3GUXA

Crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
298
structure length
247
Chain Sequence
EVIKAPEFDADSAYQYIQVQADFGPRVPNTQAHKECGEYLAGQLEKFGAKVYNQYADLIAYDGTILKSRNIIGAYKPESKKRILLCAHWDSRPGASGVGVLLEIARQIQKEQPALGIDIVFFDSEDYQDTWCLGSQYWARTPHVQNYNARYGILLDMVGGKDATFYYEGYSARTARSEMKKIWKKAHELGYGKYFVKEDGGETVDDHIYVNKLARIPCVDIINYDNIDRNTLKAVGQTVMDVIYNEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative Zn-dependent exopeptidase (YP_001298628.1) from Bacteroides vulgatus ATCC 8482 at 1.80 A resolution
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Hydrolase
molecule keywords putative Zn-dependent exopeptidase
total genus 80
structure length 247
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3guxA00
2PIZA 2I3CA 2NYQA 4P44A 3T8WA 3PFOA 1ZLHA 2V8DA 2AFSA 3D7HA 3H8EA 4UIBA 1VHOA 3FEEA 4H2KA 4A39A 4NGMA 2PVVA 1Y0YA 3IC1A 1BPNA 4NGPA 3HLPA 1Y0RA 1H8LA 3WABA 3SI0A 1TKFA 4TWEA 3FVLA 4P4JA 1VGYA 5HVGA 1TKHA 1ARLA 1ZG9A 5LRKA 4BD9A 3N5FA 4OC1A 2V77A 1TKJA 2ZOGA 6CPAA 2EK8A 5LRJA 3PB9X 1XRYA 4CPAA 3KHZA 4P6YA 1R3NA 1R43A 2IMOA 2ZEHA 3CPAA 3B3SA 4R7MA 2IQ6A 3B2YA 4X2TA 2AFMA 4DUKA 4NGTA 3D7DA 3VH9A 3SJXA 5I4MA 2PJ7A 2QJ8A 1Z8LA 1HEEA 3D68A 4A37A 1CP6A 2ZEFA 1OBRA 3K9TA 5D8NA 4YWYA 4ZYQA 4K3NA 2XEFA 2C6GA 4W9YA 2BCOA 5K8PA 4EMEA 5J1QA 4P4DA 4PXBA 1AMPA 3VARA 3VATA 3V7ZA 2PE3A 4IK2A 4MCQA 4IAVA 2FVGA 2CF4A 1PYTB 1LCPA 4NJQA 1YW6A 1ZG7A 4MCRA 2PJBA 2V8GA 1IGBA 3ISZA 2ZELA 4ONWA 4NFRA 2Q43A 3CPXA 2O53A 4JYWA 4PXCA 4OIDA 2HC9A 4F8ZA 5JGFA 4FWUA 1LOKA 2XEIA 1F2PA 3WT4A 3WC5A 4A94A 3ISXA 3PEIA 2GLFA 2NSMA 4OMEA 4OKOA 3B7IA 3KL9A 3D67A 3TC8A 4P10A 4PQAA 3NH5A 4OC2A 4RUHA 1M4LA 5HVFA 2BO9A 2GLJA 2Q51A 3SI2A 3PBEA 2ABZA 4OIWA 3KR4A 4UEZA 3RAMA 2PIYA 1BAVA 1FT7A 2PJ3A 1GYTA 4NGQA 4MHZA 1IY7A 3NFZA 2ZEPA 2C1CA 4NGSA 3FMCA 4G1PA 4MCPA 1HDQA 5JM6A 5K8MA 2AFOA 2C6PA 3KASA 1YSJA 3PRTA 3RZAA 2ZEEA 2CTBA 1CP7A 3PB8X 1PCAA 1XMBA 3B3VA 5LYDA 3S9LA 3SI1A 4EWTA 5K8OA 4O23A 3IJ3A 1XBUA 1Y7EA 1CPSA 3GB0A 2EWBA 2J9AA 4FAIA 4NJRA 4NGRA 5HVHA 3S9MA 2PJ2A 3LMSA 3PB7X 2ZOFA 2BOAA 2POKA 4JZ0A 4UEFA 4X8IA 4A38A 2PJ5A 7CPAA 1F2OA 4R76A 2CIJA 1BPMA 3GUXA 3KQXA 2EK9A 3FH4A 3DLJA 2F8HA 5K8NA 4YU9A 3BI0A 4FUUA 1YMEA 2RFHA 4WWVA 4ZY1A 3WC7A 4MHYA 4ZX9A 4TNUA 2ZEMA 5LYLA 3PBBA 4R8FA 4UEEA 4ZY0A 4OP4A 5D29A 2AFWA 4DJLA 2XEJA 4OC3A 4MRIA 3LWUA 1TF8A 1FNOA 2GREA 3FF3A 3K2KA 2C6CA 4MMOA 3PB4X 3NH4A 4MHNA 1F57A 1XJOA 3B3CA 4AXVA 1LFWA 2PJ1A 3V38A 3CDXA 4UIAA 3IEHA 3RBUA 1VHEA 3BHXA 3B3TA 4GM5A 2JEWA 1ELMP 2PCUA 1YLOA 3D66A 3IIBA 2PJCA 2OOTA 3D4UA 1RTQA 3BXMA 3KZWA 2V8VA 4B6ZA 5CBMA 2AFZA 3SJEA 4DYOA 2PJ6A 3B35A 2F7VA 1TF9A 4KSIA 2V8HA 4PPZA 2WZNA 1QQ9A 1LANA 3I1UA 4ZY2A 3TX8A 1VIXA 4R6TA 1ELLP 3KQZA 4PXEA 5F09A 3MN8A 1JQGA 1YW4A 4P45A 5LYIA 3GLJA 4LQGA 4P4BA 5CPAA 3FJUA 3HUVA 2AFUA 4OC5A 1BLLE 3WC6A 2DEAA 3IWWA 2ANPA 4F9VA 2ZEDA 2OR4A 3NH8A 1AYEA 1CG2A 4F9UA 2G9DA 5LYFA 3PFEA 2XEGA 5ELYA 2PRQA 1QMUA 3IFEA 2PJ0A 4ZX8A 4Z65A 4ZI6A 4P4IA 3QNVA 2PJ9A 3FEDA 1DE4C 1KWMA 5IB9A 4NGNA 1HDUA 8CPAA 5LRGA 1TXRA 2CTCA 5HXDA 1ZLIA 3B3WA 3D7GA 3CT9A 2PJ4A 2ZENA 2Q4ZA 3KI9A 3KHXA 3FX6A 2HB6A 2QYVA 3MRUA 2GU2A 2PVWA 1Z2LA 3BI1A 3FECA 1ARMA 4EFDA 2ZEOA 4UF4A 3KGQA 2O4HA 4MXUA 1NSAA 4FBEA 1EE3P 1DTDA 3PB6X 1UWYA 2RB7A 4WJBA 4Q7AA 3DGVA 3H8FA 3KR5A 4OC4A 2AFXA 2PJ8A 3D7FA 3S9NA 2ZEGA 4OC0A 4X3RA 1Q7LA 2VL1A 4MHPA 1CX8A 4IHMA 3L2NA 2JBJA 1LAPA 1XFOA 2PJAA 4P4FA 3SJGA 2WYRA 5DS0A 3NA6A 3JRUA 5THWA 1CPXA 4P4EA 2JBKA 3IO1A 1LAMA 1CBXA 1Z5RA 3H8GA 3SJFA 2IJZA 2QVPA 5JH9A 4PXDA 4MCSA 1ZG8A
chains in the Genus database with same CATH superfamily
1XMTA 2PIZA 2I3CA 2FL4A 2NYQA 4P44A 4XNHC 3W91A 3T8WA 3PFOA 1ZLHA 2V8DA 2AFSA 2GANA 3D7HA 3H8EA 4UIBA 1VHOA 4QUSA 1QSNA 2D4OA 3FEEA 4E0AA 2FS5A 2GFQA 4KLVA 4H2KA 4A39A 4NGMA 2PVVA 3SHPA 5KTCA 5A28A 5IB0A 1Y0YA 4FD5A 4KSFA 5AGEA 4CAWA 4EVYA 5G22A 4NXYA 3IC1A 1WWZA 2A4NA 4C2YA 3FRMA 1BPNA 4K30A 3C26A 4NGPA 2P0WA 4KOVA 1IICA 3HLPA 1Y0RA 4E8OA 1H8LA 3WABA 3SI0A 3FB3A 4CS0B 1TKFA 3DNSA 3R9EA 4TWEA 4UA3A 4M3SA 3FVLA 4P4JA 4YGOA 4JJXA 5C88A 1VGYA 2J8MA 5HVGA 1TKHA 1ARLA 1ZG9A 4KZTA 5LRKA 2B4DB 2GIVA 4QVTA 4CYOA 4KVME 4UFWA 4BD9A 3D2MA 4ZBGA 5ISVA 3IU2A 3N5FA 4OC1A 2V77A 2PRBA 1S3ZA 1S7LA 1TKJA 2ZOGA 4JLYA 2EK8A 4R3KA 5F48A 4A31A 4CGPA 6CPAA 5LRJA 2DXQA 3PB9X 1XRYA 4HNXB 2P6GA 1KUVA 4CPAA 3KHZA 4M6GA 4P6YA 4LQ6A 1R3NA 1R43A 2VZZA 2IMOA 4BINA 4JWPA 2Q4VA 2R7HA 2ZEHA 1XE4A 3CPAA 4FD4A 2WSAA 3B3SA 3T9YA 3GIUA 5AG6A 4FD7A 4R7MA 4C7IA 2IQ6A 3B2YA 4X2TA 2YNCA 2AFMA 4DUKA 1QSMA 4NGTA 3D7DA 3VH9A 3SJXA 4IUSA 5I4MA 2PJ7A 2QJ8A 4PSWA 1Z8LA 4L89A 1HEEA 3D68A 3EY5A 3S6HA 1CP6A 2ZEFA 3LD2A 4A37A 1OBRA 2VBQA 3EO4A 3K9TA 5D8NA 2QIRA 4YWYA 4CYPA 4ZYQA 2ODFA 1IYKA 4K3NA 2XEFA 4MY0A 2C6GA 3UY5A 5HMNA 4W9YA 2WPXA 2BCOA 5K8PA 4EMEA 3R1KA 2VI7A 4CGOA 1I12A 2Q04A 4Y49C 4RS2A 1Q2DA 2Z11A 5J1QA 4B5PA 1GHEA 4P4DA 1AMPA 4KOTA 4PXBA 5DWNA 3VARA 2HUZA 1Z4EA 2WUUA 3VATA 2JLMA 3V7ZA 2PE3A 1B87A 4B12A 4F0XA 4IK2A 5I0CA 4MCQA 2QMLA 4IAVA 4R87A 2EUIA 2FVGA 3MGDA 2ZW4A 4KUAA 3S6FA 3DSBA 2R1IA 3JVNA 2CF4A 4OADA 1PYTB 1LCPA 1M1DA 2VZYA 3QAYA 4NJQA 1YW6A 1ZG7A 2JEVA 4MCRA 2PJBA 4UFVA 2V8GA 1A2ZA 1IGBA 3FIXA 2O28A 4F6AA 3ISZA 1XIXA 2ZELA 2YNDA 4ONWA 4CYQA 1KUYA 3ZJ0A 2REEA 4NFRA 2GE3A 2KCWA 2Q43A 3CPXA 2O53A 1QSTA 3CXQA 4JYWA 4NSQA 4PXCA 4OIDA 2HC9A 4MY3A 1U6MA 4F8ZA 5JGFA 2ATRA 2G3TA 2R98A 2CY2A 3GKRA 4XPDC 2FIWA 3PZJA 4FWUA 3S6GA 1LOKA 1Y9WA 4PK2A 2XEIA 1YREA 4ZGYB 1F2PA 5AG5A 3WT4A 2YNEA 5JPHA 2G3AA 3R9FA 3WC5A 4A94A 2FE7A 3ISXA 3PEIA 2GLFA 1S7NA 3P2FA 2NSMA 4OMEA 4OKOA 1B6BA 3B7IA 3KL9A 3QAHA 4CAXA 2Y0MA 3D67A 4B5OA 3JTKA 3TC8A 4P10A 4PQAA 1YQEA 3FYNA 3NH5A 1M4LA 4KORA 4OC2A 5HVFA 2I00A 4RUHA 2IL4A 2BO9A 2GLJA 4MFLA 5CNPA 2Q51A 3NE8A 3PP9A 2DPSA 3SI2A 4B10A 3PBEA 2ABZA 3FXTA 4U9ZA 4H89A 1UFHA 4R57A 3TE4A 1RO5A 4OIWA 5JQ4A 3VWEA 3KR4A 4UEZA 4R3LA 2PIYA 2FIAA 3RAMA 5EMIA 1BAVA 1Y7RA 1YR0A 2ZW6A 4CYNA 4CGMA 1FT7A 2Z3NA 4KLWA 2PJ3A 1GYTA 4NGQA 4ORFA 4MHZA 4UCPA 2Q4YA 5HH1A 1IY7A 3NFZA 3TO6A 2ZEPA 2C1CA 4NGSA 3CXPA 4H6UA 1IOFA 3FMCA 4G1PA 1QSRA 4MCPA 1HDQA 5JM6A 5K8MA 2AFOA 2C6PA 3KASA 1BO4A 4E2AA 1YSJA 1S7FA 3PRTA 3RZAA 2ZEEA 4C2XA 2CTBA 2Q7BA 1CM0A 1CP7A 1IIDA 3PB8X 3EC4A 1M4IA 1PCAA 5G1ZA 1XMBA 3B3VA 1WK4A 1YVOA 4AVAA 5J8FA 2OZUA 5LYDA 4A95A 1RXTA 3S9LA 4II9A 5F47A 3SI1A 3TO7A 4A2ZA 4EWTA 5K8OA 1IYLA 1Q2YA 2RC4A 4B14A 2B58A 4O23A 4PK3A 3IJ3A 1NE9A 5EBVA 1XBUA 1N71A 2NMTA 1Y7EA 4U5YA 1CPSA 3GB0A 2EWBA 2J9AA 4FAIA 4NJRA 4C68A 4NGRA 5HVHA 4U9YA 5E96A 3S9MA 4KOYA 2PJ2A 3LMSA 3D3SA 3PB7X 4B11A 2C27A 2VEZA 4KSAA 2ZOFA 2BOAA 2POKA 3TOAA 4UFXA 2G0BA 2PDOA 3GY9A 4CRZB 2Z0ZA 3A9LA 4QBJA 4JZ0A 4UEFA 4X8IA 3D2PA 4M6HA 4UBRA 1IU8A 3EFAA 1P0HA 4A38A 2PJ5A 1JWQA 7CPAA 2ZW5A 1F2OA 4R76A 3S9NA 2EBJA 2CIJA 2AE6A 2PC1A 1BPMA 4UWJA 4YFJA 1XF8A 3GUXA 3KQXA 1XOVA 2EK9A 1S7KA 3FH4A 5F46A 2CXAA 3DLJA 1OZPA 2F8HA 4GXHA 4KS9A 5K8NA 4YU9A 3BI0A 4FUUA 2ZW7A 3K9UA 1YMEA 2VXKA 2RFHA 2YGWA 4XPLA 4WWVA 1ON0A 4ZY1A 2YNCC 3B8GA 4MHYA 4LX9A 1Z8TA 4ZX9A 5AG7A 3WC7A 4TNUA 2ZEMA 4NF1A 2B3VA 5LYLA 3I9SA 3PBBA 4R8FA 4UEEA 4OP4A 5D29A 4ZY0A 1PUAA 1MJBA 3F5BA 5A27A 4HPSA 1I1DA 2EO8A 5BWAB 2AFWA 5G20A 4AB7A 4DJLA 2Z3KA 2B3UA 3CZXA 2JDDA 2XEJA 4BBHA 4OC3A 2OB0A 5F49A 4MRIA 4FD6A 3LWUA 1TF8A 1FNOA 2CNTA 2GREA 2HQYA 2Z3OA 3FF3A 4NEXA 3N7ZA 2DF5A 2FCKA 3SXNA 4KVOE 4PV6A 2OH1A 1MJAA 3K2KA 2C6CA 5G21A 4JD6A 5EC4A 4LUAA 4AVCA 4MMOA 3PB4X 3NH4A 4RI1A 4MHNA 1F57A 1IB1E 1XJOA 1YGHA 2ZXVA 3B3CA 4AXVA 1LFWA 3LODA 2PJ1A 4HNWB 3R9GA 3V8IA 4KOSA 3CDXA 4UIAA 3V38A 4C7HA 3IEHA 1KZFA 3RBUA 3H5ZA 4MFQA 1VHEA 3BHXA 4AVBA 1AUGA 3B3TA 2JEWA 4GM5A 4UCMA 1IOIA 1NSLA 3NE7A 4MFZA 5DWMA 1ELMP 2PCUA 1YLOA 3D66A 4ONUA 3IIBA 3LACA 4QB9A 2HV2A 4XPDB 2PJCA 4YRHA 2OOTA 3D4UA 2H5MA 1RTQA 3BXMA 3KZWA 2V8VA 4R9MA 4B6ZA 2B5GA 2REFA 5CBMA 2AFZA 5H86A 3SJEA 4DYOA 2PJ6A 2B5GB 5GCNA 1LRZA 1VHSA 2JDCA 2F7VA 1TF9A 1Q2CA 1Y9KA 2Q7SA 2V8HA 3B35A 3IWGA 4KSIA 2WZNA 4PPZA 1QQ9A 4A32A 1LANA 3I1UA 4ZY2A 4MFJA 3RO0A 3R95A 3TX8A 1VIXA 3DDDA 1M4GA 4CGNA 1QSOA 4R6TA 1ELLP 3KQZA 5AG4A 4M6IA 4PXEA 3D8PA 3T90A 5F09A 3MN8A 1JQGA 1YW4A 4P45A 4CAVA 4BMHA 1SQHA 2B4BA 3GLJA 4LQGA 4P4BA 1FY7A 5LYIA 1V0CA 4XPKA 5CPAA 5H84A 3CXSA 4AG7A 3FJUA 3HUVA 4MI4A 2AFUA 4J3GA 1S60A 4OC5A 1BLLE 3WC6A 2DEAA 4L8AA 3IWWA 1KUXA 4M85A 3IWEA 2ANPA 4IF5A 1NMTA 2AJ6A 4CAFA 2QECA 2F5IA 4F9VA 2FSRA 4DNCA 2ZEDA 3BJ7A 3OWCA 4X5KA 1X12A 5C82A 4XNHB 2OR4A 4CGLA 2K5TA 1AYEA 1CG2A 3NH8A 3S6KA 4F9UA 2G9DA 2Z3MA 4Q36A 5IX3A 5LYFA 3PFEA 2ZPAA 4OLLA 2XEGA 4RN7A 4Q38A 3RNZA 4KOXA 3TT2A 3G3SA 3R96A 2OZHA 5ELYA 2PRQA 1QMUA 3IFEA 4GS4A 4A33A 2PJ0A 1YVKA 4Y49B 3BLNA 3GYAA 3EXNA 4ZX8A 4MBUA 4Z65A 1TIQA 4ZI6A 4UCNA 4P4IA 3QNVA 2PJ9A 3FEDA 3F8KA 1DE4C 1KWMA 4B13A 5IB9A 3G8WA 2BEIA 2I79A 2R8VA 1HDUA 4NGNA 8CPAA 1M44A 1L0CA 1VKCA 1Z8WA 2BSWA 2Q0YA 3I3GA 3BJ8A 1TXRA 2CTCA 4OAEA 5LRGA 5HXDA 1ZLIA 3B3WA 2BUEA 1J4JA 3D7GA 3CT9A 4JXQA 2P6EA 4MFKA 3TTHA 2PR8A 3FNCA 2PJ4A 2ZENA 2Q4ZA 3KI9A 3DR6A 3KHXA 4HNYB 3FX6A 2HB6A 5KTAA 2QYVA 5KTDA 2FXFA 2D4PA 2Z3PA 3MRUA 3QB8A 4KOWA 1XEBA 2GU2A 4MJ8A 2PVWA 1Z2LA 3BI1A 3TFYA 3FECA 1ARMA 1MJ9A 4KVXA 4EFDA 3H4QA 2PQ8A 2ZEOA 1Z4RA 3W6XA 3KKWA 4UF4A 2PSWA 3KGQA 2O4HA 4MXUA 1I21A 1Z9UA 2EVNA 3TCVA 1NSAA 2Z3LA 3IU1A 3TOBA 4FBEA 1EE3P 1DTDA 3PB6X 1UWYA 2RB7A 4WJBA 2B4DA 3JUWA 3RYOA 1K4JA 1MK4A 4I49A 4F0YA 3DR8A 2J8RA 4Q7AA 4AG9A 3DGVA 5J8CA 2X7BA 3H8FA 1YX0A 3KR5A 4OC4A 3WR7A 2AFXA 2PJ8A 1M4DA 3D7FA 1BOBA 2ZEGA 4JXRA 4OC0A 2PR1A 1CJWA 1Q7LA 4X3RA 5FVJA 2VL1A 2OU2A 1S5KA 4MHPA 4UWIA 1CX8A 2Q44A 4IHMA 3L2NA 2FT0A 2JBJA 2PJAA 1LAPA 1X10A 1XFOA 2DPTA 3IGRA 2OZGA 4CRYB 1Z8XA 3F0AA 4H6ZA 4P4FA 3TO9A 2P6FA 3PGPA 1YK3A 3SJGA 3W6SA 4QC6A 2J8NA 3P2HA 2BL1A 2WYRA 5DS0A 3JRUA 3NA6A 5THWA 1CPXA 1R57A 1ZO0A 3SXOA 4PSXA 4NCZA 4P4EA 2WPWA 4KUBA 2JBKA 3IO1A 4MHDA 3E0KA 1P4NA 2ARHA 4A30A 1LAMA 4MFPA 4C2ZA 1CBXA 4KOUA 3VWDA 1Z5RA 2Z10A 3H8GA 5IV0A 3SJFA 3FBUA 3ZZIA 4B5PB 4CAEA 2IJZA 2QVPA 5JH9A 4PXDA 1YLEA 2CNSA 1PU9A 2VQYA 4HKFA 4MCSA 1ZG8A 2CNMA
chains in the Genus database with same CATH topology
2PIZA 2I3CA 2NYQA 4P44A 3T8WA 3PFOA 1ZLHA 2V8DA 2AFSA 3D7HA 3H8EA 4UIBA 1VHOA 3FEEA 4H2KA 4A39A 4NGMA 2PVVA 1Y0YA 3IC1A 1BPNA 4NGPA 3HLPA 1Y0RA 1H8LA 3WABA 3SI0A 1TKFA 4TWEA 3FVLA 4P4JA 1VGYA 5HVGA 1TKHA 1ARLA 1ZG9A 5LRKA 4BD9A 3N5FA 4OC1A 2V77A 1TKJA 2ZOGA 6CPAA 2EK8A 5LRJA 3PB9X 1XRYA 4CPAA 3KHZA 4P6YA 1R3NA 1R43A 2IMOA 2ZEHA 3CPAA 3B3SA 4R7MA 2IQ6A 3B2YA 4X2TA 2AFMA 4DUKA 4NGTA 3D7DA 3VH9A 3SJXA 5I4MA 2PJ7A 2QJ8A 1Z8LA 1HEEA 3D68A 4A37A 1CP6A 2ZEFA 1OBRA 3K9TA 5D8NA 4YWYA 4ZYQA 4K3NA 2XEFA 2C6GA 4W9YA 2BCOA 5K8PA 4EMEA 5J1QA 4P4DA 4PXBA 1AMPA 3VARA 3VATA 3V7ZA 2PE3A 4IK2A 4MCQA 4IAVA 2FVGA 2CF4A 1PYTB 1LCPA 4NJQA 1YW6A 1ZG7A 4MCRA 2PJBA 2V8GA 1IGBA 3ISZA 2ZELA 4ONWA 4NFRA 2Q43A 3CPXA 2O53A 4JYWA 4PXCA 4OIDA 2HC9A 4F8ZA 5JGFA 4FWUA 1LOKA 2XEIA 1F2PA 3WT4A 3WC5A 4A94A 3ISXA 3PEIA 2GLFA 2NSMA 4OMEA 4OKOA 3B7IA 3KL9A 3D67A 3TC8A 4P10A 4PQAA 3NH5A 4OC2A 4RUHA 1M4LA 5HVFA 2BO9A 2GLJA 2Q51A 3SI2A 3PBEA 2ABZA 4OIWA 3KR4A 4UEZA 3RAMA 2PIYA 1BAVA 1FT7A 2PJ3A 1GYTA 4NGQA 4MHZA 1IY7A 3NFZA 2ZEPA 2C1CA 4NGSA 3FMCA 4G1PA 4MCPA 1HDQA 5JM6A 5K8MA 2AFOA 2C6PA 3KASA 1YSJA 3PRTA 3RZAA 2ZEEA 2CTBA 1CP7A 3PB8X 1PCAA 1XMBA 3B3VA 5LYDA 3S9LA 3SI1A 4EWTA 5K8OA 4O23A 3IJ3A 1XBUA 1Y7EA 1CPSA 3GB0A 2EWBA 2J9AA 4FAIA 4NJRA 4NGRA 5HVHA 3S9MA 2PJ2A 3LMSA 3PB7X 2ZOFA 2BOAA 2POKA 4JZ0A 4UEFA 4X8IA 4A38A 2PJ5A 7CPAA 1F2OA 4R76A 2CIJA 1BPMA 3GUXA 3KQXA 2EK9A 3FH4A 3DLJA 2F8HA 5K8NA 4YU9A 3BI0A 4FUUA 1YMEA 2RFHA 4WWVA 4ZY1A 3WC7A 4MHYA 4ZX9A 4TNUA 2ZEMA 5LYLA 3PBBA 4R8FA 4UEEA 4ZY0A 4OP4A 5D29A 2AFWA 4DJLA 2XEJA 4OC3A 4MRIA 3LWUA 1TF8A 1FNOA 2GREA 3FF3A 3K2KA 2C6CA 4MMOA 3PB4X 3NH4A 4MHNA 1F57A 1XJOA 3B3CA 4AXVA 1LFWA 2PJ1A 3V38A 3CDXA 4UIAA 3IEHA 3RBUA 1VHEA 3BHXA 3B3TA 4GM5A 2JEWA 1ELMP 2PCUA 1YLOA 3D66A 3IIBA 2PJCA 2OOTA 3D4UA 1RTQA 3BXMA 3KZWA 2V8VA 4B6ZA 5CBMA 2AFZA 3SJEA 4DYOA 2PJ6A 3B35A 2F7VA 1TF9A 4KSIA 2V8HA 4PPZA 2WZNA 1QQ9A 1LANA 3I1UA 4ZY2A 3TX8A 1VIXA 4R6TA 1ELLP 3KQZA 4PXEA 5F09A 3MN8A 1JQGA 1YW4A 4P45A 5LYIA 3GLJA 4LQGA 4P4BA 5CPAA 3FJUA 3HUVA 2AFUA 4OC5A 1BLLE 3WC6A 2DEAA 3IWWA 2ANPA 4F9VA 2ZEDA 2OR4A 3NH8A 1AYEA 1CG2A 4F9UA 2G9DA 5LYFA 3PFEA 2XEGA 5ELYA 2PRQA 1QMUA 3IFEA 2PJ0A 4ZX8A 4Z65A 4ZI6A 4P4IA 3QNVA 2PJ9A 3FEDA 1DE4C 1KWMA 5IB9A 4NGNA 1HDUA 8CPAA 5LRGA 1TXRA 2CTCA 5HXDA 1ZLIA 3B3WA 3D7GA 3CT9A 2PJ4A 2ZENA 2Q4ZA 3KI9A 3KHXA 3FX6A 2HB6A 2QYVA 3MRUA 2GU2A 2PVWA 1Z2LA 3BI1A 3FECA 1ARMA 4EFDA 2ZEOA 4UF4A 3KGQA 2O4HA 4MXUA 1NSAA 4FBEA 1EE3P 1DTDA 3PB6X 1UWYA 2RB7A 4WJBA 4Q7AA 3DGVA 3H8FA 3KR5A 4OC4A 2AFXA 2PJ8A 3D7FA 3S9NA 2ZEGA 4OC0A 4X3RA 1Q7LA 2VL1A 4MHPA 1CX8A 4IHMA 3L2NA 2JBJA 1LAPA 1XFOA 2PJAA 4P4FA 3SJGA 2WYRA 5DS0A 3NA6A 3JRUA 5THWA 1CPXA 4P4EA 2JBKA 3IO1A 1LAMA 1CBXA 1Z5RA 3H8GA 3SJFA 2IJZA 2QVPA 5JH9A 4PXDA 4MCSA 1ZG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PIZ A;  2I3C A;  2NYQ A;  4P44 A;  3T8W A;  3PFO A;  1ZLH A;  2V8D A;  2AFS A;  3D7H A;  3H8E A;  4UIB A;  1VHO A;  3FEE A;  4H2K A;  4A39 A;  4NGM A;  2PVV A;  1Y0Y A;  3IC1 A;  1BPN A;  4NGP A;  3HLP A;  1Y0R A;  1H8L A;  3WAB A;  3SI0 A;  1TKF A;  4TWE A;  3FVL A;  4P4J A;  1VGY A;  5HVG A;  1TKH A;  1ARL A;  1ZG9 A;  5LRK A;  4BD9 A;  3N5F A;  4OC1 A;  2V77 A;  1TKJ A;  2ZOG A;  6CPA A;  2EK8 A;  5LRJ A;  3PB9 X;  1XRY A;  4CPA A;  3KHZ A;  4P6Y A;  1R3N A;  1R43 A;  2IMO A;  2ZEH A;  3CPA A;  3B3S A;  4R7M A;  2IQ6 A;  3B2Y A;  4X2T A;  2AFM A;  4DUK A;  4NGT A;  3D7D A;  3VH9 A;  3SJX A;  5I4M A;  2PJ7 A;  2QJ8 A;  1Z8L A;  1HEE A;  3D68 A;  4A37 A;  1CP6 A;  2ZEF A;  1OBR A;  3K9T A;  5D8N A;  4YWY A;  4ZYQ A;  4K3N A;  2XEF A;  2C6G A;  4W9Y A;  2BCO A;  5K8P A;  4EME A;  5J1Q A;  4P4D A;  4PXB A;  1AMP A;  3VAR A;  3VAT A;  3V7Z A;  2PE3 A;  4IK2 A;  4MCQ A;  4IAV A;  2FVG A;  2CF4 A;  1PYT B;  1LCP A;  4NJQ A;  1YW6 A;  1ZG7 A;  4MCR A;  2PJB A;  2V8G A;  1IGB A;  3ISZ A;  2ZEL A;  4ONW A;  4NFR A;  2Q43 A;  3CPX A;  2O53 A;  4JYW A;  4PXC A;  4OID A;  2HC9 A;  4F8Z A;  5JGF A;  4FWU A;  1LOK A;  2XEI A;  1F2P A;  3WT4 A;  3WC5 A;  4A94 A;  3ISX A;  3PEI A;  2GLF A;  2NSM A;  4OME A;  4OKO A;  3B7I A;  3KL9 A;  3D67 A;  3TC8 A;  4P10 A;  4PQA A;  3NH5 A;  4OC2 A;  4RUH A;  1M4L A;  5HVF A;  2BO9 A;  2GLJ A;  2Q51 A;  3SI2 A;  3PBE A;  2ABZ A;  4OIW A;  3KR4 A;  4UEZ A;  3RAM A;  2PIY A;  1BAV A;  1FT7 A;  2PJ3 A;  1GYT A;  4NGQ A;  4MHZ A;  1IY7 A;  3NFZ A;  2ZEP A;  2C1C A;  4NGS A;  3FMC A;  4G1P A;  4MCP A;  1HDQ A;  5JM6 A;  5K8M A;  2AFO A;  2C6P A;  3KAS A;  1YSJ A;  3PRT A;  3RZA A;  2ZEE A;  2CTB A;  1CP7 A;  3PB8 X;  1PCA A;  1XMB A;  3B3V A;  5LYD A;  3S9L A;  3SI1 A;  4EWT A;  5K8O A;  4O23 A;  3IJ3 A;  1XBU A;  1Y7E A;  1CPS A;  3GB0 A;  2EWB A;  2J9A A;  4FAI A;  4NJR A;  4NGR A;  5HVH A;  3S9M A;  2PJ2 A;  3LMS A;  3PB7 X;  2ZOF A;  2BOA A;  2POK A;  4JZ0 A;  4UEF A;  4X8I A;  4A38 A;  2PJ5 A;  7CPA A;  1F2O A;  4R76 A;  2CIJ A;  1BPM A;  3GUX A;  3KQX A;  2EK9 A;  3FH4 A;  3DLJ A;  2F8H A;  5K8N A;  4YU9 A;  3BI0 A;  4FUU A;  1YME A;  2RFH A;  4WWV A;  4ZY1 A;  3WC7 A;  4MHY A;  4ZX9 A;  4TNU A;  2ZEM A;  5LYL A;  3PBB A;  4R8F A;  4UEE A;  4ZY0 A;  4OP4 A;  5D29 A;  2AFW A;  4DJL A;  2XEJ A;  4OC3 A;  4MRI A;  3LWU A;  1TF8 A;  1FNO A;  2GRE A;  3FF3 A;  3K2K A;  2C6C A;  4MMO A;  3PB4 X;  3NH4 A;  4MHN A;  1F57 A;  1XJO A;  3B3C A;  4AXV A;  1LFW A;  2PJ1 A;  3V38 A;  3CDX A;  4UIA A;  3IEH A;  3RBU A;  1VHE A;  3BHX A;  3B3T A;  4GM5 A;  2JEW A;  1ELM P;  2PCU A;  1YLO A;  3D66 A;  3IIB A;  2PJC A;  2OOT A;  3D4U A;  1RTQ A;  3BXM A;  3KZW A;  2V8V A;  4B6Z A;  5CBM A;  2AFZ A;  3SJE A;  4DYO A;  2PJ6 A;  3B35 A;  2F7V A;  1TF9 A;  4KSI A;  2V8H A;  4PPZ A;  2WZN A;  1QQ9 A;  1LAN A;  3I1U A;  4ZY2 A;  3TX8 A;  1VIX A;  4R6T A;  1ELL P;  3KQZ A;  4PXE A;  5F09 A;  3MN8 A;  1JQG A;  1YW4 A;  4P45 A;  5LYI A;  3GLJ A;  4LQG A;  4P4B A;  5CPA A;  3FJU A;  3HUV A;  2AFU A;  4OC5 A;  1BLL E;  3WC6 A;  2DEA A;  3IWW A;  2ANP A;  4F9V A;  2ZED A;  2OR4 A;  3NH8 A;  1AYE A;  1CG2 A;  4F9U A;  2G9D A;  5LYF A;  3PFE A;  2XEG A;  5ELY A;  2PRQ A;  1QMU A;  3IFE A;  2PJ0 A;  4ZX8 A;  4Z65 A;  4ZI6 A;  4P4I A;  3QNV A;  2PJ9 A;  3FED A;  1DE4 C;  1KWM A;  5IB9 A;  4NGN A;  1HDU A;  8CPA A;  5LRG A;  1TXR A;  2CTC A;  5HXD A;  1ZLI A;  3B3W A;  3D7G A;  3CT9 A;  2PJ4 A;  2ZEN A;  2Q4Z A;  3KI9 A;  3KHX A;  3FX6 A;  2HB6 A;  2QYV A;  3MRU A;  2GU2 A;  2PVW A;  1Z2L A;  3BI1 A;  3FEC A;  1ARM A;  4EFD A;  2ZEO A;  4UF4 A;  3KGQ A;  2O4H A;  4MXU A;  1NSA A;  4FBE A;  1EE3 P;  1DTD A;  3PB6 X;  1UWY A;  2RB7 A;  4WJB A;  4Q7A A;  3DGV A;  3H8F A;  3KR5 A;  4OC4 A;  2AFX A;  2PJ8 A;  3D7F A;  3S9N A;  2ZEG A;  4OC0 A;  4X3R A;  1Q7L A;  2VL1 A;  4MHP A;  1CX8 A;  4IHM A;  3L2N A;  2JBJ A;  1LAP A;  1XFO A;  2PJA A;  4P4F A;  3SJG A;  2WYR A;  5DS0 A;  3NA6 A;  3JRU A;  5THW A;  1CPX A;  4P4E A;  2JBK A;  3IO1 A;  1LAM A;  1CBX A;  1Z5R A;  3H8G A;  3SJF A;  2IJZ A;  2QVP A;  5JH9 A;  4PXD A;  4MCS A;  1ZG8 A; 
#chains in the Genus database with same CATH topology
 1XMT A;  2PIZ A;  2I3C A;  2FL4 A;  2NYQ A;  4P44 A;  4XNH C;  3W91 A;  3T8W A;  3PFO A;  1ZLH A;  2V8D A;  2AFS A;  2GAN A;  3D7H A;  3H8E A;  4UIB A;  1VHO A;  4QUS A;  1QSN A;  2D4O A;  3FEE A;  4E0A A;  2FS5 A;  2GFQ A;  4KLV A;  4H2K A;  4A39 A;  4NGM A;  2PVV A;  3SHP A;  5KTC A;  5A28 A;  5IB0 A;  1Y0Y A;  4FD5 A;  4KSF A;  5AGE A;  4CAW A;  4EVY A;  5G22 A;  4NXY A;  3IC1 A;  1WWZ A;  2A4N A;  4C2Y A;  3FRM A;  1BPN A;  4K30 A;  3C26 A;  4NGP A;  2P0W A;  4KOV A;  1IIC A;  3HLP A;  1Y0R A;  4E8O A;  1H8L A;  3WAB A;  3SI0 A;  3FB3 A;  4CS0 B;  1TKF A;  3DNS A;  3R9E A;  4TWE A;  4UA3 A;  4M3S A;  3FVL A;  4P4J A;  4YGO A;  4JJX A;  5C88 A;  1VGY A;  2J8M A;  5HVG A;  1TKH A;  1ARL A;  1ZG9 A;  4KZT A;  5LRK A;  2B4D B;  2GIV A;  4QVT A;  4CYO A;  4KVM E;  4UFW A;  4BD9 A;  3D2M A;  4ZBG A;  5ISV A;  3IU2 A;  3N5F A;  4OC1 A;  2V77 A;  2PRB A;  1S3Z A;  1S7L A;  1TKJ A;  2ZOG A;  4JLY A;  2EK8 A;  4R3K A;  5F48 A;  4A31 A;  4CGP A;  6CPA A;  5LRJ A;  2DXQ A;  3PB9 X;  1XRY A;  4HNX B;  2P6G A;  1KUV A;  4CPA A;  3KHZ A;  4M6G A;  4P6Y A;  4LQ6 A;  1R3N A;  1R43 A;  2VZZ A;  2IMO A;  4BIN A;  4JWP A;  2Q4V A;  2R7H A;  2ZEH A;  1XE4 A;  3CPA A;  4FD4 A;  2WSA A;  3B3S A;  3T9Y A;  3GIU A;  5AG6 A;  4FD7 A;  4R7M A;  4C7I A;  2IQ6 A;  3B2Y A;  4X2T A;  2YNC A;  2AFM A;  4DUK A;  1QSM A;  4NGT A;  3D7D A;  3VH9 A;  3SJX A;  4IUS A;  5I4M A;  2PJ7 A;  2QJ8 A;  4PSW A;  1Z8L A;  4L89 A;  1HEE A;  3D68 A;  3EY5 A;  3S6H A;  1CP6 A;  2ZEF A;  3LD2 A;  4A37 A;  1OBR A;  2VBQ A;  3EO4 A;  3K9T A;  5D8N A;  2QIR A;  4YWY A;  4CYP A;  4ZYQ A;  2ODF A;  1IYK A;  4K3N A;  2XEF A;  4MY0 A;  2C6G A;  3UY5 A;  5HMN A;  4W9Y A;  2WPX A;  2BCO A;  5K8P A;  4EME A;  3R1K A;  2VI7 A;  4CGO A;  1I12 A;  2Q04 A;  4Y49 C;  4RS2 A;  1Q2D A;  2Z11 A;  5J1Q A;  4B5P A;  1GHE A;  4P4D A;  1AMP A;  4KOT A;  4PXB A;  5DWN A;  3VAR A;  2HUZ A;  1Z4E A;  2WUU A;  3VAT A;  2JLM A;  3V7Z A;  2PE3 A;  1B87 A;  4B12 A;  4F0X A;  4IK2 A;  5I0C A;  4MCQ A;  2QML A;  4IAV A;  4R87 A;  2EUI A;  2FVG A;  3MGD A;  2ZW4 A;  4KUA A;  3S6F A;  3DSB A;  2R1I A;  3JVN A;  2CF4 A;  4OAD A;  1PYT B;  1LCP A;  1M1D A;  2VZY A;  3QAY A;  4NJQ A;  1YW6 A;  1ZG7 A;  2JEV A;  4MCR A;  2PJB A;  4UFV A;  2V8G A;  1A2Z A;  1IGB A;  3FIX A;  2O28 A;  4F6A A;  3ISZ A;  1XIX A;  2ZEL A;  2YND A;  4ONW A;  4CYQ A;  1KUY A;  3ZJ0 A;  2REE A;  4NFR A;  2GE3 A;  2KCW A;  2Q43 A;  3CPX A;  2O53 A;  1QST A;  3CXQ A;  4JYW A;  4NSQ A;  4PXC A;  4OID A;  2HC9 A;  4MY3 A;  1U6M A;  4F8Z A;  5JGF A;  2ATR A;  2G3T A;  2R98 A;  2CY2 A;  3GKR A;  4XPD C;  2FIW A;  3PZJ A;  4FWU A;  3S6G A;  1LOK A;  1Y9W A;  4PK2 A;  2XEI A;  1YRE A;  4ZGY B;  1F2P A;  5AG5 A;  3WT4 A;  2YNE A;  5JPH A;  2G3A A;  3R9F A;  3WC5 A;  4A94 A;  2FE7 A;  3ISX A;  3PEI A;  2GLF A;  1S7N A;  3P2F A;  2NSM A;  4OME A;  4OKO A;  1B6B A;  3B7I A;  3KL9 A;  3QAH A;  4CAX A;  2Y0M A;  3D67 A;  4B5O A;  3JTK A;  3TC8 A;  4P10 A;  4PQA A;  1YQE A;  3FYN A;  3NH5 A;  1M4L A;  4KOR A;  4OC2 A;  5HVF A;  2I00 A;  4RUH A;  2IL4 A;  2BO9 A;  2GLJ A;  4MFL A;  5CNP A;  2Q51 A;  3NE8 A;  3PP9 A;  2DPS A;  3SI2 A;  4B10 A;  3PBE A;  2ABZ A;  3FXT A;  4U9Z A;  4H89 A;  1UFH A;  4R57 A;  3TE4 A;  1RO5 A;  4OIW A;  5JQ4 A;  3VWE A;  3KR4 A;  4UEZ A;  4R3L A;  2PIY A;  2FIA A;  3RAM A;  5EMI A;  1BAV A;  1Y7R A;  1YR0 A;  2ZW6 A;  4CYN A;  4CGM A;  1FT7 A;  2Z3N A;  4KLW A;  2PJ3 A;  1GYT A;  4NGQ A;  4ORF A;  4MHZ A;  4UCP A;  2Q4Y A;  5HH1 A;  1IY7 A;  3NFZ A;  3TO6 A;  2ZEP A;  2C1C A;  4NGS A;  3CXP A;  4H6U A;  1IOF A;  3FMC A;  4G1P A;  1QSR A;  4MCP A;  1HDQ A;  5JM6 A;  5K8M A;  2AFO A;  2C6P A;  3KAS A;  1BO4 A;  4E2A A;  1YSJ A;  1S7F A;  3PRT A;  3RZA A;  2ZEE A;  4C2X A;  2CTB A;  2Q7B A;  1CM0 A;  1CP7 A;  1IID A;  3PB8 X;  3EC4 A;  1M4I A;  1PCA A;  5G1Z A;  1XMB A;  3B3V A;  1WK4 A;  1YVO A;  4AVA A;  5J8F A;  2OZU A;  5LYD A;  4A95 A;  1RXT A;  3S9L A;  4II9 A;  5F47 A;  3SI1 A;  3TO7 A;  4A2Z A;  4EWT A;  5K8O A;  1IYL A;  1Q2Y A;  2RC4 A;  4B14 A;  2B58 A;  4O23 A;  4PK3 A;  3IJ3 A;  1NE9 A;  5EBV A;  1XBU A;  1N71 A;  2NMT A;  1Y7E A;  4U5Y A;  1CPS A;  3GB0 A;  2EWB A;  2J9A A;  4FAI A;  4NJR A;  4C68 A;  4NGR A;  5HVH A;  4U9Y A;  5E96 A;  3S9M A;  4KOY A;  2PJ2 A;  3LMS A;  3D3S A;  3PB7 X;  4B11 A;  2C27 A;  2VEZ A;  4KSA A;  2ZOF A;  2BOA A;  2POK A;  3TOA A;  4UFX A;  2G0B A;  2PDO A;  3GY9 A;  4CRZ B;  2Z0Z A;  3A9L A;  4QBJ A;  4JZ0 A;  4UEF A;  4X8I A;  3D2P A;  4M6H A;  4UBR A;  1IU8 A;  3EFA A;  1P0H A;  4A38 A;  2PJ5 A;  1JWQ A;  7CPA A;  2ZW5 A;  1F2O A;  4R76 A;  3S9N A;  2EBJ A;  2CIJ A;  2AE6 A;  2PC1 A;  1BPM A;  4UWJ A;  4YFJ A;  1XF8 A;  3GUX A;  3KQX A;  1XOV A;  2EK9 A;  1S7K A;  3FH4 A;  5F46 A;  2CXA A;  3DLJ A;  1OZP A;  2F8H A;  4GXH A;  4KS9 A;  5K8N A;  4YU9 A;  3BI0 A;  4FUU A;  2ZW7 A;  3K9U A;  1YME A;  2VXK A;  2RFH A;  2YGW A;  4XPL A;  4WWV A;  1ON0 A;  4ZY1 A;  2YNC C;  3B8G A;  4MHY A;  4LX9 A;  1Z8T A;  4ZX9 A;  5AG7 A;  3WC7 A;  4TNU A;  2ZEM A;  4NF1 A;  2B3V A;  5LYL A;  3I9S A;  3PBB A;  4R8F A;  4UEE A;  4OP4 A;  5D29 A;  4ZY0 A;  1PUA A;  1MJB A;  3F5B A;  5A27 A;  4HPS A;  1I1D A;  2EO8 A;  5BWA B;  2AFW A;  5G20 A;  4AB7 A;  4DJL A;  2Z3K A;  2B3U A;  3CZX A;  2JDD A;  2XEJ A;  4BBH A;  4OC3 A;  2OB0 A;  5F49 A;  4MRI A;  4FD6 A;  3LWU A;  1TF8 A;  1FNO A;  2CNT A;  2GRE A;  2HQY A;  2Z3O A;  3FF3 A;  4NEX A;  3N7Z A;  2DF5 A;  2FCK A;  3SXN A;  4KVO E;  4PV6 A;  2OH1 A;  1MJA A;  3K2K A;  2C6C A;  5G21 A;  4JD6 A;  5EC4 A;  4LUA A;  4AVC A;  4MMO A;  3PB4 X;  3NH4 A;  4RI1 A;  4MHN A;  1F57 A;  1IB1 E;  1XJO A;  1YGH A;  2ZXV A;  3B3C A;  4AXV A;  1LFW A;  3LOD A;  2PJ1 A;  4HNW B;  3R9G A;  3V8I A;  4KOS A;  3CDX A;  4UIA A;  3V38 A;  4C7H A;  3IEH A;  1KZF A;  3RBU A;  3H5Z A;  4MFQ A;  1VHE A;  3BHX A;  4AVB A;  1AUG A;  3B3T A;  2JEW A;  4GM5 A;  4UCM A;  1IOI A;  1NSL A;  3NE7 A;  4MFZ A;  5DWM A;  1ELM P;  2PCU A;  1YLO A;  3D66 A;  4ONU A;  3IIB A;  3LAC A;  4QB9 A;  2HV2 A;  4XPD B;  2PJC A;  4YRH A;  2OOT A;  3D4U A;  2H5M A;  1RTQ A;  3BXM A;  3KZW A;  2V8V A;  4R9M A;  4B6Z A;  2B5G A;  2REF A;  5CBM A;  2AFZ A;  5H86 A;  3SJE A;  4DYO A;  2PJ6 A;  2B5G B;  5GCN A;  1LRZ A;  1VHS A;  2JDC A;  2F7V A;  1TF9 A;  1Q2C A;  1Y9K A;  2Q7S A;  2V8H A;  3B35 A;  3IWG A;  4KSI A;  2WZN A;  4PPZ A;  1QQ9 A;  4A32 A;  1LAN A;  3I1U A;  4ZY2 A;  4MFJ A;  3RO0 A;  3R95 A;  3TX8 A;  1VIX A;  3DDD A;  1M4G A;  4CGN A;  1QSO A;  4R6T A;  1ELL P;  3KQZ A;  5AG4 A;  4M6I A;  4PXE A;  3D8P A;  3T90 A;  5F09 A;  3MN8 A;  1JQG A;  1YW4 A;  4P45 A;  4CAV A;  4BMH A;  1SQH A;  2B4B A;  3GLJ A;  4LQG A;  4P4B A;  1FY7 A;  5LYI A;  1V0C A;  4XPK A;  5CPA A;  5H84 A;  3CXS A;  4AG7 A;  3FJU A;  3HUV A;  4MI4 A;  2AFU A;  4J3G A;  1S60 A;  4OC5 A;  1BLL E;  3WC6 A;  2DEA A;  4L8A A;  3IWW A;  1KUX A;  4M85 A;  3IWE A;  2ANP A;  4IF5 A;  1NMT A;  2AJ6 A;  4CAF A;  2QEC A;  2F5I A;  4F9V A;  2FSR A;  4DNC A;  2ZED A;  3BJ7 A;  3OWC A;  4X5K A;  1X12 A;  5C82 A;  4XNH B;  2OR4 A;  4CGL A;  2K5T A;  1AYE A;  1CG2 A;  3NH8 A;  3S6K A;  4F9U A;  2G9D A;  2Z3M A;  4Q36 A;  5IX3 A;  5LYF A;  3PFE A;  2ZPA A;  4OLL A;  2XEG A;  4RN7 A;  4Q38 A;  3RNZ A;  4KOX A;  3TT2 A;  3G3S A;  3R96 A;  2OZH A;  5ELY A;  2PRQ A;  1QMU A;  3IFE A;  4GS4 A;  4A33 A;  2PJ0 A;  1YVK A;  4Y49 B;  3BLN A;  3GYA A;  3EXN A;  4ZX8 A;  4MBU A;  4Z65 A;  1TIQ A;  4ZI6 A;  4UCN A;  4P4I A;  3QNV A;  2PJ9 A;  3FED A;  3F8K A;  1DE4 C;  1KWM A;  4B13 A;  5IB9 A;  3G8W A;  2BEI A;  2I79 A;  2R8V A;  1HDU A;  4NGN A;  8CPA A;  1M44 A;  1L0C A;  1VKC A;  1Z8W A;  2BSW A;  2Q0Y A;  3I3G A;  3BJ8 A;  1TXR A;  2CTC A;  4OAE A;  5LRG A;  5HXD A;  1ZLI A;  3B3W A;  2BUE A;  1J4J A;  3D7G A;  3CT9 A;  4JXQ A;  2P6E A;  4MFK A;  3TTH A;  2PR8 A;  3FNC A;  2PJ4 A;  2ZEN A;  2Q4Z A;  3KI9 A;  3DR6 A;  3KHX A;  4HNY B;  3FX6 A;  2HB6 A;  5KTA A;  2QYV A;  5KTD A;  2FXF A;  2D4P A;  2Z3P A;  3MRU A;  3QB8 A;  4KOW A;  1XEB A;  2GU2 A;  4MJ8 A;  2PVW A;  1Z2L A;  3BI1 A;  3TFY A;  3FEC A;  1ARM A;  1MJ9 A;  4KVX A;  4EFD A;  3H4Q A;  2PQ8 A;  2ZEO A;  1Z4R A;  3W6X A;  3KKW A;  4UF4 A;  2PSW A;  3KGQ A;  2O4H A;  4MXU A;  1I21 A;  1Z9U A;  2EVN A;  3TCV A;  1NSA A;  2Z3L A;  3IU1 A;  3TOB A;  4FBE A;  1EE3 P;  1DTD A;  3PB6 X;  1UWY A;  2RB7 A;  4WJB A;  2B4D A;  3JUW A;  3RYO A;  1K4J A;  1MK4 A;  4I49 A;  4F0Y A;  3DR8 A;  2J8R A;  4Q7A A;  4AG9 A;  3DGV A;  5J8C A;  2X7B A;  3H8F A;  1YX0 A;  3KR5 A;  4OC4 A;  3WR7 A;  2AFX A;  2PJ8 A;  1M4D A;  3D7F A;  1BOB A;  2ZEG A;  4JXR A;  4OC0 A;  2PR1 A;  1CJW A;  1Q7L A;  4X3R A;  5FVJ A;  2VL1 A;  2OU2 A;  1S5K A;  4MHP A;  4UWI A;  1CX8 A;  2Q44 A;  4IHM A;  3L2N A;  2FT0 A;  2JBJ A;  2PJA A;  1LAP A;  1X10 A;  1XFO A;  2DPT A;  3IGR A;  2OZG A;  4CRY B;  1Z8X A;  3F0A A;  4H6Z A;  4P4F A;  3TO9 A;  2P6F A;  3PGP A;  1YK3 A;  3SJG A;  3W6S A;  4QC6 A;  2J8N A;  3P2H A;  2BL1 A;  2WYR A;  5DS0 A;  3JRU A;  3NA6 A;  5THW A;  1CPX A;  1R57 A;  1ZO0 A;  3SXO A;  4PSX A;  4NCZ A;  4P4E A;  2WPW A;  4KUB A;  2JBK A;  3IO1 A;  4MHD A;  3E0K A;  1P4N A;  2ARH A;  4A30 A;  1LAM A;  4MFP A;  4C2Z A;  1CBX A;  4KOU A;  3VWD A;  1Z5R A;  2Z10 A;  3H8G A;  5IV0 A;  3SJF A;  3FBU A;  3ZZI A;  4B5P B;  4CAE A;  2IJZ A;  2QVP A;  5JH9 A;  4PXD A;  1YLE A;  2CNS A;  1PU9 A;  2VQY A;  4HKF A;  4MCS A;  1ZG8 A;  2CNM A; 
#chains in the Genus database with same CATH homology
 2PIZ A;  2I3C A;  2NYQ A;  4P44 A;  3T8W A;  3PFO A;  1ZLH A;  2V8D A;  2AFS A;  3D7H A;  3H8E A;  4UIB A;  1VHO A;  3FEE A;  4H2K A;  4A39 A;  4NGM A;  2PVV A;  1Y0Y A;  3IC1 A;  1BPN A;  4NGP A;  3HLP A;  1Y0R A;  1H8L A;  3WAB A;  3SI0 A;  1TKF A;  4TWE A;  3FVL A;  4P4J A;  1VGY A;  5HVG A;  1TKH A;  1ARL A;  1ZG9 A;  5LRK A;  4BD9 A;  3N5F A;  4OC1 A;  2V77 A;  1TKJ A;  2ZOG A;  6CPA A;  2EK8 A;  5LRJ A;  3PB9 X;  1XRY A;  4CPA A;  3KHZ A;  4P6Y A;  1R3N A;  1R43 A;  2IMO A;  2ZEH A;  3CPA A;  3B3S A;  4R7M A;  2IQ6 A;  3B2Y A;  4X2T A;  2AFM A;  4DUK A;  4NGT A;  3D7D A;  3VH9 A;  3SJX A;  5I4M A;  2PJ7 A;  2QJ8 A;  1Z8L A;  1HEE A;  3D68 A;  4A37 A;  1CP6 A;  2ZEF A;  1OBR A;  3K9T A;  5D8N A;  4YWY A;  4ZYQ A;  4K3N A;  2XEF A;  2C6G A;  4W9Y A;  2BCO A;  5K8P A;  4EME A;  5J1Q A;  4P4D A;  4PXB A;  1AMP A;  3VAR A;  3VAT A;  3V7Z A;  2PE3 A;  4IK2 A;  4MCQ A;  4IAV A;  2FVG A;  2CF4 A;  1PYT B;  1LCP A;  4NJQ A;  1YW6 A;  1ZG7 A;  4MCR A;  2PJB A;  2V8G A;  1IGB A;  3ISZ A;  2ZEL A;  4ONW A;  4NFR A;  2Q43 A;  3CPX A;  2O53 A;  4JYW A;  4PXC A;  4OID A;  2HC9 A;  4F8Z A;  5JGF A;  4FWU A;  1LOK A;  2XEI A;  1F2P A;  3WT4 A;  3WC5 A;  4A94 A;  3ISX A;  3PEI A;  2GLF A;  2NSM A;  4OME A;  4OKO A;  3B7I A;  3KL9 A;  3D67 A;  3TC8 A;  4P10 A;  4PQA A;  3NH5 A;  4OC2 A;  4RUH A;  1M4L A;  5HVF A;  2BO9 A;  2GLJ A;  2Q51 A;  3SI2 A;  3PBE A;  2ABZ A;  4OIW A;  3KR4 A;  4UEZ A;  3RAM A;  2PIY A;  1BAV A;  1FT7 A;  2PJ3 A;  1GYT A;  4NGQ A;  4MHZ A;  1IY7 A;  3NFZ A;  2ZEP A;  2C1C A;  4NGS A;  3FMC A;  4G1P A;  4MCP A;  1HDQ A;  5JM6 A;  5K8M A;  2AFO A;  2C6P A;  3KAS A;  1YSJ A;  3PRT A;  3RZA A;  2ZEE A;  2CTB A;  1CP7 A;  3PB8 X;  1PCA A;  1XMB A;  3B3V A;  5LYD A;  3S9L A;  3SI1 A;  4EWT A;  5K8O A;  4O23 A;  3IJ3 A;  1XBU A;  1Y7E A;  1CPS A;  3GB0 A;  2EWB A;  2J9A A;  4FAI A;  4NJR A;  4NGR A;  5HVH A;  3S9M A;  2PJ2 A;  3LMS A;  3PB7 X;  2ZOF A;  2BOA A;  2POK A;  4JZ0 A;  4UEF A;  4X8I A;  4A38 A;  2PJ5 A;  7CPA A;  1F2O A;  4R76 A;  2CIJ A;  1BPM A;  3GUX A;  3KQX A;  2EK9 A;  3FH4 A;  3DLJ A;  2F8H A;  5K8N A;  4YU9 A;  3BI0 A;  4FUU A;  1YME A;  2RFH A;  4WWV A;  4ZY1 A;  3WC7 A;  4MHY A;  4ZX9 A;  4TNU A;  2ZEM A;  5LYL A;  3PBB A;  4R8F A;  4UEE A;  4ZY0 A;  4OP4 A;  5D29 A;  2AFW A;  4DJL A;  2XEJ A;  4OC3 A;  4MRI A;  3LWU A;  1TF8 A;  1FNO A;  2GRE A;  3FF3 A;  3K2K A;  2C6C A;  4MMO A;  3PB4 X;  3NH4 A;  4MHN A;  1F57 A;  1XJO A;  3B3C A;  4AXV A;  1LFW A;  2PJ1 A;  3V38 A;  3CDX A;  4UIA A;  3IEH A;  3RBU A;  1VHE A;  3BHX A;  3B3T A;  4GM5 A;  2JEW A;  1ELM P;  2PCU A;  1YLO A;  3D66 A;  3IIB A;  2PJC A;  2OOT A;  3D4U A;  1RTQ A;  3BXM A;  3KZW A;  2V8V A;  4B6Z A;  5CBM A;  2AFZ A;  3SJE A;  4DYO A;  2PJ6 A;  3B35 A;  2F7V A;  1TF9 A;  4KSI A;  2V8H A;  4PPZ A;  2WZN A;  1QQ9 A;  1LAN A;  3I1U A;  4ZY2 A;  3TX8 A;  1VIX A;  4R6T A;  1ELL P;  3KQZ A;  4PXE A;  5F09 A;  3MN8 A;  1JQG A;  1YW4 A;  4P45 A;  5LYI A;  3GLJ A;  4LQG A;  4P4B A;  5CPA A;  3FJU A;  3HUV A;  2AFU A;  4OC5 A;  1BLL E;  3WC6 A;  2DEA A;  3IWW A;  2ANP A;  4F9V A;  2ZED A;  2OR4 A;  3NH8 A;  1AYE A;  1CG2 A;  4F9U A;  2G9D A;  5LYF A;  3PFE A;  2XEG A;  5ELY A;  2PRQ A;  1QMU A;  3IFE A;  2PJ0 A;  4ZX8 A;  4Z65 A;  4ZI6 A;  4P4I A;  3QNV A;  2PJ9 A;  3FED A;  1DE4 C;  1KWM A;  5IB9 A;  4NGN A;  1HDU A;  8CPA A;  5LRG A;  1TXR A;  2CTC A;  5HXD A;  1ZLI A;  3B3W A;  3D7G A;  3CT9 A;  2PJ4 A;  2ZEN A;  2Q4Z A;  3KI9 A;  3KHX A;  3FX6 A;  2HB6 A;  2QYV A;  3MRU A;  2GU2 A;  2PVW A;  1Z2L A;  3BI1 A;  3FEC A;  1ARM A;  4EFD A;  2ZEO A;  4UF4 A;  3KGQ A;  2O4H A;  4MXU A;  1NSA A;  4FBE A;  1EE3 P;  1DTD A;  3PB6 X;  1UWY A;  2RB7 A;  4WJB A;  4Q7A A;  3DGV A;  3H8F A;  3KR5 A;  4OC4 A;  2AFX A;  2PJ8 A;  3D7F A;  3S9N A;  2ZEG A;  4OC0 A;  4X3R A;  1Q7L A;  2VL1 A;  4MHP A;  1CX8 A;  4IHM A;  3L2N A;  2JBJ A;  1LAP A;  1XFO A;  2PJA A;  4P4F A;  3SJG A;  2WYR A;  5DS0 A;  3NA6 A;  3JRU A;  5THW A;  1CPX A;  4P4E A;  2JBK A;  3IO1 A;  1LAM A;  1CBX A;  1Z5R A;  3H8G A;  3SJF A;  2IJZ A;  2QVP A;  5JH9 A;  4PXD A;  4MCS A;  1ZG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...