9A 3VARA 1KUXA 3D7FA 4NCZA 4C68A 1KUVA 2GIVA 2CXAA 3PFOA 2WZNA 2PJCA 3LACA 1CP7A 4A30A 1M4LA 3TTHA 4GM5A 2P6GA 3V7ZA 2REFA 2YNDA 3R95A 4H6ZA 2O53A 3SJEA 3L2NA 3CT9A 4X3RA 2AFSA 3B8GA 1YREA 5HVGA 5GCNA 1NE9A 4OC1A 4KLWA 4ZBGA 5C82A 5DWMA 3FH4A 4F0YA 2Z3LA 3KGQA 2R7HA 3NH5A 5AG7A 1IYKA 1CX8A 4FBEA 2DPSA 2OR4A 3LMSA 3TO7A 2Q7SA 4OC3A 3RZAA 2JBKA 2PJ3A 4MXUA 3FYNA 4YRHA 4KOXA 4B5OA 4ZYQA 3TC8A 4H6UA 4R3LA 2RFHA 4XPDC 3CPXA 1BLLE 4NF1A 4NFRA 4JXRA 2FS5A 4ZX8A 4AG9A 1BOBA 1S3ZA 3DR8A 4MFZA 1QMUA 3JRUA 3FVLA 4UEZA 4F9VA 5IV0A 1IYLA 5DS0A 2D4OA 2PJ0A 2ZW4A 4MRIA 3GKRA 3BI0A 2OZGA 1Q2CA 3F8KA 3ISXA 1R43A 2B4BA 2PC1A 3JUWA 4EVYA 1Z5RA 1IOIA 3H8EA 4OKOA 4P4JA 1XMTA 1KWMA 3FIXA 4CGPA 2IL4A 2JEVA 1MK4A 2PRQA 2PVWA 2J8NA 2F8HA 4MHDA 3GY9A 2VL1A 4GS4A 2GANA 2AJ6A 2HC9A 3CXQA 4KOTA 3IFEA 5CNPA 1TKHA 4KLVA 2FE7A 1XE4A 3MN8A 4MFLA 5THWA 3IWGA 4A33A 4DYOA 4MBUA 4IUSA 5J8CA 3IEHA 1X10A 3SJFA 4C7HA 3CXSA 4ZI6A 1ARLA 1XEBA 4R87A 2OH1A 3FJUA 1YK3A 3EO4A 3H4QA 2PJBA 1M1DA 2AFMA 2V8DA 5D8NA 2R1IA 3FEEA 4UBRA 3T90A 5JPHA 4NJQA 4C7IA 5J1QA 4HNXB 5H84A 3R96A 3QB8A 4DNCA 1YQEA 5FVJA 4MFKA 4UIBA 4XPDB 4CYNA 2V77A 4EWTA 4G1PA 4HKFA 4NGSA 1MJBA 1I1DA 1YMEA 1LCPA 4PPZA 2WPWA 2ZELA 3K9UA 4MI4A 3EY5A 2G9DA 4KOYA 3K9TA 4XNHC 3TO6A 4XPKA 1TXRA 4RN7A 2POKA 4NGQA 4PSWA 3RBUA 3I1UA 1CBXA 4CAVA 4UFWA 5C88A 5J8FA 3KASA 4LUAA 4F8ZA 1HDUA 2CTBA 4UWIA 4R7MA 1OBRA 3NE8A 3PB9X 4K30A 5K8MA 2O4HA 3JVNA 4Q36A 4CAEA 5KTDA 5A27A 2Q44A 4ZX9A 4OC4A 4MCSA 2VQYA 2IJZA 3IU2A 5I0CA 4JWPA 2YGWA 1IICA 2NSMA 1VHEA 4NGPA 2ZEHA 2Q7BA 4A2ZA 4UCNA 2OB0A 3WC6A 3VWEA 4R6TA 2X7BA 1JWQA 1QSMA 2YNCC 4MFPA 2H5MA 1YX0A 2HQYA 4UF4A 3WT4A 2DEAA 4B13A 2KCWA 2JDDA 4P45A 2AFXA 3GYAA 4KUAA 4R76A 3R9FA 1MJ9A 5F47A 1AUGA 1YSJA 2C27A 2FIWA 4KOUA 1ON0A 5F09A 2YNEA 4R57A 3TO9A 2ZPAA 1V0CA 3B7IA 3GIUA 4NGTA 3H5ZA 5ELYA 4KSAA 1P0HA 1WWZA 4A37A 1XJOA 4PQAA 5CBMA 1ZO0A 3B35A 5AG4A 4B14A 4R3KA 2AFUA 3H8GA 8CPAA 4XNHB 2CF4A 3S6KA 4E0AA 5JH9A 2C6CA 5IB0A 5LYFA 2QJ8A 1DE4C 3KHXA 3RAMA 2ZXVA 2CTCA 1IU8A 4JD6A 3LODA 1ARMA 4AXVA 3TE4A 1LFWA 2PJ2A 4RS2A 4UFVA 3D4UA 1YLOA 3KKWA 4OC0A 4P44A 1TF8A 3V38A 7CPAA 2F5IA 1XFOA 2WSAA 2DXQA 1IGBA 2AFZA 4QC6A 3MGDA 4ZGYB 3BXMA 4C2YA 4M85A 2QECA 4FUUA 3CXPA 5G22A 4CRYB 1OZPA 4MY3A 2Z11A 1LRZA 3TFYA 4RI1A 4DJLA 1ELMP 4JYWA 4UFXA 5KTCA 1YLEA 4ZY0A 3QNVA 1BPMA 2PJ9A 1M4DA
chains in the Genus database with same CATH topology
2ABZA 4MCQA 2Q4ZA 1AMPA 4PXBA 2NYQA 5HXDA 1BAVA 1CP6A 2ZOFA 4UEFA 3DLJA 3B2YA 2IQ6A 5LYIA 2BO9A 4A39A 2ZEGA 1ZG9A 1ZG8A 5K8OA 1F2PA 1H8LA 4MMOA 2ZENA 4OIWA 1GYTA 5K8PA 1Y0YA 5JM6A 4JZ0A 3SJGA 1PYTB 4OMEA 2WYRA 2C6GA 2PJAA 4ZY1A 4IK2A 3NH4A 2ZEDA 6CPAA 1BPNA 2HB6A 5LYDA 4FWUA 3FMCA 3KI9A 3PEIA 4P6YA 4ONWA 1DTDA 3IWWA 3PBEA 3GUXA 3S9LA 1NSAA 2C1CA 2F7VA 2IMOA 1JQGA 4NGNA 1LAPA 3PB4X 4P4EA 3FF3A 3N5FA 4OC2A 4W9YA 4UEEA 1UWYA 3T8WA 1LAMA 4B6ZA 5CPAA 1FNOA 2EWBA 4P4IA 2C6PA 4Q7AA 2OOTA 4F9UA 2GLJA 2ZEOA 1AYEA 4NGRA 2V8GA 1HEEA 2BCOA 2I3CA 4YWYA 3B3CA 3GB0A 2JBJA 3KL9A 3H8FA 3BI1A 2PJ1A 3SI2A 4MCRA 1HDQA 3S9MA 3FECA 3D7GA 3LWUA 2PCUA 1CG2A 3CPAA 2PJ4A 2QYVA 1LANA 2ZEMA 3WC5A 4H2KA 5LRKA 3KZWA 1VHOA 3CDXA 2RB7A 3IO1A 1Q7LA 4EFDA 1VIXA 4R8FA 4OIDA 4IHMA 1Y0RA 4YU9A 3PB8X 3WC7A 4RUHA 3KQZA 3KR4A 3NH8A 3B3VA 4O23A 3NFZA 2GLFA 1YW6A 3SJXA 1IY7A 4IAVA 2BOAA 5LYLA 1XRYA 1Y7EA 3VH9A 3FX6A 1VGYA 1ZG7A 2GREA 3IIBA 1ELLP 3WABA 4MCPA 2V8HA 3IJ3A 3PB6X 1F57A 2QVPA 4FAIA 4A38A 4WJBA 4EMEA 2EK8A 4OC5A 3KHZA 1F2OA 1Z2LA 2ZEFA 4PXCA 4X2TA 5JGFA 2ZEPA 3ISZA 2ZEEA 2PE3A 1ZLHA 4P4BA 2JEWA 4P10A 3PBBA 2J9AA 5I4MA 1PCAA 3GLJA 1YW4A 4X8IA 3TX8A 3HUVA 4WWVA 4MHNA 2Q51A 3VATA 2PJ8A 1LOKA 3DGVA 3BHXA 3PFEA 4BD9A 3SI1A 4NJRA 3D7HA 4K3NA 2XEIA 2GU2A 1FT7A 2EK9A 3KQXA 2XEFA 3B3SA 3D7DA 4UIAA 4NGMA 1Z8LA 4DUKA 4P4DA 3MRUA 4P4FA 2PVVA 2PJ7A 1CPXA 5LRJA 5HVFA 4MHYA 4TNUA 2ANPA 3S9NA 3PRTA 1XMBA 4LQGA 5HVHA 4MHPA 4A94A 4Z65A 2V8VA 1EE3P 2PJ6A 3D68A 1CPSA 3IC1A 3NA6A 4TWEA 3D67A 2PIYA 1QQ9A 2PIZA 2CIJA 3D66A 1TF9A 1TKFA 1ZLIA 5D29A 1R3NA 3HLPA 3PB7X 5K8NA 5IB9A 2ZOGA 4ZY2A 4OP4A 3B3TA 3FEDA 4CPAA 4KSIA 2AFOA 1TKJA 1RTQA 2PJ5A 3K2KA 4PXEA 4MHZA 3KR5A 5LRGA 4PXDA 2Q43A 2FVGA 2XEJA 3SI0A 1XBUA 2XEGA 2AFWA 3B3WA 3VARA 3D7FA 3PFOA 2WZNA 2PJCA 1CP7A 1M4LA 4GM5A 3V7ZA 2O53A 3SJEA 3L2NA 3CT9A 4X3RA 2AFSA 5HVGA 4OC1A 3FH4A 3KGQA 3NH5A 1CX8A 4FBEA 2OR4A 3LMSA 4OC3A 3RZAA 2JBKA 2PJ3A 4MXUA 4ZYQA 3TC8A 2RFHA 3CPXA 1BLLE 4NFRA 4ZX8A 1QMUA 3JRUA 3FVLA 4UEZA 4F9VA 5DS0A 2PJ0A 4MRIA 3BI0A 3ISXA 1R43A 1Z5RA 3H8EA 4OKOA 4P4JA 1KWMA 2PRQA 2PVWA 2F8HA 2VL1A 2HC9A 3IFEA 1TKHA 3MN8A 5THWA 4DYOA 3IEHA 3SJFA 4ZI6A 1ARLA 3FJUA 2PJBA 2AFMA 2V8DA 5D8NA 3FEEA 4NJQA 5J1QA 4UIBA 2V77A 4EWTA 4G1PA 4NGSA 1YMEA 1LCPA 4PPZA 2ZELA 2G9DA 3K9TA 1TXRA 2POKA 4NGQA 3RBUA 3I1UA 1CBXA 3KASA 4F8ZA 1HDUA 2CTBA 4R7MA 1OBRA 3PB9X 5K8MA 2O4HA 4ZX9A 4OC4A 4MCSA 2IJZA 2NSMA 1VHEA 4NGPA 2ZEHA 3WC6A 4R6TA 4UF4A 3WT4A 2DEAA 4P45A 2AFXA 4R76A 1YSJA 5F09A 3B7IA 4NGTA 5ELYA 4A37A 1XJOA 4PQAA 5CBMA 3B35A 2AFUA 3H8GA 8CPAA 5JH9A 2CF4A 2C6CA 5LYFA 2QJ8A 1DE4C 3KHXA 3RAMA 2CTCA 1ARMA 4AXVA 1LFWA 2PJ2A 3D4UA 1YLOA 3V38A 4OC0A 4P44A 1TF8A 7CPAA 1XFOA 1IGBA 2AFZA 3BXMA 4FUUA 4DJLA 1ELMP 4JYWA 4ZY0A 3QNVA 1BPMA 2PJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABZ A;  4MCQ A;  2Q4Z A;  1AMP A;  4PXB A;  2NYQ A;  5HXD A;  1BAV A;  1CP6 A;  2ZOF A;  4UEF A;  3DLJ A;  3B2Y A;  2IQ6 A;  5LYI A;  2BO9 A;  4A39 A;  2ZEG A;  1ZG9 A;  1ZG8 A;  5K8O A;  1F2P A;  1H8L A;  4MMO A;  2ZEN A;  4OIW A;  1GYT A;  5K8P A;  1Y0Y A;  5JM6 A;  4JZ0 A;  3SJG A;  1PYT B;  4OME A;  2WYR A;  2C6G A;  2PJA A;  4ZY1 A;  4IK2 A;  3NH4 A;  2ZED A;  6CPA A;  1BPN A;  2HB6 A;  5LYD A;  4FWU A;  3FMC A;  3KI9 A;  3PEI A;  4P6Y A;  4ONW A;  1DTD A;  3IWW A;  3PBE A;  3GUX A;  3S9L A;  1NSA A;  2C1C A;  2F7V A;  2IMO A;  1JQG A;  4NGN A;  1LAP A;  3PB4 X;  4P4E A;  3FF3 A;  3N5F A;  4OC2 A;  4W9Y A;  4UEE A;  1UWY A;  3T8W A;  1LAM A;  4B6Z A;  5CPA A;  1FNO A;  2EWB A;  4P4I A;  2C6P A;  4Q7A A;  2OOT A;  4F9U A;  2GLJ A;  2ZEO A;  1AYE A;  4NGR A;  2V8G A;  1HEE A;  2BCO A;  2I3C A;  4YWY A;  3B3C A;  3GB0 A;  2JBJ A;  3KL9 A;  3H8F A;  3BI1 A;  2PJ1 A;  3SI2 A;  4MCR A;  1HDQ A;  3S9M A;  3FEC A;  3D7G A;  3LWU A;  2PCU A;  1CG2 A;  3CPA A;  2PJ4 A;  2QYV A;  1LAN A;  2ZEM A;  3WC5 A;  4H2K A;  5LRK A;  3KZW A;  1VHO A;  3CDX A;  2RB7 A;  3IO1 A;  1Q7L A;  4EFD A;  1VIX A;  4R8F A;  4OID A;  4IHM A;  1Y0R A;  4YU9 A;  3PB8 X;  3WC7 A;  4RUH A;  3KQZ A;  3KR4 A;  3NH8 A;  3B3V A;  4O23 A;  3NFZ A;  2GLF A;  1YW6 A;  3SJX A;  1IY7 A;  4IAV A;  2BOA A;  5LYL A;  1XRY A;  1Y7E A;  3VH9 A;  3FX6 A;  1VGY A;  1ZG7 A;  2GRE A;  3IIB A;  1ELL P;  3WAB A;  4MCP A;  2V8H A;  3IJ3 A;  3PB6 X;  1F57 A;  2QVP A;  4FAI A;  4A38 A;  4WJB A;  4EME A;  2EK8 A;  4OC5 A;  3KHZ A;  1F2O A;  1Z2L A;  2ZEF A;  4PXC A;  4X2T A;  5JGF A;  2ZEP A;  3ISZ A;  2ZEE A;  2PE3 A;  1ZLH A;  4P4B A;  2JEW A;  4P10 A;  3PBB A;  2J9A A;  5I4M A;  1PCA A;  3GLJ A;  1YW4 A;  4X8I A;  3TX8 A;  3HUV A;  4WWV A;  4MHN A;  2Q51 A;  3VAT A;  2PJ8 A;  1LOK A;  3DGV A;  3BHX A;  3PFE A;  4BD9 A;  3SI1 A;  4NJR A;  3D7H A;  4K3N A;  2XEI A;  2GU2 A;  1FT7 A;  2EK9 A;  3KQX A;  2XEF A;  3B3S A;  3D7D A;  4UIA A;  4NGM A;  1Z8L A;  4DUK A;  4P4D A;  3MRU A;  4P4F A;  2PVV A;  2PJ7 A;  1CPX A;  5LRJ A;  5HVF A;  4MHY A;  4TNU A;  2ANP A;  3S9N A;  3PRT A;  1XMB A;  4LQG A;  5HVH A;  4MHP A;  4A94 A;  4Z65 A;  2V8V A;  1EE3 P;  2PJ6 A;  3D68 A;  1CPS A;  3IC1 A;  3NA6 A;  4TWE A;  3D67 A;  2PIY A;  1QQ9 A;  2PIZ A;  2CIJ A;  3D66 A;  1TF9 A;  1TKF A;  1ZLI A;  5D29 A;  1R3N A;  3HLP A;  3PB7 X;  5K8N A;  5IB9 A;  2ZOG A;  4ZY2 A;  4OP4 A;  3B3T A;  3FED A;  4CPA A;  4KSI A;  2AFO A;  1TKJ A;  1RTQ A;  2PJ5 A;  3K2K A;  4PXE A;  4MHZ A;  3KR5 A;  5LRG A;  4PXD A;  2Q43 A;  2FVG A;  2XEJ A;  3SI0 A;  1XBU A;  2XEG A;  2AFW A;  3B3W A;  3VAR A;  3D7F A;  3PFO A;  2WZN A;  2PJC A;  1CP7 A;  1M4L A;  4GM5 A;  3V7Z A;  2O53 A;  3SJE A;  3L2N A;  3CT9 A;  4X3R A;  2AFS A;  5HVG A;  4OC1 A;  3FH4 A;  3KGQ A;  3NH5 A;  1CX8 A;  4FBE A;  2OR4 A;  3LMS A;  4OC3 A;  3RZA A;  2JBK A;  2PJ3 A;  4MXU A;  4ZYQ A;  3TC8 A;  2RFH A;  3CPX A;  1BLL E;  4NFR A;  4ZX8 A;  1QMU A;  3JRU A;  3FVL A;  4UEZ A;  4F9V A;  5DS0 A;  2PJ0 A;  4MRI A;  3BI0 A;  3ISX A;  1R43 A;  1Z5R A;  3H8E A;  4OKO A;  4P4J A;  1KWM A;  2PRQ A;  2PVW A;  2F8H A;  2VL1 A;  2HC9 A;  3IFE A;  1TKH A;  3MN8 A;  5THW A;  4DYO A;  3IEH A;  3SJF A;  4ZI6 A;  1ARL A;  3FJU A;  2PJB A;  2AFM A;  2V8D A;  5D8N A;  3FEE A;  4NJQ A;  5J1Q A;  4UIB A;  2V77 A;  4EWT A;  4G1P A;  4NGS A;  1YME A;  1LCP A;  4PPZ A;  2ZEL A;  2G9D A;  3K9T A;  1TXR A;  2POK A;  4NGQ A;  3RBU A;  3I1U A;  1CBX A;  3KAS A;  4F8Z A;  1HDU A;  2CTB A;  4R7M A;  1OBR A;  3PB9 X;  5K8M A;  2O4H A;  4ZX9 A;  4OC4 A;  4MCS A;  2IJZ A;  2NSM A;  1VHE A;  4NGP A;  2ZEH A;  3WC6 A;  4R6T A;  4UF4 A;  3WT4 A;  2DEA A;  4P45 A;  2AFX A;  4R76 A;  1YSJ A;  5F09 A;  3B7I A;  4NGT A;  5ELY A;  4A37 A;  1XJO A;  4PQA A;  5CBM A;  3B35 A;  2AFU A;  3H8G A;  8CPA A;  5JH9 A;  2CF4 A;  2C6C A;  5LYF A;  2QJ8 A;  1DE4 C;  3KHX A;  3RAM A;  2CTC A;  1ARM A;  4AXV A;  1LFW A;  2PJ2 A;  3D4U A;  1YLO A;  3V38 A;  4OC0 A;  4P44 A;  1TF8 A;  7CPA A;  1XFO A;  1IGB A;  2AFZ A;  3BXM A;  4FUU A;  4DJL A;  1ELM P;  4JYW A;  4ZY0 A;  3QNV A;  1BPM A;  2PJ9 A; 
#chains in the Genus database with same CATH topology
 1S7K A;  4KOV A;  4U9Z A;  2B5G A;  1QSO A;  2ABZ A;  3VWD A;  4MCQ A;  1I21 A;  2B4D A;  2Q4Z A;  3F5B A;  3IGR A;  3SXO A;  2QML A;  1AMP A;  3D8P A;  4PXB A;  4R9M A;  3I9S A;  3FRM A;  1CJW A;  4M6G A;  2NYQ A;  5HXD A;  3W91 A;  1NMT A;  1U6M A;  3CZX A;  1TIQ A;  4HPS A;  4NXY A;  1IB1 E;  3V8I A;  1QSN A;  1BAV A;  3R9E A;  4M3S A;  2Z3O A;  2ZW6 A;  4CGN A;  1CP6 A;  2ZOF A;  4UEF A;  3DLJ A;  4PK2 A;  5F48 A;  5ISV A;  3B2Y A;  5G1Z A;  2IQ6 A;  2JLM A;  3N7Z A;  5LYI A;  1Q2D A;  2BO9 A;  4AB7 A;  4A39 A;  1X12 A;  2ZEG A;  2FIA A;  3TOB A;  1ZG9 A;  4B5P B;  1Z4E A;  1ZG8 A;  5K8O A;  5G21 A;  1F2P A;  1H8L A;  1Z9U A;  4UCP A;  4MMO A;  4AVA A;  2ZEN A;  2Y0M A;  1PUA A;  4KSF A;  4OIW A;  1GYT A;  1I12 A;  4X5K A;  2G0B A;  5K8P A;  1Y0Y A;  5JM6 A;  4JZ0 A;  2CY2 A;  4PSX A;  3SJG A;  3W6S A;  1PYT B;  4OME A;  2WYR A;  2C6G A;  2PJA A;  4ZY1 A;  2RC4 A;  4MY0 A;  5KTA A;  4IK2 A;  3WR7 A;  2P6E A;  2ZED A;  3NH4 A;  6CPA A;  1BPN A;  2VZY A;  2HB6 A;  5LYD A;  2Z3N A;  1N71 A;  2P6F A;  3FMC A;  4FWU A;  4MFJ A;  4E2A A;  4BIN A;  3KI9 A;  3FXT A;  3PEI A;  4P6Y A;  2PR1 A;  1WK4 A;  2REE A;  4ONW A;  1DTD A;  2B3V A;  3IWW A;  3PBE A;  3GUX A;  3S9L A;  4KOS A;  4LQ6 A;  4NSQ A;  1NSA A;  5HH1 A;  2C1C A;  2F7V A;  4QBJ A;  1M44 A;  2IMO A;  2DF5 A;  1JQG A;  4NGN A;  4AG7 A;  1LAP A;  1M4I A;  3PB4 X;  3DSB A;  1YVO A;  4P4E A;  4F0X A;  1IOF A;  3FF3 A;  4A31 A;  3N5F A;  4B10 A;  4OC2 A;  3EFA A;  4W9Y A;  2G3A A;  4UEE A;  2BSW A;  1UWY A;  1MJA A;  4KZT A;  2Z3K A;  2YNC A;  1LAM A;  2Z3P A;  3QAH A;  3T8W A;  4B6Z A;  2JDC A;  3T9Y A;  5CPA A;  4J3G A;  1FNO A;  5F46 A;  2GE3 A;  1B6B A;  2EWB A;  2J8R A;  2ZW7 A;  3SXN A;  4P4I A;  2C6P A;  4CAF A;  4Q7A A;  2OOT A;  4F9U A;  4E8O A;  2GLJ A;  2ZEO A;  1AYE A;  4NGR A;  2V8G A;  4LX9 A;  4KS9 A;  1CM0 A;  1HEE A;  2BCO A;  2I3C A;  2J8M A;  2P0W A;  2G3T A;  2Z10 A;  4YWY A;  4CYP A;  5DWN A;  3RO0 A;  4OAE A;  3B3C A;  3GB0 A;  4MFQ A;  2FSR A;  2JBJ A;  2B3U A;  3KL9 A;  3H8F A;  3BI1 A;  2PJ1 A;  3SI2 A;  4U5Y A;  4MCR A;  2I00 A;  1HDQ A;  3S9M A;  4KOR A;  3FEC A;  4C2X A;  3D2P A;  3D7G A;  2EBJ A;  3LWU A;  4FD6 A;  2PCU A;  4KVM E;  4L89 A;  4AVC A;  4PK3 A;  3ZJ0 A;  1CG2 A;  3CPA A;  4B5P A;  1Z8W A;  2K5T A;  1SQH A;  2GFQ A;  2PJ4 A;  2QYV A;  3D2M A;  3F0A A;  4HNW B;  1LAN A;  2ZEM A;  3WC5 A;  2WPX A;  4YFJ A;  4H2K A;  4NEX A;  5LRK A;  3KZW A;  1VHO A;  3CDX A;  4QVT A;  2RB7 A;  3P2F A;  3FB3 A;  3IO1 A;  1Q7L A;  4M6H A;  4EFD A;  1VIX A;  4R8F A;  4OID A;  4IHM A;  1Y0R A;  5AG5 A;  1B87 A;  2Q4Y A;  1BO4 A;  4JJX A;  4YU9 A;  4B11 A;  3PB8 X;  1Q2Y A;  3WC7 A;  4RUH A;  1R57 A;  1YGH A;  3KQZ A;  2AE6 A;  3KR4 A;  2VEZ A;  4II9 A;  3NH8 A;  2BEI A;  1VKC A;  3B3V A;  1Z4R A;  4CAX A;  3LD2 A;  4O23 A;  5IX3 A;  3IU1 A;  3JTK A;  2EUI A;  3R1K A;  1S7N A;  3NFZ A;  2GLF A;  4QB9 A;  4PV6 A;  1YW6 A;  4BBH A;  3SJX A;  1IY7 A;  4IAV A;  4KVX A;  5E96 A;  1Y7R A;  2BOA A;  2R98 A;  3TT2 A;  5LYL A;  1XRY A;  1Y7E A;  1S60 A;  3I3G A;  4L8A A;  2Q0Y A;  1NSL A;  2ODF A;  3VH9 A;  1YR0 A;  3FX6 A;  1M4G A;  3C26 A;  1VGY A;  3FNC A;  4KVO E;  1ZG7 A;  2GRE A;  1GHE A;  3IIB A;  1K4J A;  1Y9W A;  1IID A;  2D4P A;  1ELL P;  1L0C A;  3G8W A;  1Z8T A;  2PR8 A;  3WAB A;  4MCP A;  3DR6 A;  1VHS A;  4CS0 B;  3TOA A;  4XPL A;  3EXN A;  2V8H A;  2EVN A;  2FCK A;  2PQ8 A;  3EC4 A;  3IJ3 A;  3PB6 X;  4U9Y A;  1F57 A;  1A2Z A;  4H89 A;  4ORF A;  1KUY A;  2QVP A;  2NMT A;  4FAI A;  1J4J A;  4A38 A;  2ZW5 A;  4WJB A;  5EC4 A;  4EME A;  2EK8 A;  4OC5 A;  3KHZ A;  1F2O A;  1Z2L A;  2ZEF A;  4PXC A;  4X2T A;  4Q38 A;  5JGF A;  2ZEP A;  2ATR A;  1XF8 A;  3ISZ A;  4CAW A;  3G3S A;  2ZEE A;  2VZZ A;  2PE3 A;  2VXK A;  2Z3M A;  1ZLH A;  4P4B A;  4UWJ A;  5AG6 A;  2JEW A;  4C2Z A;  3DDD A;  3PBB A;  4P10 A;  2J9A A;  4A95 A;  5I4M A;  3R9G A;  1PCA A;  3GLJ A;  1YW4 A;  3NE7 A;  3BLN A;  4X8I A;  3ZZI A;  1S7F A;  3SHP A;  3TX8 A;  3HUV A;  2VBQ A;  1UFH A;  3QAY A;  4UA3 A;  4WWV A;  2O28 A;  4M6I A;  2Q51 A;  4MHN A;  3PZJ A;  1KZF A;  3BJ7 A;  3VAT A;  2FXF A;  2PJ8 A;  2Q4V A;  1LOK A;  3DGV A;  4Y49 C;  3BHX A;  3RYO A;  2PRB A;  3PFE A;  4BD9 A;  4OLL A;  3SI1 A;  4NJR A;  3D7H A;  1XOV A;  4GXH A;  2EO8 A;  4K3N A;  2XEI A;  2GU2 A;  1FT7 A;  2EK9 A;  4FD7 A;  4ONU A;  4KUB A;  3KQX A;  5H86 A;  4AVB A;  2WUU A;  2XEF A;  3B3S A;  3D7D A;  5JQ4 A;  5BWA B;  4UIA A;  4NGM A;  2B58 A;  1Z8L A;  1QSR A;  3PGP A;  4HNY B;  3FBU A;  3IWE A;  2BUE A;  4DUK A;  4IF5 A;  4YGO A;  4CGM A;  1S7L A;  4I49 A;  3W6X A;  4P4D A;  3P2H A;  4QUS A;  2OU2 A;  3MRU A;  1RO5 A;  2DPT A;  4BMH A;  3UY5 A;  1RXT A;  5HMN A;  4P4F A;  2PVV A;  2PJ7 A;  1CPX A;  3S6H A;  5LRJ A;  4CGO A;  1P4N A;  3A9L A;  5HVF A;  4MHY A;  2B5G B;  2OZH A;  4TNU A;  2ANP A;  3S9N A;  3PRT A;  2VI7 A;  1XMB A;  3E0K A;  4LQG A;  3TCV A;  2B4D B;  5HVH A;  3BJ8 A;  4JXQ A;  4MHP A;  1QST A;  4A94 A;  3DNS A;  4Z65 A;  2OZU A;  2V8V A;  2ARH A;  2PDO A;  5F49 A;  1EE3 P;  2PJ6 A;  5EBV A;  2FL4 A;  2FT0 A;  3D68 A;  1CPS A;  1S5K A;  1YVK A;  2Q04 A;  3OWC A;  3IC1 A;  4FD5 A;  4CYQ A;  4UCM A;  1Y9K A;  4A32 A;  3NA6 A;  5G20 A;  4Y49 B;  2R8V A;  4TWE A;  4MJ8 A;  3D67 A;  2Z0Z A;  3RNZ A;  2PIY A;  1QQ9 A;  2PIZ A;  2PSW A;  4OAD A;  2CIJ A;  4CYO A;  3D66 A;  2HV2 A;  4CRZ B;  1TF9 A;  1TKF A;  5A28 A;  2I79 A;  1ZLI A;  2A4N A;  1R3N A;  2CNM A;  3HLP A;  3PB7 X;  5D29 A;  5K8N A;  5AGE A;  5IB9 A;  2ZOG A;  4ZY2 A;  3S6F A;  4OP4 A;  3B3T A;  3FED A;  4B12 A;  4CPA A;  1Z8X A;  4KSI A;  2BL1 A;  2AFO A;  1TKJ A;  5EMI A;  1RTQ A;  2PJ5 A;  1PU9 A;  4KOW A;  4FD4 A;  3D3S A;  3K2K A;  2HUZ A;  2QIR A;  4PXE A;  4MHZ A;  4JLY A;  3KR5 A;  5LRG A;  3S6G A;  4PXD A;  2Q43 A;  1XIX A;  1FY7 A;  4CGL A;  2FVG A;  2CNT A;  2XEJ A;  3SI0 A;  1XBU A;  2CNS A;  2XEG A;  2AFW A;  3B3W A;  4F6A A;  3PP9 A;  3VAR A;  1KUX A;  3D7F A;  4NCZ A;  4C68 A;  1KUV A;  2GIV A;  2CXA A;  3PFO A;  2WZN A;  2PJC A;  3LAC A;  1CP7 A;  4A30 A;  1M4L A;  3TTH A;  4GM5 A;  2P6G A;  3V7Z A;  2REF A;  2YND A;  3R95 A;  4H6Z A;  2O53 A;  3SJE A;  3L2N A;  3CT9 A;  4X3R A;  2AFS A;  3B8G A;  1YRE A;  5HVG A;  5GCN A;  1NE9 A;  4OC1 A;  4KLW A;  4ZBG A;  5C82 A;  5DWM A;  3FH4 A;  4F0Y A;  2Z3L A;  3KGQ A;  2R7H A;  3NH5 A;  5AG7 A;  1IYK A;  1CX8 A;  4FBE A;  2DPS A;  2OR4 A;  3LMS A;  3TO7 A;  2Q7S A;  4OC3 A;  3RZA A;  2JBK A;  2PJ3 A;  4MXU A;  3FYN A;  4YRH A;  4KOX A;  4B5O A;  4ZYQ A;  3TC8 A;  4H6U A;  4R3L A;  2RFH A;  4XPD C;  3CPX A;  1BLL E;  4NF1 A;  4NFR A;  4JXR A;  2FS5 A;  4ZX8 A;  4AG9 A;  1BOB A;  1S3Z A;  3DR8 A;  4MFZ A;  1QMU A;  3JRU A;  3FVL A;  4UEZ A;  4F9V A;  5IV0 A;  1IYL A;  5DS0 A;  2D4O A;  2PJ0 A;  2ZW4 A;  4MRI A;  3GKR A;  3BI0 A;  2OZG A;  1Q2C A;  3F8K A;  3ISX A;  1R43 A;  2B4B A;  2PC1 A;  3JUW A;  4EVY A;  1Z5R A;  1IOI A;  3H8E A;  4OKO A;  4P4J A;  1XMT A;  1KWM A;  3FIX A;  4CGP A;  2IL4 A;  2JEV A;  1MK4 A;  2PRQ A;  2PVW A;  2J8N A;  2F8H A;  4MHD A;  3GY9 A;  2VL1 A;  4GS4 A;  2GAN A;  2AJ6 A;  2HC9 A;  3CXQ A;  4KOT A;  3IFE A;  5CNP A;  1TKH A;  4KLV A;  2FE7 A;  1XE4 A;  3MN8 A;  4MFL A;  5THW A;  3IWG A;  4A33 A;  4DYO A;  4MBU A;  4IUS A;  5J8C A;  3IEH A;  1X10 A;  3SJF A;  4C7H A;  3CXS A;  4ZI6 A;  1ARL A;  1XEB A;  4R87 A;  2OH1 A;  3FJU A;  1YK3 A;  3EO4 A;  3H4Q A;  2PJB A;  1M1D A;  2AFM A;  2V8D A;  5D8N A;  2R1I A;  3FEE A;  4UBR A;  3T90 A;  5JPH A;  4NJQ A;  4C7I A;  5J1Q A;  4HNX B;  5H84 A;  3R96 A;  3QB8 A;  4DNC A;  1YQE A;  5FVJ A;  4MFK A;  4UIB A;  4XPD B;  4CYN A;  2V77 A;  4EWT A;  4G1P A;  4HKF A;  4NGS A;  1MJB A;  1I1D A;  1YME A;  1LCP A;  4PPZ A;  2WPW A;  2ZEL A;  3K9U A;  4MI4 A;  3EY5 A;  2G9D A;  4KOY A;  3K9T A;  4XNH C;  3TO6 A;  4XPK A;  1TXR A;  4RN7 A;  2POK A;  4NGQ A;  4PSW A;  3RBU A;  3I1U A;  1CBX A;  4CAV A;  4UFW A;  5C88 A;  5J8F A;  3KAS A;  4LUA A;  4F8Z A;  1HDU A;  2CTB A;  4UWI A;  4R7M A;  1OBR A;  3NE8 A;  3PB9 X;  4K30 A;  5K8M A;  2O4H A;  3JVN A;  4Q36 A;  4CAE A;  5KTD A;  5A27 A;  2Q44 A;  4ZX9 A;  4OC4 A;  4MCS A;  2VQY A;  2IJZ A;  3IU2 A;  5I0C A;  4JWP A;  2YGW A;  1IIC A;  2NSM A;  1VHE A;  4NGP A;  2ZEH A;  2Q7B A;  4A2Z A;  4UCN A;  2OB0 A;  3WC6 A;  3VWE A;  4R6T A;  2X7B A;  1JWQ A;  1QSM A;  2YNC C;  4MFP A;  2H5M A;  1YX0 A;  2HQY A;  4UF4 A;  3WT4 A;  2DEA A;  4B13 A;  2KCW A;  2JDD A;  4P45 A;  2AFX A;  3GYA A;  4KUA A;  4R76 A;  3R9F A;  1MJ9 A;  5F47 A;  1AUG A;  1YSJ A;  2C27 A;  2FIW A;  4KOU A;  1ON0 A;  5F09 A;  2YNE A;  4R57 A;  3TO9 A;  2ZPA A;  1V0C A;  3B7I A;  3GIU A;  4NGT A;  3H5Z A;  5ELY A;  4KSA A;  1P0H A;  1WWZ A;  4A37 A;  1XJO A;  4PQA A;  5CBM A;  1ZO0 A;  3B35 A;  5AG4 A;  4B14 A;  4R3K A;  2AFU A;  3H8G A;  8CPA A;  4XNH B;  2CF4 A;  3S6K A;  4E0A A;  5JH9 A;  2C6C A;  5IB0 A;  5LYF A;  2QJ8 A;  1DE4 C;  3KHX A;  3RAM A;  2ZXV A;  2CTC A;  1IU8 A;  4JD6 A;  3LOD A;  1ARM A;  4AXV A;  3TE4 A;  1LFW A;  2PJ2 A;  4RS2 A;  4UFV A;  3D4U A;  1YLO A;  3KKW A;  4OC0 A;  4P44 A;  1TF8 A;  3V38 A;  7CPA A;  2F5I A;  1XFO A;  2WSA A;  2DXQ A;  1IGB A;  2AFZ A;  4QC6 A;  3MGD A;  4ZGY B;  3BXM A;  4C2Y A;  4M85 A;  2QEC A;  4FUU A;  3CXP A;  5G22 A;  4CRY B;  1OZP A;  4MY3 A;  2Z11 A;  1LRZ A;  3TFY A;  4RI1 A;  4DJL A;  1ELM P;  4JYW A;  4UFX A;  5KTC A;  1YLE A;  4ZY0 A;  3QNV A;  1BPM A;  2PJ9 A;  1M4D A; 
#chains in the Genus database with same CATH homology
 2ABZ A;  4MCQ A;  2Q4Z A;  1AMP A;  4PXB A;  2NYQ A;  5HXD A;  1BAV A;  1CP6 A;  2ZOF A;  4UEF A;  3DLJ A;  3B2Y A;  2IQ6 A;  5LYI A;  2BO9 A;  4A39 A;  2ZEG A;  1ZG9 A;  1ZG8 A;  5K8O A;  1F2P A;  1H8L A;  4MMO A;  2ZEN A;  4OIW A;  1GYT A;  5K8P A;  1Y0Y A;  5JM6 A;  4JZ0 A;  3SJG A;  1PYT B;  4OME A;  2WYR A;  2C6G A;  2PJA A;  4ZY1 A;  4IK2 A;  3NH4 A;  2ZED A;  6CPA A;  1BPN A;  2HB6 A;  5LYD A;  4FWU A;  3FMC A;  3KI9 A;  3PEI A;  4P6Y A;  4ONW A;  1DTD A;  3IWW A;  3PBE A;  3GUX A;  3S9L A;  1NSA A;  2C1C A;  2F7V A;  2IMO A;  1JQG A;  4NGN A;  1LAP A;  3PB4 X;  4P4E A;  3FF3 A;  3N5F A;  4OC2 A;  4W9Y A;  4UEE A;  1UWY A;  3T8W A;  1LAM A;  4B6Z A;  5CPA A;  1FNO A;  2EWB A;  4P4I A;  2C6P A;  4Q7A A;  2OOT A;  4F9U A;  2GLJ A;  2ZEO A;  1AYE A;  4NGR A;  2V8G A;  1HEE A;  2BCO A;  2I3C A;  4YWY A;  3B3C A;  3GB0 A;  2JBJ A;  3KL9 A;  3H8F A;  3BI1 A;  2PJ1 A;  3SI2 A;  4MCR A;  1HDQ A;  3S9M A;  3FEC A;  3D7G A;  3LWU A;  2PCU A;  1CG2 A;  3CPA A;  2PJ4 A;  2QYV A;  1LAN A;  2ZEM A;  3WC5 A;  4H2K A;  5LRK A;  3KZW A;  1VHO A;  3CDX A;  2RB7 A;  3IO1 A;  1Q7L A;  4EFD A;  1VIX A;  4R8F A;  4OID A;  4IHM A;  1Y0R A;  4YU9 A;  3PB8 X;  3WC7 A;  4RUH A;  3KQZ A;  3KR4 A;  3NH8 A;  3B3V A;  4O23 A;  3NFZ A;  2GLF A;  1YW6 A;  3SJX A;  1IY7 A;  4IAV A;  2BOA A;  5LYL A;  1XRY A;  1Y7E A;  3VH9 A;  3FX6 A;  1VGY A;  1ZG7 A;  2GRE A;  3IIB A;  1ELL P;  3WAB A;  4MCP A;  2V8H A;  3IJ3 A;  3PB6 X;  1F57 A;  2QVP A;  4FAI A;  4A38 A;  4WJB A;  4EME A;  2EK8 A;  4OC5 A;  3KHZ A;  1F2O A;  1Z2L A;  2ZEF A;  4PXC A;  4X2T A;  5JGF A;  2ZEP A;  3ISZ A;  2ZEE A;  2PE3 A;  1ZLH A;  4P4B A;  2JEW A;  4P10 A;  3PBB A;  2J9A A;  5I4M A;  1PCA A;  3GLJ A;  1YW4 A;  4X8I A;  3TX8 A;  3HUV A;  4WWV A;  4MHN A;  2Q51 A;  3VAT A;  2PJ8 A;  1LOK A;  3DGV A;  3BHX A;  3PFE A;  4BD9 A;  3SI1 A;  4NJR A;  3D7H A;  4K3N A;  2XEI A;  2GU2 A;  1FT7 A;  2EK9 A;  3KQX A;  2XEF A;  3B3S A;  3D7D A;  4UIA A;  4NGM A;  1Z8L A;  4DUK A;  4P4D A;  3MRU A;  4P4F A;  2PVV A;  2PJ7 A;  1CPX A;  5LRJ A;  5HVF A;  4MHY A;  4TNU A;  2ANP A;  3S9N A;  3PRT A;  1XMB A;  4LQG A;  5HVH A;  4MHP A;  4A94 A;  4Z65 A;  2V8V A;  1EE3 P;  2PJ6 A;  3D68 A;  1CPS A;  3IC1 A;  3NA6 A;  4TWE A;  3D67 A;  2PIY A;  1QQ9 A;  2PIZ A;  2CIJ A;  3D66 A;  1TF9 A;  1TKF A;  1ZLI A;  5D29 A;  1R3N A;  3HLP A;  3PB7 X;  5K8N A;  5IB9 A;  2ZOG A;  4ZY2 A;  4OP4 A;  3B3T A;  3FED A;  4CPA A;  4KSI A;  2AFO A;  1TKJ A;  1RTQ A;  2PJ5 A;  3K2K A;  4PXE A;  4MHZ A;  3KR5 A;  5LRG A;  4PXD A;  2Q43 A;  2FVG A;  2XEJ A;  3SI0 A;  1XBU A;  2XEG A;  2AFW A;  3B3W A;  3VAR A;  3D7F A;  3PFO A;  2WZN A;  2PJC A;  1CP7 A;  1M4L A;  4GM5 A;  3V7Z A;  2O53 A;  3SJE A;  3L2N A;  3CT9 A;  4X3R A;  2AFS A;  5HVG A;  4OC1 A;  3FH4 A;  3KGQ A;  3NH5 A;  1CX8 A;  4FBE A;  2OR4 A;  3LMS A;  4OC3 A;  3RZA A;  2JBK A;  2PJ3 A;  4MXU A;  4ZYQ A;  3TC8 A;  2RFH A;  3CPX A;  1BLL E;  4NFR A;  4ZX8 A;  1QMU A;  3JRU A;  3FVL A;  4UEZ A;  4F9V A;  5DS0 A;  2PJ0 A;  4MRI A;  3BI0 A;  3ISX A;  1R43 A;  1Z5R A;  3H8E A;  4OKO A;  4P4J A;  1KWM A;  2PRQ A;  2PVW A;  2F8H A;  2VL1 A;  2HC9 A;  3IFE A;  1TKH A;  3MN8 A;  5THW A;  4DYO A;  3IEH A;  3SJF A;  4ZI6 A;  1ARL A;  3FJU A;  2PJB A;  2AFM A;  2V8D A;  5D8N A;  3FEE A;  4NJQ A;  5J1Q A;  4UIB A;  2V77 A;  4EWT A;  4G1P A;  4NGS A;  1YME A;  1LCP A;  4PPZ A;  2ZEL A;  2G9D A;  3K9T A;  1TXR A;  2POK A;  4NGQ A;  3RBU A;  3I1U A;  1CBX A;  3KAS A;  4F8Z A;  1HDU A;  2CTB A;  4R7M A;  1OBR A;  3PB9 X;  5K8M A;  2O4H A;  4ZX9 A;  4OC4 A;  4MCS A;  2IJZ A;  2NSM A;  1VHE A;  4NGP A;  2ZEH A;  3WC6 A;  4R6T A;  4UF4 A;  3WT4 A;  2DEA A;  4P45 A;  2AFX A;  4R76 A;  1YSJ A;  5F09 A;  3B7I A;  4NGT A;  5ELY A;  4A37 A;  1XJO A;  4PQA A;  5CBM A;  3B35 A;  2AFU A;  3H8G A;  8CPA A;  5JH9 A;  2CF4 A;  2C6C A;  5LYF A;  2QJ8 A;  1DE4 C;  3KHX A;  3RAM A;  2CTC A;  1ARM A;  4AXV A;  1LFW A;  2PJ2 A;  3D4U A;  1YLO A;  3V38 A;  4OC0 A;  4P44 A;  1TF8 A;  7CPA A;  1XFO A;  1IGB A;  2AFZ A;  3BXM A;  4FUU A;  4DJL A;  1ELM P;  4JYW A;  4ZY0 A;  3QNV A;  1BPM A;  2PJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...