3GV1A

Crystal structure of disulfide interchange protein from neisseria gonorrhoeae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
b'MSLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNGRTQSGYSPMPQLEEIIRKNQQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide interchange protein
publication title The crystal structure of disulfide interchange protein from Neisseria gonorrhoeae
rcsb
source organism Neisseria gonorrhoeae
molecule tags Structural genomics, unknown function
total genus 44
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gv1A00
1XWAA 2C3NA 3CMIA 1A8LA 2C8UA 2BMXA 1TK8B 4K8MA 2CT6A 2CZ3A 2IMFA 5CNWA 3F8UA 5JCUA 1JHBA 2XBIA 1R26A 3TRQA 1GSSA 4MJCA 4HZ2A 2E2MA 11GSA 2VM1A 1F3BA 1ERWA 3G9BA 2G2QA 4TN8A 3GKNA 2N5BA 5L71A 2EIOA 4MF5A 2L57A 4BVXA 5ENUA 4ZL9A 4ECJA 1OYJA 3ERWA 4J56E 1O6JA 1T4ZA 1Z6MA 1A2LA 2V6KA 2OE0A 1OC9A 5H5SA 4EUYA 2PMTA 1EZKA 5ECNB 3APQA 5D73A 4O5RA 1TRWA 4I5QA 1E6BA 3D22A 2QSIA 3ME7A 3RPPA 2F9SA 2LKUA 2IWTA 3GKXA 4HUAA 2YWOA 4MPFA 4KCAA 1FVKA 1ABAA 3IK7A 3M0FA 5DBQA 1J0FA 2VCVA 5LNKe 1X5DA 2H66A 4MCUA 4KB3A 1T8EB 3F6FA 3TKSA 5AIVA 3MNGA 3F3QA 1V9WA 5AN1A 2VCTA 2JACA 2WDUA 4LMVA 2VLTA 1Z3EA 5ELGA 5E4WA 4MDCA 1TDIA 2CAIA 5B7CA 2Z9SA 2YV9A 1ZMAA 1M2DA 2GS3A 2CVBA 5F8BA 5C00A 5KN0A 5DJLA 5CRHA 2C0GA 1A2MA 3C7MA 5IM9A 2J9HA 1GUHA 3H1NA 4EO3A 22GSA 1G6WA 2JSYA 5GAPD 4KUNA 1SJ6A 4JR4A 1SKWB 3ME8A 2HFDA 2YWIA 4X1UA 2CX3A 4EC0A 4N11A 3ZIJA 1QMVA 2PERA 2YV7A 1VF4A 3W6GA 2IFQA 4MH3A 2H6YA 3C8EA 2DJKA 4DSQA 1W89A 4K0GA 5AISA 3KP8A 3NOFA 1HNBA 1FOVA 3D21A 1F3AA 5D9TA 4HI7A 2F3MA 5CRWA 3F9UA 5GZZB 4GWRA 2VD0A 3KIJA 3BCKA 1S3DA 4DSSB 1T7PB 3TKSE 1VF1A 4V2LA 2GZPA 3GNJA 3BD2A 2DJ0A 3L4NA 2HSHA 4PGTA 2GSQA 2HRFA 2OADA 2XC2A 5CP1A 3TKRA 1JLWA 5DAKB 5ID2B 3TKPA 3KTLA 3CYNA 1M2BA 3WD6A 3BBYA 4IVFA 2WULA 3CRTA 1NHYA 1NW2A 1GL8A 4MMMA 2C0EA 5GSTA 1PD21 3HVSA 4KE3A 2LRCA 2FHEA 1YEXA 4FYBA 4MK3A 2O89A 3UVTA 4PXOA 4F03A 4GLTA 4GQCA 2EIRA 3TCOA 3PINA 1O81A 2RIIA 3SBCA 3WYWA 1EOGA 1JZDA 2NVLA 4PQHA 4V2NA 1WRYA 4X0XA 2PVQA 2X8HA 2FD3A 2HZEA 3EU4A 1TTZA 2LNTA 2QGVA 4KDYA 3ERGA 4EVMA 4OCEA 2VOCA 4WKWA 2IMEA 2HE3A 2K8VA 2H19A 3PR8A 1N8JA 4NAXA 2YPMA 2PU9C 3IBHA 2JU5A 3F3RA 2B7KA 1BAYA 2IMIA 1TI1A 4IJIA 5CO3A 3L0HA 3GURA 3EYTA 2C3QA 1A0RP 3AY8A 3KTBA 3D5JA 1X9WB 2IN3A 3IK9A 1W4VA 4F2IA 1SL1B 5C04A 2H73A 13GSA 2V2GA 4JZQA 4KNDA 1CQGA 1KBNA 2DJ1A 2K6VA 1V58A 3L78A 2VCXA 2CAQA 1Z9HA 2KP2A 4E8EA 2NBSA 1BX9A 3M9KA 2HYXA 4WXTA 3LYKA 5EPFA 5AGYA 1N2AA 5F07A 3F4TA 1M9BA 2MZCA 1GUMA 2WJUA 4XIHA 1TW9A 5CREA 3Q18A 1EWXA 2OBIA 2I3YA 1X5CA 5ECMB 3P7XA 3KXOA 3UJ1A 3GSSA 1GSEA 1T00A 4RI7A 1FG4A 5AIXA 1MDKA 3Q19A 3GL3A 2VCQA 5DALA 2IMKA 1JLVA 4G19A 4I8BA 2E0QA 1XWBA 3FYGA 1TP9A 1C72A 4OMVA 1OE8A 1UA5A 1Z7RA 5A4WA 2N5AA 2CV4A 1Z5YE 2CQ9A 1K0AA 2CZ2A 3CRUA 1GNEA 2L4CA 2HXKA 4KSMA 1ML6A 4XRDA 3WGXA 2H74A 1YKAA 3ZVJA 3D4MA 1GTIA 4ML6A 2O87A 6GSXA 1FB6A 4FIWA 2VM2A 3DD3A 3RHCA 1R5AA 2GQMA 1THXA 4ML1A 3VPQA 2YOIA 3VPTA 2PBJA 4K7IA 2FGXA 4YH2A 2LRNA 2KP1A 3FKFA 3CSIA 3PGTA 4KA0A 2I4AA 1AQWA 5A4UA 4NXIA 1FVJA 3BOAA 5ECOB 5B8AA 1ZYEA 5EL8A 3IDVA 5G30A 4PQIA 1AXDA 4JU5A 4POMA 4IGJA 2H0IA 1GSDA 3QOUA 4OD7A 1WP0A 3U6VA 2C3TA 4WR5A 4LL4B 2AAWA 5ABRA 2B1LA 2VCWA 3WT1A 3P8WA 1WOUA 3HYPA 4CHSA 2H6ZA 3L9SA 4RQXA 4RI6A 5J9BA 1LU4A 4IHUA 2RUFA 1GTBA 1F9MA 2HZFA 2EC4A 3LFLA 1WJKA 1TRUA 3H8QA 2A2RA 3VWUA 4L8EA 2OBKA 3VWVA 4Q5NA 2L5LA 1AAZA 2PPTA 3FEUA 1PX7A 4ILFA 4AF2A 1PA3A 4FYCA 1EEMA 3DVWA 4HOJA 4L5OA 2ES7A 4IBPA 4LMWA 5IO0A 4DVCA 1GUKA 3DEXA 3W8SA 4XS4B 5D96A 2HI7A 2V41A 3A2WA 1V57A 3LWAA 8GSSA 1F2EA 4P3YB 2C0DA 2RM5A 2TRXA 1MD4A 1FO5A 1TRSA 4G9HA 3GTUA 1MD3A 3TKQA 4OCFA 1YY7A 1HQOA 3RDWA 2C1YA 3NZNA 2IL3A 1PKWA 1TI3A 4K9ZA 4G10A 3RBTA 1HYUA 4NHZA 3EVIA 3GYKA 2DJJA 4FH8A 3KGKA 1MTCA 4HU9A 2V32A 3QAWA 4MJAA 4NWYA 3UBKA 4Z7XA 2WCIA 2JADA 3M3MA 2FWEA 5ECSA 6GSSA 5E59A 1SU9A 2YZHA 1SL2B 3TJFA 4EDZA 1TJDA 4TR3A 1T1VA 3D6IA 4ACSA 1LBKA 4X43A 4TXOB 3MWHA 1DUGA 3EINA 2XBQA 2RUEA 3LXZA 3HJPA 2P5RA 1XVQA 1SK0A 5IPGA 5IMZA 2H8LA 2DMMA 2X8GA 2H71A 3U5RE 3A2VA 3F4SA 1AW9A 3HY2A 3FHKA 4JRRA 4J2FA 4AJ8A 5LD0A 3VI5A 2DMLA 4WF4A 3I43A 2H0HA 3Q74A 2P0GA 2R6KA 2FWGA 3LORA 3HJOA 3KJYA 6GSWA 5KN3A 5DQSA 3ZFLA 1K0BA 2F8AA 1WMJA 4ZB6A 1PMTA 1TKDB 1Z6NA 4XS6A 3CXGA 5D9XA 2E2GA 1DBYA 1PRXA 4I2UA 1A2JA 1B4QA 3QFBC 4AGSA 6GSTA 2LUSA 2OA7A 2B5XA 5ECRB 3VK9A 3HZ4A 1AQVA 4TXVA 3V1WA 2DIYA 2VL3A 2LV3A 2GGTA 3GMFA 3EU3A 2AYTA 3D4TA 6GSUA 3GFKA 2CVKA 4PUAA 3GV1A 4PUFC 2H0GA 4TR1A 2PGTA 1K0OA 1VGLA 4ZXGA 1RQMA 2LSTA 1H4OA 1Y25A 2YJHA 5IOXA 4KCEA 4AJ7A 4MZBA 2VAFA 2IIYA 4EE0A 4IW9A 3UAPA 5IMFA 1Q4JA 2XPEA 5D8IA 2NDOA 2B7JA 4HS1A 2X99A 3C73A 5F06A 1R5PA 1EGOA 2CA8A 5IMAA 1UVZA 1AQXA 3GX0A 3MAKA 1GNWA 5IQYA 1SL0B 1XXUA 3GN3A 1XOBA 4MJBA 3C1RA 2GT5A 3GSTA 2E7PA 2HNLA 4Q5RA 5A5KA 1O85A 5ECLB 1FHEA 4GSNA 1URMA 2O85A 4LLRA 3E9JB 5IPHA 1FW1A 3FZ4A 3ZMLA 4O32A 3ZFBA 2VUPA 2OKAA 4DEJA 1X9MB 2ALBA 5B8BA 5DDLA 3ZYWA 1K0DA 3UEMA 3A5WA 3EMPA 1M99A 2JSZA 4TR4A 1AC1A 3I69A 4N0VA 1HNCA 1XW6A 3PH9A 5F0GA 5FWGA 1G0TA 1GSUA 1XW5A 2H70A 1OC9B 3O3TA 2M72A 3C1SA 2K18A 1O8WA 3ZREA 4N10A 5DCGA 3QAVA 4GF0A 2YANA 2H1BA 2HSYA 3HCZA 5CRGA 4KGIA 1RW1A 3TDGA 3KMNA 4IJ3A 5JCGA 1SYXA 2LEGA 2VD1A 9GSSA 4L0WA 1OKDA 4F82A 4H86A 3IOSA 3QCPA 1O8XA 3RHBA 1PKZA 1R7HA 4POLA 2YP6A 3GA4A 5IIZA 1J9BA 4MF6A 1QK8A 2F51A 16GSA 1GP1A 5JWQB 3QDNA 3DIEA 3IHQA 3TJKA 1GSFA 1B48A 1LJRA 5EY6A 1OVNA 3QAGA 1O73A 4PQ1A 4NV2A 3H4KA 1XWKA 2B3SA 3FZAA 1AUCA 2LS5A 4MABA 4EDYA 1T3BA 2IFQB 5JWRB 1X5EA 3KD0A 2KUCA 3GKKA 1U6TA 1JFUA 4CW9A 3WT2A 1OC3A 3EE2A 3GUSA 2GZZA 4JE1A 3M1GA 4KH7A 2B5EA 5GAND 5JWOB 3EC3A 4ZB9A 3IR4A 1R4WA 3HVXA 3TOUA 2VL9A 1ZCPA 2CVDA 1F6MC 3JCML 2C80A 2GQKA 2XHFA 4V1Ap 1J08A 1E2YA 5FT3A 3I9V2 3M8NA 2H1AA 4ZBAA 1IYIA 2AHEA 4IP6A 3KH9A 4EL1A 2YN1A 1SENA 2VL2C 1OKTA 1GSYA 3ZZXA 3HA9A 2REMA 5HQPA 4XRAA 3UL3A 2FWFA 4D73A 1JZOA 5HFIA 3GL5A 3QD9A 4IQAA 2HRNA 5INYA 4DSRA 2MMOA 4K6XA 3ZITA 1MEKA 2HZEB 4KDUA 2DSAA 6GSYA 3ZIVA 3LGCA 4ZL8A 2HLSA 2RM6A 3E0UA 2L4QA 2FLSA 1TK5B 4HU7A 3GHAA 1CQHA 4BWSA 2I81A 4HZ4A 2R37A 1TOFA 1KNGA 1A8YA 2MMZA 1GLQA 4NHWA 1M0UA 4RQRA 2L6CA 1B9XC 2H76A 4GRFA 2H30A 5IMDA 4ECIA 3VLNA 4ZBBA 5J9CA 2J23A 5G31A 1PSQA 1JZWA 4J57E 3S9FA 4RUVA 2MMAA 4Q5QA 1XIYA 1NM3A 4BL7A 1GRXA 3LSZA 3D0ZA 2PWJA 1ACVA 4I2TA 4IP1A 4V1Ag 1QXHA 1EV4A 2ON5A 3H93A 3E3EA 3FR3A 3UBLA 4GCIA 2L59A 4BA7A 1XWCA 4JBBA 1JZRA 2OE3A 4K7NA 1WWJA 2M46A 4GSTA 5HR0A 2YWNA 4OFNA 3VWXA 3GH9A 3ERFA 1SYRA 2O8VB 1GH2A 2A2SA 2QKEA 3ZL5A 2FWHA 1FAAA 2DLXA 2VL2A 2GSRA 3QMXA 4WEYA 2WB9A 2DC5A 1EP7A 5COHA 1TXXA 3ISOA 1K0CA 3ZMKA 4Q5FA 2HT9A 2FY6A 4LL1B 4MZWA 2GLRA 5D93A 1PL1A 2ZUPA 4HDEA 5DALB 5GSSA 4AJ6A 5DCHA 3IPZA 4ZBDA 17GSA 3LG6A 5KEJA 2GSTA 3IC4A 2JZRA 1ST9A 3FY7A 4FYUA 1Q98A 2TIRA 1PL2A 1B4PA 3QFAC 2LJAA 2R3XA 2BJXA 5ECPB 2IMDA 1EOHA 1WE0A 5HFKA 3UVHA 5ECQB 1B8XA 1UC7A 3UMAA 1XWGA 5A4VA 5CAXA 2GT6A 3DRNA 1Y6EA 3KH7A 2GSSA 4LA1A 4ULXA 2VLVA 3LYPA 1GULA 2FA8A 3WGDA 1QUWA 4KW6A 2N5FA 3APSA 1PN9A 5H5RA 2DJ3A 4PNFA 1QFNA 2YWMA 2QC7A 4QL9A 2B1KA 2GZYA 1EEJA 3VWWA 1M2AA 1BJXA 4MZCA 1OAZA 4DSSA 1I5GA 1GTAA 1BQ7A 2FCHA 2FUG2 3TGZA 2WS2A 1SJZA 2LJKA 3KEBA 3M9JA 3H79A 4POBA 3HD5A 2WFCA 2KOKA 1USBA 3WGEA 4K1FA 4K0NA 3DWVA 4PNGA 4K2DA 3W8JA 2I9HA 3IE3A 2MBTA 5DAKA 2LNSA 5ID2A 5CRDA 4MP4A 4F9ZA 4NV5A 1DE1A 5H5QA 4KDXA 2R4VA 3EURA 2C4JA 6GSVA 3FZ9A 4MPGA 4ZIJA 1MDJA 3HHVA 4YAPA 1XOAA 7GSSA 1G7EA 5DVBA 3NIVA 5J5NA 1A0FA 3LJRA 1XW9A 2CX4A 2TRCP 2JZTA 4ID0A 4FO5A 2H75A 3HJMA 3I6AA 3APOA 3IA1A 3L9VA 1VF2A 3IV4A 3ZTLA 2H1DA 1VRSD 1YJ6A 4V2MA 3FK8A 1EP8A 5B6MA 5G1KA 3GH6A 3GRXA 2V1MA 2C0FA 1EGRA 3GTUB 5B6NA 1K3LA 2AV4A 2GQLA 4ECCA 3C71A 1ERTA 1B9YC 4GQFA 5G5FA 1TK0B 2VIMA 1V40A 2JL4A 2BTOT 4PX1A 2K8SA 1YDKA 4CDOA 4HJ2A 5IMCA 3BCIA 2IJYA 2A4VA 1ZOFA 1TU7A 2FNOA 2LQOA 3VI7A 4L0UA 18GSA 1M7TA 4TRXA 2P5QA 4XCSA 1ERUA 2WRTA 1WPIA 3HVVA 2WGRA 2NPBA 2JZSA 4OO5A 1QGVA 4JEDA 4N30A 2YZUA 3F63A 3EMXA 5HFGA 2DBCA 4ZL7A 1SKSB 5D9VA 3DGQA 2R2JA 2D2ZA 1PGTA 1A23A 5KN2A 3DMLA 1UN2A 4WF5A 4IN0A 1T4YA 2LQQA 2YJ7A 5J3RA 3FZ5A 1K0MA 3F6DA 3TJJA 4NPBA 14GSA 4KX4A 1U88A 3US3A 5G5EA 2MYGA 4MA9A 4NMUA 1M9AA 1X0RA 2GTUA 1YZXA 4GXZA 3DYRA 3VFIA 4IQ1A 4OWYA 2X64A 3F0IA 3UIWA 5IO2A 2H72A 3OR5A 3GIXA 19GSA 1SK1A 3N5OA 2KHPA 5D9WA 2DIZA 2ON7A 3LQ7A 1BEDA 1GTUA 1QQ2A 4E8HA 4ZB8A 3HXSA 4QQ7A 2X8CA 2YCDA 1SK2A 1FB0A 3KM6A 4IS0A 3DVXA 4WETA 3TOTA 1Z7PA 5ELAA 4EF0A 1V2AA 3GKMA 3R2QA 5FHIA 1VF3A 4TR1B 3G7IA 4O7HA 4K7OA 1SJIA 4TW5A 1ON4A 3UARA 3RPNA 1S3CA 2VCZA 1PX6A 2L6DA 3CBUA 1U87A 4BWQA 3ED3A 5LCZA 3N9JA 2B5YA 4G2EA 3CTGA 2WZ9A 2I1UA 2AB6A 2P31A 3P90A 5KN1A 2IPAA 3FW2A 12GSA 1YF1A 1XPVA 1ZYQB 3O6TA 3MDKA 2L5OA 4EKZA 1SKRB 4MH2A 1GWCA 10GSA 1U3IA 4XS1A 5G1LA 5CYYA 1YQ1A 1K3OA 1RK4A 2YNXA 3TUEA 2DJ2A 1S3AA 2K9FA 4WBJA 3ZRDA 1V98A 3IXRA 2LRTA 2OACA 4OFMA 3L9UA 2F8FA 4MLYA 3A2XA 5IMVA 1G6YA 2XPDA 2MMNA 3O76A 4GTUA 1YKCA 1OC8A 20GSA 1XFLA 1XZOA 1TU8A 3GX8A 2OJLA 1F37A 5F05A 4MF7A 2GDRA 4QL7A 1ILOA 3FR9A 1KEBA 1BYEA 2PUKC 5G2ZA 1A24A 2VO4A 1IYHA 4N0ZA 4HJMA 5HR3A 4BPYA 2H01A 4XS4A 3FRCA 1NSWA 2PN8A 1MDIA 4YQMA 1SD8A 4POKA 1NHOA 2MBSA 1XBSA 5DQYA 2LTKA 3FR6A 3KP9A 5IOWA 3CSHA 3HDCA 4TKYA 3UOMA 3TB2A 3TJBA 3CSJA 5EVOA 3HKRA 1OE7A 4KAEA 1YF0A 3DKSA 4O92A 2ZCTA 5J41A 3QPMA 1EV9A 4I97A 3IAM2 3VURA 1ZL9A 3CTFA 1YEPA 2RLIA 3HZ8A 1HD2A 2AUVA 1PQNA 2AJQB 5ECHB 4WR4A 4YQVA 4HQZA 5ECIB 1X9SB 3G7JA 4TXOA 4YQUA 4IKHA 5JCWA 3ZVJD 2OE1A 2EIQA 1SD9A 2PVOC 3TRXA 3A3TA 3K8NA 1BG5A 2H6XA 3Q6OA 4HEA2 4MJEA 2H1GA 3KMOA 1I9DA 4YAVA 1ERVA 1XCCA 3RAZA 3IRAA 1THOA 2GVPA 3F4RA 4HQSA 1K3YA 1HNAA 3LXTA 1XVWA 4ISDA 2O7KA 1ZZYA 2LJRA 4OFTA 4I6XA 4GSSA 2KLXA 4XTSA 3TRPA 1DSBA 2G0FA 4JR6A 2R5GA 4D73B 1U3AA 3BJ5A 4TVEA 5J4UA 3DXBA 2VLUA 1GSQA 3IAS2 4IELA 1H75A 1O7UA 3KCMA 4WBRD 3ZLPA 2FA4A 1ZGNA 2V6OA 1AIUA 4OO4A 1KTEA 2M80A 4ECBA 4XHMA 5HR1A 3TKSC 3KZQA 3QR6A 3EWLA 4EXJA 3P2AA 2ZNMA 3J7Yb 3J7Yk 1TRVA 4PURA 4F0BA 4F0CA 4TR0A 5HR2A 1DE2A 2NTOA 4BVYA 4KSOA 4L5LA 2B6MA 1G7OA 1K0NA 5DJMA 3LEFA 3G7YA 1GLPA 3TJGA 4TOPA 5ECKB 1WIKA 3SWLA 3MSZA 4ZILA
chains in the Genus database with same CATH superfamily
1XWAA 2C3NA 3CMIA 1A8LA 2C8UA 2BMXA 1TK8B 4K8MA 2CT6A 2CZ3A 2IMFA 5CNWA 3F8UA 5JCUA 1JHBA 2XBIA 1R26A 3TRQA 1GSSA 4MJCA 4HZ2A 2E2MA 11GSA 2VM1A 1F3BA 1ERWA 3G9BA 2G2QA 4TN8A 4O5UA 3GKNA 1ZYNA 2N5BA 5L71A 2EIOA 4MF5A 2L57A 4BVXA 5ENUA 4ZL9A 4ECJA 1OYJA 3ERWA 4J56E 1O6JA 1T4ZA 1Z6MA 1A2LA 2V6KA 2OE0A 1OC9A 5H5SA 4EUYA 2PMTA 1EZKA 5ECNB 3APQA 5D73A 4O5RA 1TRWA 4I5QA 1E6BA 3D22A 2QSIA 3ME7A 3RPPA 2F9SA 2LKUA 2IWTA 3GKXA 4HUAA 2YWOA 4MPFA 4KCAA 1FVKA 1ABAA 3IK7A 3M0FA 5DBQA 1J0FA 2VCVA 5LNKe 1X5DA 2H66A 4EIPA 4MCUA 4KB3A 1T8EB 3F6FA 3TKSA 5AIVA 3MNGA 3F3QA 1V9WA 5AN1A 2VCTA 2JACA 2WDUA 4LMVA 2VLTA 1Z3EA 5ELGA 5E4WA 4MDCA 1TDIA 2CAIA 5B7CA 2Z9SA 2YV9A 1ZMAA 1M2DA 2GS3A 2CVBA 5F8BA 5C00A 5KN0A 5DJLA 1XG8A 5CRHA 2C0GA 1A2MA 3C7MA 5IM9A 2J9HA 1GUHA 3H1NA 4EO3A 22GSA 1G6WA 2JSYA 5GAPD 4KUNA 1SJ6A 4JR4A 1SKWB 3ME8A 2HFDA 2YWIA 4X1UA 2CX3A 4EC0A 4N11A 3ZIJA 1QMVA 2PERA 2YV7A 1VF4A 4K5SA 3W6GA 2IFQA 4MH3A 2H6YA 3C8EA 2DJKA 4DSQA 1W89A 4K0GA 5AISA 3KP8A 3NOFA 1HNBA 1FOVA 3D21A 1F3AA 5D9TA 4HI7A 2F3MA 5CRWA 3F9UA 5GZZB 4GWRA 2VD0A 3KIJA 3BCKA 1S3DA 4DSSB 1T7PB 3LW9A 3TKSE 1VF1A 4V2LA 2GZPA 3GNJA 3BD2A 2DJ0A 3L4NA 2HSHA 4PGTA 2GSQA 2HRFA 2OADA 2XC2A 5CP1A 3TKRA 1JLWA 5DAKB 5ID2B 3TKPA 3KTLA 3CYNA 1M2BA 3WD6A 3BBYA 4IVFA 2WULA 4A5PA 3CRTA 1M3JA 1NHYA 1NW2A 1GL8A 4MMMA 2C0EA 5GSTA 1PD21 3HVSA 4KE3A 2LRCA 2FHEA 1YEXA 4FYBA 4MK3A 2O89A 3UVTA 4PXOA 4F03A 4GLTA 4GQCA 2EIRA 3TCOA 3PINA 1O81A 2RIIA 3SBCA 4O5QA 3WYWA 1EOGA 1JZDA 2NVLA 4HSCX 4PQHA 4V2NA 1WRYA 4X0XA 2PVQA 2X8HA 2FD3A 4Z2RA 2HZEA 4BIKA 3EU4A 1TTZA 2LNTA 2QGVA 4KDYA 3ERGA 4EVMA 4OCEA 2VOCA 4WKWA 2IMEA 2HE3A 2K8VA 2H19A 3PR8A 1N8JA 4NAXA 2YPMA 2PU9C 3IBHA 2JU5A 3F3RA 2B7KA 1BAYA 2IMIA 1TI1A 4IJIA 5CO3A 3L0HA 3GURA 3EYTA 2C3QA 1A0RP 3AY8A 3KTBA 3D5JA 1X9WB 2IN3A 4USSA 3IK9A 1W4VA 4F2IA 1SL1B 5C04A 2H73A 13GSA 2V2GA 4JZQA 4KNDA 1CQGA 1KBNA 2DJ1A 2K6VA 1V58A 3L78A 2VCXA 2CAQA 1Z9HA 2KP2A 4E8EA 2NBSA 3EPTA 1BX9A 3M9KA 2HYXA 4WXTA 3LYKA 5EPFA 5AGYA 1N2AA 5F07A 3F4TA 1M9BA 2MZCA 1GUMA 2WJUA 4XIHA 1TW9A 5CREA 3Q18A 1EWXA 2OBIA 2I3YA 1X5CA 5ECMB 3P7XA 3KXOA 3UJ1A 3GSSA 1GSEA 1T00A 4RI7A 1FG4A 5AIXA 1MDKA 3Q19A 3GL3A 2VCQA 5DALA 2IMKA 1JLVA 4G19A 4I8BA 2E0QA 4CY6A 1XWBA 3FYGA 1TP9A 1C72A 4OMVA 1OE8A 1UA5A 1Z7RA 5A4WA 2N5AA 2CV4A 1Z5YE 2CQ9A 1K0AA 2CZ2A 3CRUA 1GNEA 4Z2UA 2L4CA 2HXKA 4KSMA 1ML6A 4XRDA 4FQUA 3WGXA 2H74A 1YKAA 3ZVJA 3D4MA 1GTIA 4ML6A 2O87A 6GSXA 1FB6A 4FIWA 2VM2A 3DD3A 3RHCA 1R5AA 4G0KA 2GQMA 1THXA 4ML1A 3VPQA 2YOIA 3VPTA 2PBJA 4K7IA 2FGXA 4YH2A 2LRNA 2KP1A 3FKFA 3CSIA 3PGTA 4KA0A 2I4AA 1AQWA 5A4UA 4NXIA 1FVJA 3BOAA 5ECOB 5B8AA 1ZYEA 5EL8A 3IDVA 5G30A 4PQIA 1AXDA 4JU5A 4POMA 4IGJA 2H0IA 1GSDA 3QOUA 4OD7A 1WP0A 3U6VA 2C3TA 4WR5A 4LL4B 2AAWA 5ABRA 2QA2A 2B1LA 2VCWA 3WT1A 3P8WA 1WOUA 3HYPA 4CHSA 2H6ZA 3L9SA 4RQXA 4RI6A 5J9BA 1LU4A 4IHUA 2RUFA 1GTBA 1F9MA 2HZFA 2EC4A 3LFLA 1WJKA 1TRUA 3H8QA 2A2RA 4PTSA 3VWUA 4L8EA 2OBKA 3VWVA 4Q5NA 2L5LA 1S3RA 1AAZA 2PPTA 3FEUA 1PX7A 4ILFA 4G0IA 4AF2A 1PA3A 4FYCA 1EEMA 3DVWA 4HOJA 4L5OA 2ES7A 4IBPA 1ZYPA 4LMWA 5IO0A 4DVCA 1GUKA 3DEXA 3W8SA 4XS4B 5D96A 2HI7A 2V41A 3A2WA 4X4JA 1V57A 3LWAA 8GSSA 1F2EA 4P3YB 2C0DA 2RM5A 2TRXA 1MD4A 1FO5A 1TRSA 4G9HA 3GTUA 1MD3A 3TKQA 4OCFA 1YY7A 1HQOA 3RDWA 2C1YA 3NZNA 5BMUA 2IL3A 1PKWA 1TI3A 4K9ZA 4G10A 3RBTA 1HYUA 4NHZA 3EVIA 3GYKA 2DJJA 4FH8A 3KGKA 1MTCA 4HU9A 2V32A 3QAWA 4MJAA 4NWYA 3UBKA 4Z7XA 2WCIA 2JADA 3M3MA 2FWEA 5ECSA 6GSSA 5E59A 1SU9A 2YZHA 1SL2B 3TJFA 4EDZA 1TJDA 4TR3A 1T1VA 3D6IA 4ACSA 1LBKA 4X43A 4TXOB 3MWHA 1DUGA 3EINA 2XBQA 2RUEA 5BRTA 3LXZA 3HJPA 2P5RA 1XVQA 1SK0A 5IPGA 5IMZA 2H8LA 2DMMA 2X8GA 2H71A 3U5RE 3A2VA 3F4SA 1AW9A 3HY2A 3FHKA 4JRRA 4J2FA 4AJ8A 5LD0A 3VI5A 2DMLA 4WF4A 3I43A 2H0HA 3Q74A 2P0GA 2R6KA 2FWGA 3LORA 3HJOA 3KJYA 6GSWA 5KN3A 5DQSA 2R0PA 3ZFLA 1K0BA 2F8AA 4Z2TA 1WMJA 4ZB6A 1PMTA 1TKDB 1Z6NA 4XS6A 3CXGA 5D9XA 2E2GA 1DBYA 1PRXA 4I2UA 1A2JA 1B4QA 3QFBC 4AGSA 6GSTA 2LUSA 2OA7A 2B5XA 5ECRB 3VK9A 3HZ4A 1AQVA 4TXVA 3V1WA 2DIYA 2VL3A 2LV3A 2GGTA 3GMFA 3EU3A 2AYTA 3D4TA 6GSUA 3GFKA 2CVKA 4PUAA 3GV1A 4PUFC 2H0GA 4TR1A 2PGTA 1K0OA 1VGLA 4ZXGA 1RQMA 2LSTA 1H4OA 1Y25A 2YJHA 5IOXA 4KCEA 3MIXA 4AJ7A 4BVYB 4MZBA 2VAFA 2IIYA 4EE0A 4IW9A 3UAPA 5IMFA 1Q4JA 2XPEA 5D8IA 2NDOA 2B7JA 4HS1A 2X99A 3C73A 5F06A 1R5PA 1EGOA 2CA8A 5IMAA 1UVZA 1AQXA 3GX0A 3MAKA 1GNWA 5IQYA 1SL0B 1XXUA 3GN3A 1XOBA 4MJBA 3C1RA 2GT5A 3GSTA 2E7PA 2HNLA 4Q5RA 5A5KA 1O85A 5ECLB 2R0GA 1FHEA 4GSNA 1URMA 2O85A 4LLRA 3E9JB 5IPHA 1FW1A 3FZ4A 3ZMLA 4O32A 3ZFBA 2VUPA 3CQFA 2OKAA 4DEJA 1X9MB 2ALBA 5B8BA 3IC8A 5DDLA 3ZYWA 1K0DA 3UEMA 4BVXB 3A5WA 3EMPA 1M99A 2JSZA 4TR4A 1AC1A 3I69A 4N0VA 1HNCA 1XW6A 3PH9A 5F0GA 5FWGA 1G0TA 1GSUA 1XW5A 2H70A 1OC9B 3O3TA 2M72A 3C1SA 2K18A 1O8WA 3ZREA 4N10A 5DCGA 3QAVA 4GF0A 2YANA 2H1BA 2HSYA 3HCZA 5CRGA 4KGIA 1RW1A 3TDGA 3KMNA 4IJ3A 5JCGA 1SYXA 2LEGA 2VD1A 9GSSA 4L0WA 1OKDA 4F82A 4H86A 3IOSA 3QCPA 1O8XA 3RHBA 1PKZA 1R7HA 2DKHA 4POLA 2YP6A 3GA4A 5IIZA 1J9BA 4MF6A 1QK8A 2F51A 16GSA 1GP1A 5JWQB 3QDNA 3DIEA 3IHQA 3TJKA 1GSFA 1B48A 1LJRA 5EY6A 1OVNA 3QAGA 4CY8A 1O73A 4PQ1A 4NV2A 3H4KA 1XWKA 2B3SA 4K5RA 3FZAA 1AUCA 2LS5A 4MABA 4EDYA 1T3BA 2IFQB 5JWRB 1X5EA 3KD0A 2KUCA 3GKKA 1U6TA 1JFUA 4CW9A 3WT2A 1OC3A 3EE2A 3GUSA 2GZZA 4JE1A 3M1GA 4KH7A 2B5EA 5GAND 5JWOB 3EC3A 4ZB9A 3IR4A 1R4WA 3HVXA 3TOUA 2VL9A 1ZCPA 2CVDA 1F6MC 3JCML 2C80A 2GQKA 2XHFA 4V1Ap 1J08A 1E2YA 5FT3A 3I9V2 4MNNA 3M8NA 2H1AA 4ZBAA 1IYIA 2AHEA 4IP6A 3KH9A 4EL1A 2YN1A 1SENA 2VL2C 1OKTA 1GSYA 3ZZXA 3MYDA 3HA9A 2REMA 5HQPA 4XRAA 3UL3A 2FWFA 4D73A 1JZOA 5HFIA 4K2XA 3GL5A 3QD9A 4IQAA 2HRNA 5INYA 4DSRA 2MMOA 4K6XA 3ZITA 1MEKA 2HZEB 4KDUA 2DSAA 6GSYA 3ZIVA 3LGCA 4ZL8A 2HLSA 2RM6A 3E0UA 2L4QA 2FLSA 1TK5B 4HU7A 3GHAA 1CQHA 4BWSA 2I81A 4HZ4A 2R37A 1TOFA 1PN0A 1KNGA 1A8YA 2MMZA 1GLQA 4NHWA 1M0UA 4RQRA 2L6CA 1B9XC 2H76A 4GRFA 2H30A 5IMDA 4ECIA 3VLNA 4ZBBA 5J9CA 2J23A 5G31A 1PSQA 1JZWA 4J57E 3S9FA 4RUVA 2MMAA 4Q5QA 1XIYA 1NM3A 4BL7A 1GRXA 3LSZA 3D0ZA 2PWJA 1ACVA 4I2TA 4IP1A 4V1Ag 1QXHA 1EV4A 2ON5A 3H93A 3E3EA 3FR3A 3UBLA 4GCIA 2L59A 4BA7A 1XWCA 4JBBA 2A4HA 1JZRA 2OE3A 4K7NA 1WWJA 2M46A 4GSTA 5HR0A 2YWNA 4OFNA 3VWXA 3GH9A 3ERFA 1SYRA 2O8VB 1GH2A 2A2SA 2QKEA 3ZL5A 2FWHA 1FAAA 2DLXA 2VL2A 2GSRA 2A2PA 3QMXA 4WEYA 2WB9A 2DC5A 1EP7A 5COHA 1TXXA 3ISOA 1K0CA 3ZMKA 4Q5FA 2HT9A 2FY6A 4LL1B 4MZWA 2GLRA 5D93A 1PL1A 2ZUPA 4HDEA 5DALB 5GSSA 4AJ6A 5DCHA 3IPZA 4ZBDA 17GSA 3LG6A 5KEJA 2GSTA 3IC4A 2JZRA 1FOHA 1ST9A 4YKFA 3FY7A 4FYUA 1Q98A 2TIRA 1PL2A 1B4PA 3QFAC 2LJAA 2R3XA 2BJXA 5ECPB 2IMDA 1EOHA 1WE0A 5HFKA 3UVHA 5ECQB 1B8XA 1UC7A 3UMAA 1XWGA 5A4VA 5CAXA 2GT6A 3DRNA 1Y6EA 3KH7A 2GSSA 4LA1A 4ULXA 2VLVA 3LYPA 1GULA 2FA8A 3WGDA 1QUWA 4KW6A 2N5FA 3APSA 1PN9A 5H5RA 2DJ3A 4PNFA 1QFNA 2YWMA 2QC7A 4QL9A 2B1KA 2GZYA 1EEJA 3VWWA 1M2AA 3A5IA 1BJXA 4MZCA 1OAZA 4DSSA 1I5GA 1GTAA 1BQ7A 2FCHA 2FUG2 3TGZA 2WS2A 1SJZA 2LJKA 3KEBA 3M9JA 3H79A 4POBA 3HD5A 2WFCA 2KOKA 1USBA 3WGEA 4K1FA 4K0NA 3DWVA 4PNGA 4K2DA 3W8JA 2I9HA 3IE3A 2MBTA 5DAKA 2LNSA 5ID2A 5CRDA 4MP4A 4F9ZA 4NV5A 1DE1A 5H5QA 4KDXA 2R4VA 3EURA 2C4JA 6GSVA 3FZ9A 4MPGA 4ZIJA 1MDJA 3HHVA 4YAPA 1XOAA 7GSSA 1G7EA 5DVBA 3NIVA 5J5NA 1A0FA 3LJRA 1XW9A 2CX4A 2TRCP 2JZTA 5KOXA 3FMWA 4ID0A 4FO5A 2H75A 3HJMA 3I6AA 3APOA 3IA1A 3L9VA 1VF2A 3IV4A 3ZTLA 2H1DA 1VRSD 1YJ6A 4V2MA 3FK8A 1EP8A 5B6MA 5G1KA 3GH6A 3GRXA 2V1MA 2C0FA 1EGRA 3GTUB 5B6NA 1K3LA 2AV4A 2GQLA 4ECCA 3C71A 1ERTA 1B9YC 4GQFA 5G5FA 1TK0B 2VIMA 1V40A 2JL4A 2BTOT 4PX1A 2K8SA 1YDKA 4CDOA 4HJ2A 5IMCA 3BCIA 2IJYA 2A4VA 1ZOFA 1TU7A 2FNOA 2LQOA 3VI7A 4L0UA 18GSA 2UZ8A 1M7TA 4TRXA 2P5QA 4XCSA 1ERUA 2WRTA 1WPIA 3HVVA 2WGRA 2NPBA 2JZSA 4OO5A 1QGVA 4JEDA 4N30A 2YZUA 3F63A 3EMXA 5HFGA 2DBCA 4ZL7A 1SKSB 5D9VA 3DGQA 2R2JA 2D2ZA 1PGTA 1A23A 5KN2A 3DMLA 1UN2A 4WF5A 4IN0A 1T4YA 2LQQA 2YJ7A 2HRAA 5J3RA 3FZ5A 1K0MA 3F6DA 3TJJA 4NPBA 14GSA 4KX4A 1U88A 3US3A 5G5EA 2MYGA 4MA9A 4NMUA 1M9AA 1X0RA 2GTUA 1YZXA 4GXZA 3DYRA 3VFIA 4G0LA 4IQ1A 4OWYA 2X64A 3F0IA 3UIWA 5IO2A 2H72A 3OR5A 3GIXA 19GSA 1SK1A 3N5OA 2KHPA 5D9WA 2DIZA 2ON7A 3LQ7A 1BEDA 1GTUA 1QQ2A 4E8HA 4ZB8A 2QA1A 3HXSA 2HRKA 4QQ7A 2X8CA 2YCDA 1SK2A 1FB0A 3KM6A 4IS0A 3DVXA 4WETA 3TOTA 1Z7PA 5ELAA 4EF0A 1V2AA 3GKMA 3R2QA 5FHIA 4YKGA 1VF3A 4TR1B 3G7IA 4O7HA 4K7OA 1SJIA 4TW5A 1ON4A 3UARA 3RPNA 1S3CA 2VCZA 1PX6A 2L6DA 3CBUA 1U87A 4BWQA 3ED3A 5LCZA 3N9JA 2B5YA 4G2EA 3CTGA 3PPUA 2WZ9A 2I1UA 2AB6A 2P31A 3P90A 5KN1A 2IPAA 3FW2A 12GSA 1YF1A 1XPVA 1ZYQB 3O6TA 3MDKA 2DKIA 2L5OA 4EKZA 1SKRB 4MH2A 1GWCA 10GSA 1U3IA 4XS1A 5G1LA 5CYYA 4KF9A 1YQ1A 1K3OA 1RK4A 2YNXA 3IHGA 3TUEA 2DJ2A 1S3AA 2K9FA 4WBJA 3ZRDA 1V98A 3IXRA 2LRTA 2OACA 4OFMA 3L9UA 2F8FA 4MLYA 3A2XA 1M3IA 5IMVA 1G6YA 2XPDA 2MMNA 3O76A 4GTUA 1YKCA 1OC8A 20GSA 1XFLA 1XZOA 1TU8A 3GX8A 2OJLA 1F37A 5F05A 4MF7A 2GDRA 4QL7A 1ILOA 3FR9A 1KEBA 1BYEA 2PUKC 5G2ZA 1A24A 2VO4A 1IYHA 1PFOA 4N0ZA 4HJMA 5HR3A 4BPYA 2H01A 4XS4A 3FRCA 1NSWA 2PN8A 1MDIA 4YQMA 1SD8A 3R3EA 4POKA 1NHOA 2MBSA 1XBSA 5DQYA 2LTKA 3FR6A 3KP9A 5IOWA 3CSHA 3HDCA 4TKYA 3UOMA 3TB2A 3TJBA 3CSJA 5EVOA 3HKRA 1OE7A 4KAEA 1YF0A 3DKSA 4O92A 2ZCTA 5J41A 3QPMA 1EV9A 4I97A 3IAM2 3VURA 1ZL9A 3CTFA 1YEPA 2RLIA 3HZ8A 4ICYA 1HD2A 2AUVA 1PQNA 2AJQB 2R0CA 5ECHB 4WR4A 4YQVA 4HQZA 5ECIB 2X4AA 1X9SB 3G7JA 4TXOA 4YQUA 4IKHA 5JCWA 3ZVJD 2OE1A 2EIQA 1SD9A 2PVOC 3TRXA 3A3TA 3K8NA 1BG5A 2H6XA 3Q6OA 4HEA2 4MJEA 2H1GA 3HVNA 3KMOA 1I9DA 4YAVA 1ERVA 1XCCA 3RAZA 3IRAA 1THOA 2GVPA 3F4RA 4HQSA 2HSMA 1K3YA 1HNAA 3LXTA 1XVWA 4ISDA 2O7KA 1ZZYA 2LJRA 4OFTA 4I6XA 4GSSA 2KLXA 4XTSA 3TRPA 1DSBA 2G0FA 4JR6A 2R5GA 4D73B 1U3AA 3BJ5A 5KOWA 4TVEA 5J4UA 3DXBA 2VLUA 1GSQA 3IAS2 4IELA 1H75A 1O7UA 3KCMA 4WBRD 3ZLPA 2FA4A 1ZGNA 2V6OA 1AIUA 4OO4A 1KTEA 2M80A 4ECBA 4XHMA 5HR1A 3TKSC 3KZQA 3QR6A 3EWLA 4EXJA 3P2AA 2ZNMA 3J7Yb 3J7Yk 1TRVA 4PURA 4F0BA 4F0CA 4TR0A 5HR2A 1DE2A 2NTOA 2X49A 4BVYA 4KSOA 4L5LA 2B6MA 1G7OA 1K0NA 5DJMA 3LEFA 3G7YA 1GLPA 3TJGA 4TOPA 5ECKB 1WIKA 3SWLA 3MSZA 4EIQA 4BL7B 4ZILA
chains in the Genus database with same CATH topology
1XWAA 2C3NA 3CMIA 1A8LA 2C8UA 2BMXA 1TK8B 4K8MA 2CT6A 2CZ3A 2IMFA 5CNWA 3F8UA 5JCUA 1JHBA 2XBIA 1R26A 3TRQA 1GSSA 4MJCA 4HZ2A 2E2MA 11GSA 2VM1A 1F3BA 1ERWA 3G9BA 2G2QA 4TN8A 4O5UA 3GKNA 1ZYNA 2N5BA 5L71A 2EIOA 4MF5A 2L57A 4BVXA 5ENUA 4ZL9A 4ECJA 1OYJA 3ERWA 4J56E 1O6JA 1T4ZA 1Z6MA 1A2LA 2V6KA 2OE0A 1OC9A 5H5SA 4EUYA 2PMTA 1EZKA 5ECNB 3APQA 5D73A 4O5RA 1TRWA 4I5QA 1E6BA 3D22A 2QSIA 3ME7A 3RPPA 2F9SA 2LKUA 2IWTA 3GKXA 4HUAA 2YWOA 4MPFA 4KCAA 1FVKA 1ABAA 3IK7A 3M0FA 5DBQA 1J0FA 2VCVA 5LNKe 1X5DA 2H66A 4EIPA 4MCUA 4KB3A 1T8EB 3F6FA 3TKSA 5AIVA 3MNGA 3F3QA 1V9WA 5AN1A 2VCTA 2JACA 2WDUA 4LMVA 2VLTA 1Z3EA 5ELGA 5E4WA 4MDCA 1TDIA 2CAIA 5B7CA 2Z9SA 2YV9A 1ZMAA 1M2DA 2GS3A 2CVBA 5F8BA 5C00A 5KN0A 5DJLA 5CRHA 2C0GA 1A2MA 3C7MA 5IM9A 2J9HA 1GUHA 3H1NA 4EO3A 22GSA 1G6WA 2JSYA 5GAPD 4KUNA 1SJ6A 4JR4A 1SKWB 3ME8A 2HFDA 2YWIA 4X1UA 2CX3A 4EC0A 4N11A 3ZIJA 1QMVA 2PERA 2YV7A 1VF4A 4K5SA 3W6GA 2IFQA 4MH3A 2H6YA 3C8EA 2DJKA 4DSQA 1W89A 4K0GA 5AISA 3KP8A 3NOFA 1HNBA 1FOVA 3D21A 1F3AA 5D9TA 4HI7A 2F3MA 5CRWA 3F9UA 5GZZB 4GWRA 2VD0A 3KIJA 3BCKA 1S3DA 4DSSB 1T7PB 3LW9A 3TKSE 1VF1A 4V2LA 2GZPA 3GNJA 3BD2A 2DJ0A 3L4NA 2HSHA 4PGTA 2GSQA 2HRFA 2OADA 2XC2A 5CP1A 3TKRA 1JLWA 5DAKB 5ID2B 3TKPA 3KTLA 3CYNA 1M2BA 3WD6A 3BBYA 4IVFA 2WULA 4A5PA 3CRTA 1NHYA 1NW2A 1GL8A 4MMMA 2C0EA 5GSTA 1PD21 3HVSA 4KE3A 2LRCA 2FHEA 1YEXA 4FYBA 4MK3A 2O89A 3UVTA 4PXOA 4F03A 4GLTA 4GQCA 2EIRA 3TCOA 3PINA 1O81A 2RIIA 3SBCA 4O5QA 3WYWA 1EOGA 1JZDA 2NVLA 4PQHA 4V2NA 1WRYA 4X0XA 2PVQA 2X8HA 2FD3A 4Z2RA 2HZEA 3EU4A 1TTZA 2LNTA 2QGVA 4KDYA 3ERGA 4EVMA 4OCEA 2VOCA 4WKWA 2IMEA 2HE3A 2K8VA 2H19A 3PR8A 1N8JA 4NAXA 2YPMA 2PU9C 3IBHA 2JU5A 3F3RA 2B7KA 1BAYA 2IMIA 1TI1A 4IJIA 5CO3A 3L0HA 3GURA 3EYTA 2C3QA 1A0RP 3AY8A 3KTBA 3D5JA 1X9WB 2IN3A 4USSA 3IK9A 1W4VA 4F2IA 1SL1B 5C04A 2H73A 13GSA 2V2GA 4JZQA 4KNDA 1CQGA 1KBNA 2DJ1A 2K6VA 1V58A 3L78A 2VCXA 2CAQA 1Z9HA 2KP2A 4E8EA 2NBSA 3EPTA 1BX9A 3M9KA 2HYXA 4WXTA 3LYKA 5EPFA 5AGYA 1N2AA 5F07A 3F4TA 1M9BA 2MZCA 1GUMA 2WJUA 4XIHA 1TW9A 5CREA 3Q18A 1EWXA 2OBIA 2I3YA 1X5CA 5ECMB 3P7XA 3KXOA 3UJ1A 3GSSA 1GSEA 1T00A 4RI7A 1FG4A 5AIXA 1MDKA 3Q19A 3GL3A 2VCQA 5DALA 2IMKA 1JLVA 4G19A 4I8BA 2E0QA 4CY6A 1XWBA 3FYGA 1TP9A 1C72A 4OMVA 1OE8A 1UA5A 1Z7RA 5A4WA 2N5AA 2CV4A 1Z5YE 2CQ9A 1K0AA 2CZ2A 3CRUA 1GNEA 4Z2UA 2L4CA 2HXKA 4KSMA 1ML6A 4XRDA 4FQUA 3WGXA 2H74A 1YKAA 3ZVJA 3D4MA 1GTIA 4ML6A 2O87A 6GSXA 1FB6A 4FIWA 2VM2A 3DD3A 3RHCA 1R5AA 4G0KA 2GQMA 1THXA 4ML1A 3VPQA 2YOIA 3VPTA 2PBJA 4K7IA 2FGXA 4YH2A 2LRNA 2KP1A 3FKFA 3CSIA 3PGTA 4KA0A 2I4AA 1AQWA 5A4UA 4NXIA 1FVJA 3BOAA 5ECOB 5B8AA 1ZYEA 5EL8A 3IDVA 5G30A 4PQIA 1AXDA 4JU5A 4POMA 4IGJA 2H0IA 1GSDA 3QOUA 4OD7A 1WP0A 3U6VA 2C3TA 4WR5A 4LL4B 2AAWA 5ABRA 2QA2A 2B1LA 2VCWA 3WT1A 3P8WA 1WOUA 3HYPA 4CHSA 2H6ZA 3L9SA 4RQXA 4RI6A 5J9BA 1LU4A 4IHUA 2RUFA 1GTBA 1F9MA 2HZFA 2EC4A 3LFLA 1WJKA 1TRUA 3H8QA 2A2RA 4PTSA 3VWUA 4L8EA 2OBKA 3VWVA 4Q5NA 2L5LA 1AAZA 2PPTA 3FEUA 1PX7A 4ILFA 4G0IA 4AF2A 1PA3A 4FYCA 1EEMA 3DVWA 4HOJA 4L5OA 2ES7A 4IBPA 1ZYPA 4LMWA 5IO0A 4DVCA 1GUKA 3DEXA 3W8SA 4XS4B 5D96A 2HI7A 2V41A 3A2WA 4X4JA 1V57A 3LWAA 8GSSA 1F2EA 4P3YB 2C0DA 2RM5A 2TRXA 1MD4A 1FO5A 1TRSA 4G9HA 3GTUA 1MD3A 3TKQA 4OCFA 1YY7A 1HQOA 3RDWA 2C1YA 3NZNA 5BMUA 2IL3A 1PKWA 1TI3A 4K9ZA 4G10A 3RBTA 1HYUA 4NHZA 3EVIA 3GYKA 2DJJA 4FH8A 3KGKA 1MTCA 4HU9A 2V32A 3QAWA 4MJAA 4NWYA 3UBKA 4Z7XA 2WCIA 2JADA 3M3MA 2FWEA 5ECSA 6GSSA 5E59A 1SU9A 2YZHA 1SL2B 3TJFA 4EDZA 1TJDA 4TR3A 1T1VA 3D6IA 4ACSA 1LBKA 4X43A 4TXOB 3MWHA 1DUGA 3EINA 2XBQA 2RUEA 5BRTA 3LXZA 3HJPA 2P5RA 1XVQA 1SK0A 5IPGA 5IMZA 2H8LA 2DMMA 2X8GA 2H71A 3U5RE 3A2VA 3F4SA 1AW9A 3HY2A 3FHKA 4JRRA 4J2FA 4AJ8A 5LD0A 3VI5A 2DMLA 4WF4A 3I43A 2H0HA 3Q74A 2P0GA 2R6KA 2FWGA 3LORA 3HJOA 3KJYA 6GSWA 5KN3A 5DQSA 2R0PA 3ZFLA 1K0BA 2F8AA 4Z2TA 1WMJA 4ZB6A 1PMTA 1TKDB 1Z6NA 4XS6A 3CXGA 5D9XA 2E2GA 1DBYA 1PRXA 4I2UA 1A2JA 1B4QA 3QFBC 4AGSA 6GSTA 2LUSA 2OA7A 2B5XA 5ECRB 3VK9A 3HZ4A 1AQVA 4TXVA 3V1WA 2DIYA 2VL3A 2LV3A 2GGTA 3GMFA 3EU3A 2AYTA 3D4TA 6GSUA 3GFKA 2CVKA 4PUAA 3GV1A 4PUFC 2H0GA 4TR1A 2PGTA 1K0OA 1VGLA 4ZXGA 1RQMA 2LSTA 1H4OA 1Y25A 2YJHA 5IOXA 4KCEA 3MIXA 4AJ7A 4BVYB 4MZBA 2VAFA 2IIYA 4EE0A 4IW9A 3UAPA 5IMFA 1Q4JA 2XPEA 5D8IA 2NDOA 2B7JA 4HS1A 2X99A 3C73A 5F06A 1R5PA 1EGOA 2CA8A 5IMAA 1UVZA 1AQXA 3GX0A 3MAKA 1GNWA 5IQYA 1SL0B 1XXUA 3GN3A 1XOBA 4MJBA 3C1RA 2GT5A 3GSTA 2E7PA 2HNLA 4Q5RA 5A5KA 1O85A 5ECLB 2R0GA 1FHEA 4GSNA 1URMA 2O85A 4LLRA 3E9JB 5IPHA 1FW1A 3FZ4A 3ZMLA 4O32A 3ZFBA 2VUPA 2OKAA 4DEJA 1X9MB 2ALBA 5B8BA 3IC8A 5DDLA 3ZYWA 1K0DA 3UEMA 4BVXB 3A5WA 3EMPA 1M99A 2JSZA 4TR4A 1AC1A 3I69A 4N0VA 1HNCA 1XW6A 3PH9A 5F0GA 5FWGA 1G0TA 1GSUA 1XW5A 2H70A 1OC9B 3O3TA 2M72A 3C1SA 2K18A 1O8WA 3ZREA 4N10A 5DCGA 3QAVA 4GF0A 2YANA 2H1BA 2HSYA 3HCZA 5CRGA 4KGIA 1RW1A 3TDGA 3KMNA 4IJ3A 5JCGA 1SYXA 2LEGA 2VD1A 9GSSA 4L0WA 1OKDA 4F82A 4H86A 3IOSA 3QCPA 1O8XA 3RHBA 1PKZA 1R7HA 2DKHA 4POLA 2YP6A 3GA4A 5IIZA 1J9BA 4MF6A 1QK8A 2F51A 16GSA 1GP1A 5JWQB 3QDNA 3DIEA 3IHQA 3TJKA 1GSFA 1B48A 1LJRA 5EY6A 1OVNA 3QAGA 4CY8A 1O73A 4PQ1A 4NV2A 3H4KA 1XWKA 2B3SA 4K5RA 3FZAA 1AUCA 2LS5A 4MABA 4EDYA 1T3BA 2IFQB 5JWRB 1X5EA 3KD0A 2KUCA 3GKKA 1U6TA 1JFUA 4CW9A 3WT2A 1OC3A 3EE2A 3GUSA 2GZZA 4JE1A 3M1GA 4KH7A 2B5EA 5GAND 5JWOB 3EC3A 4ZB9A 3IR4A 1R4WA 3HVXA 3TOUA 2VL9A 1ZCPA 2CVDA 1F6MC 3JCML 2C80A 2GQKA 2XHFA 4V1Ap 1J08A 1E2YA 5FT3A 3I9V2 4MNNA 3M8NA 2H1AA 4ZBAA 1IYIA 2AHEA 4IP6A 3KH9A 4EL1A 2YN1A 1SENA 2VL2C 1OKTA 1GSYA 3ZZXA 3MYDA 3HA9A 2REMA 5HQPA 4XRAA 3UL3A 2FWFA 4D73A 1JZOA 5HFIA 4K2XA 3GL5A 3QD9A 4IQAA 2HRNA 5INYA 4DSRA 2MMOA 4K6XA 3ZITA 1MEKA 2HZEB 4KDUA 2DSAA 6GSYA 3ZIVA 3LGCA 4ZL8A 2HLSA 2RM6A 3E0UA 2L4QA 2FLSA 1TK5B 4HU7A 3GHAA 1CQHA 4BWSA 2I81A 4HZ4A 2R37A 1TOFA 1PN0A 1KNGA 1A8YA 2MMZA 1GLQA 4NHWA 1M0UA 4RQRA 2L6CA 1B9XC 2H76A 4GRFA 2H30A 5IMDA 4ECIA 3VLNA 4ZBBA 5J9CA 2J23A 5G31A 1PSQA 1JZWA 4J57E 3S9FA 4RUVA 2MMAA 4Q5QA 1XIYA 1NM3A 4BL7A 1GRXA 3LSZA 3D0ZA 2PWJA 1ACVA 4I2TA 4IP1A 4V1Ag 1QXHA 1EV4A 2ON5A 3H93A 3E3EA 3FR3A 3UBLA 4GCIA 2L59A 4BA7A 1XWCA 4JBBA 2A4HA 1JZRA 2OE3A 4K7NA 1WWJA 2M46A 4GSTA 5HR0A 2YWNA 4OFNA 3VWXA 3GH9A 3ERFA 1SYRA 2O8VB 1GH2A 2A2SA 2QKEA 3ZL5A 2FWHA 1FAAA 2DLXA 2VL2A 2GSRA 2A2PA 3QMXA 4WEYA 2WB9A 2DC5A 1EP7A 5COHA 1TXXA 3ISOA 1K0CA 3ZMKA 4Q5FA 2HT9A 2FY6A 4LL1B 4MZWA 2GLRA 5D93A 1PL1A 2ZUPA 4HDEA 5DALB 5GSSA 4AJ6A 5DCHA 3IPZA 4ZBDA 17GSA 3LG6A 5KEJA 2GSTA 3IC4A 2JZRA 1FOHA 1ST9A 4YKFA 3FY7A 4FYUA 1Q98A 2TIRA 1PL2A 1B4PA 3QFAC 2LJAA 2R3XA 2BJXA 5ECPB 2IMDA 1EOHA 1WE0A 5HFKA 3UVHA 5ECQB 1B8XA 1UC7A 3UMAA 1XWGA 5A4VA 5CAXA 2GT6A 3DRNA 1Y6EA 3KH7A 2GSSA 4LA1A 4ULXA 2VLVA 3LYPA 1GULA 2FA8A 3WGDA 1QUWA 4KW6A 2N5FA 3APSA 1PN9A 5H5RA 2DJ3A 4PNFA 1QFNA 2YWMA 2QC7A 4QL9A 2B1KA 2GZYA 1EEJA 3VWWA 1M2AA 3A5IA 1BJXA 4MZCA 1OAZA 4DSSA 1I5GA 1GTAA 1BQ7A 2FCHA 2FUG2 3TGZA 2WS2A 1SJZA 2LJKA 3KEBA 3M9JA 3H79A 4POBA 3HD5A 2WFCA 2KOKA 1USBA 3WGEA 4K1FA 4K0NA 3DWVA 4PNGA 4K2DA 3W8JA 2I9HA 3IE3A 2MBTA 5DAKA 2LNSA 5ID2A 5CRDA 4MP4A 4F9ZA 4NV5A 1DE1A 5H5QA 4KDXA 2R4VA 3EURA 2C4JA 6GSVA 3FZ9A 4MPGA 4ZIJA 1MDJA 3HHVA 4YAPA 1XOAA 7GSSA 1G7EA 5DVBA 3NIVA 5J5NA 1A0FA 3LJRA 1XW9A 2CX4A 2TRCP 2JZTA 5KOXA 3FMWA 4ID0A 4FO5A 2H75A 3HJMA 3I6AA 3APOA 3IA1A 3L9VA 1VF2A 3IV4A 3ZTLA 2H1DA 1VRSD 1YJ6A 4V2MA 3FK8A 1EP8A 5B6MA 5G1KA 3GH6A 3GRXA 2V1MA 2C0FA 1EGRA 3GTUB 5B6NA 1K3LA 2AV4A 2GQLA 4ECCA 3C71A 1ERTA 1B9YC 4GQFA 5G5FA 1TK0B 2VIMA 1V40A 2JL4A 2BTOT 4PX1A 2K8SA 1YDKA 4CDOA 4HJ2A 5IMCA 3BCIA 2IJYA 2A4VA 1ZOFA 1TU7A 2FNOA 2LQOA 3VI7A 4L0UA 18GSA 2UZ8A 1M7TA 4TRXA 2P5QA 4XCSA 1ERUA 2WRTA 1WPIA 3HVVA 2WGRA 2NPBA 2JZSA 4OO5A 1QGVA 4JEDA 4N30A 2YZUA 3F63A 3EMXA 5HFGA 2DBCA 4ZL7A 1SKSB 5D9VA 3DGQA 2R2JA 2D2ZA 1PGTA 1A23A 5KN2A 3DMLA 1UN2A 4WF5A 4IN0A 1T4YA 2LQQA 2YJ7A 2HRAA 5J3RA 3FZ5A 1K0MA 3F6DA 3TJJA 4NPBA 14GSA 4KX4A 1U88A 3US3A 5G5EA 2MYGA 4MA9A 4NMUA 1M9AA 1X0RA 2GTUA 1YZXA 4GXZA 3DYRA 3VFIA 4G0LA 4IQ1A 4OWYA 2X64A 3F0IA 3UIWA 5IO2A 2H72A 3OR5A 3GIXA 19GSA 1SK1A 3N5OA 2KHPA 5D9WA 2DIZA 2ON7A 3LQ7A 1BEDA 1GTUA 1QQ2A 4E8HA 4ZB8A 2QA1A 3HXSA 2HRKA 4QQ7A 2X8CA 2YCDA 1SK2A 1FB0A 3KM6A 4IS0A 3DVXA 4WETA 3TOTA 1Z7PA 5ELAA 4EF0A 1V2AA 3GKMA 3R2QA 5FHIA 4YKGA 1VF3A 4TR1B 3G7IA 4O7HA 4K7OA 1SJIA 4TW5A 1ON4A 3UARA 3RPNA 1S3CA 2VCZA 1PX6A 2L6DA 3CBUA 1U87A 4BWQA 3ED3A 5LCZA 3N9JA 2B5YA 4G2EA 3CTGA 3PPUA 2WZ9A 2I1UA 2AB6A 2P31A 3P90A 5KN1A 2IPAA 3FW2A 12GSA 1YF1A 1XPVA 1ZYQB 3O6TA 3MDKA 2DKIA 2L5OA 4EKZA 1SKRB 4MH2A 1GWCA 10GSA 1U3IA 4XS1A 5G1LA 5CYYA 4KF9A 1YQ1A 1K3OA 1RK4A 2YNXA 3IHGA 3TUEA 2DJ2A 1S3AA 2K9FA 4WBJA 3ZRDA 1V98A 3IXRA 2LRTA 2OACA 4OFMA 3L9UA 2F8FA 4MLYA 3A2XA 5IMVA 1G6YA 2XPDA 2MMNA 3O76A 4GTUA 1YKCA 1OC8A 20GSA 1XFLA 1XZOA 1TU8A 3GX8A 2OJLA 1F37A 5F05A 4MF7A 2GDRA 4QL7A 1ILOA 3FR9A 1KEBA 1BYEA 2PUKC 5G2ZA 1A24A 2VO4A 1IYHA 4N0ZA 4HJMA 5HR3A 4BPYA 2H01A 4XS4A 3FRCA 1NSWA 2PN8A 1MDIA 4YQMA 1SD8A 3R3EA 4POKA 1NHOA 2MBSA 1XBSA 5DQYA 2LTKA 3FR6A 3KP9A 5IOWA 3CSHA 3HDCA 4TKYA 3UOMA 3TB2A 3TJBA 3CSJA 5EVOA 3HKRA 1OE7A 4KAEA 1YF0A 3DKSA 4O92A 2ZCTA 5J41A 3QPMA 1EV9A 4I97A 3IAM2 3VURA 1ZL9A 3CTFA 1YEPA 2RLIA 3HZ8A 4ICYA 1HD2A 2AUVA 1PQNA 2AJQB 2R0CA 5ECHB 4WR4A 4YQVA 4HQZA 5ECIB 2X4AA 1X9SB 3G7JA 4TXOA 4YQUA 4IKHA 5JCWA 3ZVJD 2OE1A 2EIQA 1SD9A 2PVOC 3TRXA 3A3TA 3K8NA 1BG5A 2H6XA 3Q6OA 4HEA2 4MJEA 2H1GA 3KMOA 1I9DA 4YAVA 1ERVA 1XCCA 3RAZA 3IRAA 1THOA 2GVPA 3F4RA 4HQSA 2HSMA 1K3YA 1HNAA 3LXTA 1XVWA 4ISDA 2O7KA 1ZZYA 2LJRA 4OFTA 4I6XA 4GSSA 2KLXA 4XTSA 3TRPA 1DSBA 2G0FA 4JR6A 2R5GA 4D73B 1U3AA 3BJ5A 5KOWA 4TVEA 5J4UA 3DXBA 2VLUA 1GSQA 3IAS2 4IELA 1H75A 1O7UA 3KCMA 4WBRD 3ZLPA 2FA4A 1ZGNA 2V6OA 1AIUA 4OO4A 1KTEA 2M80A 4ECBA 4XHMA 5HR1A 3TKSC 3KZQA 3QR6A 3EWLA 4EXJA 3P2AA 2ZNMA 3J7Yb 3J7Yk 1TRVA 4PURA 4F0BA 4F0CA 4TR0A 5HR2A 1DE2A 2NTOA 2X49A 4BVYA 4KSOA 4L5LA 2B6MA 1G7OA 1K0NA 5DJMA 3LEFA 3G7YA 1GLPA 3TJGA 4TOPA 5ECKB 1WIKA 3SWLA 3MSZA 4EIQA 4BL7B 4ZILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWA A;  2C3N A;  3CMI A;  1A8L A;  2C8U A;  2BMX A;  1TK8 B;  4K8M A;  2CT6 A;  2CZ3 A;  2IMF A;  5CNW A;  3F8U A;  5JCU A;  1JHB A;  2XBI A;  1R26 A;  3TRQ A;  1GSS A;  4MJC A;  4HZ2 A;  2E2M A;  11GS A;  2VM1 A;  1F3B A;  1ERW A;  3G9B A;  2G2Q A;  4TN8 A;  3GKN A;  2N5B A;  5L71 A;  2EIO A;  4MF5 A;  2L57 A;  4BVX A;  5ENU A;  4ZL9 A;  4ECJ A;  1OYJ A;  3ERW A;  4J56 E;  1O6J A;  1T4Z A;  1Z6M A;  1A2L A;  2V6K A;  2OE0 A;  1OC9 A;  5H5S A;  4EUY A;  2PMT A;  1EZK A;  5ECN B;  3APQ A;  5D73 A;  4O5R A;  1TRW A;  4I5Q A;  1E6B A;  3D22 A;  2QSI A;  3ME7 A;  3RPP A;  2F9S A;  2LKU A;  2IWT A;  3GKX A;  4HUA A;  2YWO A;  4MPF A;  4KCA A;  1FVK A;  1ABA A;  3IK7 A;  3M0F A;  5DBQ A;  1J0F A;  2VCV A;  5LNK e;  1X5D A;  2H66 A;  4MCU A;  4KB3 A;  1T8E B;  3F6F A;  3TKS A;  5AIV A;  3MNG A;  3F3Q A;  1V9W A;  5AN1 A;  2VCT A;  2JAC A;  2WDU A;  4LMV A;  2VLT A;  1Z3E A;  5ELG A;  5E4W A;  4MDC A;  1TDI A;  2CAI A;  5B7C A;  2Z9S A;  2YV9 A;  1ZMA A;  1M2D A;  2GS3 A;  2CVB A;  5F8B A;  5C00 A;  5KN0 A;  5DJL A;  5CRH A;  2C0G A;  1A2M A;  3C7M A;  5IM9 A;  2J9H A;  1GUH A;  3H1N A;  4EO3 A;  22GS A;  1G6W A;  2JSY A;  5GAP D;  4KUN A;  1SJ6 A;  4JR4 A;  1SKW B;  3ME8 A;  2HFD A;  2YWI A;  4X1U A;  2CX3 A;  4EC0 A;  4N11 A;  3ZIJ A;  1QMV A;  2PER A;  2YV7 A;  1VF4 A;  3W6G A;  2IFQ A;  4MH3 A;  2H6Y A;  3C8E A;  2DJK A;  4DSQ A;  1W89 A;  4K0G A;  5AIS A;  3KP8 A;  3NOF A;  1HNB A;  1FOV A;  3D21 A;  1F3A A;  5D9T A;  4HI7 A;  2F3M A;  5CRW A;  3F9U A;  5GZZ B;  4GWR A;  2VD0 A;  3KIJ A;  3BCK A;  1S3D A;  4DSS B;  1T7P B;  3TKS E;  1VF1 A;  4V2L A;  2GZP A;  3GNJ A;  3BD2 A;  2DJ0 A;  3L4N A;  2HSH A;  4PGT A;  2GSQ A;  2HRF A;  2OAD A;  2XC2 A;  5CP1 A;  3TKR A;  1JLW A;  5DAK B;  5ID2 B;  3TKP A;  3KTL A;  3CYN A;  1M2B A;  3WD6 A;  3BBY A;  4IVF A;  2WUL A;  3CRT A;  1NHY A;  1NW2 A;  1GL8 A;  4MMM A;  2C0E A;  5GST A;  1PD2 1;  3HVS A;  4KE3 A;  2LRC A;  2FHE A;  1YEX A;  4FYB A;  4MK3 A;  2O89 A;  3UVT A;  4PXO A;  4F03 A;  4GLT A;  4GQC A;  2EIR A;  3TCO A;  3PIN A;  1O81 A;  2RII A;  3SBC A;  3WYW A;  1EOG A;  1JZD A;  2NVL A;  4PQH A;  4V2N A;  1WRY A;  4X0X A;  2PVQ A;  2X8H A;  2FD3 A;  2HZE A;  3EU4 A;  1TTZ A;  2LNT A;  2QGV A;  4KDY A;  3ERG A;  4EVM A;  4OCE A;  2VOC A;  4WKW A;  2IME A;  2HE3 A;  2K8V A;  2H19 A;  3PR8 A;  1N8J A;  4NAX A;  2YPM A;  2PU9 C;  3IBH A;  2JU5 A;  3F3R A;  2B7K A;  1BAY A;  2IMI A;  1TI1 A;  4IJI A;  5CO3 A;  3L0H A;  3GUR A;  3EYT A;  2C3Q A;  1A0R P;  3AY8 A;  3KTB A;  3D5J A;  1X9W B;  2IN3 A;  3IK9 A;  1W4V A;  4F2I A;  1SL1 B;  5C04 A;  2H73 A;  13GS A;  2V2G A;  4JZQ A;  4KND A;  1CQG A;  1KBN A;  2DJ1 A;  2K6V A;  1V58 A;  3L78 A;  2VCX A;  2CAQ A;  1Z9H A;  2KP2 A;  4E8E A;  2NBS A;  1BX9 A;  3M9K A;  2HYX A;  4WXT A;  3LYK A;  5EPF A;  5AGY A;  1N2A A;  5F07 A;  3F4T A;  1M9B A;  2MZC A;  1GUM A;  2WJU A;  4XIH A;  1TW9 A;  5CRE A;  3Q18 A;  1EWX A;  2OBI A;  2I3Y A;  1X5C A;  5ECM B;  3P7X A;  3KXO A;  3UJ1 A;  3GSS A;  1GSE A;  1T00 A;  4RI7 A;  1FG4 A;  5AIX A;  1MDK A;  3Q19 A;  3GL3 A;  2VCQ A;  5DAL A;  2IMK A;  1JLV A;  4G19 A;  4I8B A;  2E0Q A;  1XWB A;  3FYG A;  1TP9 A;  1C72 A;  4OMV A;  1OE8 A;  1UA5 A;  1Z7R A;  5A4W A;  2N5A A;  2CV4 A;  1Z5Y E;  2CQ9 A;  1K0A A;  2CZ2 A;  3CRU A;  1GNE A;  2L4C A;  2HXK A;  4KSM A;  1ML6 A;  4XRD A;  3WGX A;  2H74 A;  1YKA A;  3ZVJ A;  3D4M A;  1GTI A;  4ML6 A;  2O87 A;  6GSX A;  1FB6 A;  4FIW A;  2VM2 A;  3DD3 A;  3RHC A;  1R5A A;  2GQM A;  1THX A;  4ML1 A;  3VPQ A;  2YOI A;  3VPT A;  2PBJ A;  4K7I A;  2FGX A;  4YH2 A;  2LRN A;  2KP1 A;  3FKF A;  3CSI A;  3PGT A;  4KA0 A;  2I4A A;  1AQW A;  5A4U A;  4NXI A;  1FVJ A;  3BOA A;  5ECO B;  5B8A A;  1ZYE A;  5EL8 A;  3IDV A;  5G30 A;  4PQI A;  1AXD A;  4JU5 A;  4POM A;  4IGJ A;  2H0I A;  1GSD A;  3QOU A;  4OD7 A;  1WP0 A;  3U6V A;  2C3T A;  4WR5 A;  4LL4 B;  2AAW A;  5ABR A;  2B1L A;  2VCW A;  3WT1 A;  3P8W A;  1WOU A;  3HYP A;  4CHS A;  2H6Z A;  3L9S A;  4RQX A;  4RI6 A;  5J9B A;  1LU4 A;  4IHU A;  2RUF A;  1GTB A;  1F9M A;  2HZF A;  2EC4 A;  3LFL A;  1WJK A;  1TRU A;  3H8Q A;  2A2R A;  3VWU A;  4L8E A;  2OBK A;  3VWV A;  4Q5N A;  2L5L A;  1AAZ A;  2PPT A;  3FEU A;  1PX7 A;  4ILF A;  4AF2 A;  1PA3 A;  4FYC A;  1EEM A;  3DVW A;  4HOJ A;  4L5O A;  2ES7 A;  4IBP A;  4LMW A;  5IO0 A;  4DVC A;  1GUK A;  3DEX A;  3W8S A;  4XS4 B;  5D96 A;  2HI7 A;  2V41 A;  3A2W A;  1V57 A;  3LWA A;  8GSS A;  1F2E A;  4P3Y B;  2C0D A;  2RM5 A;  2TRX A;  1MD4 A;  1FO5 A;  1TRS A;  4G9H A;  3GTU A;  1MD3 A;  3TKQ A;  4OCF A;  1YY7 A;  1HQO A;  3RDW A;  2C1Y A;  3NZN A;  2IL3 A;  1PKW A;  1TI3 A;  4K9Z A;  4G10 A;  3RBT A;  1HYU A;  4NHZ A;  3EVI A;  3GYK A;  2DJJ A;  4FH8 A;  3KGK A;  1MTC A;  4HU9 A;  2V32 A;  3QAW A;  4MJA A;  4NWY A;  3UBK A;  4Z7X A;  2WCI A;  2JAD A;  3M3M A;  2FWE A;  5ECS A;  6GSS A;  5E59 A;  1SU9 A;  2YZH A;  1SL2 B;  3TJF A;  4EDZ A;  1TJD A;  4TR3 A;  1T1V A;  3D6I A;  4ACS A;  1LBK A;  4X43 A;  4TXO B;  3MWH A;  1DUG A;  3EIN A;  2XBQ A;  2RUE A;  3LXZ A;  3HJP A;  2P5R A;  1XVQ A;  1SK0 A;  5IPG A;  5IMZ A;  2H8L A;  2DMM A;  2X8G A;  2H71 A;  3U5R E;  3A2V A;  3F4S A;  1AW9 A;  3HY2 A;  3FHK A;  4JRR A;  4J2F A;  4AJ8 A;  5LD0 A;  3VI5 A;  2DML A;  4WF4 A;  3I43 A;  2H0H A;  3Q74 A;  2P0G A;  2R6K A;  2FWG A;  3LOR A;  3HJO A;  3KJY A;  6GSW A;  5KN3 A;  5DQS A;  3ZFL A;  1K0B A;  2F8A A;  1WMJ A;  4ZB6 A;  1PMT A;  1TKD B;  1Z6N A;  4XS6 A;  3CXG A;  5D9X A;  2E2G A;  1DBY A;  1PRX A;  4I2U A;  1A2J A;  1B4Q A;  3QFB C;  4AGS A;  6GST A;  2LUS A;  2OA7 A;  2B5X A;  5ECR B;  3VK9 A;  3HZ4 A;  1AQV A;  4TXV A;  3V1W A;  2DIY A;  2VL3 A;  2LV3 A;  2GGT A;  3GMF A;  3EU3 A;  2AYT A;  3D4T A;  6GSU A;  3GFK A;  2CVK A;  4PUA A;  3GV1 A;  4PUF C;  2H0G A;  4TR1 A;  2PGT A;  1K0O A;  1VGL A;  4ZXG A;  1RQM A;  2LST A;  1H4O A;  1Y25 A;  2YJH A;  5IOX A;  4KCE A;  4AJ7 A;  4MZB A;  2VAF A;  2IIY A;  4EE0 A;  4IW9 A;  3UAP A;  5IMF A;  1Q4J A;  2XPE A;  5D8I A;  2NDO A;  2B7J A;  4HS1 A;  2X99 A;  3C73 A;  5F06 A;  1R5P A;  1EGO A;  2CA8 A;  5IMA A;  1UVZ A;  1AQX A;  3GX0 A;  3MAK A;  1GNW A;  5IQY A;  1SL0 B;  1XXU A;  3GN3 A;  1XOB A;  4MJB A;  3C1R A;  2GT5 A;  3GST A;  2E7P A;  2HNL A;  4Q5R A;  5A5K A;  1O85 A;  5ECL B;  1FHE A;  4GSN A;  1URM A;  2O85 A;  4LLR A;  3E9J B;  5IPH A;  1FW1 A;  3FZ4 A;  3ZML A;  4O32 A;  3ZFB A;  2VUP A;  2OKA A;  4DEJ A;  1X9M B;  2ALB A;  5B8B A;  5DDL A;  3ZYW A;  1K0D A;  3UEM A;  3A5W A;  3EMP A;  1M99 A;  2JSZ A;  4TR4 A;  1AC1 A;  3I69 A;  4N0V A;  1HNC A;  1XW6 A;  3PH9 A;  5F0G A;  5FWG A;  1G0T A;  1GSU A;  1XW5 A;  2H70 A;  1OC9 B;  3O3T A;  2M72 A;  3C1S A;  2K18 A;  1O8W A;  3ZRE A;  4N10 A;  5DCG A;  3QAV A;  4GF0 A;  2YAN A;  2H1B A;  2HSY A;  3HCZ A;  5CRG A;  4KGI A;  1RW1 A;  3TDG A;  3KMN A;  4IJ3 A;  5JCG A;  1SYX A;  2LEG A;  2VD1 A;  9GSS A;  4L0W A;  1OKD A;  4F82 A;  4H86 A;  3IOS A;  3QCP A;  1O8X A;  3RHB A;  1PKZ A;  1R7H A;  4POL A;  2YP6 A;  3GA4 A;  5IIZ A;  1J9B A;  4MF6 A;  1QK8 A;  2F51 A;  16GS A;  1GP1 A;  5JWQ B;  3QDN A;  3DIE A;  3IHQ A;  3TJK A;  1GSF A;  1B48 A;  1LJR A;  5EY6 A;  1OVN A;  3QAG A;  1O73 A;  4PQ1 A;  4NV2 A;  3H4K A;  1XWK A;  2B3S A;  3FZA A;  1AUC A;  2LS5 A;  4MAB A;  4EDY A;  1T3B A;  2IFQ B;  5JWR B;  1X5E A;  3KD0 A;  2KUC A;  3GKK A;  1U6T A;  1JFU A;  4CW9 A;  3WT2 A;  1OC3 A;  3EE2 A;  3GUS A;  2GZZ A;  4JE1 A;  3M1G A;  4KH7 A;  2B5E A;  5GAN D;  5JWO B;  3EC3 A;  4ZB9 A;  3IR4 A;  1R4W A;  3HVX A;  3TOU A;  2VL9 A;  1ZCP A;  2CVD A;  1F6M C;  3JCM L;  2C80 A;  2GQK A;  2XHF A;  4V1A p;  1J08 A;  1E2Y A;  5FT3 A;  3I9V 2;  3M8N A;  2H1A A;  4ZBA A;  1IYI A;  2AHE A;  4IP6 A;  3KH9 A;  4EL1 A;  2YN1 A;  1SEN A;  2VL2 C;  1OKT A;  1GSY A;  3ZZX A;  3HA9 A;  2REM A;  5HQP A;  4XRA A;  3UL3 A;  2FWF A;  4D73 A;  1JZO A;  5HFI A;  3GL5 A;  3QD9 A;  4IQA A;  2HRN A;  5INY A;  4DSR A;  2MMO A;  4K6X A;  3ZIT A;  1MEK A;  2HZE B;  4KDU A;  2DSA A;  6GSY A;  3ZIV A;  3LGC A;  4ZL8 A;  2HLS A;  2RM6 A;  3E0U A;  2L4Q A;  2FLS A;  1TK5 B;  4HU7 A;  3GHA A;  1CQH A;  4BWS A;  2I81 A;  4HZ4 A;  2R37 A;  1TOF A;  1KNG A;  1A8Y A;  2MMZ A;  1GLQ A;  4NHW A;  1M0U A;  4RQR A;  2L6C A;  1B9X C;  2H76 A;  4GRF A;  2H30 A;  5IMD A;  4ECI A;  3VLN A;  4ZBB A;  5J9C A;  2J23 A;  5G31 A;  1PSQ A;  1JZW A;  4J57 E;  3S9F A;  4RUV A;  2MMA A;  4Q5Q A;  1XIY A;  1NM3 A;  4BL7 A;  1GRX A;  3LSZ A;  3D0Z A;  2PWJ A;  1ACV A;  4I2T A;  4IP1 A;  4V1A g;  1QXH A;  1EV4 A;  2ON5 A;  3H93 A;  3E3E A;  3FR3 A;  3UBL A;  4GCI A;  2L59 A;  4BA7 A;  1XWC A;  4JBB A;  1JZR A;  2OE3 A;  4K7N A;  1WWJ A;  2M46 A;  4GST A;  5HR0 A;  2YWN A;  4OFN A;  3VWX A;  3GH9 A;  3ERF A;  1SYR A;  2O8V B;  1GH2 A;  2A2S A;  2QKE A;  3ZL5 A;  2FWH A;  1FAA A;  2DLX A;  2VL2 A;  2GSR A;  3QMX A;  4WEY A;  2WB9 A;  2DC5 A;  1EP7 A;  5COH A;  1TXX A;  3ISO A;  1K0C A;  3ZMK A;  4Q5F A;  2HT9 A;  2FY6 A;  4LL1 B;  4MZW A;  2GLR A;  5D93 A;  1PL1 A;  2ZUP A;  4HDE A;  5DAL B;  5GSS A;  4AJ6 A;  5DCH A;  3IPZ A;  4ZBD A;  17GS A;  3LG6 A;  5KEJ A;  2GST A;  3IC4 A;  2JZR A;  1ST9 A;  3FY7 A;  4FYU A;  1Q98 A;  2TIR A;  1PL2 A;  1B4P A;  3QFA C;  2LJA A;  2R3X A;  2BJX A;  5ECP B;  2IMD A;  1EOH A;  1WE0 A;  5HFK A;  3UVH A;  5ECQ B;  1B8X A;  1UC7 A;  3UMA A;  1XWG A;  5A4V A;  5CAX A;  2GT6 A;  3DRN A;  1Y6E A;  3KH7 A;  2GSS A;  4LA1 A;  4ULX A;  2VLV A;  3LYP A;  1GUL A;  2FA8 A;  3WGD A;  1QUW A;  4KW6 A;  2N5F A;  3APS A;  1PN9 A;  5H5R A;  2DJ3 A;  4PNF A;  1QFN A;  2YWM A;  2QC7 A;  4QL9 A;  2B1K A;  2GZY A;  1EEJ A;  3VWW A;  1M2A A;  1BJX A;  4MZC A;  1OAZ A;  4DSS A;  1I5G A;  1GTA A;  1BQ7 A;  2FCH A;  2FUG 2;  3TGZ A;  2WS2 A;  1SJZ A;  2LJK A;  3KEB A;  3M9J A;  3H79 A;  4POB A;  3HD5 A;  2WFC A;  2KOK A;  1USB A;  3WGE A;  4K1F A;  4K0N A;  3DWV A;  4PNG A;  4K2D A;  3W8J A;  2I9H A;  3IE3 A;  2MBT A;  5DAK A;  2LNS A;  5ID2 A;  5CRD A;  4MP4 A;  4F9Z A;  4NV5 A;  1DE1 A;  5H5Q A;  4KDX A;  2R4V A;  3EUR A;  2C4J A;  6GSV A;  3FZ9 A;  4MPG A;  4ZIJ A;  1MDJ A;  3HHV A;  4YAP A;  1XOA A;  7GSS A;  1G7E A;  5DVB A;  3NIV A;  5J5N A;  1A0F A;  3LJR A;  1XW9 A;  2CX4 A;  2TRC P;  2JZT A;  4ID0 A;  4FO5 A;  2H75 A;  3HJM A;  3I6A A;  3APO A;  3IA1 A;  3L9V A;  1VF2 A;  3IV4 A;  3ZTL A;  2H1D A;  1VRS D;  1YJ6 A;  4V2M A;  3FK8 A;  1EP8 A;  5B6M A;  5G1K A;  3GH6 A;  3GRX A;  2V1M A;  2C0F A;  1EGR A;  3GTU B;  5B6N A;  1K3L A;  2AV4 A;  2GQL A;  4ECC A;  3C71 A;  1ERT A;  1B9Y C;  4GQF A;  5G5F A;  1TK0 B;  2VIM A;  1V40 A;  2JL4 A;  2BTO T;  4PX1 A;  2K8S A;  1YDK A;  4CDO A;  4HJ2 A;  5IMC A;  3BCI A;  2IJY A;  2A4V A;  1ZOF A;  1TU7 A;  2FNO A;  2LQO A;  3VI7 A;  4L0U A;  18GS A;  1M7T A;  4TRX A;  2P5Q A;  4XCS A;  1ERU A;  2WRT A;  1WPI A;  3HVV A;  2WGR A;  2NPB A;  2JZS A;  4OO5 A;  1QGV A;  4JED A;  4N30 A;  2YZU A;  3F63 A;  3EMX A;  5HFG A;  2DBC A;  4ZL7 A;  1SKS B;  5D9V A;  3DGQ A;  2R2J A;  2D2Z A;  1PGT A;  1A23 A;  5KN2 A;  3DML A;  1UN2 A;  4WF5 A;  4IN0 A;  1T4Y A;  2LQQ A;  2YJ7 A;  5J3R A;  3FZ5 A;  1K0M A;  3F6D A;  3TJJ A;  4NPB A;  14GS A;  4KX4 A;  1U88 A;  3US3 A;  5G5E A;  2MYG A;  4MA9 A;  4NMU A;  1M9A A;  1X0R A;  2GTU A;  1YZX A;  4GXZ A;  3DYR A;  3VFI A;  4IQ1 A;  4OWY A;  2X64 A;  3F0I A;  3UIW A;  5IO2 A;  2H72 A;  3OR5 A;  3GIX A;  19GS A;  1SK1 A;  3N5O A;  2KHP A;  5D9W A;  2DIZ A;  2ON7 A;  3LQ7 A;  1BED A;  1GTU A;  1QQ2 A;  4E8H A;  4ZB8 A;  3HXS A;  4QQ7 A;  2X8C A;  2YCD A;  1SK2 A;  1FB0 A;  3KM6 A;  4IS0 A;  3DVX A;  4WET A;  3TOT A;  1Z7P A;  5ELA A;  4EF0 A;  1V2A A;  3GKM A;  3R2Q A;  5FHI A;  1VF3 A;  4TR1 B;  3G7I A;  4O7H A;  4K7O A;  1SJI A;  4TW5 A;  1ON4 A;  3UAR A;  3RPN A;  1S3C A;  2VCZ A;  1PX6 A;  2L6D A;  3CBU A;  1U87 A;  4BWQ A;  3ED3 A;  5LCZ A;  3N9J A;  2B5Y A;  4G2E A;  3CTG A;  2WZ9 A;  2I1U A;  2AB6 A;  2P31 A;  3P90 A;  5KN1 A;  2IPA A;  3FW2 A;  12GS A;  1YF1 A;  1XPV A;  1ZYQ B;  3O6T A;  3MDK A;  2L5O A;  4EKZ A;  1SKR B;  4MH2 A;  1GWC A;  10GS A;  1U3I A;  4XS1 A;  5G1L A;  5CYY A;  1YQ1 A;  1K3O A;  1RK4 A;  2YNX A;  3TUE A;  2DJ2 A;  1S3A A;  2K9F A;  4WBJ A;  3ZRD A;  1V98 A;  3IXR A;  2LRT A;  2OAC A;  4OFM A;  3L9U A;  2F8F A;  4MLY A;  3A2X A;  5IMV A;  1G6Y A;  2XPD A;  2MMN A;  3O76 A;  4GTU A;  1YKC A;  1OC8 A;  20GS A;  1XFL A;  1XZO A;  1TU8 A;  3GX8 A;  2OJL A;  1F37 A;  5F05 A;  4MF7 A;  2GDR A;  4QL7 A;  1ILO A;  3FR9 A;  1KEB A;  1BYE A;  2PUK C;  5G2Z A;  1A24 A;  2VO4 A;  1IYH A;  4N0Z A;  4HJM A;  5HR3 A;  4BPY A;  2H01 A;  4XS4 A;  3FRC A;  1NSW A;  2PN8 A;  1MDI A;  4YQM A;  1SD8 A;  4POK A;  1NHO A;  2MBS A;  1XBS A;  5DQY A;  2LTK A;  3FR6 A;  3KP9 A;  5IOW A;  3CSH A;  3HDC A;  4TKY A;  3UOM A;  3TB2 A;  3TJB A;  3CSJ A;  5EVO A;  3HKR A;  1OE7 A;  4KAE A;  1YF0 A;  3DKS A;  4O92 A;  2ZCT A;  5J41 A;  3QPM A;  1EV9 A;  4I97 A;  3IAM 2;  3VUR A;  1ZL9 A;  3CTF A;  1YEP A;  2RLI A;  3HZ8 A;  1HD2 A;  2AUV A;  1PQN A;  2AJQ B;  5ECH B;  4WR4 A;  4YQV A;  4HQZ A;  5ECI B;  1X9S B;  3G7J A;  4TXO A;  4YQU A;  4IKH A;  5JCW A;  3ZVJ D;  2OE1 A;  2EIQ A;  1SD9 A;  2PVO C;  3TRX A;  3A3T A;  3K8N A;  1BG5 A;  2H6X A;  3Q6O A;  4HEA 2;  4MJE A;  2H1G A;  3KMO A;  1I9D A;  4YAV A;  1ERV A;  1XCC A;  3RAZ A;  3IRA A;  1THO A;  2GVP A;  3F4R A;  4HQS A;  1K3Y A;  1HNA A;  3LXT A;  1XVW A;  4ISD A;  2O7K A;  1ZZY A;  2LJR A;  4OFT A;  4I6X A;  4GSS A;  2KLX A;  4XTS A;  3TRP A;  1DSB A;  2G0F A;  4JR6 A;  2R5G A;  4D73 B;  1U3A A;  3BJ5 A;  4TVE A;  5J4U A;  3DXB A;  2VLU A;  1GSQ A;  3IAS 2;  4IEL A;  1H75 A;  1O7U A;  3KCM A;  4WBR D;  3ZLP A;  2FA4 A;  1ZGN A;  2V6O A;  1AIU A;  4OO4 A;  1KTE A;  2M80 A;  4ECB A;  4XHM A;  5HR1 A;  3TKS C;  3KZQ A;  3QR6 A;  3EWL A;  4EXJ A;  3P2A A;  2ZNM A;  3J7Y b;  3J7Y k;  1TRV A;  4PUR A;  4F0B A;  4F0C A;  4TR0 A;  5HR2 A;  1DE2 A;  2NTO A;  4BVY A;  4KSO A;  4L5L A;  2B6M A;  1G7O A;  1K0N A;  5DJM A;  3LEF A;  3G7Y A;  1GLP A;  3TJG A;  4TOP A;  5ECK B;  1WIK A;  3SWL A;  3MSZ A;  4ZIL A; 
#chains in the Genus database with same CATH topology
 1XWA A;  2C3N A;  3CMI A;  1A8L A;  2C8U A;  2BMX A;  1TK8 B;  4K8M A;  2CT6 A;  2CZ3 A;  2IMF A;  5CNW A;  3F8U A;  5JCU A;  1JHB A;  2XBI A;  1R26 A;  3TRQ A;  1GSS A;  4MJC A;  4HZ2 A;  2E2M A;  11GS A;  2VM1 A;  1F3B A;  1ERW A;  3G9B A;  2G2Q A;  4TN8 A;  4O5U A;  3GKN A;  1ZYN A;  2N5B A;  5L71 A;  2EIO A;  4MF5 A;  2L57 A;  4BVX A;  5ENU A;  4ZL9 A;  4ECJ A;  1OYJ A;  3ERW A;  4J56 E;  1O6J A;  1T4Z A;  1Z6M A;  1A2L A;  2V6K A;  2OE0 A;  1OC9 A;  5H5S A;  4EUY A;  2PMT A;  1EZK A;  5ECN B;  3APQ A;  5D73 A;  4O5R A;  1TRW A;  4I5Q A;  1E6B A;  3D22 A;  2QSI A;  3ME7 A;  3RPP A;  2F9S A;  2LKU A;  2IWT A;  3GKX A;  4HUA A;  2YWO A;  4MPF A;  4KCA A;  1FVK A;  1ABA A;  3IK7 A;  3M0F A;  5DBQ A;  1J0F A;  2VCV A;  5LNK e;  1X5D A;  2H66 A;  4EIP A;  4MCU A;  4KB3 A;  1T8E B;  3F6F A;  3TKS A;  5AIV A;  3MNG A;  3F3Q A;  1V9W A;  5AN1 A;  2VCT A;  2JAC A;  2WDU A;  4LMV A;  2VLT A;  1Z3E A;  5ELG A;  5E4W A;  4MDC A;  1TDI A;  2CAI A;  5B7C A;  2Z9S A;  2YV9 A;  1ZMA A;  1M2D A;  2GS3 A;  2CVB A;  5F8B A;  5C00 A;  5KN0 A;  5DJL A;  1XG8 A;  5CRH A;  2C0G A;  1A2M A;  3C7M A;  5IM9 A;  2J9H A;  1GUH A;  3H1N A;  4EO3 A;  22GS A;  1G6W A;  2JSY A;  5GAP D;  4KUN A;  1SJ6 A;  4JR4 A;  1SKW B;  3ME8 A;  2HFD A;  2YWI A;  4X1U A;  2CX3 A;  4EC0 A;  4N11 A;  3ZIJ A;  1QMV A;  2PER A;  2YV7 A;  1VF4 A;  4K5S A;  3W6G A;  2IFQ A;  4MH3 A;  2H6Y A;  3C8E A;  2DJK A;  4DSQ A;  1W89 A;  4K0G A;  5AIS A;  3KP8 A;  3NOF A;  1HNB A;  1FOV A;  3D21 A;  1F3A A;  5D9T A;  4HI7 A;  2F3M A;  5CRW A;  3F9U A;  5GZZ B;  4GWR A;  2VD0 A;  3KIJ A;  3BCK A;  1S3D A;  4DSS B;  1T7P B;  3LW9 A;  3TKS E;  1VF1 A;  4V2L A;  2GZP A;  3GNJ A;  3BD2 A;  2DJ0 A;  3L4N A;  2HSH A;  4PGT A;  2GSQ A;  2HRF A;  2OAD A;  2XC2 A;  5CP1 A;  3TKR A;  1JLW A;  5DAK B;  5ID2 B;  3TKP A;  3KTL A;  3CYN A;  1M2B A;  3WD6 A;  3BBY A;  4IVF A;  2WUL A;  4A5P A;  3CRT A;  1M3J A;  1NHY A;  1NW2 A;  1GL8 A;  4MMM A;  2C0E A;  5GST A;  1PD2 1;  3HVS A;  4KE3 A;  2LRC A;  2FHE A;  1YEX A;  4FYB A;  4MK3 A;  2O89 A;  3UVT A;  4PXO A;  4F03 A;  4GLT A;  4GQC A;  2EIR A;  3TCO A;  3PIN A;  1O81 A;  2RII A;  3SBC A;  4O5Q A;  3WYW A;  1EOG A;  1JZD A;  2NVL A;  4HSC X;  4PQH A;  4V2N A;  1WRY A;  4X0X A;  2PVQ A;  2X8H A;  2FD3 A;  4Z2R A;  2HZE A;  4BIK A;  3EU4 A;  1TTZ A;  2LNT A;  2QGV A;  4KDY A;  3ERG A;  4EVM A;  4OCE A;  2VOC A;  4WKW A;  2IME A;  2HE3 A;  2K8V A;  2H19 A;  3PR8 A;  1N8J A;  4NAX A;  2YPM A;  2PU9 C;  3IBH A;  2JU5 A;  3F3R A;  2B7K A;  1BAY A;  2IMI A;  1TI1 A;  4IJI A;  5CO3 A;  3L0H A;  3GUR A;  3EYT A;  2C3Q A;  1A0R P;  3AY8 A;  3KTB A;  3D5J A;  1X9W B;  2IN3 A;  4USS A;  3IK9 A;  1W4V A;  4F2I A;  1SL1 B;  5C04 A;  2H73 A;  13GS A;  2V2G A;  4JZQ A;  4KND A;  1CQG A;  1KBN A;  2DJ1 A;  2K6V A;  1V58 A;  3L78 A;  2VCX A;  2CAQ A;  1Z9H A;  2KP2 A;  4E8E A;  2NBS A;  3EPT A;  1BX9 A;  3M9K A;  2HYX A;  4WXT A;  3LYK A;  5EPF A;  5AGY A;  1N2A A;  5F07 A;  3F4T A;  1M9B A;  2MZC A;  1GUM A;  2WJU A;  4XIH A;  1TW9 A;  5CRE A;  3Q18 A;  1EWX A;  2OBI A;  2I3Y A;  1X5C A;  5ECM B;  3P7X A;  3KXO A;  3UJ1 A;  3GSS A;  1GSE A;  1T00 A;  4RI7 A;  1FG4 A;  5AIX A;  1MDK A;  3Q19 A;  3GL3 A;  2VCQ A;  5DAL A;  2IMK A;  1JLV A;  4G19 A;  4I8B A;  2E0Q A;  4CY6 A;  1XWB A;  3FYG A;  1TP9 A;  1C72 A;  4OMV A;  1OE8 A;  1UA5 A;  1Z7R A;  5A4W A;  2N5A A;  2CV4 A;  1Z5Y E;  2CQ9 A;  1K0A A;  2CZ2 A;  3CRU A;  1GNE A;  4Z2U A;  2L4C A;  2HXK A;  4KSM A;  1ML6 A;  4XRD A;  4FQU A;  3WGX A;  2H74 A;  1YKA A;  3ZVJ A;  3D4M A;  1GTI A;  4ML6 A;  2O87 A;  6GSX A;  1FB6 A;  4FIW A;  2VM2 A;  3DD3 A;  3RHC A;  1R5A A;  4G0K A;  2GQM A;  1THX A;  4ML1 A;  3VPQ A;  2YOI A;  3VPT A;  2PBJ A;  4K7I A;  2FGX A;  4YH2 A;  2LRN A;  2KP1 A;  3FKF A;  3CSI A;  3PGT A;  4KA0 A;  2I4A A;  1AQW A;  5A4U A;  4NXI A;  1FVJ A;  3BOA A;  5ECO B;  5B8A A;  1ZYE A;  5EL8 A;  3IDV A;  5G30 A;  4PQI A;  1AXD A;  4JU5 A;  4POM A;  4IGJ A;  2H0I A;  1GSD A;  3QOU A;  4OD7 A;  1WP0 A;  3U6V A;  2C3T A;  4WR5 A;  4LL4 B;  2AAW A;  5ABR A;  2QA2 A;  2B1L A;  2VCW A;  3WT1 A;  3P8W A;  1WOU A;  3HYP A;  4CHS A;  2H6Z A;  3L9S A;  4RQX A;  4RI6 A;  5J9B A;  1LU4 A;  4IHU A;  2RUF A;  1GTB A;  1F9M A;  2HZF A;  2EC4 A;  3LFL A;  1WJK A;  1TRU A;  3H8Q A;  2A2R A;  4PTS A;  3VWU A;  4L8E A;  2OBK A;  3VWV A;  4Q5N A;  2L5L A;  1S3R A;  1AAZ A;  2PPT A;  3FEU A;  1PX7 A;  4ILF A;  4G0I A;  4AF2 A;  1PA3 A;  4FYC A;  1EEM A;  3DVW A;  4HOJ A;  4L5O A;  2ES7 A;  4IBP A;  1ZYP A;  4LMW A;  5IO0 A;  4DVC A;  1GUK A;  3DEX A;  3W8S A;  4XS4 B;  5D96 A;  2HI7 A;  2V41 A;  3A2W A;  4X4J A;  1V57 A;  3LWA A;  8GSS A;  1F2E A;  4P3Y B;  2C0D A;  2RM5 A;  2TRX A;  1MD4 A;  1FO5 A;  1TRS A;  4G9H A;  3GTU A;  1MD3 A;  3TKQ A;  4OCF A;  1YY7 A;  1HQO A;  3RDW A;  2C1Y A;  3NZN A;  5BMU A;  2IL3 A;  1PKW A;  1TI3 A;  4K9Z A;  4G10 A;  3RBT A;  1HYU A;  4NHZ A;  3EVI A;  3GYK A;  2DJJ A;  4FH8 A;  3KGK A;  1MTC A;  4HU9 A;  2V32 A;  3QAW A;  4MJA A;  4NWY A;  3UBK A;  4Z7X A;  2WCI A;  2JAD A;  3M3M A;  2FWE A;  5ECS A;  6GSS A;  5E59 A;  1SU9 A;  2YZH A;  1SL2 B;  3TJF A;  4EDZ A;  1TJD A;  4TR3 A;  1T1V A;  3D6I A;  4ACS A;  1LBK A;  4X43 A;  4TXO B;  3MWH A;  1DUG A;  3EIN A;  2XBQ A;  2RUE A;  5BRT A;  3LXZ A;  3HJP A;  2P5R A;  1XVQ A;  1SK0 A;  5IPG A;  5IMZ A;  2H8L A;  2DMM A;  2X8G A;  2H71 A;  3U5R E;  3A2V A;  3F4S A;  1AW9 A;  3HY2 A;  3FHK A;  4JRR A;  4J2F A;  4AJ8 A;  5LD0 A;  3VI5 A;  2DML A;  4WF4 A;  3I43 A;  2H0H A;  3Q74 A;  2P0G A;  2R6K A;  2FWG A;  3LOR A;  3HJO A;  3KJY A;  6GSW A;  5KN3 A;  5DQS A;  2R0P A;  3ZFL A;  1K0B A;  2F8A A;  4Z2T A;  1WMJ A;  4ZB6 A;  1PMT A;  1TKD B;  1Z6N A;  4XS6 A;  3CXG A;  5D9X A;  2E2G A;  1DBY A;  1PRX A;  4I2U A;  1A2J A;  1B4Q A;  3QFB C;  4AGS A;  6GST A;  2LUS A;  2OA7 A;  2B5X A;  5ECR B;  3VK9 A;  3HZ4 A;  1AQV A;  4TXV A;  3V1W A;  2DIY A;  2VL3 A;  2LV3 A;  2GGT A;  3GMF A;  3EU3 A;  2AYT A;  3D4T A;  6GSU A;  3GFK A;  2CVK A;  4PUA A;  3GV1 A;  4PUF C;  2H0G A;  4TR1 A;  2PGT A;  1K0O A;  1VGL A;  4ZXG A;  1RQM A;  2LST A;  1H4O A;  1Y25 A;  2YJH A;  5IOX A;  4KCE A;  3MIX A;  4AJ7 A;  4BVY B;  4MZB A;  2VAF A;  2IIY A;  4EE0 A;  4IW9 A;  3UAP A;  5IMF A;  1Q4J A;  2XPE A;  5D8I A;  2NDO A;  2B7J A;  4HS1 A;  2X99 A;  3C73 A;  5F06 A;  1R5P A;  1EGO A;  2CA8 A;  5IMA A;  1UVZ A;  1AQX A;  3GX0 A;  3MAK A;  1GNW A;  5IQY A;  1SL0 B;  1XXU A;  3GN3 A;  1XOB A;  4MJB A;  3C1R A;  2GT5 A;  3GST A;  2E7P A;  2HNL A;  4Q5R A;  5A5K A;  1O85 A;  5ECL B;  2R0G A;  1FHE A;  4GSN A;  1URM A;  2O85 A;  4LLR A;  3E9J B;  5IPH A;  1FW1 A;  3FZ4 A;  3ZML A;  4O32 A;  3ZFB A;  2VUP A;  3CQF A;  2OKA A;  4DEJ A;  1X9M B;  2ALB A;  5B8B A;  3IC8 A;  5DDL A;  3ZYW A;  1K0D A;  3UEM A;  4BVX B;  3A5W A;  3EMP A;  1M99 A;  2JSZ A;  4TR4 A;  1AC1 A;  3I69 A;  4N0V A;  1HNC A;  1XW6 A;  3PH9 A;  5F0G A;  5FWG A;  1G0T A;  1GSU A;  1XW5 A;  2H70 A;  1OC9 B;  3O3T A;  2M72 A;  3C1S A;  2K18 A;  1O8W A;  3ZRE A;  4N10 A;  5DCG A;  3QAV A;  4GF0 A;  2YAN A;  2H1B A;  2HSY A;  3HCZ A;  5CRG A;  4KGI A;  1RW1 A;  3TDG A;  3KMN A;  4IJ3 A;  5JCG A;  1SYX A;  2LEG A;  2VD1 A;  9GSS A;  4L0W A;  1OKD A;  4F82 A;  4H86 A;  3IOS A;  3QCP A;  1O8X A;  3RHB A;  1PKZ A;  1R7H A;  2DKH A;  4POL A;  2YP6 A;  3GA4 A;  5IIZ A;  1J9B A;  4MF6 A;  1QK8 A;  2F51 A;  16GS A;  1GP1 A;  5JWQ B;  3QDN A;  3DIE A;  3IHQ A;  3TJK A;  1GSF A;  1B48 A;  1LJR A;  5EY6 A;  1OVN A;  3QAG A;  4CY8 A;  1O73 A;  4PQ1 A;  4NV2 A;  3H4K A;  1XWK A;  2B3S A;  4K5R A;  3FZA A;  1AUC A;  2LS5 A;  4MAB A;  4EDY A;  1T3B A;  2IFQ B;  5JWR B;  1X5E A;  3KD0 A;  2KUC A;  3GKK A;  1U6T A;  1JFU A;  4CW9 A;  3WT2 A;  1OC3 A;  3EE2 A;  3GUS A;  2GZZ A;  4JE1 A;  3M1G A;  4KH7 A;  2B5E A;  5GAN D;  5JWO B;  3EC3 A;  4ZB9 A;  3IR4 A;  1R4W A;  3HVX A;  3TOU A;  2VL9 A;  1ZCP A;  2CVD A;  1F6M C;  3JCM L;  2C80 A;  2GQK A;  2XHF A;  4V1A p;  1J08 A;  1E2Y A;  5FT3 A;  3I9V 2;  4MNN A;  3M8N A;  2H1A A;  4ZBA A;  1IYI A;  2AHE A;  4IP6 A;  3KH9 A;  4EL1 A;  2YN1 A;  1SEN A;  2VL2 C;  1OKT A;  1GSY A;  3ZZX A;  3MYD A;  3HA9 A;  2REM A;  5HQP A;  4XRA A;  3UL3 A;  2FWF A;  4D73 A;  1JZO A;  5HFI A;  4K2X A;  3GL5 A;  3QD9 A;  4IQA A;  2HRN A;  5INY A;  4DSR A;  2MMO A;  4K6X A;  3ZIT A;  1MEK A;  2HZE B;  4KDU A;  2DSA A;  6GSY A;  3ZIV A;  3LGC A;  4ZL8 A;  2HLS A;  2RM6 A;  3E0U A;  2L4Q A;  2FLS A;  1TK5 B;  4HU7 A;  3GHA A;  1CQH A;  4BWS A;  2I81 A;  4HZ4 A;  2R37 A;  1TOF A;  1PN0 A;  1KNG A;  1A8Y A;  2MMZ A;  1GLQ A;  4NHW A;  1M0U A;  4RQR A;  2L6C A;  1B9X C;  2H76 A;  4GRF A;  2H30 A;  5IMD A;  4ECI A;  3VLN A;  4ZBB A;  5J9C A;  2J23 A;  5G31 A;  1PSQ A;  1JZW A;  4J57 E;  3S9F A;  4RUV A;  2MMA A;  4Q5Q A;  1XIY A;  1NM3 A;  4BL7 A;  1GRX A;  3LSZ A;  3D0Z A;  2PWJ A;  1ACV A;  4I2T A;  4IP1 A;  4V1A g;  1QXH A;  1EV4 A;  2ON5 A;  3H93 A;  3E3E A;  3FR3 A;  3UBL A;  4GCI A;  2L59 A;  4BA7 A;  1XWC A;  4JBB A;  2A4H A;  1JZR A;  2OE3 A;  4K7N A;  1WWJ A;  2M46 A;  4GST A;  5HR0 A;  2YWN A;  4OFN A;  3VWX A;  3GH9 A;  3ERF A;  1SYR A;  2O8V B;  1GH2 A;  2A2S A;  2QKE A;  3ZL5 A;  2FWH A;  1FAA A;  2DLX A;  2VL2 A;  2GSR A;  2A2P A;  3QMX A;  4WEY A;  2WB9 A;  2DC5 A;  1EP7 A;  5COH A;  1TXX A;  3ISO A;  1K0C A;  3ZMK A;  4Q5F A;  2HT9 A;  2FY6 A;  4LL1 B;  4MZW A;  2GLR A;  5D93 A;  1PL1 A;  2ZUP A;  4HDE A;  5DAL B;  5GSS A;  4AJ6 A;  5DCH A;  3IPZ A;  4ZBD A;  17GS A;  3LG6 A;  5KEJ A;  2GST A;  3IC4 A;  2JZR A;  1FOH A;  1ST9 A;  4YKF A;  3FY7 A;  4FYU A;  1Q98 A;  2TIR A;  1PL2 A;  1B4P A;  3QFA C;  2LJA A;  2R3X A;  2BJX A;  5ECP B;  2IMD A;  1EOH A;  1WE0 A;  5HFK A;  3UVH A;  5ECQ B;  1B8X A;  1UC7 A;  3UMA A;  1XWG A;  5A4V A;  5CAX A;  2GT6 A;  3DRN A;  1Y6E A;  3KH7 A;  2GSS A;  4LA1 A;  4ULX A;  2VLV A;  3LYP A;  1GUL A;  2FA8 A;  3WGD A;  1QUW A;  4KW6 A;  2N5F A;  3APS A;  1PN9 A;  5H5R A;  2DJ3 A;  4PNF A;  1QFN A;  2YWM A;  2QC7 A;  4QL9 A;  2B1K A;  2GZY A;  1EEJ A;  3VWW A;  1M2A A;  3A5I A;  1BJX A;  4MZC A;  1OAZ A;  4DSS A;  1I5G A;  1GTA A;  1BQ7 A;  2FCH A;  2FUG 2;  3TGZ A;  2WS2 A;  1SJZ A;  2LJK A;  3KEB A;  3M9J A;  3H79 A;  4POB A;  3HD5 A;  2WFC A;  2KOK A;  1USB A;  3WGE A;  4K1F A;  4K0N A;  3DWV A;  4PNG A;  4K2D A;  3W8J A;  2I9H A;  3IE3 A;  2MBT A;  5DAK A;  2LNS A;  5ID2 A;  5CRD A;  4MP4 A;  4F9Z A;  4NV5 A;  1DE1 A;  5H5Q A;  4KDX A;  2R4V A;  3EUR A;  2C4J A;  6GSV A;  3FZ9 A;  4MPG A;  4ZIJ A;  1MDJ A;  3HHV A;  4YAP A;  1XOA A;  7GSS A;  1G7E A;  5DVB A;  3NIV A;  5J5N A;  1A0F A;  3LJR A;  1XW9 A;  2CX4 A;  2TRC P;  2JZT A;  5KOX A;  3FMW A;  4ID0 A;  4FO5 A;  2H75 A;  3HJM A;  3I6A A;  3APO A;  3IA1 A;  3L9V A;  1VF2 A;  3IV4 A;  3ZTL A;  2H1D A;  1VRS D;  1YJ6 A;  4V2M A;  3FK8 A;  1EP8 A;  5B6M A;  5G1K A;  3GH6 A;  3GRX A;  2V1M A;  2C0F A;  1EGR A;  3GTU B;  5B6N A;  1K3L A;  2AV4 A;  2GQL A;  4ECC A;  3C71 A;  1ERT A;  1B9Y C;  4GQF A;  5G5F A;  1TK0 B;  2VIM A;  1V40 A;  2JL4 A;  2BTO T;  4PX1 A;  2K8S A;  1YDK A;  4CDO A;  4HJ2 A;  5IMC A;  3BCI A;  2IJY A;  2A4V A;  1ZOF A;  1TU7 A;  2FNO A;  2LQO A;  3VI7 A;  4L0U A;  18GS A;  2UZ8 A;  1M7T A;  4TRX A;  2P5Q A;  4XCS A;  1ERU A;  2WRT A;  1WPI A;  3HVV A;  2WGR A;  2NPB A;  2JZS A;  4OO5 A;  1QGV A;  4JED A;  4N30 A;  2YZU A;  3F63 A;  3EMX A;  5HFG A;  2DBC A;  4ZL7 A;  1SKS B;  5D9V A;  3DGQ A;  2R2J A;  2D2Z A;  1PGT A;  1A23 A;  5KN2 A;  3DML A;  1UN2 A;  4WF5 A;  4IN0 A;  1T4Y A;  2LQQ A;  2YJ7 A;  2HRA A;  5J3R A;  3FZ5 A;  1K0M A;  3F6D A;  3TJJ A;  4NPB A;  14GS A;  4KX4 A;  1U88 A;  3US3 A;  5G5E A;  2MYG A;  4MA9 A;  4NMU A;  1M9A A;  1X0R A;  2GTU A;  1YZX A;  4GXZ A;  3DYR A;  3VFI A;  4G0L A;  4IQ1 A;  4OWY A;  2X64 A;  3F0I A;  3UIW A;  5IO2 A;  2H72 A;  3OR5 A;  3GIX A;  19GS A;  1SK1 A;  3N5O A;  2KHP A;  5D9W A;  2DIZ A;  2ON7 A;  3LQ7 A;  1BED A;  1GTU A;  1QQ2 A;  4E8H A;  4ZB8 A;  2QA1 A;  3HXS A;  2HRK A;  4QQ7 A;  2X8C A;  2YCD A;  1SK2 A;  1FB0 A;  3KM6 A;  4IS0 A;  3DVX A;  4WET A;  3TOT A;  1Z7P A;  5ELA A;  4EF0 A;  1V2A A;  3GKM A;  3R2Q A;  5FHI A;  4YKG A;  1VF3 A;  4TR1 B;  3G7I A;  4O7H A;  4K7O A;  1SJI A;  4TW5 A;  1ON4 A;  3UAR A;  3RPN A;  1S3C A;  2VCZ A;  1PX6 A;  2L6D A;  3CBU A;  1U87 A;  4BWQ A;  3ED3 A;  5LCZ A;  3N9J A;  2B5Y A;  4G2E A;  3CTG A;  3PPU A;  2WZ9 A;  2I1U A;  2AB6 A;  2P31 A;  3P90 A;  5KN1 A;  2IPA A;  3FW2 A;  12GS A;  1YF1 A;  1XPV A;  1ZYQ B;  3O6T A;  3MDK A;  2DKI A;  2L5O A;  4EKZ A;  1SKR B;  4MH2 A;  1GWC A;  10GS A;  1U3I A;  4XS1 A;  5G1L A;  5CYY A;  4KF9 A;  1YQ1 A;  1K3O A;  1RK4 A;  2YNX A;  3IHG A;  3TUE A;  2DJ2 A;  1S3A A;  2K9F A;  4WBJ A;  3ZRD A;  1V98 A;  3IXR A;  2LRT A;  2OAC A;  4OFM A;  3L9U A;  2F8F A;  4MLY A;  3A2X A;  1M3I A;  5IMV A;  1G6Y A;  2XPD A;  2MMN A;  3O76 A;  4GTU A;  1YKC A;  1OC8 A;  20GS A;  1XFL A;  1XZO A;  1TU8 A;  3GX8 A;  2OJL A;  1F37 A;  5F05 A;  4MF7 A;  2GDR A;  4QL7 A;  1ILO A;  3FR9 A;  1KEB A;  1BYE A;  2PUK C;  5G2Z A;  1A24 A;  2VO4 A;  1IYH A;  1PFO A;  4N0Z A;  4HJM A;  5HR3 A;  4BPY A;  2H01 A;  4XS4 A;  3FRC A;  1NSW A;  2PN8 A;  1MDI A;  4YQM A;  1SD8 A;  3R3E A;  4POK A;  1NHO A;  2MBS A;  1XBS A;  5DQY A;  2LTK A;  3FR6 A;  3KP9 A;  5IOW A;  3CSH A;  3HDC A;  4TKY A;  3UOM A;  3TB2 A;  3TJB A;  3CSJ A;  5EVO A;  3HKR A;  1OE7 A;  4KAE A;  1YF0 A;  3DKS A;  4O92 A;  2ZCT A;  5J41 A;  3QPM A;  1EV9 A;  4I97 A;  3IAM 2;  3VUR A;  1ZL9 A;  3CTF A;  1YEP A;  2RLI A;  3HZ8 A;  4ICY A;  1HD2 A;  2AUV A;  1PQN A;  2AJQ B;  2R0C A;  5ECH B;  4WR4 A;  4YQV A;  4HQZ A;  5ECI B;  2X4A A;  1X9S B;  3G7J A;  4TXO A;  4YQU A;  4IKH A;  5JCW A;  3ZVJ D;  2OE1 A;  2EIQ A;  1SD9 A;  2PVO C;  3TRX A;  3A3T A;  3K8N A;  1BG5 A;  2H6X A;  3Q6O A;  4HEA 2;  4MJE A;  2H1G A;  3HVN A;  3KMO A;  1I9D A;  4YAV A;  1ERV A;  1XCC A;  3RAZ A;  3IRA A;  1THO A;  2GVP A;  3F4R A;  4HQS A;  2HSM A;  1K3Y A;  1HNA A;  3LXT A;  1XVW A;  4ISD A;  2O7K A;  1ZZY A;  2LJR A;  4OFT A;  4I6X A;  4GSS A;  2KLX A;  4XTS A;  3TRP A;  1DSB A;  2G0F A;  4JR6 A;  2R5G A;  4D73 B;  1U3A A;  3BJ5 A;  5KOW A;  4TVE A;  5J4U A;  3DXB A;  2VLU A;  1GSQ A;  3IAS 2;  4IEL A;  1H75 A;  1O7U A;  3KCM A;  4WBR D;  3ZLP A;  2FA4 A;  1ZGN A;  2V6O A;  1AIU A;  4OO4 A;  1KTE A;  2M80 A;  4ECB A;  4XHM A;  5HR1 A;  3TKS C;  3KZQ A;  3QR6 A;  3EWL A;  4EXJ A;  3P2A A;  2ZNM A;  3J7Y b;  3J7Y k;  1TRV A;  4PUR A;  4F0B A;  4F0C A;  4TR0 A;  5HR2 A;  1DE2 A;  2NTO A;  2X49 A;  4BVY A;  4KSO A;  4L5L A;  2B6M A;  1G7O A;  1K0N A;  5DJM A;  3LEF A;  3G7Y A;  1GLP A;  3TJG A;  4TOP A;  5ECK B;  1WIK A;  3SWL A;  3MSZ A;  4EIQ A;  4BL7 B;  4ZIL A; 
#chains in the Genus database with same CATH homology
 1XWA A;  2C3N A;  3CMI A;  1A8L A;  2C8U A;  2BMX A;  1TK8 B;  4K8M A;  2CT6 A;  2CZ3 A;  2IMF A;  5CNW A;  3F8U A;  5JCU A;  1JHB A;  2XBI A;  1R26 A;  3TRQ A;  1GSS A;  4MJC A;  4HZ2 A;  2E2M A;  11GS A;  2VM1 A;  1F3B A;  1ERW A;  3G9B A;  2G2Q A;  4TN8 A;  4O5U A;  3GKN A;  1ZYN A;  2N5B A;  5L71 A;  2EIO A;  4MF5 A;  2L57 A;  4BVX A;  5ENU A;  4ZL9 A;  4ECJ A;  1OYJ A;  3ERW A;  4J56 E;  1O6J A;  1T4Z A;  1Z6M A;  1A2L A;  2V6K A;  2OE0 A;  1OC9 A;  5H5S A;  4EUY A;  2PMT A;  1EZK A;  5ECN B;  3APQ A;  5D73 A;  4O5R A;  1TRW A;  4I5Q A;  1E6B A;  3D22 A;  2QSI A;  3ME7 A;  3RPP A;  2F9S A;  2LKU A;  2IWT A;  3GKX A;  4HUA A;  2YWO A;  4MPF A;  4KCA A;  1FVK A;  1ABA A;  3IK7 A;  3M0F A;  5DBQ A;  1J0F A;  2VCV A;  5LNK e;  1X5D A;  2H66 A;  4EIP A;  4MCU A;  4KB3 A;  1T8E B;  3F6F A;  3TKS A;  5AIV A;  3MNG A;  3F3Q A;  1V9W A;  5AN1 A;  2VCT A;  2JAC A;  2WDU A;  4LMV A;  2VLT A;  1Z3E A;  5ELG A;  5E4W A;  4MDC A;  1TDI A;  2CAI A;  5B7C A;  2Z9S A;  2YV9 A;  1ZMA A;  1M2D A;  2GS3 A;  2CVB A;  5F8B A;  5C00 A;  5KN0 A;  5DJL A;  5CRH A;  2C0G A;  1A2M A;  3C7M A;  5IM9 A;  2J9H A;  1GUH A;  3H1N A;  4EO3 A;  22GS A;  1G6W A;  2JSY A;  5GAP D;  4KUN A;  1SJ6 A;  4JR4 A;  1SKW B;  3ME8 A;  2HFD A;  2YWI A;  4X1U A;  2CX3 A;  4EC0 A;  4N11 A;  3ZIJ A;  1QMV A;  2PER A;  2YV7 A;  1VF4 A;  4K5S A;  3W6G A;  2IFQ A;  4MH3 A;  2H6Y A;  3C8E A;  2DJK A;  4DSQ A;  1W89 A;  4K0G A;  5AIS A;  3KP8 A;  3NOF A;  1HNB A;  1FOV A;  3D21 A;  1F3A A;  5D9T A;  4HI7 A;  2F3M A;  5CRW A;  3F9U A;  5GZZ B;  4GWR A;  2VD0 A;  3KIJ A;  3BCK A;  1S3D A;  4DSS B;  1T7P B;  3LW9 A;  3TKS E;  1VF1 A;  4V2L A;  2GZP A;  3GNJ A;  3BD2 A;  2DJ0 A;  3L4N A;  2HSH A;  4PGT A;  2GSQ A;  2HRF A;  2OAD A;  2XC2 A;  5CP1 A;  3TKR A;  1JLW A;  5DAK B;  5ID2 B;  3TKP A;  3KTL A;  3CYN A;  1M2B A;  3WD6 A;  3BBY A;  4IVF A;  2WUL A;  4A5P A;  3CRT A;  1NHY A;  1NW2 A;  1GL8 A;  4MMM A;  2C0E A;  5GST A;  1PD2 1;  3HVS A;  4KE3 A;  2LRC A;  2FHE A;  1YEX A;  4FYB A;  4MK3 A;  2O89 A;  3UVT A;  4PXO A;  4F03 A;  4GLT A;  4GQC A;  2EIR A;  3TCO A;  3PIN A;  1O81 A;  2RII A;  3SBC A;  4O5Q A;  3WYW A;  1EOG A;  1JZD A;  2NVL A;  4PQH A;  4V2N A;  1WRY A;  4X0X A;  2PVQ A;  2X8H A;  2FD3 A;  4Z2R A;  2HZE A;  3EU4 A;  1TTZ A;  2LNT A;  2QGV A;  4KDY A;  3ERG A;  4EVM A;  4OCE A;  2VOC A;  4WKW A;  2IME A;  2HE3 A;  2K8V A;  2H19 A;  3PR8 A;  1N8J A;  4NAX A;  2YPM A;  2PU9 C;  3IBH A;  2JU5 A;  3F3R A;  2B7K A;  1BAY A;  2IMI A;  1TI1 A;  4IJI A;  5CO3 A;  3L0H A;  3GUR A;  3EYT A;  2C3Q A;  1A0R P;  3AY8 A;  3KTB A;  3D5J A;  1X9W B;  2IN3 A;  4USS A;  3IK9 A;  1W4V A;  4F2I A;  1SL1 B;  5C04 A;  2H73 A;  13GS A;  2V2G A;  4JZQ A;  4KND A;  1CQG A;  1KBN A;  2DJ1 A;  2K6V A;  1V58 A;  3L78 A;  2VCX A;  2CAQ A;  1Z9H A;  2KP2 A;  4E8E A;  2NBS A;  3EPT A;  1BX9 A;  3M9K A;  2HYX A;  4WXT A;  3LYK A;  5EPF A;  5AGY A;  1N2A A;  5F07 A;  3F4T A;  1M9B A;  2MZC A;  1GUM A;  2WJU A;  4XIH A;  1TW9 A;  5CRE A;  3Q18 A;  1EWX A;  2OBI A;  2I3Y A;  1X5C A;  5ECM B;  3P7X A;  3KXO A;  3UJ1 A;  3GSS A;  1GSE A;  1T00 A;  4RI7 A;  1FG4 A;  5AIX A;  1MDK A;  3Q19 A;  3GL3 A;  2VCQ A;  5DAL A;  2IMK A;  1JLV A;  4G19 A;  4I8B A;  2E0Q A;  4CY6 A;  1XWB A;  3FYG A;  1TP9 A;  1C72 A;  4OMV A;  1OE8 A;  1UA5 A;  1Z7R A;  5A4W A;  2N5A A;  2CV4 A;  1Z5Y E;  2CQ9 A;  1K0A A;  2CZ2 A;  3CRU A;  1GNE A;  4Z2U A;  2L4C A;  2HXK A;  4KSM A;  1ML6 A;  4XRD A;  4FQU A;  3WGX A;  2H74 A;  1YKA A;  3ZVJ A;  3D4M A;  1GTI A;  4ML6 A;  2O87 A;  6GSX A;  1FB6 A;  4FIW A;  2VM2 A;  3DD3 A;  3RHC A;  1R5A A;  4G0K A;  2GQM A;  1THX A;  4ML1 A;  3VPQ A;  2YOI A;  3VPT A;  2PBJ A;  4K7I A;  2FGX A;  4YH2 A;  2LRN A;  2KP1 A;  3FKF A;  3CSI A;  3PGT A;  4KA0 A;  2I4A A;  1AQW A;  5A4U A;  4NXI A;  1FVJ A;  3BOA A;  5ECO B;  5B8A A;  1ZYE A;  5EL8 A;  3IDV A;  5G30 A;  4PQI A;  1AXD A;  4JU5 A;  4POM A;  4IGJ A;  2H0I A;  1GSD A;  3QOU A;  4OD7 A;  1WP0 A;  3U6V A;  2C3T A;  4WR5 A;  4LL4 B;  2AAW A;  5ABR A;  2QA2 A;  2B1L A;  2VCW A;  3WT1 A;  3P8W A;  1WOU A;  3HYP A;  4CHS A;  2H6Z A;  3L9S A;  4RQX A;  4RI6 A;  5J9B A;  1LU4 A;  4IHU A;  2RUF A;  1GTB A;  1F9M A;  2HZF A;  2EC4 A;  3LFL A;  1WJK A;  1TRU A;  3H8Q A;  2A2R A;  4PTS A;  3VWU A;  4L8E A;  2OBK A;  3VWV A;  4Q5N A;  2L5L A;  1AAZ A;  2PPT A;  3FEU A;  1PX7 A;  4ILF A;  4G0I A;  4AF2 A;  1PA3 A;  4FYC A;  1EEM A;  3DVW A;  4HOJ A;  4L5O A;  2ES7 A;  4IBP A;  1ZYP A;  4LMW A;  5IO0 A;  4DVC A;  1GUK A;  3DEX A;  3W8S A;  4XS4 B;  5D96 A;  2HI7 A;  2V41 A;  3A2W A;  4X4J A;  1V57 A;  3LWA A;  8GSS A;  1F2E A;  4P3Y B;  2C0D A;  2RM5 A;  2TRX A;  1MD4 A;  1FO5 A;  1TRS A;  4G9H A;  3GTU A;  1MD3 A;  3TKQ A;  4OCF A;  1YY7 A;  1HQO A;  3RDW A;  2C1Y A;  3NZN A;  5BMU A;  2IL3 A;  1PKW A;  1TI3 A;  4K9Z A;  4G10 A;  3RBT A;  1HYU A;  4NHZ A;  3EVI A;  3GYK A;  2DJJ A;  4FH8 A;  3KGK A;  1MTC A;  4HU9 A;  2V32 A;  3QAW A;  4MJA A;  4NWY A;  3UBK A;  4Z7X A;  2WCI A;  2JAD A;  3M3M A;  2FWE A;  5ECS A;  6GSS A;  5E59 A;  1SU9 A;  2YZH A;  1SL2 B;  3TJF A;  4EDZ A;  1TJD A;  4TR3 A;  1T1V A;  3D6I A;  4ACS A;  1LBK A;  4X43 A;  4TXO B;  3MWH A;  1DUG A;  3EIN A;  2XBQ A;  2RUE A;  5BRT A;  3LXZ A;  3HJP A;  2P5R A;  1XVQ A;  1SK0 A;  5IPG A;  5IMZ A;  2H8L A;  2DMM A;  2X8G A;  2H71 A;  3U5R E;  3A2V A;  3F4S A;  1AW9 A;  3HY2 A;  3FHK A;  4JRR A;  4J2F A;  4AJ8 A;  5LD0 A;  3VI5 A;  2DML A;  4WF4 A;  3I43 A;  2H0H A;  3Q74 A;  2P0G A;  2R6K A;  2FWG A;  3LOR A;  3HJO A;  3KJY A;  6GSW A;  5KN3 A;  5DQS A;  2R0P A;  3ZFL A;  1K0B A;  2F8A A;  4Z2T A;  1WMJ A;  4ZB6 A;  1PMT A;  1TKD B;  1Z6N A;  4XS6 A;  3CXG A;  5D9X A;  2E2G A;  1DBY A;  1PRX A;  4I2U A;  1A2J A;  1B4Q A;  3QFB C;  4AGS A;  6GST A;  2LUS A;  2OA7 A;  2B5X A;  5ECR B;  3VK9 A;  3HZ4 A;  1AQV A;  4TXV A;  3V1W A;  2DIY A;  2VL3 A;  2LV3 A;  2GGT A;  3GMF A;  3EU3 A;  2AYT A;  3D4T A;  6GSU A;  3GFK A;  2CVK A;  4PUA A;  3GV1 A;  4PUF C;  2H0G A;  4TR1 A;  2PGT A;  1K0O A;  1VGL A;  4ZXG A;  1RQM A;  2LST A;  1H4O A;  1Y25 A;  2YJH A;  5IOX A;  4KCE A;  3MIX A;  4AJ7 A;  4BVY B;  4MZB A;  2VAF A;  2IIY A;  4EE0 A;  4IW9 A;  3UAP A;  5IMF A;  1Q4J A;  2XPE A;  5D8I A;  2NDO A;  2B7J A;  4HS1 A;  2X99 A;  3C73 A;  5F06 A;  1R5P A;  1EGO A;  2CA8 A;  5IMA A;  1UVZ A;  1AQX A;  3GX0 A;  3MAK A;  1GNW A;  5IQY A;  1SL0 B;  1XXU A;  3GN3 A;  1XOB A;  4MJB A;  3C1R A;  2GT5 A;  3GST A;  2E7P A;  2HNL A;  4Q5R A;  5A5K A;  1O85 A;  5ECL B;  2R0G A;  1FHE A;  4GSN A;  1URM A;  2O85 A;  4LLR A;  3E9J B;  5IPH A;  1FW1 A;  3FZ4 A;  3ZML A;  4O32 A;  3ZFB A;  2VUP A;  2OKA A;  4DEJ A;  1X9M B;  2ALB A;  5B8B A;  3IC8 A;  5DDL A;  3ZYW A;  1K0D A;  3UEM A;  4BVX B;  3A5W A;  3EMP A;  1M99 A;  2JSZ A;  4TR4 A;  1AC1 A;  3I69 A;  4N0V A;  1HNC A;  1XW6 A;  3PH9 A;  5F0G A;  5FWG A;  1G0T A;  1GSU A;  1XW5 A;  2H70 A;  1OC9 B;  3O3T A;  2M72 A;  3C1S A;  2K18 A;  1O8W A;  3ZRE A;  4N10 A;  5DCG A;  3QAV A;  4GF0 A;  2YAN A;  2H1B A;  2HSY A;  3HCZ A;  5CRG A;  4KGI A;  1RW1 A;  3TDG A;  3KMN A;  4IJ3 A;  5JCG A;  1SYX A;  2LEG A;  2VD1 A;  9GSS A;  4L0W A;  1OKD A;  4F82 A;  4H86 A;  3IOS A;  3QCP A;  1O8X A;  3RHB A;  1PKZ A;  1R7H A;  2DKH A;  4POL A;  2YP6 A;  3GA4 A;  5IIZ A;  1J9B A;  4MF6 A;  1QK8 A;  2F51 A;  16GS A;  1GP1 A;  5JWQ B;  3QDN A;  3DIE A;  3IHQ A;  3TJK A;  1GSF A;  1B48 A;  1LJR A;  5EY6 A;  1OVN A;  3QAG A;  4CY8 A;  1O73 A;  4PQ1 A;  4NV2 A;  3H4K A;  1XWK A;  2B3S A;  4K5R A;  3FZA A;  1AUC A;  2LS5 A;  4MAB A;  4EDY A;  1T3B A;  2IFQ B;  5JWR B;  1X5E A;  3KD0 A;  2KUC A;  3GKK A;  1U6T A;  1JFU A;  4CW9 A;  3WT2 A;  1OC3 A;  3EE2 A;  3GUS A;  2GZZ A;  4JE1 A;  3M1G A;  4KH7 A;  2B5E A;  5GAN D;  5JWO B;  3EC3 A;  4ZB9 A;  3IR4 A;  1R4W A;  3HVX A;  3TOU A;  2VL9 A;  1ZCP A;  2CVD A;  1F6M C;  3JCM L;  2C80 A;  2GQK A;  2XHF A;  4V1A p;  1J08 A;  1E2Y A;  5FT3 A;  3I9V 2;  4MNN A;  3M8N A;  2H1A A;  4ZBA A;  1IYI A;  2AHE A;  4IP6 A;  3KH9 A;  4EL1 A;  2YN1 A;  1SEN A;  2VL2 C;  1OKT A;  1GSY A;  3ZZX A;  3MYD A;  3HA9 A;  2REM A;  5HQP A;  4XRA A;  3UL3 A;  2FWF A;  4D73 A;  1JZO A;  5HFI A;  4K2X A;  3GL5 A;  3QD9 A;  4IQA A;  2HRN A;  5INY A;  4DSR A;  2MMO A;  4K6X A;  3ZIT A;  1MEK A;  2HZE B;  4KDU A;  2DSA A;  6GSY A;  3ZIV A;  3LGC A;  4ZL8 A;  2HLS A;  2RM6 A;  3E0U A;  2L4Q A;  2FLS A;  1TK5 B;  4HU7 A;  3GHA A;  1CQH A;  4BWS A;  2I81 A;  4HZ4 A;  2R37 A;  1TOF A;  1PN0 A;  1KNG A;  1A8Y A;  2MMZ A;  1GLQ A;  4NHW A;  1M0U A;  4RQR A;  2L6C A;  1B9X C;  2H76 A;  4GRF A;  2H30 A;  5IMD A;  4ECI A;  3VLN A;  4ZBB A;  5J9C A;  2J23 A;  5G31 A;  1PSQ A;  1JZW A;  4J57 E;  3S9F A;  4RUV A;  2MMA A;  4Q5Q A;  1XIY A;  1NM3 A;  4BL7 A;  1GRX A;  3LSZ A;  3D0Z A;  2PWJ A;  1ACV A;  4I2T A;  4IP1 A;  4V1A g;  1QXH A;  1EV4 A;  2ON5 A;  3H93 A;  3E3E A;  3FR3 A;  3UBL A;  4GCI A;  2L59 A;  4BA7 A;  1XWC A;  4JBB A;  2A4H A;  1JZR A;  2OE3 A;  4K7N A;  1WWJ A;  2M46 A;  4GST A;  5HR0 A;  2YWN A;  4OFN A;  3VWX A;  3GH9 A;  3ERF A;  1SYR A;  2O8V B;  1GH2 A;  2A2S A;  2QKE A;  3ZL5 A;  2FWH A;  1FAA A;  2DLX A;  2VL2 A;  2GSR A;  2A2P A;  3QMX A;  4WEY A;  2WB9 A;  2DC5 A;  1EP7 A;  5COH A;  1TXX A;  3ISO A;  1K0C A;  3ZMK A;  4Q5F A;  2HT9 A;  2FY6 A;  4LL1 B;  4MZW A;  2GLR A;  5D93 A;  1PL1 A;  2ZUP A;  4HDE A;  5DAL B;  5GSS A;  4AJ6 A;  5DCH A;  3IPZ A;  4ZBD A;  17GS A;  3LG6 A;  5KEJ A;  2GST A;  3IC4 A;  2JZR A;  1FOH A;  1ST9 A;  4YKF A;  3FY7 A;  4FYU A;  1Q98 A;  2TIR A;  1PL2 A;  1B4P A;  3QFA C;  2LJA A;  2R3X A;  2BJX A;  5ECP B;  2IMD A;  1EOH A;  1WE0 A;  5HFK A;  3UVH A;  5ECQ B;  1B8X A;  1UC7 A;  3UMA A;  1XWG A;  5A4V A;  5CAX A;  2GT6 A;  3DRN A;  1Y6E A;  3KH7 A;  2GSS A;  4LA1 A;  4ULX A;  2VLV A;  3LYP A;  1GUL A;  2FA8 A;  3WGD A;  1QUW A;  4KW6 A;  2N5F A;  3APS A;  1PN9 A;  5H5R A;  2DJ3 A;  4PNF A;  1QFN A;  2YWM A;  2QC7 A;  4QL9 A;  2B1K A;  2GZY A;  1EEJ A;  3VWW A;  1M2A A;  3A5I A;  1BJX A;  4MZC A;  1OAZ A;  4DSS A;  1I5G A;  1GTA A;  1BQ7 A;  2FCH A;  2FUG 2;  3TGZ A;  2WS2 A;  1SJZ A;  2LJK A;  3KEB A;  3M9J A;  3H79 A;  4POB A;  3HD5 A;  2WFC A;  2KOK A;  1USB A;  3WGE A;  4K1F A;  4K0N A;  3DWV A;  4PNG A;  4K2D A;  3W8J A;  2I9H A;  3IE3 A;  2MBT A;  5DAK A;  2LNS A;  5ID2 A;  5CRD A;  4MP4 A;  4F9Z A;  4NV5 A;  1DE1 A;  5H5Q A;  4KDX A;  2R4V A;  3EUR A;  2C4J A;  6GSV A;  3FZ9 A;  4MPG A;  4ZIJ A;  1MDJ A;  3HHV A;  4YAP A;  1XOA A;  7GSS A;  1G7E A;  5DVB A;  3NIV A;  5J5N A;  1A0F A;  3LJR A;  1XW9 A;  2CX4 A;  2TRC P;  2JZT A;  5KOX A;  3FMW A;  4ID0 A;  4FO5 A;  2H75 A;  3HJM A;  3I6A A;  3APO A;  3IA1 A;  3L9V A;  1VF2 A;  3IV4 A;  3ZTL A;  2H1D A;  1VRS D;  1YJ6 A;  4V2M A;  3FK8 A;  1EP8 A;  5B6M A;  5G1K A;  3GH6 A;  3GRX A;  2V1M A;  2C0F A;  1EGR A;  3GTU B;  5B6N A;  1K3L A;  2AV4 A;  2GQL A;  4ECC A;  3C71 A;  1ERT A;  1B9Y C;  4GQF A;  5G5F A;  1TK0 B;  2VIM A;  1V40 A;  2JL4 A;  2BTO T;  4PX1 A;  2K8S A;  1YDK A;  4CDO A;  4HJ2 A;  5IMC A;  3BCI A;  2IJY A;  2A4V A;  1ZOF A;  1TU7 A;  2FNO A;  2LQO A;  3VI7 A;  4L0U A;  18GS A;  2UZ8 A;  1M7T A;  4TRX A;  2P5Q A;  4XCS A;  1ERU A;  2WRT A;  1WPI A;  3HVV A;  2WGR A;  2NPB A;  2JZS A;  4OO5 A;  1QGV A;  4JED A;  4N30 A;  2YZU A;  3F63 A;  3EMX A;  5HFG A;  2DBC A;  4ZL7 A;  1SKS B;  5D9V A;  3DGQ A;  2R2J A;  2D2Z A;  1PGT A;  1A23 A;  5KN2 A;  3DML A;  1UN2 A;  4WF5 A;  4IN0 A;  1T4Y A;  2LQQ A;  2YJ7 A;  2HRA A;  5J3R A;  3FZ5 A;  1K0M A;  3F6D A;  3TJJ A;  4NPB A;  14GS A;  4KX4 A;  1U88 A;  3US3 A;  5G5E A;  2MYG A;  4MA9 A;  4NMU A;  1M9A A;  1X0R A;  2GTU A;  1YZX A;  4GXZ A;  3DYR A;  3VFI A;  4G0L A;  4IQ1 A;  4OWY A;  2X64 A;  3F0I A;  3UIW A;  5IO2 A;  2H72 A;  3OR5 A;  3GIX A;  19GS A;  1SK1 A;  3N5O A;  2KHP A;  5D9W A;  2DIZ A;  2ON7 A;  3LQ7 A;  1BED A;  1GTU A;  1QQ2 A;  4E8H A;  4ZB8 A;  2QA1 A;  3HXS A;  2HRK A;  4QQ7 A;  2X8C A;  2YCD A;  1SK2 A;  1FB0 A;  3KM6 A;  4IS0 A;  3DVX A;  4WET A;  3TOT A;  1Z7P A;  5ELA A;  4EF0 A;  1V2A A;  3GKM A;  3R2Q A;  5FHI A;  4YKG A;  1VF3 A;  4TR1 B;  3G7I A;  4O7H A;  4K7O A;  1SJI A;  4TW5 A;  1ON4 A;  3UAR A;  3RPN A;  1S3C A;  2VCZ A;  1PX6 A;  2L6D A;  3CBU A;  1U87 A;  4BWQ A;  3ED3 A;  5LCZ A;  3N9J A;  2B5Y A;  4G2E A;  3CTG A;  3PPU A;  2WZ9 A;  2I1U A;  2AB6 A;  2P31 A;  3P90 A;  5KN1 A;  2IPA A;  3FW2 A;  12GS A;  1YF1 A;  1XPV A;  1ZYQ B;  3O6T A;  3MDK A;  2DKI A;  2L5O A;  4EKZ A;  1SKR B;  4MH2 A;  1GWC A;  10GS A;  1U3I A;  4XS1 A;  5G1L A;  5CYY A;  4KF9 A;  1YQ1 A;  1K3O A;  1RK4 A;  2YNX A;  3IHG A;  3TUE A;  2DJ2 A;  1S3A A;  2K9F A;  4WBJ A;  3ZRD A;  1V98 A;  3IXR A;  2LRT A;  2OAC A;  4OFM A;  3L9U A;  2F8F A;  4MLY A;  3A2X A;  5IMV A;  1G6Y A;  2XPD A;  2MMN A;  3O76 A;  4GTU A;  1YKC A;  1OC8 A;  20GS A;  1XFL A;  1XZO A;  1TU8 A;  3GX8 A;  2OJL A;  1F37 A;  5F05 A;  4MF7 A;  2GDR A;  4QL7 A;  1ILO A;  3FR9 A;  1KEB A;  1BYE A;  2PUK C;  5G2Z A;  1A24 A;  2VO4 A;  1IYH A;  4N0Z A;  4HJM A;  5HR3 A;  4BPY A;  2H01 A;  4XS4 A;  3FRC A;  1NSW A;  2PN8 A;  1MDI A;  4YQM A;  1SD8 A;  3R3E A;  4POK A;  1NHO A;  2MBS A;  1XBS A;  5DQY A;  2LTK A;  3FR6 A;  3KP9 A;  5IOW A;  3CSH A;  3HDC A;  4TKY A;  3UOM A;  3TB2 A;  3TJB A;  3CSJ A;  5EVO A;  3HKR A;  1OE7 A;  4KAE A;  1YF0 A;  3DKS A;  4O92 A;  2ZCT A;  5J41 A;  3QPM A;  1EV9 A;  4I97 A;  3IAM 2;  3VUR A;  1ZL9 A;  3CTF A;  1YEP A;  2RLI A;  3HZ8 A;  4ICY A;  1HD2 A;  2AUV A;  1PQN A;  2AJQ B;  2R0C A;  5ECH B;  4WR4 A;  4YQV A;  4HQZ A;  5ECI B;  2X4A A;  1X9S B;  3G7J A;  4TXO A;  4YQU A;  4IKH A;  5JCW A;  3ZVJ D;  2OE1 A;  2EIQ A;  1SD9 A;  2PVO C;  3TRX A;  3A3T A;  3K8N A;  1BG5 A;  2H6X A;  3Q6O A;  4HEA 2;  4MJE A;  2H1G A;  3KMO A;  1I9D A;  4YAV A;  1ERV A;  1XCC A;  3RAZ A;  3IRA A;  1THO A;  2GVP A;  3F4R A;  4HQS A;  2HSM A;  1K3Y A;  1HNA A;  3LXT A;  1XVW A;  4ISD A;  2O7K A;  1ZZY A;  2LJR A;  4OFT A;  4I6X A;  4GSS A;  2KLX A;  4XTS A;  3TRP A;  1DSB A;  2G0F A;  4JR6 A;  2R5G A;  4D73 B;  1U3A A;  3BJ5 A;  5KOW A;  4TVE A;  5J4U A;  3DXB A;  2VLU A;  1GSQ A;  3IAS 2;  4IEL A;  1H75 A;  1O7U A;  3KCM A;  4WBR D;  3ZLP A;  2FA4 A;  1ZGN A;  2V6O A;  1AIU A;  4OO4 A;  1KTE A;  2M80 A;  4ECB A;  4XHM A;  5HR1 A;  3TKS C;  3KZQ A;  3QR6 A;  3EWL A;  4EXJ A;  3P2A A;  2ZNM A;  3J7Y b;  3J7Y k;  1TRV A;  4PUR A;  4F0B A;  4F0C A;  4TR0 A;  5HR2 A;  1DE2 A;  2NTO A;  2X49 A;  4BVY A;  4KSO A;  4L5L A;  2B6M A;  1G7O A;  1K0N A;  5DJM A;  3LEF A;  3G7Y A;  1GLP A;  3TJG A;  4TOP A;  5ECK B;  1WIK A;  3SWL A;  3MSZ A;  4EIQ A;  4BL7 B;  4ZIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...