3GV1A

Crystal structure of disulfide interchange protein from neisseria gonorrhoeae
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
MSLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNGRTQSGYSPMPQLEEIIRKNQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide interchange protein
publication title The crystal structure of disulfide interchange protein from Neisseria gonorrhoeae
rcsb
source organism Neisseria gonorrhoeae
molecule tags Structural genomics, unknown function
total genus 44
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gv1A00
5ENUA 1AQXA 4ZILA 2A2RA 1M2AA 3G7YA 1JZOA 2YPMA 1X5EA 2VL2C 2OE0A 2CAIA 3C71A 4ECJA 4OO5A 2XBQA 2OA7A 2GSTA 1SKRB 5D8IA 4KSMA 2LJAA 1FVKA 5F07A 2REMA 1X5DA 3D21A 2R5GA 1XW9A 3GTUB 2DJ2A 3ZMKA 4I5QA 4YQUA 1U6TA 2GDRA 3APSA 5IM9A 1HNAA 1EOHA 2ES7A 4EXJA 2VL9A 1A8YA 4N0VA 3EWLA 2ALBA 4IP1A 2I1UA 1O8XA 5G30A 4DVCA 1OE7A 3CMIA 4V2NA 2ZCTA 5HR3A 2RLIA 1SJ6A 1EEJA 4ZB6A 4POKA 3UIWA 1W89A 5ID2B 4OFTA 1PL1A 3F3RA 3H1NA 4ECIA 2JACA 5DCHA 4K0GA 4HZ2A 1OC9B 2LJKA 1TRSA 3MSZA 4NWYA 1VRSD 2H30A 3DKSA 1LU4A 2YJHA 4PNGA 4KW6A 4E8HA 17GSA 3U5RE 4XS4B 1AUCA 1YF0A 4WBRD 4GXZA 1O85A 1USBA 2G0FA 3VWUA 4KAEA 2LRCA 5IMAA 4K6XA 2X8GA 4JR4A 1H75A 2DBCA 5A5KA 1FVJA 4QL9A 1MEKA 1YF1A 3W8SA 2DJ0A 3GUSA 5DAKA 2FD3A 2CX3A 2HZFA 4ZB8A 4KX4A 4K7OA 2O87A 1ST9A 3HZ8A 5FHIA 5DALA 4MH2A 2F3MA 3IRAA 1TRVA 5G1KA 4PUFC 1PL2A 4ISDA 2C0FA 2OE1A 5L71A 1TU8A 4WXTA 4PGTA 6GSSA 1K0CA 4FYUA 3BCIA 5EL8A 2CVBA 2K8VA 3CTFA 1XOBA 6GSXA 1U3IA 1GNWA 1NW2A 2FA4A 3IBHA 2B7JA 4MP4A 6GSTA 1ERVA 3GH6A 2CQ9A 4OFNA 4DSSB 3P90A 5HFKA 1N8JA 3H93A 3DWVA 1X9MB 3GA4A 4F82A 1MDKA 2PBJA 6GSUA 3IV4A 4KE3A 6GSVA 5EY6A 2JSZA 1XWGA 1F2EA 2IFQA 3KGKA 4L8EA 5C04A 1ILOA 2AB6A 1I9DA 4MZWA 1FO5A 1ABAA 4JE1A 4GTUA 1TJDA 2O85A 2HSYA 1OYJA 5G2ZA 1X9SB 2QGVA 5A4VA 2CVDA 3DVWA 3J7Yb 1GSQA 3WGXA 1E2YA 2YWIA 3TOTA 2RUEA 5F8BA 1ERUA 4BWQA 4EKZA 3WD6A 1R26A 5B8AA 1MTCA 5HR0A 2HT9A 4XRAA 5J4UA 2IWTA 2P5RA 3EU4A 2H1GA 2VL2A 1OC8A 1KNGA 5ECKB 3UVTA 1C72A 4KCEA 1SJZA 5IOXA 2L4CA 2H76A 3EVIA 2C3QA 2PU9C 2LEGA 5E4WA 3LQ7A 4ULXA 1VF1A 4K9ZA 4IJIA 3LWAA 4I6XA 4MCUA 3F4RA 1Z7PA 4X1UA 5KN0A 4G19A 5LNKe 1WE0A 3TKSC 1YEPA 4ID0A 1I5GA 1GTAA 1YQ1A 4EL1A 4J2FA 4XS6A 2V6KA 3GRXA 3P8WA 3GL3A 5COHA 1TRWA 4LL1B 1M0UA 4L5OA 2PWJA 3ME8A 4HU9A 3LYPA 2MMAA 4WETA 3IK7A 2RM6A 3HYPA 4ZBAA 3EINA 3GV1A 1ERTA 1EP8A 4KDXA 2OBIA 3FR9A 2C80A 3RDWA 2NBSA 4BVYA 2OBKA 1OKTA 3GKNA 18GSA 1SD8A 1NHOA 3O76A 2PMTA 2FWEA 1YEXA 1A2JA 5CRWA 2F8AA 1RK4A 1A2LA 3QDNA 3KXOA 4MMMA 2DIZA 3FR6A 3IHQA 3G9BA 3EE2A 3TJBA 4Z7XA 3LXZA 2FWGA 1QFNA 4TXOA 2E2GA 2VUPA 4IW9A 1TK8B 1OE8A 3LJRA 1J9BA 2LQQA 3M8NA 3WGEA 1X9WB 2OADA 1DBYA 5ECPB 1GSUA 1YJ6A 2L5OA 4GSNA 3H8QA 3HY2A 3ZYWA 3HKRA 3VLNA 3M9JA 4V1Ap 1EV9A 1Y6EA 3VWWA 4WBJA 3HCZA 3W6GA 1GRXA 1TOFA 3EMPA 4IHUA 1TK5B 3QFBC 3HJMA 2K8SA 4F03A 5KN2A 2GSQA 2CZ2A 1MD4A 2AJQB 1BG5A 3L9SA 4ECCA 4MZBA 3QPMA 3D4TA 3ZLPA 3TUEA 5JCUA 5DJLA 4DSQA 3GHAA 2ON7A 4F2IA 4KDUA 4O7HA 1KTEA 3GL5A 3ZIJA 2P5QA 3C1RA 1GSDA 4TR1A 3FRCA 3KJYA 1GLQA 4MLYA 2V32A 2FCHA 5D73A 1ERWA 3ME7A 11GSA 1EGRA 2VCWA 4MA9A 1HD2A 3VI7A 4NV5A 2YWOA 1AIUA 3NIVA 2C4JA 1CQHA 4CHSA 3KP8A 1GLPA 2GGTA 4MJAA 1XFLA 2E2MA 2V2GA 3NOFA 2GSRA 5GZZB 1GWCA 2IMKA 4TKYA 4N0ZA 1YZXA 4PQ1A 1G0TA 1F37A 2KP2A 3CTGA 1THOA 2EIOA 4BVXA 1SKSB 3K8NA 3HVXA 1BX9A 1HNCA 4G9HA 2KP1A 2CZ3A 1AAZA 2PPTA 4JZQA 2MMNA 2HLSA 1WPIA 1JZWA 3GURA 4XS4A 1K0BA 4Q5NA 2C0EA 3VPQA 5B6NA 2WULA 1ZGNA 1TKDB 3AY8A 2H1BA 1S3DA 2PGTA 1SYRA 2H72A 2GZYA 4TVEA 1A24A 5ELAA 2HFDA 1JZDA 5DDLA 1EZKA 1UVZA 2NTOA 3E3EA 3WYWA 3C8EA 1PMTA 2H0GA 4YH2A 1T4ZA 3BCKA 2ZUPA 2AHEA 2GT6A 1TTZA 2DMMA 1EP7A 2YANA 3VWXA 3GH9A 1SENA 2XC2A 3KH9A 1RW1A 3CBUA 1Z9HA 5ECLB 3HJPA 2H0IA 1V58A 4G10A 1RQMA 3QD9A 4KNDA 3PR8A 2M80A 4I2UA 1AC1A 3IC4A 4V1Ag 4OWYA 3N9JA 3L9UA 2H6YA 1MD3A 3CSHA 3VWVA 2WCIA 1JZRA 4K2DA 4TN8A 2P31A 1AQWA 2R37A 5J5NA 3RAZA 4TOPA 1A8LA 3BJ5A 1QQ2A 3F6FA 3UMAA 3ERGA 1O73A 4TR4A 4HU7A 2WJUA 3FYGA 4J56E 5J9CA 4N10A 2M46A 2MBSA 4RQXA 3M0FA 1GSEA 4EC0A 3CRTA 3KZQA 3RBTA 3CSIA 3MAKA 4JU5A 3TJFA 1S3AA 1BYEA 2YWNA 1Z7RA 2GLRA 1ZMAA 2BTOT 4JBBA 2LV3A 1GH2A 1A2MA 1WRYA 4F0CA 2HZEB 1AQVA 4ILFA 4RQRA 4EDZA 3EYTA 4NPBA 2FGXA 4TR3A 1GNEA 3MNGA 1XPVA 1O7UA 2GTUA 4IQ1A 1XVQA 4IKHA 3F6DA 3O3TA 3ZL5A 1EWXA 1O6JA 4MPGA 3ZREA 2VLUA 4FO5A 2DJJA 3DD3A 4K7IA 4WKWA 3L78A 3KM6A 1S3CA 3PGTA 4NV2A 1V2AA 3HJOA 10GSA 5D96A 1SU9A 1Z5YE 3D5JA 1DE1A 3FW2A 3DIEA 3KH7A 1A0FA 5FT3A 1B4PA 3TOUA 5KEJA 1T00A 2HRFA 4L0UA 3APQA 4POMA 5G31A 1GP1A 2LNTA 1XWCA 4HQSA 2PVQA 5CRDA 2IIYA 1YKCA 4Q5RA 3TKPA 5GAPD 4KH7A 3GX8A 1M9BA 1GSSA 3VURA 3L4NA 2A4VA 20GSA 1IYIA 2DJ1A 1NM3A 4MF5A 3RHCA 2C0GA 2TIRA 1G6YA 4PX1A 1SK0A 1QUWA 3ED3A 2YV9A 1J08A 2DIYA 2CA8A 2L5LA 1TK0B 4ML6A 1WP0A 4NHWA 4ZBBA 3KD0A 3FEUA 2DJ3A 1KBNA 3GSSA 4IS0A 4MZCA 3I69A 3RHBA 2B7KA 5DQYA 2HYXA 2R3XA 2H19A 2YNXA 2LS5A 3MDKA 1TU7A 2CX4A 4J57E 3EU3A 2WRTA 3HD5A 2KUCA 3HVVA 2OKAA 1V40A 1UN2A 1X0RA 3QFAC 3ZVJA 1GSYA 1XIYA 4HI7A 1ACVA 2HI7A 2G2QA 2I9HA 2YZHA 5H5SA 1GUMA 5IMCA 1QMVA 4OFMA 3F0IA 5HQPA 5IO2A 2H1AA 2BJXA 4Q5QA 5CRGA 4O32A 3TJKA 2H6XA 3PINA 5IMDA 3ZMLA 4KCAA 3LG6A 2VIMA 2L6DA 2L4QA 4IQAA 4RUVA 5IMFA 1PQNA 2QSIA 4K7NA 2B5XA 4YAVA 2F9SA 3TJGA 3DVXA 1T3BA 5J41A 3FZ5A 1NSWA 1EGOA 1R4WA 2GSSA 2YZUA 2JADA 3A3TA 5ECMB 3CYNA 3UARA 2VL3A 1EV4A 3M1GA 1R5AA 4I2TA 5CAXA 5GAND 3IK9A 2XHFA 3D22A 2YP6A 3TRQA 2VOCA 2C0DA 3F8UA 3P2AA 3HZ4A 2GT5A 3HVSA 5HR1A 1SL2B 3UOMA 1XWKA 3HHVA 4BA7A 3HDCA 5DAKB 1O81A 4LMVA 4AJ8A 5DALB 2FUG2 1XOAA 1PRXA 3NZNA 4TXVA 3LXTA 2IMDA 3A5WA 2IMEA 2LTKA 4K1FA 1ML6A 2K18A 4XRDA 3D4MA 3F9UA 4X0XA 3CSJA 3EMXA 2IL3A 4MJEA 1SD9A 4GF0A 2CT6A 3Q74A 4NMUA 4EO3A 4G2EA 2RM5A 3KCMA 2MZCA 4V2LA 2QKEA 3QMXA 4D73A 3C73A 1GTIA 4CW9A 3UL3A 4JR6A 5DVBA 4WR5A 3MWHA 3M9KA 2N5AA 2FY6A 2IFQB 3DGQA 1Z3EA 1A0RP 1JHBA 2L59A 1U3AA 2V6OA 1B8XA 3FY7A 3A2XA 3L9VA 2C1YA 3KIJA 2YV7A 1K0DA 1URMA 2O8VB 4OD7A 4GQFA 3IAM2 2XPDA 1Y25A 4CDOA 2EIRA 3RPNA 4ACSA 2B6MA 1T8EB 3BD2A 3DRNA 2M72A 3EC3A 1R7HA 4N11A 4O92A 4WF4A 3O6TA 3GTUA 2VCQA 5F05A 3F4TA 1CQGA 2PVOC 1PD21 2AAWA 1YKAA 2X99A 2GS3A 2H6ZA 2WS2A 4GQCA 4HZ4A 1V57A 4F0BA 9GSSA 3QOUA 5F06A 2FA8A 4KUNA 5KN1A 3D0ZA 2HXKA 2FLSA 1BQ7A 2YJ7A 4FYBA 5DJMA 2HSHA 1R5PA 2B1KA 1OVNA 4GSSA 3GX0A 1FG4A 4Q5FA 2GZPA 1WWJA 5FWGA 1GTBA 3GSTA 1FB6A 1U87A 4WEYA 3IPZA 4MH3A 3OR5A 4NAXA 2KOKA 2H0HA 1BAYA 2L6CA 3Q18A 1JFUA 4AF2A 4HOJA 5ID2A 2FWFA 2I81A 5HFGA 1PKWA 2BMXA 2LRTA 1MDJA 3GKMA 4E8EA 3VFIA 1F9MA 3FK8A 1OC9A 3FZ4A 3LSZA 1PX6A 4OO4A 5JWQB 3U6VA 13GSA 1GSFA 4GSTA 3APOA 4POLA 1TXXA 3QAWA 5AIXA 1XW6A 1FOVA 1EEMA 3IA1A 3KTBA 2O89A 5AN1A 2MMOA 5GSSA 3UBLA 4BL7A 1VF4A 3GIXA 5IMZA 5B7CA 2O7KA 2PERA 4LMWA 5D93A 3Q6OA 5CO3A 4MPFA 5AISA 3ZFBA 2R4VA 5CNWA 5D9VA 2MBTA 2A2SA 1ZCPA 3ZZXA 4EF0A 3BOAA 2NVLA 3HXSA 5INYA 1PSQA 3E9JB 1PGTA 1T4YA 2PUKC 5DBQA 3A2VA 4I97A 4ZBDA 3LYKA 2KLXA 3F3QA 4PQIA 2LSTA 3GMFA 2F51A 4ZL8A 4KB3A 2IMIA 2RIIA 4TXOB 1PKZA 4K0NA 1SJIA 4XCSA 1F3AA 3KTLA 4POBA 2B1LA 4WR4A 3FHKA 4LA1A 3HA9A 3TKSE 3Q19A 1WJKA 4DSSA 1WMJA 4TRXA 5CRHA 4ZB9A 3L0HA 1X5CA 2D2ZA 2H66A 3TB2A 2TRCP 3A2WA 4KA0A 1DUGA 1G7EA 4FIWA 2VD1A 1AW9A 2WGRA 2VO4A 4PQHA 3CRUA 5EVOA 2JZSA 1QXHA 3ZRDA 2GQLA 1U88A 3UBKA 1K3YA 3GKXA 1T7PB 4JRRA 3H79A 3QAVA 4ZL9A 2AYTA 1G7OA 1OKDA 3IR4A 1BJXA 1YY7A 14GSA 4TR1B 5AIVA 4MF7A 1M2BA 3VPTA 1E6BA 5D9TA 2LUSA 5ECNB 1B4QA 4XTSA 3W8JA 3IAS2 12GSA 4ECBA 2GVPA 2H75A 1Z6MA 3I43A 2H71A 5HFIA 2GQMA 1EOGA 1K0AA 3F4SA 5HR2A 1ZYEA 3D6IA 4P3YB 3QAGA 3FR3A 1YDKA 4LLRA 5ECSA 2QC7A 1HNBA 2WB9A 6GSWA 2KHPA 1QK8A 5LD0A 1V98A 4NXIA 5E59A 2WZ9A 2FHEA 2YN1A 2XBIA 3G7JA 2V41A 2VLTA 1TDIA 5IPGA 4IP6A 3ERWA 1ON4A 3IDVA 2P0GA 3KMOA 2EIQA 4MF6A 4N30A 1H4OA 5CP1A 1B48A 2JU5A 4MK3A 5CREA 1Q98A 1GUHA 5EPFA 1M99A 1QGVA 5H5QA 4IELA 2DJKA 3QR6A 3TKRA 5ECRB 2DSAA 1TW9A 4ZL7A 2X8CA 4IGJA 1NHYA 1XXUA 5ECQB 3TGZA 3N5OA 5IOWA 1LJRA 4TW5A 1DE2A 1K3LA 3J7Yk 4V2MA 3DYRA 2HRNA 5D9XA 5KN3A 1F3BA 2NDOA 5ECIB 1M9AA 4K8MA 4IVFA 1OC3A 4YAPA 2C3NA 4HUAA 1K3OA 3VK9A 1V9WA 1XWBA 4WF5A 4KSOA 1THXA 4KDYA 2GQKA 2E7PA 4OCEA 2J23A 5JCGA 5GSTA 5JWOB 22GSA 1TP9A 2OE3A 5B6MA 2N5BA 3LORA 1ZYQB 5A4WA 1ZOFA 3WT2A 4EUYA 2JZTA 3C1SA 3KEBA 4LL4B 3C7MA 5IPHA 2LQOA 3RPPA 4DSRA 2JSYA 2DLXA 2H70A 5IQYA 4X43A 3BBYA 1ZL9A 4IJ3A 3GNJA 5JWRB 5C00A 3UAPA 1J0FA 2B5YA 4L0WA 2EC4A 4HJMA 4AJ6A 4NHZA 2H01A 2RUFA 3US3A 5JCWA 2WFCA 3WT1A 2CV4A 4I8BA 1XBSA 3LFLA 1SK1A 3GKKA 4MJBA 3ISOA 3UEMA 2H73A 3M3MA 3FZAA 2JL4A 3P7XA 4QL7A 4RI7A 5G5FA 4ZIJA 1ZZYA 2LKUA 1SYXA 1VF3A 4EDYA 4PXOA 5ELGA 2AUVA 1WOUA 2ZNMA 1LBKA 2YOIA 3JCML 1F6MC 2NPBA 2C8UA 4YQMA 3VI5A 4GLTA 2LNSA 5J9BA 5J3RA 4GWRA 4QQ7A 5D9WA 1GL8A 3FZ9A 2E0QA 4PNFA 5F0GA 2VM2A 4H86A 4F9ZA 2K6VA 2H1DA 1SL1B 1FW1A 1JLWA 2TRXA 2AV4A 1PX7A 4PUAA 5G5EA 2VCXA 3SBCA 5G1LA 3E0UA 6GSYA 3G7IA 19GSA 2MMZA 1K0OA 3H4KA 4GRFA 2LRNA 4EVMA 1SK2A 4GCIA 2VM1A 1KEBA 3I6AA 1T1VA 5ECHB 3UJ1A 1B9YC 2F8FA 4RI6A 2IJYA 3IE3A 4TR0A 4HQZA 3DMLA 3UVHA 2OACA 3R2QA 1VGLA 4MDCA 2OJLA 4PURA 8GSSA 3QCPA 3FKFA 7GSSA 3TKQA 3ZFLA 1PN9A 2VD0A 2GZZA 2PN8A 2IN3A 1GULA 1GUKA 2YWMA 2LJRA 2DC5A 4HS1A 2R6KA 2YCDA 4L5LA 3DXBA 1Q4JA 1JLVA 5LCZA 16GSA 2X8HA 4XHMA 2CAQA 4AGSA 1HYUA 4IBPA 4ML1A 2VCZA 2JZRA 2ON5A 2J9HA 4HDEA 4HEA2 5AGYA 3F63A 4AJ7A 1GTUA 5IMVA 1UA5A 3ERFA 4YQVA 3GYKA 5H5RA 4HJ2A 4DEJA 3IOSA 2H8LA 4EE0A 1W4VA 1PA3A 3WGDA 3CXGA 2HE3A 2K9FA 1TI1A 4BPYA 1TI3A 3ZITA 2HZEA 2VAFA 1SL0B 2DMLA 2N5FA 4FH8A 1O8WA 3GN3A 1K0NA 3TCOA 4BWSA 1N2AA 4MJCA 4O5RA 1M2DA 2WDUA 1B9XC 1UC7A 2B3SA 2V1MA 3LGCA 3ZIVA 1A23A 2VCTA 5DQSA 2H74A 2I4AA 2VCVA 5IO0A 3I9V2 2XPEA 2IPAA 2VLVA 1IYHA 3DEXA 1SKWB 5CYYA 1DSBA 3S9FA 5ECOB 3SWLA 3V1WA 4OCFA 3ZVJD 2B5EA 1XW5A 1VF2A 3TRXA 2CVKA 1OAZA 3ZTLA 4OMVA 2FWHA 1BEDA 5A4UA 5IIZA 1WIKA 3TKSA 3GFKA 4ZXGA 1AXDA 2Z9SA 2R2JA 1FHEA 4FYCA 3LEFA 5DCGA 2C3TA 1TRUA 4IN0A 3EURA 2L57A 1K0MA 1M7TA 1FB0A 4D73B 1G6WA 4XS1A 3TJJA 2X64A 3KMNA 4JEDA 4XIHA 3TRPA 2MYGA 1HQOA 5ABRA 1XVWA 3KP9A 1Z6NA 1FAAA 3PH9A 4KGIA 2HNLA 1XWAA 4MABA 1XZOA 3TDGA 2IMFA 3IXRA 2FNOA 1MDIA 2I3YA 5B8BA 1XCCA
chains in the Genus database with same CATH superfamily
4KF9A 5ENUA 1AQXA 4ZILA 2A2RA 1M2AA 3G7YA 1JZOA 4Z2UA 2YPMA 1X5EA 2VL2C 2OE0A 2CAIA 3C71A 4ECJA 4OO5A 4A5PA 2XBQA 2OA7A 2GSTA 1SKRB 5D8IA 4KSMA 2LJAA 1FVKA 5F07A 2REMA 1X5DA 3D21A 2R5GA 1XW9A 3GTUB 2DJ2A 3ZMKA 4I5QA 4YQUA 1U6TA 2GDRA 3APSA 5IM9A 1HNAA 1EOHA 2ES7A 4EXJA 3IC8A 2VL9A 1A8YA 4N0VA 3EWLA 2ALBA 4IP1A 2I1UA 1M3JA 1O8XA 5G30A 4DVCA 1OE7A 3CMIA 4V2NA 2ZCTA 5HR3A 2RLIA 1SJ6A 1EEJA 4ZB6A 4POKA 3UIWA 1W89A 5ID2B 4OFTA 1PL1A 4EIPA 3F3RA 3H1NA 4ECIA 2JACA 5DCHA 4K0GA 4HZ2A 1OC9B 2LJKA 1TRSA 3MSZA 4NWYA 1VRSD 2H30A 3DKSA 1LU4A 2YJHA 4PNGA 4KW6A 4E8HA 17GSA 3U5RE 4XS4B 1AUCA 1YF0A 4WBRD 4GXZA 1O85A 1USBA 4BL7B 2G0FA 3VWUA 4KAEA 2LRCA 5IMAA 4K6XA 2X8GA 4JR4A 1H75A 2DBCA 5A5KA 1FVJA 4QL9A 1MEKA 1YF1A 3W8SA 2DJ0A 3GUSA 5DAKA 2FD3A 2CX3A 2HZFA 4ZB8A 4KX4A 4K7OA 2O87A 1ST9A 3HZ8A 5FHIA 5DALA 4MH2A 2F3MA 3IRAA 1TRVA 5G1KA 4PUFC 1PL2A 4ISDA 2C0FA 2OE1A 5L71A 1TU8A 4WXTA 4PGTA 6GSSA 1K0CA 4FYUA 3BCIA 5EL8A 2CVBA 2K8VA 3CTFA 4G0LA 1XOBA 6GSXA 1U3IA 1GNWA 1NW2A 2FA4A 3IBHA 2B7JA 4MP4A 6GSTA 1ERVA 3GH6A 2CQ9A 4OFNA 4DSSB 3P90A 5HFKA 1N8JA 3H93A 3DWVA 1X9MB 3GA4A 4F82A 1MDKA 2PBJA 6GSUA 3IV4A 4KE3A 6GSVA 5EY6A 2JSZA 1XWGA 1F2EA 2IFQA 3KGKA 4L8EA 5C04A 1ILOA 2AB6A 1I9DA 4MZWA 1FO5A 1ABAA 4JE1A 4GTUA 1TJDA 2O85A 2HSYA 1OYJA 5G2ZA 1X9SB 2QGVA 5A4VA 2CVDA 3DVWA 3J7Yb 1GSQA 3WGXA 1E2YA 2YWIA 3TOTA 2RUEA 5F8BA 1ERUA 4BWQA 4EKZA 4K5RA 3WD6A 1R26A 5B8AA 1MTCA 5HR0A 2HT9A 4XRAA 5J4UA 2IWTA 2P5RA 3EU4A 2H1GA 2VL2A 1OC8A 1KNGA 5ECKB 3UVTA 1C72A 4KCEA 1SJZA 5IOXA 2L4CA 2H76A 3EVIA 2C3QA 2PU9C 2LEGA 5E4WA 3LQ7A 4ULXA 1VF1A 4K9ZA 4IJIA 3LWAA 4I6XA 4MCUA 3F4RA 1Z7PA 4X1UA 5KN0A 4G19A 5LNKe 1WE0A 3TKSC 1YEPA 4ID0A 1I5GA 1GTAA 1YQ1A 4EL1A 4J2FA 4XS6A 2V6KA 3GRXA 5BRTA 3P8WA 3GL3A 5COHA 1TRWA 4LL1B 1M0UA 4L5OA 2PWJA 3ME8A 4HU9A 3LYPA 2MMAA 4WETA 3IK7A 2RM6A 3HYPA 4ZBAA 3EINA 3GV1A 4X4JA 1ERTA 1EP8A 3IHGA 4KDXA 2OBIA 3FR9A 5BMUA 2C80A 3RDWA 2NBSA 4BVYA 2OBKA 1OKTA 3GKNA 18GSA 1SD8A 1NHOA 3O76A 2PMTA 2FWEA 1YEXA 2X49A 1A2JA 5CRWA 2F8AA 1RK4A 1A2LA 3QDNA 3KXOA 4MMMA 2DIZA 3FR6A 3IHQA 3G9BA 3EE2A 3TJBA 4Z7XA 3LXZA 2FWGA 1QFNA 4TXOA 2E2GA 2VUPA 4IW9A 1TK8B 1OE8A 3LJRA 1J9BA 2LQQA 3M8NA 4Z2RA 3WGEA 1X9WB 2OADA 1DBYA 5ECPB 1GSUA 1YJ6A 2L5OA 4GSNA 3H8QA 3HY2A 3ZYWA 3HKRA 3VLNA 3M9JA 4V1Ap 1EV9A 1Y6EA 3VWWA 4WBJA 3HCZA 3W6GA 1GRXA 1TOFA 3EMPA 4IHUA 1TK5B 3QFBC 3HJMA 2K8SA 4F03A 5KN2A 2GSQA 2CZ2A 1MD4A 2AJQB 1BG5A 3L9SA 4ECCA 4MZBA 3QPMA 3D4TA 3ZLPA 3TUEA 5JCUA 5DJLA 4DSQA 3GHAA 2ON7A 4F2IA 4KDUA 4O7HA 1KTEA 3GL5A 3ZIJA 2P5QA 3C1RA 1GSDA 4TR1A 3FRCA 2A2PA 3KJYA 3LW9A 1GLQA 4MLYA 2V32A 2FCHA 5D73A 1ERWA 3ME7A 11GSA 1EGRA 2VCWA 4MA9A 1HD2A 3VI7A 4NV5A 2YWOA 1AIUA 3NIVA 2C4JA 1CQHA 4CHSA 3KP8A 1GLPA 2GGTA 4MJAA 1XFLA 2E2MA 2V2GA 3NOFA 2GSRA 5GZZB 1GWCA 2IMKA 1XG8A 4TKYA 4N0ZA 1YZXA 4PQ1A 1G0TA 1F37A 2KP2A 3CTGA 1THOA 2EIOA 4BVXA 1SKSB 3K8NA 3HVXA 1BX9A 1HNCA 4G9HA 2KP1A 2CZ3A 1AAZA 2PPTA 4JZQA 2MMNA 2HLSA 1WPIA 1JZWA 3GURA 4XS4A 1K0BA 4Q5NA 2C0EA 3VPQA 5B6NA 2WULA 1ZGNA 1TKDB 3AY8A 2H1BA 1S3DA 2PGTA 1SYRA 2H72A 2GZYA 4TVEA 1A24A 5ELAA 2HFDA 1JZDA 5DDLA 1EZKA 1UVZA 2NTOA 3E3EA 3WYWA 3C8EA 1PMTA 2H0GA 4YH2A 1T4ZA 3BCKA 2ZUPA 2AHEA 2GT6A 1TTZA 2DMMA 1EP7A 2YANA 3FMWA 3VWXA 3GH9A 1SENA 2XC2A 3KH9A 1RW1A 3CBUA 1Z9HA 5ECLB 3HJPA 2H0IA 1V58A 4G10A 1RQMA 4EIQA 3QD9A 4KNDA 3PR8A 2M80A 4I2UA 1AC1A 3IC4A 4V1Ag 4OWYA 3N9JA 1FOHA 3L9UA 2H6YA 1MD3A 3CSHA 3VWVA 2WCIA 1JZRA 4K2DA 4TN8A 2P31A 1AQWA 2A4HA 2R37A 5J5NA 3RAZA 4TOPA 1A8LA 3BJ5A 1QQ2A 3F6FA 3UMAA 3ERGA 1O73A 4FQUA 4TR4A 4HU7A 2WJUA 3FYGA 4J56E 5J9CA 4N10A 2M46A 2MBSA 4RQXA 3M0FA 1GSEA 4EC0A 3CRTA 3KZQA 3RBTA 3CSIA 3MAKA 4JU5A 3TJFA 1S3AA 1BYEA 2YWNA 1Z7RA 2GLRA 1ZMAA 2BTOT 4JBBA 2LV3A 4K2XA 1GH2A 1A2MA 1WRYA 4F0CA 2HZEB 1AQVA 4ILFA 4RQRA 4CY6A 4EDZA 3EYTA 4NPBA 2FGXA 4TR3A 1GNEA 3MNGA 1XPVA 1O7UA 2QA1A 2GTUA 1ZYNA 5KOWA 4IQ1A 1XVQA 4IKHA 3F6DA 3O3TA 3ZL5A 1EWXA 1O6JA 4MPGA 3ZREA 2VLUA 4FO5A 2DJJA 3DD3A 4K7IA 4WKWA 3L78A 3KM6A 3MYDA 1S3CA 3PGTA 4NV2A 1V2AA 3HJOA 10GSA 5D96A 1SU9A 1Z5YE 3D5JA 1DE1A 3FW2A 3DIEA 3KH7A 1A0FA 5FT3A 1B4PA 3TOUA 5KEJA 1T00A 2HRFA 4L0UA 3APQA 2R0GA 4POMA 5G31A 1GP1A 2LNTA 1XWCA 4HQSA 2PVQA 5CRDA 2IIYA 1YKCA 4Q5RA 3TKPA 5GAPD 2DKIA 4KH7A 3GX8A 1M9BA 1GSSA 3VURA 3L4NA 2A4VA 20GSA 1IYIA 2DJ1A 1NM3A 4MF5A 3RHCA 2C0GA 2TIRA 1G6YA 4PX1A 1SK0A 1QUWA 3ED3A 2YV9A 1J08A 2DIYA 2CA8A 2L5LA 1TK0B 4ML6A 1WP0A 4NHWA 4ZBBA 3KD0A 3FEUA 2DJ3A 1KBNA 3GSSA 4IS0A 4MZCA 3I69A 3RHBA 2B7KA 5DQYA 2HYXA 2R3XA 2H19A 2YNXA 2LS5A 3MDKA 1TU7A 2CX4A 1M3IA 4J57E 3EU3A 2WRTA 3HD5A 2KUCA 3HVVA 2OKAA 1V40A 1UN2A 1X0RA 3QFAC 3ZVJA 4USSA 1GSYA 1XIYA 4HI7A 1ACVA 2HI7A 2G2QA 2I9HA 2YZHA 5H5SA 1GUMA 5IMCA 1QMVA 4OFMA 3F0IA 5HQPA 5IO2A 2H1AA 2BJXA 4Q5QA 5CRGA 4O32A 3TJKA 2H6XA 3PINA 5IMDA 3ZMLA 4KCAA 3LG6A 2VIMA 2L6DA 2L4QA 4IQAA 4RUVA 5IMFA 1PQNA 2QSIA 4K7NA 2B5XA 4YAVA 2F9SA 3TJGA 3DVXA 1T3BA 5J41A 3FZ5A 1NSWA 1EGOA 1R4WA 2GSSA 2YZUA 2JADA 3A3TA 5ECMB 3CYNA 3UARA 2VL3A 1EV4A 3M1GA 1R5AA 4I2TA 5CAXA 5GAND 3IK9A 2XHFA 3D22A 2YP6A 3TRQA 2VOCA 2C0DA 3F8UA 3P2AA 3HZ4A 2GT5A 3HVSA 5HR1A 1SL2B 3UOMA 1XWKA 3HHVA 4BA7A 3HDCA 5DAKB 1O81A 4LMVA 4YKFA 4AJ8A 5DALB 2FUG2 1XOAA 1PRXA 3NZNA 4TXVA 3LXTA 2IMDA 3A5WA 2IMEA 2LTKA 4K1FA 1ML6A 2K18A 4XRDA 3D4MA 3F9UA 4X0XA 3CSJA 3EMXA 2IL3A 4MJEA 1SD9A 4GF0A 2CT6A 3CQFA 3Q74A 4NMUA 4EO3A 4G2EA 2RM5A 4CY8A 3KCMA 4O5UA 2MZCA 4V2LA 2QKEA 3QMXA 4D73A 3C73A 1GTIA 4CW9A 3UL3A 4JR6A 5DVBA 4WR5A 3MWHA 3M9KA 2N5AA 2FY6A 4G0KA 2IFQB 3DGQA 1Z3EA 1A0RP 1JHBA 2L59A 1U3AA 2V6OA 1B8XA 3FY7A 3A2XA 3L9VA 2C1YA 3KIJA 2YV7A 1K0DA 1URMA 2O8VB 4OD7A 4GQFA 3IAM2 2XPDA 1Y25A 4CDOA 2EIRA 3RPNA 4ACSA 2B6MA 1T8EB 3BD2A 3DRNA 2M72A 4ICYA 3EC3A 1R7HA 4N11A 1ZYPA 4O92A 4WF4A 3O6TA 3GTUA 2VCQA 5F05A 3F4TA 1CQGA 2PVOC 1PD21 2AAWA 1YKAA 2X99A 2GS3A 2H6ZA 2WS2A 4GQCA 5KOXA 4HZ4A 1V57A 4F0BA 9GSSA 3QOUA 5F06A 2FA8A 4KUNA 5KN1A 3D0ZA 2HXKA 2FLSA 2X4AA 1BQ7A 2YJ7A 4FYBA 5DJMA 2HSHA 1R5PA 2B1KA 1OVNA 4GSSA 3GX0A 1FG4A 4Q5FA 2GZPA 1WWJA 5FWGA 1GTBA 3GSTA 1FB6A 1U87A 2R0CA 3IPZA 4WEYA 4MH3A 3OR5A 4NAXA 2KOKA 2H0HA 1BAYA 2L6CA 3Q18A 1JFUA 4AF2A 4HOJA 5ID2A 2FWFA 2I81A 5HFGA 1PKWA 2BMXA 2LRTA 1MDJA 3GKMA 4E8EA 3VFIA 1F9MA 3FK8A 1OC9A 3FZ4A 3LSZA 1PX6A 4OO4A 5JWQB 3U6VA 13GSA 1GSFA 4GSTA 3APOA 4POLA 1TXXA 3QAWA 5AIXA 1XW6A 1FOVA 1EEMA 3IA1A 3KTBA 2O89A 5AN1A 2MMOA 5GSSA 3UBLA 4BL7A 1VF4A 3GIXA 5IMZA 5B7CA 2O7KA 2PERA 4LMWA 5D93A 3A5IA 3Q6OA 5CO3A 4MPFA 5AISA 3ZFBA 2R4VA 5CNWA 5D9VA 2MBTA 2A2SA 1ZCPA 3ZZXA 4EF0A 3BOAA 2NVLA 3HXSA 5INYA 1PSQA 3E9JB 1PGTA 1T4YA 2PUKC 5DBQA 3A2VA 4I97A 4ZBDA 3LYKA 2KLXA 3F3QA 4PQIA 2LSTA 3GMFA 2F51A 4ZL8A 4KB3A 2IMIA 2RIIA 4TXOB 1PKZA 4K0NA 1SJIA 4XCSA 1F3AA 3KTLA 4POBA 2B1LA 4WR4A 3FHKA 4LA1A 3HA9A 3TKSE 3Q19A 4G0IA 1WJKA 2HRAA 4DSSA 1WMJA 4TRXA 5CRHA 4ZB9A 3L0HA 1X5CA 2D2ZA 2H66A 3TB2A 2TRCP 3A2WA 4KA0A 1DUGA 1G7EA 4FIWA 2VD1A 1AW9A 2WGRA 2VO4A 4PQHA 3CRUA 5EVOA 2JZSA 1QXHA 3ZRDA 2GQLA 1U88A 3UBKA 1K3YA 3GKXA 1T7PB 4JRRA 3H79A 3QAVA 4ZL9A 2AYTA 1G7OA 1OKDA 3IR4A 1BJXA 1YY7A 14GSA 4TR1B 5AIVA 4MF7A 1M2BA 3VPTA 1E6BA 5D9TA 2LUSA 5ECNB 1B4QA 4XTSA 3W8JA 3IAS2 12GSA 4ECBA 2GVPA 2H75A 1Z6MA 3I43A 2H71A 5HFIA 2GQMA 1EOGA 1K0AA 3F4SA 5HR2A 1ZYEA 3D6IA 4P3YB 3QAGA 3FR3A 1YDKA 4YKGA 4LLRA 5ECSA 2QC7A 1HNBA 2WB9A 6GSWA 2KHPA 1QK8A 5LD0A 1V98A 4NXIA 5E59A 2WZ9A 2FHEA 2YN1A 2XBIA 3G7JA 4BVXB 2V41A 2VLTA 1TDIA 5IPGA 4IP6A 3ERWA 1ON4A 3IDVA 2P0GA 3KMOA 2EIQA 4MF6A 4N30A 1H4OA 5CP1A 1B48A 2JU5A 4MK3A 5CREA 1Q98A 1GUHA 5EPFA 1M99A 1QGVA 5H5QA 4IELA 2DJKA 3QR6A 3TKRA 5ECRB 2DSAA 1TW9A 4ZL7A 2X8CA 4IGJA 1NHYA 1XXUA 5ECQB 3EPTA 3TGZA 3N5OA 4PTSA 5IOWA 1LJRA 4TW5A 1DE2A 1K3LA 3J7Yk 4V2MA 3DYRA 2HRNA 5D9XA 5KN3A 1F3BA 2NDOA 5ECIB 1M9AA 4K8MA 4IVFA 1OC3A 4YAPA 2C3NA 4HUAA 1K3OA 3VK9A 1V9WA 1XWBA 4WF5A 4KSOA 1THXA 4KDYA 2GQKA 2E7PA 4OCEA 2J23A 5JCGA 5GSTA 5JWOB 22GSA 1TP9A 2OE3A 5B6MA 2N5BA 3LORA 1ZYQB 5A4WA 1ZOFA 3WT2A 4EUYA 2JZTA 3C1SA 3KEBA 4LL4B 3C7MA 5IPHA 2LQOA 3RPPA 2HSMA 4DSRA 2JSYA 2DLXA 2H70A 5IQYA 4X43A 3BBYA 1ZL9A 4IJ3A 3GNJA 5JWRB 5C00A 3UAPA 1J0FA 2B5YA 4L0WA 2EC4A 4HJMA 4AJ6A 4NHZA 2H01A 2RUFA 3US3A 5JCWA 2WFCA 3WT1A 2CV4A 4I8BA 1XBSA 3LFLA 1SK1A 3GKKA 4MJBA 3ISOA 1S3RA 3UEMA 2H73A 3M3MA 3FZAA 2JL4A 3P7XA 4QL7A 4RI7A 5G5FA 4ZIJA 1ZZYA 2LKUA 1SYXA 1VF3A 4EDYA 4PXOA 5ELGA 2AUVA 1WOUA 2ZNMA 1LBKA 2YOIA 3JCML 1F6MC 2NPBA 2C8UA 4YQMA 3VI5A 4GLTA 2LNSA 5J9BA 5J3RA 4GWRA 4QQ7A 5D9WA 1GL8A 4HSCX 3FZ9A 2E0QA 4PNFA 5F0GA 2VM2A 4H86A 4F9ZA 2K6VA 2H1DA 1SL1B 1FW1A 1PN0A 1JLWA 2TRXA 2AV4A 1PX7A 4PUAA 5G5EA 2VCXA 3SBCA 3PPUA 5G1LA 3E0UA 6GSYA 3G7IA 19GSA 2MMZA 1K0OA 3H4KA 3R3EA 4GRFA 2LRNA 4EVMA 1SK2A 2HRKA 4GCIA 2VM1A 1KEBA 3I6AA 1T1VA 5ECHB 2DKHA 3UJ1A 1B9YC 2F8FA 4O5QA 4RI6A 2IJYA 3IE3A 4TR0A 4HQZA 3DMLA 3UVHA 2OACA 3R2QA 1VGLA 4BIKA 4MDCA 2OJLA 2UZ8A 4PURA 8GSSA 1PFOA 3QCPA 3FKFA 7GSSA 3TKQA 3ZFLA 1PN9A 2VD0A 2GZZA 2PN8A 2IN3A 1GULA 1GUKA 2QA2A 2YWMA 4K5SA 2LJRA 2DC5A 4HS1A 2R6KA 2YCDA 4L5LA 3DXBA 1Q4JA 1JLVA 5LCZA 16GSA 2X8HA 4XHMA 2CAQA 4AGSA 1HYUA 4IBPA 4ML1A 2VCZA 2JZRA 2ON5A 2J9HA 4HDEA 4HEA2 5AGYA 3F63A 4AJ7A 1GTUA 5IMVA 1UA5A 3ERFA 4YQVA 3GYKA 5H5RA 4HJ2A 2R0PA 4DEJA 3IOSA 2H8LA 4EE0A 1W4VA 1PA3A 3WGDA 3CXGA 2HE3A 2K9FA 1TI1A 4BPYA 1TI3A 3ZITA 2HZEA 2VAFA 1SL0B 2DMLA 2N5FA 4FH8A 1O8WA 3GN3A 1K0NA 3TCOA 4BWSA 1N2AA 4MJCA 4O5RA 1M2DA 2WDUA 1B9XC 1UC7A 2B3SA 4Z2TA 2V1MA 3LGCA 3ZIVA 1A23A 2VCTA 5DQSA 2H74A 2I4AA 2VCVA 5IO0A 3I9V2 2XPEA 2IPAA 2VLVA 1IYHA 3DEXA 1SKWB 5CYYA 3MIXA 1DSBA 3S9FA 5ECOB 3SWLA 3V1WA 4OCFA 3ZVJD 2B5EA 4BVYB 1XW5A 1VF2A 3TRXA 2CVKA 1OAZA 3ZTLA 4OMVA 2FWHA 1BEDA 5A4UA 4MNNA 5IIZA 1WIKA 3TKSA 3GFKA 4ZXGA 1AXDA 2Z9SA 2R2JA 1FHEA 4FYCA 3LEFA 5DCGA 2C3TA 1TRUA 4IN0A 3EURA 2L57A 1K0MA 1M7TA 1FB0A 4D73B 1G6WA 4XS1A 3TJJA 2X64A 3KMNA 4JEDA 4XIHA 3TRPA 2MYGA 1HQOA 5ABRA 1XVWA 3KP9A 1Z6NA 1FAAA 3HVNA 3PH9A 4KGIA 2HNLA 1XWAA 4MABA 1XZOA 3TDGA 2IMFA 3IXRA 2FNOA 1MDIA 2I3YA 5B8BA 1XCCA
chains in the Genus database with same CATH topology
4KF9A 5ENUA 1AQXA 4ZILA 2A2RA 1M2AA 3G7YA 1JZOA 4Z2UA 2YPMA 1X5EA 2VL2C 2OE0A 2CAIA 3C71A 4ECJA 4OO5A 4A5PA 2XBQA 2OA7A 2GSTA 1SKRB 5D8IA 4KSMA 2LJAA 1FVKA 5F07A 2REMA 1X5DA 3D21A 2R5GA 1XW9A 3GTUB 2DJ2A 3ZMKA 4I5QA 4YQUA 1U6TA 2GDRA 3APSA 5IM9A 1HNAA 1EOHA 2ES7A 4EXJA 3IC8A 2VL9A 1A8YA 4N0VA 3EWLA 2ALBA 4IP1A 2I1UA 1O8XA 5G30A 4DVCA 1OE7A 3CMIA 4V2NA 2ZCTA 5HR3A 2RLIA 1SJ6A 1EEJA 4ZB6A 4POKA 3UIWA 1W89A 5ID2B 4OFTA 1PL1A 4EIPA 3F3RA 3H1NA 4ECIA 2JACA 5DCHA 4K0GA 4HZ2A 1OC9B 2LJKA 1TRSA 3MSZA 4NWYA 1VRSD 2H30A 3DKSA 1LU4A 2YJHA 4PNGA 4KW6A 4E8HA 17GSA 3U5RE 4XS4B 1AUCA 1YF0A 4WBRD 4GXZA 1O85A 1USBA 4BL7B 2G0FA 3VWUA 4KAEA 2LRCA 5IMAA 4K6XA 2X8GA 4JR4A 1H75A 2DBCA 5A5KA 1FVJA 4QL9A 1MEKA 1YF1A 3W8SA 2DJ0A 3GUSA 5DAKA 2FD3A 2CX3A 2HZFA 4ZB8A 4KX4A 4K7OA 2O87A 1ST9A 3HZ8A 5FHIA 5DALA 4MH2A 2F3MA 3IRAA 1TRVA 5G1KA 4PUFC 1PL2A 4ISDA 2C0FA 2OE1A 5L71A 1TU8A 4WXTA 4PGTA 6GSSA 1K0CA 4FYUA 3BCIA 5EL8A 2CVBA 2K8VA 3CTFA 4G0LA 1XOBA 6GSXA 1U3IA 1GNWA 1NW2A 2FA4A 3IBHA 2B7JA 4MP4A 6GSTA 1ERVA 3GH6A 2CQ9A 4OFNA 4DSSB 3P90A 5HFKA 1N8JA 3H93A 3DWVA 1X9MB 3GA4A 4F82A 1MDKA 2PBJA 6GSUA 3IV4A 4KE3A 6GSVA 5EY6A 2JSZA 1XWGA 1F2EA 2IFQA 3KGKA 4L8EA 5C04A 1ILOA 2AB6A 1I9DA 4MZWA 1FO5A 1ABAA 4JE1A 4GTUA 1TJDA 2O85A 2HSYA 1OYJA 5G2ZA 1X9SB 2QGVA 5A4VA 2CVDA 3DVWA 3J7Yb 1GSQA 3WGXA 1E2YA 2YWIA 3TOTA 2RUEA 5F8BA 1ERUA 4BWQA 4EKZA 4K5RA 3WD6A 1R26A 5B8AA 1MTCA 5HR0A 2HT9A 4XRAA 5J4UA 2IWTA 2P5RA 3EU4A 2H1GA 2VL2A 1OC8A 1KNGA 5ECKB 3UVTA 1C72A 4KCEA 1SJZA 5IOXA 2L4CA 2H76A 3EVIA 2C3QA 2PU9C 2LEGA 5E4WA 3LQ7A 4ULXA 1VF1A 4K9ZA 4IJIA 3LWAA 4I6XA 4MCUA 3F4RA 1Z7PA 4X1UA 5KN0A 4G19A 5LNKe 1WE0A 3TKSC 1YEPA 4ID0A 1I5GA 1GTAA 1YQ1A 4EL1A 4J2FA 4XS6A 2V6KA 3GRXA 5BRTA 3P8WA 3GL3A 5COHA 1TRWA 4LL1B 1M0UA 4L5OA 2PWJA 3ME8A 4HU9A 3LYPA 2MMAA 4WETA 3IK7A 2RM6A 3HYPA 4ZBAA 3EINA 3GV1A 4X4JA 1ERTA 1EP8A 3IHGA 4KDXA 2OBIA 3FR9A 5BMUA 2C80A 3RDWA 2NBSA 4BVYA 2OBKA 1OKTA 3GKNA 18GSA 1SD8A 1NHOA 3O76A 2PMTA 2FWEA 1YEXA 2X49A 1A2JA 5CRWA 2F8AA 1RK4A 1A2LA 3QDNA 3KXOA 4MMMA 2DIZA 3FR6A 3IHQA 3G9BA 3EE2A 3TJBA 4Z7XA 3LXZA 2FWGA 1QFNA 4TXOA 2E2GA 2VUPA 4IW9A 1TK8B 1OE8A 3LJRA 1J9BA 2LQQA 3M8NA 4Z2RA 3WGEA 1X9WB 2OADA 1DBYA 5ECPB 1GSUA 1YJ6A 2L5OA 4GSNA 3H8QA 3HY2A 3ZYWA 3HKRA 3VLNA 3M9JA 4V1Ap 1EV9A 1Y6EA 3VWWA 4WBJA 3HCZA 3W6GA 1GRXA 1TOFA 3EMPA 4IHUA 1TK5B 3QFBC 3HJMA 2K8SA 4F03A 5KN2A 2GSQA 2CZ2A 1MD4A 2AJQB 1BG5A 3L9SA 4ECCA 4MZBA 3QPMA 3D4TA 3ZLPA 3TUEA 5JCUA 5DJLA 4DSQA 3GHAA 2ON7A 4F2IA 4KDUA 4O7HA 1KTEA 3GL5A 3ZIJA 2P5QA 3C1RA 1GSDA 4TR1A 3FRCA 2A2PA 3KJYA 3LW9A 1GLQA 4MLYA 2V32A 2FCHA 5D73A 1ERWA 3ME7A 11GSA 1EGRA 2VCWA 4MA9A 1HD2A 3VI7A 4NV5A 2YWOA 1AIUA 3NIVA 2C4JA 1CQHA 4CHSA 3KP8A 1GLPA 2GGTA 4MJAA 1XFLA 2E2MA 2V2GA 3NOFA 2GSRA 5GZZB 1GWCA 2IMKA 4TKYA 4N0ZA 1YZXA 4PQ1A 1G0TA 1F37A 2KP2A 3CTGA 1THOA 2EIOA 4BVXA 1SKSB 3K8NA 3HVXA 1BX9A 1HNCA 4G9HA 2KP1A 2CZ3A 1AAZA 2PPTA 4JZQA 2MMNA 2HLSA 1WPIA 1JZWA 3GURA 4XS4A 1K0BA 4Q5NA 2C0EA 3VPQA 5B6NA 2WULA 1ZGNA 1TKDB 3AY8A 2H1BA 1S3DA 2PGTA 1SYRA 2H72A 2GZYA 4TVEA 1A24A 5ELAA 2HFDA 1JZDA 5DDLA 1EZKA 1UVZA 2NTOA 3E3EA 3WYWA 3C8EA 1PMTA 2H0GA 4YH2A 1T4ZA 3BCKA 2ZUPA 2AHEA 2GT6A 1TTZA 2DMMA 1EP7A 2YANA 3FMWA 3VWXA 3GH9A 1SENA 2XC2A 3KH9A 1RW1A 3CBUA 1Z9HA 5ECLB 3HJPA 2H0IA 1V58A 4G10A 1RQMA 4EIQA 3QD9A 4KNDA 3PR8A 2M80A 4I2UA 1AC1A 3IC4A 4V1Ag 4OWYA 3N9JA 1FOHA 3L9UA 2H6YA 1MD3A 3CSHA 3VWVA 2WCIA 1JZRA 4K2DA 4TN8A 2P31A 1AQWA 2A4HA 2R37A 5J5NA 3RAZA 4TOPA 1A8LA 3BJ5A 1QQ2A 3F6FA 3UMAA 3ERGA 1O73A 4FQUA 4TR4A 4HU7A 2WJUA 3FYGA 4J56E 5J9CA 4N10A 2M46A 2MBSA 4RQXA 3M0FA 1GSEA 4EC0A 3CRTA 3KZQA 3RBTA 3CSIA 3MAKA 4JU5A 3TJFA 1S3AA 1BYEA 2YWNA 1Z7RA 2GLRA 1ZMAA 2BTOT 4JBBA 2LV3A 4K2XA 1GH2A 1A2MA 1WRYA 4F0CA 2HZEB 1AQVA 4ILFA 4RQRA 4CY6A 4EDZA 3EYTA 4NPBA 2FGXA 4TR3A 1GNEA 3MNGA 1XPVA 1O7UA 2QA1A 2GTUA 1ZYNA 5KOWA 4IQ1A 1XVQA 4IKHA 3F6DA 3O3TA 3ZL5A 1EWXA 1O6JA 4MPGA 3ZREA 2VLUA 4FO5A 2DJJA 3DD3A 4K7IA 4WKWA 3L78A 3KM6A 3MYDA 1S3CA 3PGTA 4NV2A 1V2AA 3HJOA 10GSA 5D96A 1SU9A 1Z5YE 3D5JA 1DE1A 3FW2A 3DIEA 3KH7A 1A0FA 5FT3A 1B4PA 3TOUA 5KEJA 1T00A 2HRFA 4L0UA 3APQA 2R0GA 4POMA 5G31A 1GP1A 2LNTA 1XWCA 4HQSA 2PVQA 5CRDA 2IIYA 1YKCA 4Q5RA 3TKPA 5GAPD 2DKIA 4KH7A 3GX8A 1M9BA 1GSSA 3VURA 3L4NA 2A4VA 20GSA 1IYIA 2DJ1A 1NM3A 4MF5A 3RHCA 2C0GA 2TIRA 1G6YA 4PX1A 1SK0A 1QUWA 3ED3A 2YV9A 1J08A 2DIYA 2CA8A 2L5LA 1TK0B 4ML6A 1WP0A 4NHWA 4ZBBA 3KD0A 3FEUA 2DJ3A 1KBNA 3GSSA 4IS0A 4MZCA 3I69A 3RHBA 2B7KA 5DQYA 2HYXA 2R3XA 2H19A 2YNXA 2LS5A 3MDKA 1TU7A 2CX4A 4J57E 3EU3A 2WRTA 3HD5A 2KUCA 3HVVA 2OKAA 1V40A 1UN2A 1X0RA 3QFAC 3ZVJA 4USSA 1GSYA 1XIYA 4HI7A 1ACVA 2HI7A 2G2QA 2I9HA 2YZHA 5H5SA 1GUMA 5IMCA 1QMVA 4OFMA 3F0IA 5HQPA 5IO2A 2H1AA 2BJXA 4Q5QA 5CRGA 4O32A 3TJKA 2H6XA 3PINA 5IMDA 3ZMLA 4KCAA 3LG6A 2VIMA 2L6DA 2L4QA 4IQAA 4RUVA 5IMFA 1PQNA 2QSIA 4K7NA 2B5XA 4YAVA 2F9SA 3TJGA 3DVXA 1T3BA 5J41A 3FZ5A 1NSWA 1EGOA 1R4WA 2GSSA 2YZUA 2JADA 3A3TA 5ECMB 3CYNA 3UARA 2VL3A 1EV4A 3M1GA 1R5AA 4I2TA 5CAXA 5GAND 3IK9A 2XHFA 3D22A 2YP6A 3TRQA 2VOCA 2C0DA 3F8UA 3P2AA 3HZ4A 2GT5A 3HVSA 5HR1A 1SL2B 3UOMA 1XWKA 3HHVA 4BA7A 3HDCA 5DAKB 1O81A 4LMVA 4YKFA 4AJ8A 5DALB 2FUG2 1XOAA 1PRXA 3NZNA 4TXVA 3LXTA 2IMDA 3A5WA 2IMEA 2LTKA 4K1FA 1ML6A 2K18A 4XRDA 3D4MA 3F9UA 4X0XA 3CSJA 3EMXA 2IL3A 4MJEA 1SD9A 4GF0A 2CT6A 3Q74A 4NMUA 4EO3A 4G2EA 2RM5A 4CY8A 3KCMA 4O5UA 2MZCA 4V2LA 2QKEA 3QMXA 4D73A 3C73A 1GTIA 4CW9A 3UL3A 4JR6A 5DVBA 4WR5A 3MWHA 3M9KA 2N5AA 2FY6A 4G0KA 2IFQB 3DGQA 1Z3EA 1A0RP 1JHBA 2L59A 1U3AA 2V6OA 1B8XA 3FY7A 3A2XA 3L9VA 2C1YA 3KIJA 2YV7A 1K0DA 1URMA 2O8VB 4OD7A 4GQFA 3IAM2 2XPDA 1Y25A 4CDOA 2EIRA 3RPNA 4ACSA 2B6MA 1T8EB 3BD2A 3DRNA 2M72A 4ICYA 3EC3A 1R7HA 4N11A 1ZYPA 4O92A 4WF4A 3O6TA 3GTUA 2VCQA 5F05A 3F4TA 1CQGA 2PVOC 1PD21 2AAWA 1YKAA 2X99A 2GS3A 2H6ZA 2WS2A 4GQCA 5KOXA 4HZ4A 1V57A 4F0BA 9GSSA 3QOUA 5F06A 2FA8A 4KUNA 5KN1A 3D0ZA 2HXKA 2FLSA 2X4AA 1BQ7A 2YJ7A 4FYBA 5DJMA 2HSHA 1R5PA 2B1KA 1OVNA 4GSSA 3GX0A 1FG4A 4Q5FA 2GZPA 1WWJA 5FWGA 1GTBA 3GSTA 1FB6A 1U87A 2R0CA 3IPZA 4WEYA 4MH3A 3OR5A 4NAXA 2KOKA 2H0HA 1BAYA 2L6CA 3Q18A 1JFUA 4AF2A 4HOJA 5ID2A 2FWFA 2I81A 5HFGA 1PKWA 2BMXA 2LRTA 1MDJA 3GKMA 4E8EA 3VFIA 1F9MA 3FK8A 1OC9A 3FZ4A 3LSZA 1PX6A 4OO4A 5JWQB 3U6VA 13GSA 1GSFA 4GSTA 3APOA 4POLA 1TXXA 3QAWA 5AIXA 1XW6A 1FOVA 1EEMA 3IA1A 3KTBA 2O89A 5AN1A 2MMOA 5GSSA 3UBLA 4BL7A 1VF4A 3GIXA 5IMZA 5B7CA 2O7KA 2PERA 4LMWA 5D93A 3A5IA 3Q6OA 5CO3A 4MPFA 5AISA 3ZFBA 2R4VA 5CNWA 5D9VA 2MBTA 2A2SA 1ZCPA 3ZZXA 4EF0A 3BOAA 2NVLA 3HXSA 5INYA 1PSQA 3E9JB 1PGTA 1T4YA 2PUKC 5DBQA 3A2VA 4I97A 4ZBDA 3LYKA 2KLXA 3F3QA 4PQIA 2LSTA 3GMFA 2F51A 4ZL8A 4KB3A 2IMIA 2RIIA 4TXOB 1PKZA 4K0NA 1SJIA 4XCSA 1F3AA 3KTLA 4POBA 2B1LA 4WR4A 3FHKA 4LA1A 3HA9A 3TKSE 3Q19A 4G0IA 1WJKA 2HRAA 4DSSA 1WMJA 4TRXA 5CRHA 4ZB9A 3L0HA 1X5CA 2D2ZA 2H66A 3TB2A 2TRCP 3A2WA 4KA0A 1DUGA 1G7EA 4FIWA 2VD1A 1AW9A 2WGRA 2VO4A 4PQHA 3CRUA 5EVOA 2JZSA 1QXHA 3ZRDA 2GQLA 1U88A 3UBKA 1K3YA 3GKXA 1T7PB 4JRRA 3H79A 3QAVA 4ZL9A 2AYTA 1G7OA 1OKDA 3IR4A 1BJXA 1YY7A 14GSA 4TR1B 5AIVA 4MF7A 1M2BA 3VPTA 1E6BA 5D9TA 2LUSA 5ECNB 1B4QA 4XTSA 3W8JA 3IAS2 12GSA 4ECBA 2GVPA 2H75A 1Z6MA 3I43A 2H71A 5HFIA 2GQMA 1EOGA 1K0AA 3F4SA 5HR2A 1ZYEA 3D6IA 4P3YB 3QAGA 3FR3A 1YDKA 4YKGA 4LLRA 5ECSA 2QC7A 1HNBA 2WB9A 6GSWA 2KHPA 1QK8A 5LD0A 1V98A 4NXIA 5E59A 2WZ9A 2FHEA 2YN1A 2XBIA 3G7JA 4BVXB 2V41A 2VLTA 1TDIA 5IPGA 4IP6A 3ERWA 1ON4A 3IDVA 2P0GA 3KMOA 2EIQA 4MF6A 4N30A 1H4OA 5CP1A 1B48A 2JU5A 4MK3A 5CREA 1Q98A 1GUHA 5EPFA 1M99A 1QGVA 5H5QA 4IELA 2DJKA 3QR6A 3TKRA 5ECRB 2DSAA 1TW9A 4ZL7A 2X8CA 4IGJA 1NHYA 1XXUA 5ECQB 3EPTA 3TGZA 3N5OA 4PTSA 5IOWA 1LJRA 4TW5A 1DE2A 1K3LA 3J7Yk 4V2MA 3DYRA 2HRNA 5D9XA 5KN3A 1F3BA 2NDOA 5ECIB 1M9AA 4K8MA 4IVFA 1OC3A 4YAPA 2C3NA 4HUAA 1K3OA 3VK9A 1V9WA 1XWBA 4WF5A 4KSOA 1THXA 4KDYA 2GQKA 2E7PA 4OCEA 2J23A 5JCGA 5GSTA 5JWOB 22GSA 1TP9A 2OE3A 5B6MA 2N5BA 3LORA 1ZYQB 5A4WA 1ZOFA 3WT2A 4EUYA 2JZTA 3C1SA 3KEBA 4LL4B 3C7MA 5IPHA 2LQOA 3RPPA 2HSMA 4DSRA 2JSYA 2DLXA 2H70A 5IQYA 4X43A 3BBYA 1ZL9A 4IJ3A 3GNJA 5JWRB 5C00A 3UAPA 1J0FA 2B5YA 4L0WA 2EC4A 4HJMA 4AJ6A 4NHZA 2H01A 2RUFA 3US3A 5JCWA 2WFCA 3WT1A 2CV4A 4I8BA 1XBSA 3LFLA 1SK1A 3GKKA 4MJBA 3ISOA 3UEMA 2H73A 3M3MA 3FZAA 2JL4A 3P7XA 4QL7A 4RI7A 5G5FA 4ZIJA 1ZZYA 2LKUA 1SYXA 1VF3A 4EDYA 4PXOA 5ELGA 2AUVA 1WOUA 2ZNMA 1LBKA 2YOIA 3JCML 1F6MC 2NPBA 2C8UA 4YQMA 3VI5A 4GLTA 2LNSA 5J9BA 5J3RA 4GWRA 4QQ7A 5D9WA 1GL8A 3FZ9A 2E0QA 4PNFA 5F0GA 2VM2A 4H86A 4F9ZA 2K6VA 2H1DA 1SL1B 1FW1A 1PN0A 1JLWA 2TRXA 2AV4A 1PX7A 4PUAA 5G5EA 2VCXA 3SBCA 3PPUA 5G1LA 3E0UA 6GSYA 3G7IA 19GSA 2MMZA 1K0OA 3H4KA 3R3EA 4GRFA 2LRNA 4EVMA 1SK2A 2HRKA 4GCIA 2VM1A 1KEBA 3I6AA 1T1VA 5ECHB 2DKHA 3UJ1A 1B9YC 2F8FA 4O5QA 4RI6A 2IJYA 3IE3A 4TR0A 4HQZA 3DMLA 3UVHA 2OACA 3R2QA 1VGLA 4MDCA 2OJLA 2UZ8A 4PURA 8GSSA 3QCPA 3FKFA 7GSSA 3TKQA 3ZFLA 1PN9A 2VD0A 2GZZA 2PN8A 2IN3A 1GULA 1GUKA 2QA2A 2YWMA 4K5SA 2LJRA 2DC5A 4HS1A 2R6KA 2YCDA 4L5LA 3DXBA 1Q4JA 1JLVA 5LCZA 16GSA 2X8HA 4XHMA 2CAQA 4AGSA 1HYUA 4IBPA 4ML1A 2VCZA 2JZRA 2ON5A 2J9HA 4HDEA 4HEA2 5AGYA 3F63A 4AJ7A 1GTUA 5IMVA 1UA5A 3ERFA 4YQVA 3GYKA 5H5RA 4HJ2A 2R0PA 4DEJA 3IOSA 2H8LA 4EE0A 1W4VA 1PA3A 3WGDA 3CXGA 2HE3A 2K9FA 1TI1A 4BPYA 1TI3A 3ZITA 2HZEA 2VAFA 1SL0B 2DMLA 2N5FA 4FH8A 1O8WA 3GN3A 1K0NA 3TCOA 4BWSA 1N2AA 4MJCA 4O5RA 1M2DA 2WDUA 1B9XC 1UC7A 2B3SA 4Z2TA 2V1MA 3LGCA 3ZIVA 1A23A 2VCTA 5DQSA 2H74A 2I4AA 2VCVA 5IO0A 3I9V2 2XPEA 2IPAA 2VLVA 1IYHA 3DEXA 1SKWB 5CYYA 3MIXA 1DSBA 3S9FA 5ECOB 3SWLA 3V1WA 4OCFA 3ZVJD 2B5EA 4BVYB 1XW5A 1VF2A 3TRXA 2CVKA 1OAZA 3ZTLA 4OMVA 2FWHA 1BEDA 5A4UA 4MNNA 5IIZA 1WIKA 3TKSA 3GFKA 4ZXGA 1AXDA 2Z9SA 2R2JA 1FHEA 4FYCA 3LEFA 5DCGA 2C3TA 1TRUA 4IN0A 3EURA 2L57A 1K0MA 1M7TA 1FB0A 4D73B 1G6WA 4XS1A 3TJJA 2X64A 3KMNA 4JEDA 4XIHA 3TRPA 2MYGA 1HQOA 5ABRA 1XVWA 3KP9A 1Z6NA 1FAAA 3PH9A 4KGIA 2HNLA 1XWAA 4MABA 1XZOA 3TDGA 2IMFA 3IXRA 2FNOA 1MDIA 2I3YA 5B8BA 1XCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENU A;  1AQX A;  4ZIL A;  2A2R A;  1M2A A;  3G7Y A;  1JZO A;  2YPM A;  1X5E A;  2VL2 C;  2OE0 A;  2CAI A;  3C71 A;  4ECJ A;  4OO5 A;  2XBQ A;  2OA7 A;  2GST A;  1SKR B;  5D8I A;  4KSM A;  2LJA A;  1FVK A;  5F07 A;  2REM A;  1X5D A;  3D21 A;  2R5G A;  1XW9 A;  3GTU B;  2DJ2 A;  3ZMK A;  4I5Q A;  4YQU A;  1U6T A;  2GDR A;  3APS A;  5IM9 A;  1HNA A;  1EOH A;  2ES7 A;  4EXJ A;  2VL9 A;  1A8Y A;  4N0V A;  3EWL A;  2ALB A;  4IP1 A;  2I1U A;  1O8X A;  5G30 A;  4DVC A;  1OE7 A;  3CMI A;  4V2N A;  2ZCT A;  5HR3 A;  2RLI A;  1SJ6 A;  1EEJ A;  4ZB6 A;  4POK A;  3UIW A;  1W89 A;  5ID2 B;  4OFT A;  1PL1 A;  3F3R A;  3H1N A;  4ECI A;  2JAC A;  5DCH A;  4K0G A;  4HZ2 A;  1OC9 B;  2LJK A;  1TRS A;  3MSZ A;  4NWY A;  1VRS D;  2H30 A;  3DKS A;  1LU4 A;  2YJH A;  4PNG A;  4KW6 A;  4E8H A;  17GS A;  3U5R E;  4XS4 B;  1AUC A;  1YF0 A;  4WBR D;  4GXZ A;  1O85 A;  1USB A;  2G0F A;  3VWU A;  4KAE A;  2LRC A;  5IMA A;  4K6X A;  2X8G A;  4JR4 A;  1H75 A;  2DBC A;  5A5K A;  1FVJ A;  4QL9 A;  1MEK A;  1YF1 A;  3W8S A;  2DJ0 A;  3GUS A;  5DAK A;  2FD3 A;  2CX3 A;  2HZF A;  4ZB8 A;  4KX4 A;  4K7O A;  2O87 A;  1ST9 A;  3HZ8 A;  5FHI A;  5DAL A;  4MH2 A;  2F3M A;  3IRA A;  1TRV A;  5G1K A;  4PUF C;  1PL2 A;  4ISD A;  2C0F A;  2OE1 A;  5L71 A;  1TU8 A;  4WXT A;  4PGT A;  6GSS A;  1K0C A;  4FYU A;  3BCI A;  5EL8 A;  2CVB A;  2K8V A;  3CTF A;  1XOB A;  6GSX A;  1U3I A;  1GNW A;  1NW2 A;  2FA4 A;  3IBH A;  2B7J A;  4MP4 A;  6GST A;  1ERV A;  3GH6 A;  2CQ9 A;  4OFN A;  4DSS B;  3P90 A;  5HFK A;  1N8J A;  3H93 A;  3DWV A;  1X9M B;  3GA4 A;  4F82 A;  1MDK A;  2PBJ A;  6GSU A;  3IV4 A;  4KE3 A;  6GSV A;  5EY6 A;  2JSZ A;  1XWG A;  1F2E A;  2IFQ A;  3KGK A;  4L8E A;  5C04 A;  1ILO A;  2AB6 A;  1I9D A;  4MZW A;  1FO5 A;  1ABA A;  4JE1 A;  4GTU A;  1TJD A;  2O85 A;  2HSY A;  1OYJ A;  5G2Z A;  1X9S B;  2QGV A;  5A4V A;  2CVD A;  3DVW A;  3J7Y b;  1GSQ A;  3WGX A;  1E2Y A;  2YWI A;  3TOT A;  2RUE A;  5F8B A;  1ERU A;  4BWQ A;  4EKZ A;  3WD6 A;  1R26 A;  5B8A A;  1MTC A;  5HR0 A;  2HT9 A;  4XRA A;  5J4U A;  2IWT A;  2P5R A;  3EU4 A;  2H1G A;  2VL2 A;  1OC8 A;  1KNG A;  5ECK B;  3UVT A;  1C72 A;  4KCE A;  1SJZ A;  5IOX A;  2L4C A;  2H76 A;  3EVI A;  2C3Q A;  2PU9 C;  2LEG A;  5E4W A;  3LQ7 A;  4ULX A;  1VF1 A;  4K9Z A;  4IJI A;  3LWA A;  4I6X A;  4MCU A;  3F4R A;  1Z7P A;  4X1U A;  5KN0 A;  4G19 A;  5LNK e;  1WE0 A;  3TKS C;  1YEP A;  4ID0 A;  1I5G A;  1GTA A;  1YQ1 A;  4EL1 A;  4J2F A;  4XS6 A;  2V6K A;  3GRX A;  3P8W A;  3GL3 A;  5COH A;  1TRW A;  4LL1 B;  1M0U A;  4L5O A;  2PWJ A;  3ME8 A;  4HU9 A;  3LYP A;  2MMA A;  4WET A;  3IK7 A;  2RM6 A;  3HYP A;  4ZBA A;  3EIN A;  3GV1 A;  1ERT A;  1EP8 A;  4KDX A;  2OBI A;  3FR9 A;  2C80 A;  3RDW A;  2NBS A;  4BVY A;  2OBK A;  1OKT A;  3GKN A;  18GS A;  1SD8 A;  1NHO A;  3O76 A;  2PMT A;  2FWE A;  1YEX A;  1A2J A;  5CRW A;  2F8A A;  1RK4 A;  1A2L A;  3QDN A;  3KXO A;  4MMM A;  2DIZ A;  3FR6 A;  3IHQ A;  3G9B A;  3EE2 A;  3TJB A;  4Z7X A;  3LXZ A;  2FWG A;  1QFN A;  4TXO A;  2E2G A;  2VUP A;  4IW9 A;  1TK8 B;  1OE8 A;  3LJR A;  1J9B A;  2LQQ A;  3M8N A;  3WGE A;  1X9W B;  2OAD A;  1DBY A;  5ECP B;  1GSU A;  1YJ6 A;  2L5O A;  4GSN A;  3H8Q A;  3HY2 A;  3ZYW A;  3HKR A;  3VLN A;  3M9J A;  4V1A p;  1EV9 A;  1Y6E A;  3VWW A;  4WBJ A;  3HCZ A;  3W6G A;  1GRX A;  1TOF A;  3EMP A;  4IHU A;  1TK5 B;  3QFB C;  3HJM A;  2K8S A;  4F03 A;  5KN2 A;  2GSQ A;  2CZ2 A;  1MD4 A;  2AJQ B;  1BG5 A;  3L9S A;  4ECC A;  4MZB A;  3QPM A;  3D4T A;  3ZLP A;  3TUE A;  5JCU A;  5DJL A;  4DSQ A;  3GHA A;  2ON7 A;  4F2I A;  4KDU A;  4O7H A;  1KTE A;  3GL5 A;  3ZIJ A;  2P5Q A;  3C1R A;  1GSD A;  4TR1 A;  3FRC A;  3KJY A;  1GLQ A;  4MLY A;  2V32 A;  2FCH A;  5D73 A;  1ERW A;  3ME7 A;  11GS A;  1EGR A;  2VCW A;  4MA9 A;  1HD2 A;  3VI7 A;  4NV5 A;  2YWO A;  1AIU A;  3NIV A;  2C4J A;  1CQH A;  4CHS A;  3KP8 A;  1GLP A;  2GGT A;  4MJA A;  1XFL A;  2E2M A;  2V2G A;  3NOF A;  2GSR A;  5GZZ B;  1GWC A;  2IMK A;  4TKY A;  4N0Z A;  1YZX A;  4PQ1 A;  1G0T A;  1F37 A;  2KP2 A;  3CTG A;  1THO A;  2EIO A;  4BVX A;  1SKS B;  3K8N A;  3HVX A;  1BX9 A;  1HNC A;  4G9H A;  2KP1 A;  2CZ3 A;  1AAZ A;  2PPT A;  4JZQ A;  2MMN A;  2HLS A;  1WPI A;  1JZW A;  3GUR A;  4XS4 A;  1K0B A;  4Q5N A;  2C0E A;  3VPQ A;  5B6N A;  2WUL A;  1ZGN A;  1TKD B;  3AY8 A;  2H1B A;  1S3D A;  2PGT A;  1SYR A;  2H72 A;  2GZY A;  4TVE A;  1A24 A;  5ELA A;  2HFD A;  1JZD A;  5DDL A;  1EZK A;  1UVZ A;  2NTO A;  3E3E A;  3WYW A;  3C8E A;  1PMT A;  2H0G A;  4YH2 A;  1T4Z A;  3BCK A;  2ZUP A;  2AHE A;  2GT6 A;  1TTZ A;  2DMM A;  1EP7 A;  2YAN A;  3VWX A;  3GH9 A;  1SEN A;  2XC2 A;  3KH9 A;  1RW1 A;  3CBU A;  1Z9H A;  5ECL B;  3HJP A;  2H0I A;  1V58 A;  4G10 A;  1RQM A;  3QD9 A;  4KND A;  3PR8 A;  2M80 A;  4I2U A;  1AC1 A;  3IC4 A;  4V1A g;  4OWY A;  3N9J A;  3L9U A;  2H6Y A;  1MD3 A;  3CSH A;  3VWV A;  2WCI A;  1JZR A;  4K2D A;  4TN8 A;  2P31 A;  1AQW A;  2R37 A;  5J5N A;  3RAZ A;  4TOP A;  1A8L A;  3BJ5 A;  1QQ2 A;  3F6F A;  3UMA A;  3ERG A;  1O73 A;  4TR4 A;  4HU7 A;  2WJU A;  3FYG A;  4J56 E;  5J9C A;  4N10 A;  2M46 A;  2MBS A;  4RQX A;  3M0F A;  1GSE A;  4EC0 A;  3CRT A;  3KZQ A;  3RBT A;  3CSI A;  3MAK A;  4JU5 A;  3TJF A;  1S3A A;  1BYE A;  2YWN A;  1Z7R A;  2GLR A;  1ZMA A;  2BTO T;  4JBB A;  2LV3 A;  1GH2 A;  1A2M A;  1WRY A;  4F0C A;  2HZE B;  1AQV A;  4ILF A;  4RQR A;  4EDZ A;  3EYT A;  4NPB A;  2FGX A;  4TR3 A;  1GNE A;  3MNG A;  1XPV A;  1O7U A;  2GTU A;  4IQ1 A;  1XVQ A;  4IKH A;  3F6D A;  3O3T A;  3ZL5 A;  1EWX A;  1O6J A;  4MPG A;  3ZRE A;  2VLU A;  4FO5 A;  2DJJ A;  3DD3 A;  4K7I A;  4WKW A;  3L78 A;  3KM6 A;  1S3C A;  3PGT A;  4NV2 A;  1V2A A;  3HJO A;  10GS A;  5D96 A;  1SU9 A;  1Z5Y E;  3D5J A;  1DE1 A;  3FW2 A;  3DIE A;  3KH7 A;  1A0F A;  5FT3 A;  1B4P A;  3TOU A;  5KEJ A;  1T00 A;  2HRF A;  4L0U A;  3APQ A;  4POM A;  5G31 A;  1GP1 A;  2LNT A;  1XWC A;  4HQS A;  2PVQ A;  5CRD A;  2IIY A;  1YKC A;  4Q5R A;  3TKP A;  5GAP D;  4KH7 A;  3GX8 A;  1M9B A;  1GSS A;  3VUR A;  3L4N A;  2A4V A;  20GS A;  1IYI A;  2DJ1 A;  1NM3 A;  4MF5 A;  3RHC A;  2C0G A;  2TIR A;  1G6Y A;  4PX1 A;  1SK0 A;  1QUW A;  3ED3 A;  2YV9 A;  1J08 A;  2DIY A;  2CA8 A;  2L5L A;  1TK0 B;  4ML6 A;  1WP0 A;  4NHW A;  4ZBB A;  3KD0 A;  3FEU A;  2DJ3 A;  1KBN A;  3GSS A;  4IS0 A;  4MZC A;  3I69 A;  3RHB A;  2B7K A;  5DQY A;  2HYX A;  2R3X A;  2H19 A;  2YNX A;  2LS5 A;  3MDK A;  1TU7 A;  2CX4 A;  4J57 E;  3EU3 A;  2WRT A;  3HD5 A;  2KUC A;  3HVV A;  2OKA A;  1V40 A;  1UN2 A;  1X0R A;  3QFA C;  3ZVJ A;  1GSY A;  1XIY A;  4HI7 A;  1ACV A;  2HI7 A;  2G2Q A;  2I9H A;  2YZH A;  5H5S A;  1GUM A;  5IMC A;  1QMV A;  4OFM A;  3F0I A;  5HQP A;  5IO2 A;  2H1A A;  2BJX A;  4Q5Q A;  5CRG A;  4O32 A;  3TJK A;  2H6X A;  3PIN A;  5IMD A;  3ZML A;  4KCA A;  3LG6 A;  2VIM A;  2L6D A;  2L4Q A;  4IQA A;  4RUV A;  5IMF A;  1PQN A;  2QSI A;  4K7N A;  2B5X A;  4YAV A;  2F9S A;  3TJG A;  3DVX A;  1T3B A;  5J41 A;  3FZ5 A;  1NSW A;  1EGO A;  1R4W A;  2GSS A;  2YZU A;  2JAD A;  3A3T A;  5ECM B;  3CYN A;  3UAR A;  2VL3 A;  1EV4 A;  3M1G A;  1R5A A;  4I2T A;  5CAX A;  5GAN D;  3IK9 A;  2XHF A;  3D22 A;  2YP6 A;  3TRQ A;  2VOC A;  2C0D A;  3F8U A;  3P2A A;  3HZ4 A;  2GT5 A;  3HVS A;  5HR1 A;  1SL2 B;  3UOM A;  1XWK A;  3HHV A;  4BA7 A;  3HDC A;  5DAK B;  1O81 A;  4LMV A;  4AJ8 A;  5DAL B;  2FUG 2;  1XOA A;  1PRX A;  3NZN A;  4TXV A;  3LXT A;  2IMD A;  3A5W A;  2IME A;  2LTK A;  4K1F A;  1ML6 A;  2K18 A;  4XRD A;  3D4M A;  3F9U A;  4X0X A;  3CSJ A;  3EMX A;  2IL3 A;  4MJE A;  1SD9 A;  4GF0 A;  2CT6 A;  3Q74 A;  4NMU A;  4EO3 A;  4G2E A;  2RM5 A;  3KCM A;  2MZC A;  4V2L A;  2QKE A;  3QMX A;  4D73 A;  3C73 A;  1GTI A;  4CW9 A;  3UL3 A;  4JR6 A;  5DVB A;  4WR5 A;  3MWH A;  3M9K A;  2N5A A;  2FY6 A;  2IFQ B;  3DGQ A;  1Z3E A;  1A0R P;  1JHB A;  2L59 A;  1U3A A;  2V6O A;  1B8X A;  3FY7 A;  3A2X A;  3L9V A;  2C1Y A;  3KIJ A;  2YV7 A;  1K0D A;  1URM A;  2O8V B;  4OD7 A;  4GQF A;  3IAM 2;  2XPD A;  1Y25 A;  4CDO A;  2EIR A;  3RPN A;  4ACS A;  2B6M A;  1T8E B;  3BD2 A;  3DRN A;  2M72 A;  3EC3 A;  1R7H A;  4N11 A;  4O92 A;  4WF4 A;  3O6T A;  3GTU A;  2VCQ A;  5F05 A;  3F4T A;  1CQG A;  2PVO C;  1PD2 1;  2AAW A;  1YKA A;  2X99 A;  2GS3 A;  2H6Z A;  2WS2 A;  4GQC A;  4HZ4 A;  1V57 A;  4F0B A;  9GSS A;  3QOU A;  5F06 A;  2FA8 A;  4KUN A;  5KN1 A;  3D0Z A;  2HXK A;  2FLS A;  1BQ7 A;  2YJ7 A;  4FYB A;  5DJM A;  2HSH A;  1R5P A;  2B1K A;  1OVN A;  4GSS A;  3GX0 A;  1FG4 A;  4Q5F A;  2GZP A;  1WWJ A;  5FWG A;  1GTB A;  3GST A;  1FB6 A;  1U87 A;  4WEY A;  3IPZ A;  4MH3 A;  3OR5 A;  4NAX A;  2KOK A;  2H0H A;  1BAY A;  2L6C A;  3Q18 A;  1JFU A;  4AF2 A;  4HOJ A;  5ID2 A;  2FWF A;  2I81 A;  5HFG A;  1PKW A;  2BMX A;  2LRT A;  1MDJ A;  3GKM A;  4E8E A;  3VFI A;  1F9M A;  3FK8 A;  1OC9 A;  3FZ4 A;  3LSZ A;  1PX6 A;  4OO4 A;  5JWQ B;  3U6V A;  13GS A;  1GSF A;  4GST A;  3APO A;  4POL A;  1TXX A;  3QAW A;  5AIX A;  1XW6 A;  1FOV A;  1EEM A;  3IA1 A;  3KTB A;  2O89 A;  5AN1 A;  2MMO A;  5GSS A;  3UBL A;  4BL7 A;  1VF4 A;  3GIX A;  5IMZ A;  5B7C A;  2O7K A;  2PER A;  4LMW A;  5D93 A;  3Q6O A;  5CO3 A;  4MPF A;  5AIS A;  3ZFB A;  2R4V A;  5CNW A;  5D9V A;  2MBT A;  2A2S A;  1ZCP A;  3ZZX A;  4EF0 A;  3BOA A;  2NVL A;  3HXS A;  5INY A;  1PSQ A;  3E9J B;  1PGT A;  1T4Y A;  2PUK C;  5DBQ A;  3A2V A;  4I97 A;  4ZBD A;  3LYK A;  2KLX A;  3F3Q A;  4PQI A;  2LST A;  3GMF A;  2F51 A;  4ZL8 A;  4KB3 A;  2IMI A;  2RII A;  4TXO B;  1PKZ A;  4K0N A;  1SJI A;  4XCS A;  1F3A A;  3KTL A;  4POB A;  2B1L A;  4WR4 A;  3FHK A;  4LA1 A;  3HA9 A;  3TKS E;  3Q19 A;  1WJK A;  4DSS A;  1WMJ A;  4TRX A;  5CRH A;  4ZB9 A;  3L0H A;  1X5C A;  2D2Z A;  2H66 A;  3TB2 A;  2TRC P;  3A2W A;  4KA0 A;  1DUG A;  1G7E A;  4FIW A;  2VD1 A;  1AW9 A;  2WGR A;  2VO4 A;  4PQH A;  3CRU A;  5EVO A;  2JZS A;  1QXH A;  3ZRD A;  2GQL A;  1U88 A;  3UBK A;  1K3Y A;  3GKX A;  1T7P B;  4JRR A;  3H79 A;  3QAV A;  4ZL9 A;  2AYT A;  1G7O A;  1OKD A;  3IR4 A;  1BJX A;  1YY7 A;  14GS A;  4TR1 B;  5AIV A;  4MF7 A;  1M2B A;  3VPT A;  1E6B A;  5D9T A;  2LUS A;  5ECN B;  1B4Q A;  4XTS A;  3W8J A;  3IAS 2;  12GS A;  4ECB A;  2GVP A;  2H75 A;  1Z6M A;  3I43 A;  2H71 A;  5HFI A;  2GQM A;  1EOG A;  1K0A A;  3F4S A;  5HR2 A;  1ZYE A;  3D6I A;  4P3Y B;  3QAG A;  3FR3 A;  1YDK A;  4LLR A;  5ECS A;  2QC7 A;  1HNB A;  2WB9 A;  6GSW A;  2KHP A;  1QK8 A;  5LD0 A;  1V98 A;  4NXI A;  5E59 A;  2WZ9 A;  2FHE A;  2YN1 A;  2XBI A;  3G7J A;  2V41 A;  2VLT A;  1TDI A;  5IPG A;  4IP6 A;  3ERW A;  1ON4 A;  3IDV A;  2P0G A;  3KMO A;  2EIQ A;  4MF6 A;  4N30 A;  1H4O A;  5CP1 A;  1B48 A;  2JU5 A;  4MK3 A;  5CRE A;  1Q98 A;  1GUH A;  5EPF A;  1M99 A;  1QGV A;  5H5Q A;  4IEL A;  2DJK A;  3QR6 A;  3TKR A;  5ECR B;  2DSA A;  1TW9 A;  4ZL7 A;  2X8C A;  4IGJ A;  1NHY A;  1XXU A;  5ECQ B;  3TGZ A;  3N5O A;  5IOW A;  1LJR A;  4TW5 A;  1DE2 A;  1K3L A;  3J7Y k;  4V2M A;  3DYR A;  2HRN A;  5D9X A;  5KN3 A;  1F3B A;  2NDO A;  5ECI B;  1M9A A;  4K8M A;  4IVF A;  1OC3 A;  4YAP A;  2C3N A;  4HUA A;  1K3O A;  3VK9 A;  1V9W A;  1XWB A;  4WF5 A;  4KSO A;  1THX A;  4KDY A;  2GQK A;  2E7P A;  4OCE A;  2J23 A;  5JCG A;  5GST A;  5JWO B;  22GS A;  1TP9 A;  2OE3 A;  5B6M A;  2N5B A;  3LOR A;  1ZYQ B;  5A4W A;  1ZOF A;  3WT2 A;  4EUY A;  2JZT A;  3C1S A;  3KEB A;  4LL4 B;  3C7M A;  5IPH A;  2LQO A;  3RPP A;  4DSR A;  2JSY A;  2DLX A;  2H70 A;  5IQY A;  4X43 A;  3BBY A;  1ZL9 A;  4IJ3 A;  3GNJ A;  5JWR B;  5C00 A;  3UAP A;  1J0F A;  2B5Y A;  4L0W A;  2EC4 A;  4HJM A;  4AJ6 A;  4NHZ A;  2H01 A;  2RUF A;  3US3 A;  5JCW A;  2WFC A;  3WT1 A;  2CV4 A;  4I8B A;  1XBS A;  3LFL A;  1SK1 A;  3GKK A;  4MJB A;  3ISO A;  3UEM A;  2H73 A;  3M3M A;  3FZA A;  2JL4 A;  3P7X A;  4QL7 A;  4RI7 A;  5G5F A;  4ZIJ A;  1ZZY A;  2LKU A;  1SYX A;  1VF3 A;  4EDY A;  4PXO A;  5ELG A;  2AUV A;  1WOU A;  2ZNM A;  1LBK A;  2YOI A;  3JCM L;  1F6M C;  2NPB A;  2C8U A;  4YQM A;  3VI5 A;  4GLT A;  2LNS A;  5J9B A;  5J3R A;  4GWR A;  4QQ7 A;  5D9W A;  1GL8 A;  3FZ9 A;  2E0Q A;  4PNF A;  5F0G A;  2VM2 A;  4H86 A;  4F9Z A;  2K6V A;  2H1D A;  1SL1 B;  1FW1 A;  1JLW A;  2TRX A;  2AV4 A;  1PX7 A;  4PUA A;  5G5E A;  2VCX A;  3SBC A;  5G1L A;  3E0U A;  6GSY A;  3G7I A;  19GS A;  2MMZ A;  1K0O A;  3H4K A;  4GRF A;  2LRN A;  4EVM A;  1SK2 A;  4GCI A;  2VM1 A;  1KEB A;  3I6A A;  1T1V A;  5ECH B;  3UJ1 A;  1B9Y C;  2F8F A;  4RI6 A;  2IJY A;  3IE3 A;  4TR0 A;  4HQZ A;  3DML A;  3UVH A;  2OAC A;  3R2Q A;  1VGL A;  4MDC A;  2OJL A;  4PUR A;  8GSS A;  3QCP A;  3FKF A;  7GSS A;  3TKQ A;  3ZFL A;  1PN9 A;  2VD0 A;  2GZZ A;  2PN8 A;  2IN3 A;  1GUL A;  1GUK A;  2YWM A;  2LJR A;  2DC5 A;  4HS1 A;  2R6K A;  2YCD A;  4L5L A;  3DXB A;  1Q4J A;  1JLV A;  5LCZ A;  16GS A;  2X8H A;  4XHM A;  2CAQ A;  4AGS A;  1HYU A;  4IBP A;  4ML1 A;  2VCZ A;  2JZR A;  2ON5 A;  2J9H A;  4HDE A;  4HEA 2;  5AGY A;  3F63 A;  4AJ7 A;  1GTU A;  5IMV A;  1UA5 A;  3ERF A;  4YQV A;  3GYK A;  5H5R A;  4HJ2 A;  4DEJ A;  3IOS A;  2H8L A;  4EE0 A;  1W4V A;  1PA3 A;  3WGD A;  3CXG A;  2HE3 A;  2K9F A;  1TI1 A;  4BPY A;  1TI3 A;  3ZIT A;  2HZE A;  2VAF A;  1SL0 B;  2DML A;  2N5F A;  4FH8 A;  1O8W A;  3GN3 A;  1K0N A;  3TCO A;  4BWS A;  1N2A A;  4MJC A;  4O5R A;  1M2D A;  2WDU A;  1B9X C;  1UC7 A;  2B3S A;  2V1M A;  3LGC A;  3ZIV A;  1A23 A;  2VCT A;  5DQS A;  2H74 A;  2I4A A;  2VCV A;  5IO0 A;  3I9V 2;  2XPE A;  2IPA A;  2VLV A;  1IYH A;  3DEX A;  1SKW B;  5CYY A;  1DSB A;  3S9F A;  5ECO B;  3SWL A;  3V1W A;  4OCF A;  3ZVJ D;  2B5E A;  1XW5 A;  1VF2 A;  3TRX A;  2CVK A;  1OAZ A;  3ZTL A;  4OMV A;  2FWH A;  1BED A;  5A4U A;  5IIZ A;  1WIK A;  3TKS A;  3GFK A;  4ZXG A;  1AXD A;  2Z9S A;  2R2J A;  1FHE A;  4FYC A;  3LEF A;  5DCG A;  2C3T A;  1TRU A;  4IN0 A;  3EUR A;  2L57 A;  1K0M A;  1M7T A;  1FB0 A;  4D73 B;  1G6W A;  4XS1 A;  3TJJ A;  2X64 A;  3KMN A;  4JED A;  4XIH A;  3TRP A;  2MYG A;  1HQO A;  5ABR A;  1XVW A;  3KP9 A;  1Z6N A;  1FAA A;  3PH9 A;  4KGI A;  2HNL A;  1XWA A;  4MAB A;  1XZO A;  3TDG A;  2IMF A;  3IXR A;  2FNO A;  1MDI A;  2I3Y A;  5B8B A;  1XCC A; 
#chains in the Genus database with same CATH topology
 4KF9 A;  5ENU A;  1AQX A;  4ZIL A;  2A2R A;  1M2A A;  3G7Y A;  1JZO A;  4Z2U A;  2YPM A;  1X5E A;  2VL2 C;  2OE0 A;  2CAI A;  3C71 A;  4ECJ A;  4OO5 A;  4A5P A;  2XBQ A;  2OA7 A;  2GST A;  1SKR B;  5D8I A;  4KSM A;  2LJA A;  1FVK A;  5F07 A;  2REM A;  1X5D A;  3D21 A;  2R5G A;  1XW9 A;  3GTU B;  2DJ2 A;  3ZMK A;  4I5Q A;  4YQU A;  1U6T A;  2GDR A;  3APS A;  5IM9 A;  1HNA A;  1EOH A;  2ES7 A;  4EXJ A;  3IC8 A;  2VL9 A;  1A8Y A;  4N0V A;  3EWL A;  2ALB A;  4IP1 A;  2I1U A;  1M3J A;  1O8X A;  5G30 A;  4DVC A;  1OE7 A;  3CMI A;  4V2N A;  2ZCT A;  5HR3 A;  2RLI A;  1SJ6 A;  1EEJ A;  4ZB6 A;  4POK A;  3UIW A;  1W89 A;  5ID2 B;  4OFT A;  1PL1 A;  4EIP A;  3F3R A;  3H1N A;  4ECI A;  2JAC A;  5DCH A;  4K0G A;  4HZ2 A;  1OC9 B;  2LJK A;  1TRS A;  3MSZ A;  4NWY A;  1VRS D;  2H30 A;  3DKS A;  1LU4 A;  2YJH A;  4PNG A;  4KW6 A;  4E8H A;  17GS A;  3U5R E;  4XS4 B;  1AUC A;  1YF0 A;  4WBR D;  4GXZ A;  1O85 A;  1USB A;  4BL7 B;  2G0F A;  3VWU A;  4KAE A;  2LRC A;  5IMA A;  4K6X A;  2X8G A;  4JR4 A;  1H75 A;  2DBC A;  5A5K A;  1FVJ A;  4QL9 A;  1MEK A;  1YF1 A;  3W8S A;  2DJ0 A;  3GUS A;  5DAK A;  2FD3 A;  2CX3 A;  2HZF A;  4ZB8 A;  4KX4 A;  4K7O A;  2O87 A;  1ST9 A;  3HZ8 A;  5FHI A;  5DAL A;  4MH2 A;  2F3M A;  3IRA A;  1TRV A;  5G1K A;  4PUF C;  1PL2 A;  4ISD A;  2C0F A;  2OE1 A;  5L71 A;  1TU8 A;  4WXT A;  4PGT A;  6GSS A;  1K0C A;  4FYU A;  3BCI A;  5EL8 A;  2CVB A;  2K8V A;  3CTF A;  4G0L A;  1XOB A;  6GSX A;  1U3I A;  1GNW A;  1NW2 A;  2FA4 A;  3IBH A;  2B7J A;  4MP4 A;  6GST A;  1ERV A;  3GH6 A;  2CQ9 A;  4OFN A;  4DSS B;  3P90 A;  5HFK A;  1N8J A;  3H93 A;  3DWV A;  1X9M B;  3GA4 A;  4F82 A;  1MDK A;  2PBJ A;  6GSU A;  3IV4 A;  4KE3 A;  6GSV A;  5EY6 A;  2JSZ A;  1XWG A;  1F2E A;  2IFQ A;  3KGK A;  4L8E A;  5C04 A;  1ILO A;  2AB6 A;  1I9D A;  4MZW A;  1FO5 A;  1ABA A;  4JE1 A;  4GTU A;  1TJD A;  2O85 A;  2HSY A;  1OYJ A;  5G2Z A;  1X9S B;  2QGV A;  5A4V A;  2CVD A;  3DVW A;  3J7Y b;  1GSQ A;  3WGX A;  1E2Y A;  2YWI A;  3TOT A;  2RUE A;  5F8B A;  1ERU A;  4BWQ A;  4EKZ A;  4K5R A;  3WD6 A;  1R26 A;  5B8A A;  1MTC A;  5HR0 A;  2HT9 A;  4XRA A;  5J4U A;  2IWT A;  2P5R A;  3EU4 A;  2H1G A;  2VL2 A;  1OC8 A;  1KNG A;  5ECK B;  3UVT A;  1C72 A;  4KCE A;  1SJZ A;  5IOX A;  2L4C A;  2H76 A;  3EVI A;  2C3Q A;  2PU9 C;  2LEG A;  5E4W A;  3LQ7 A;  4ULX A;  1VF1 A;  4K9Z A;  4IJI A;  3LWA A;  4I6X A;  4MCU A;  3F4R A;  1Z7P A;  4X1U A;  5KN0 A;  4G19 A;  5LNK e;  1WE0 A;  3TKS C;  1YEP A;  4ID0 A;  1I5G A;  1GTA A;  1YQ1 A;  4EL1 A;  4J2F A;  4XS6 A;  2V6K A;  3GRX A;  5BRT A;  3P8W A;  3GL3 A;  5COH A;  1TRW A;  4LL1 B;  1M0U A;  4L5O A;  2PWJ A;  3ME8 A;  4HU9 A;  3LYP A;  2MMA A;  4WET A;  3IK7 A;  2RM6 A;  3HYP A;  4ZBA A;  3EIN A;  3GV1 A;  4X4J A;  1ERT A;  1EP8 A;  3IHG A;  4KDX A;  2OBI A;  3FR9 A;  5BMU A;  2C80 A;  3RDW A;  2NBS A;  4BVY A;  2OBK A;  1OKT A;  3GKN A;  18GS A;  1SD8 A;  1NHO A;  3O76 A;  2PMT A;  2FWE A;  1YEX A;  2X49 A;  1A2J A;  5CRW A;  2F8A A;  1RK4 A;  1A2L A;  3QDN A;  3KXO A;  4MMM A;  2DIZ A;  3FR6 A;  3IHQ A;  3G9B A;  3EE2 A;  3TJB A;  4Z7X A;  3LXZ A;  2FWG A;  1QFN A;  4TXO A;  2E2G A;  2VUP A;  4IW9 A;  1TK8 B;  1OE8 A;  3LJR A;  1J9B A;  2LQQ A;  3M8N A;  4Z2R A;  3WGE A;  1X9W B;  2OAD A;  1DBY A;  5ECP B;  1GSU A;  1YJ6 A;  2L5O A;  4GSN A;  3H8Q A;  3HY2 A;  3ZYW A;  3HKR A;  3VLN A;  3M9J A;  4V1A p;  1EV9 A;  1Y6E A;  3VWW A;  4WBJ A;  3HCZ A;  3W6G A;  1GRX A;  1TOF A;  3EMP A;  4IHU A;  1TK5 B;  3QFB C;  3HJM A;  2K8S A;  4F03 A;  5KN2 A;  2GSQ A;  2CZ2 A;  1MD4 A;  2AJQ B;  1BG5 A;  3L9S A;  4ECC A;  4MZB A;  3QPM A;  3D4T A;  3ZLP A;  3TUE A;  5JCU A;  5DJL A;  4DSQ A;  3GHA A;  2ON7 A;  4F2I A;  4KDU A;  4O7H A;  1KTE A;  3GL5 A;  3ZIJ A;  2P5Q A;  3C1R A;  1GSD A;  4TR1 A;  3FRC A;  2A2P A;  3KJY A;  3LW9 A;  1GLQ A;  4MLY A;  2V32 A;  2FCH A;  5D73 A;  1ERW A;  3ME7 A;  11GS A;  1EGR A;  2VCW A;  4MA9 A;  1HD2 A;  3VI7 A;  4NV5 A;  2YWO A;  1AIU A;  3NIV A;  2C4J A;  1CQH A;  4CHS A;  3KP8 A;  1GLP A;  2GGT A;  4MJA A;  1XFL A;  2E2M A;  2V2G A;  3NOF A;  2GSR A;  5GZZ B;  1GWC A;  2IMK A;  1XG8 A;  4TKY A;  4N0Z A;  1YZX A;  4PQ1 A;  1G0T A;  1F37 A;  2KP2 A;  3CTG A;  1THO A;  2EIO A;  4BVX A;  1SKS B;  3K8N A;  3HVX A;  1BX9 A;  1HNC A;  4G9H A;  2KP1 A;  2CZ3 A;  1AAZ A;  2PPT A;  4JZQ A;  2MMN A;  2HLS A;  1WPI A;  1JZW A;  3GUR A;  4XS4 A;  1K0B A;  4Q5N A;  2C0E A;  3VPQ A;  5B6N A;  2WUL A;  1ZGN A;  1TKD B;  3AY8 A;  2H1B A;  1S3D A;  2PGT A;  1SYR A;  2H72 A;  2GZY A;  4TVE A;  1A24 A;  5ELA A;  2HFD A;  1JZD A;  5DDL A;  1EZK A;  1UVZ A;  2NTO A;  3E3E A;  3WYW A;  3C8E A;  1PMT A;  2H0G A;  4YH2 A;  1T4Z A;  3BCK A;  2ZUP A;  2AHE A;  2GT6 A;  1TTZ A;  2DMM A;  1EP7 A;  2YAN A;  3FMW A;  3VWX A;  3GH9 A;  1SEN A;  2XC2 A;  3KH9 A;  1RW1 A;  3CBU A;  1Z9H A;  5ECL B;  3HJP A;  2H0I A;  1V58 A;  4G10 A;  1RQM A;  4EIQ A;  3QD9 A;  4KND A;  3PR8 A;  2M80 A;  4I2U A;  1AC1 A;  3IC4 A;  4V1A g;  4OWY A;  3N9J A;  1FOH A;  3L9U A;  2H6Y A;  1MD3 A;  3CSH A;  3VWV A;  2WCI A;  1JZR A;  4K2D A;  4TN8 A;  2P31 A;  1AQW A;  2A4H A;  2R37 A;  5J5N A;  3RAZ A;  4TOP A;  1A8L A;  3BJ5 A;  1QQ2 A;  3F6F A;  3UMA A;  3ERG A;  1O73 A;  4FQU A;  4TR4 A;  4HU7 A;  2WJU A;  3FYG A;  4J56 E;  5J9C A;  4N10 A;  2M46 A;  2MBS A;  4RQX A;  3M0F A;  1GSE A;  4EC0 A;  3CRT A;  3KZQ A;  3RBT A;  3CSI A;  3MAK A;  4JU5 A;  3TJF A;  1S3A A;  1BYE A;  2YWN A;  1Z7R A;  2GLR A;  1ZMA A;  2BTO T;  4JBB A;  2LV3 A;  4K2X A;  1GH2 A;  1A2M A;  1WRY A;  4F0C A;  2HZE B;  1AQV A;  4ILF A;  4RQR A;  4CY6 A;  4EDZ A;  3EYT A;  4NPB A;  2FGX A;  4TR3 A;  1GNE A;  3MNG A;  1XPV A;  1O7U A;  2QA1 A;  2GTU A;  1ZYN A;  5KOW A;  4IQ1 A;  1XVQ A;  4IKH A;  3F6D A;  3O3T A;  3ZL5 A;  1EWX A;  1O6J A;  4MPG A;  3ZRE A;  2VLU A;  4FO5 A;  2DJJ A;  3DD3 A;  4K7I A;  4WKW A;  3L78 A;  3KM6 A;  3MYD A;  1S3C A;  3PGT A;  4NV2 A;  1V2A A;  3HJO A;  10GS A;  5D96 A;  1SU9 A;  1Z5Y E;  3D5J A;  1DE1 A;  3FW2 A;  3DIE A;  3KH7 A;  1A0F A;  5FT3 A;  1B4P A;  3TOU A;  5KEJ A;  1T00 A;  2HRF A;  4L0U A;  3APQ A;  2R0G A;  4POM A;  5G31 A;  1GP1 A;  2LNT A;  1XWC A;  4HQS A;  2PVQ A;  5CRD A;  2IIY A;  1YKC A;  4Q5R A;  3TKP A;  5GAP D;  2DKI A;  4KH7 A;  3GX8 A;  1M9B A;  1GSS A;  3VUR A;  3L4N A;  2A4V A;  20GS A;  1IYI A;  2DJ1 A;  1NM3 A;  4MF5 A;  3RHC A;  2C0G A;  2TIR A;  1G6Y A;  4PX1 A;  1SK0 A;  1QUW A;  3ED3 A;  2YV9 A;  1J08 A;  2DIY A;  2CA8 A;  2L5L A;  1TK0 B;  4ML6 A;  1WP0 A;  4NHW A;  4ZBB A;  3KD0 A;  3FEU A;  2DJ3 A;  1KBN A;  3GSS A;  4IS0 A;  4MZC A;  3I69 A;  3RHB A;  2B7K A;  5DQY A;  2HYX A;  2R3X A;  2H19 A;  2YNX A;  2LS5 A;  3MDK A;  1TU7 A;  2CX4 A;  1M3I A;  4J57 E;  3EU3 A;  2WRT A;  3HD5 A;  2KUC A;  3HVV A;  2OKA A;  1V40 A;  1UN2 A;  1X0R A;  3QFA C;  3ZVJ A;  4USS A;  1GSY A;  1XIY A;  4HI7 A;  1ACV A;  2HI7 A;  2G2Q A;  2I9H A;  2YZH A;  5H5S A;  1GUM A;  5IMC A;  1QMV A;  4OFM A;  3F0I A;  5HQP A;  5IO2 A;  2H1A A;  2BJX A;  4Q5Q A;  5CRG A;  4O32 A;  3TJK A;  2H6X A;  3PIN A;  5IMD A;  3ZML A;  4KCA A;  3LG6 A;  2VIM A;  2L6D A;  2L4Q A;  4IQA A;  4RUV A;  5IMF A;  1PQN A;  2QSI A;  4K7N A;  2B5X A;  4YAV A;  2F9S A;  3TJG A;  3DVX A;  1T3B A;  5J41 A;  3FZ5 A;  1NSW A;  1EGO A;  1R4W A;  2GSS A;  2YZU A;  2JAD A;  3A3T A;  5ECM B;  3CYN A;  3UAR A;  2VL3 A;  1EV4 A;  3M1G A;  1R5A A;  4I2T A;  5CAX A;  5GAN D;  3IK9 A;  2XHF A;  3D22 A;  2YP6 A;  3TRQ A;  2VOC A;  2C0D A;  3F8U A;  3P2A A;  3HZ4 A;  2GT5 A;  3HVS A;  5HR1 A;  1SL2 B;  3UOM A;  1XWK A;  3HHV A;  4BA7 A;  3HDC A;  5DAK B;  1O81 A;  4LMV A;  4YKF A;  4AJ8 A;  5DAL B;  2FUG 2;  1XOA A;  1PRX A;  3NZN A;  4TXV A;  3LXT A;  2IMD A;  3A5W A;  2IME A;  2LTK A;  4K1F A;  1ML6 A;  2K18 A;  4XRD A;  3D4M A;  3F9U A;  4X0X A;  3CSJ A;  3EMX A;  2IL3 A;  4MJE A;  1SD9 A;  4GF0 A;  2CT6 A;  3CQF A;  3Q74 A;  4NMU A;  4EO3 A;  4G2E A;  2RM5 A;  4CY8 A;  3KCM A;  4O5U A;  2MZC A;  4V2L A;  2QKE A;  3QMX A;  4D73 A;  3C73 A;  1GTI A;  4CW9 A;  3UL3 A;  4JR6 A;  5DVB A;  4WR5 A;  3MWH A;  3M9K A;  2N5A A;  2FY6 A;  4G0K A;  2IFQ B;  3DGQ A;  1Z3E A;  1A0R P;  1JHB A;  2L59 A;  1U3A A;  2V6O A;  1B8X A;  3FY7 A;  3A2X A;  3L9V A;  2C1Y A;  3KIJ A;  2YV7 A;  1K0D A;  1URM A;  2O8V B;  4OD7 A;  4GQF A;  3IAM 2;  2XPD A;  1Y25 A;  4CDO A;  2EIR A;  3RPN A;  4ACS A;  2B6M A;  1T8E B;  3BD2 A;  3DRN A;  2M72 A;  4ICY A;  3EC3 A;  1R7H A;  4N11 A;  1ZYP A;  4O92 A;  4WF4 A;  3O6T A;  3GTU A;  2VCQ A;  5F05 A;  3F4T A;  1CQG A;  2PVO C;  1PD2 1;  2AAW A;  1YKA A;  2X99 A;  2GS3 A;  2H6Z A;  2WS2 A;  4GQC A;  5KOX A;  4HZ4 A;  1V57 A;  4F0B A;  9GSS A;  3QOU A;  5F06 A;  2FA8 A;  4KUN A;  5KN1 A;  3D0Z A;  2HXK A;  2FLS A;  2X4A A;  1BQ7 A;  2YJ7 A;  4FYB A;  5DJM A;  2HSH A;  1R5P A;  2B1K A;  1OVN A;  4GSS A;  3GX0 A;  1FG4 A;  4Q5F A;  2GZP A;  1WWJ A;  5FWG A;  1GTB A;  3GST A;  1FB6 A;  1U87 A;  2R0C A;  3IPZ A;  4WEY A;  4MH3 A;  3OR5 A;  4NAX A;  2KOK A;  2H0H A;  1BAY A;  2L6C A;  3Q18 A;  1JFU A;  4AF2 A;  4HOJ A;  5ID2 A;  2FWF A;  2I81 A;  5HFG A;  1PKW A;  2BMX A;  2LRT A;  1MDJ A;  3GKM A;  4E8E A;  3VFI A;  1F9M A;  3FK8 A;  1OC9 A;  3FZ4 A;  3LSZ A;  1PX6 A;  4OO4 A;  5JWQ B;  3U6V A;  13GS A;  1GSF A;  4GST A;  3APO A;  4POL A;  1TXX A;  3QAW A;  5AIX A;  1XW6 A;  1FOV A;  1EEM A;  3IA1 A;  3KTB A;  2O89 A;  5AN1 A;  2MMO A;  5GSS A;  3UBL A;  4BL7 A;  1VF4 A;  3GIX A;  5IMZ A;  5B7C A;  2O7K A;  2PER A;  4LMW A;  5D93 A;  3A5I A;  3Q6O A;  5CO3 A;  4MPF A;  5AIS A;  3ZFB A;  2R4V A;  5CNW A;  5D9V A;  2MBT A;  2A2S A;  1ZCP A;  3ZZX A;  4EF0 A;  3BOA A;  2NVL A;  3HXS A;  5INY A;  1PSQ A;  3E9J B;  1PGT A;  1T4Y A;  2PUK C;  5DBQ A;  3A2V A;  4I97 A;  4ZBD A;  3LYK A;  2KLX A;  3F3Q A;  4PQI A;  2LST A;  3GMF A;  2F51 A;  4ZL8 A;  4KB3 A;  2IMI A;  2RII A;  4TXO B;  1PKZ A;  4K0N A;  1SJI A;  4XCS A;  1F3A A;  3KTL A;  4POB A;  2B1L A;  4WR4 A;  3FHK A;  4LA1 A;  3HA9 A;  3TKS E;  3Q19 A;  4G0I A;  1WJK A;  2HRA A;  4DSS A;  1WMJ A;  4TRX A;  5CRH A;  4ZB9 A;  3L0H A;  1X5C A;  2D2Z A;  2H66 A;  3TB2 A;  2TRC P;  3A2W A;  4KA0 A;  1DUG A;  1G7E A;  4FIW A;  2VD1 A;  1AW9 A;  2WGR A;  2VO4 A;  4PQH A;  3CRU A;  5EVO A;  2JZS A;  1QXH A;  3ZRD A;  2GQL A;  1U88 A;  3UBK A;  1K3Y A;  3GKX A;  1T7P B;  4JRR A;  3H79 A;  3QAV A;  4ZL9 A;  2AYT A;  1G7O A;  1OKD A;  3IR4 A;  1BJX A;  1YY7 A;  14GS A;  4TR1 B;  5AIV A;  4MF7 A;  1M2B A;  3VPT A;  1E6B A;  5D9T A;  2LUS A;  5ECN B;  1B4Q A;  4XTS A;  3W8J A;  3IAS 2;  12GS A;  4ECB A;  2GVP A;  2H75 A;  1Z6M A;  3I43 A;  2H71 A;  5HFI A;  2GQM A;  1EOG A;  1K0A A;  3F4S A;  5HR2 A;  1ZYE A;  3D6I A;  4P3Y B;  3QAG A;  3FR3 A;  1YDK A;  4YKG A;  4LLR A;  5ECS A;  2QC7 A;  1HNB A;  2WB9 A;  6GSW A;  2KHP A;  1QK8 A;  5LD0 A;  1V98 A;  4NXI A;  5E59 A;  2WZ9 A;  2FHE A;  2YN1 A;  2XBI A;  3G7J A;  4BVX B;  2V41 A;  2VLT A;  1TDI A;  5IPG A;  4IP6 A;  3ERW A;  1ON4 A;  3IDV A;  2P0G A;  3KMO A;  2EIQ A;  4MF6 A;  4N30 A;  1H4O A;  5CP1 A;  1B48 A;  2JU5 A;  4MK3 A;  5CRE A;  1Q98 A;  1GUH A;  5EPF A;  1M99 A;  1QGV A;  5H5Q A;  4IEL A;  2DJK A;  3QR6 A;  3TKR A;  5ECR B;  2DSA A;  1TW9 A;  4ZL7 A;  2X8C A;  4IGJ A;  1NHY A;  1XXU A;  5ECQ B;  3EPT A;  3TGZ A;  3N5O A;  4PTS A;  5IOW A;  1LJR A;  4TW5 A;  1DE2 A;  1K3L A;  3J7Y k;  4V2M A;  3DYR A;  2HRN A;  5D9X A;  5KN3 A;  1F3B A;  2NDO A;  5ECI B;  1M9A A;  4K8M A;  4IVF A;  1OC3 A;  4YAP A;  2C3N A;  4HUA A;  1K3O A;  3VK9 A;  1V9W A;  1XWB A;  4WF5 A;  4KSO A;  1THX A;  4KDY A;  2GQK A;  2E7P A;  4OCE A;  2J23 A;  5JCG A;  5GST A;  5JWO B;  22GS A;  1TP9 A;  2OE3 A;  5B6M A;  2N5B A;  3LOR A;  1ZYQ B;  5A4W A;  1ZOF A;  3WT2 A;  4EUY A;  2JZT A;  3C1S A;  3KEB A;  4LL4 B;  3C7M A;  5IPH A;  2LQO A;  3RPP A;  2HSM A;  4DSR A;  2JSY A;  2DLX A;  2H70 A;  5IQY A;  4X43 A;  3BBY A;  1ZL9 A;  4IJ3 A;  3GNJ A;  5JWR B;  5C00 A;  3UAP A;  1J0F A;  2B5Y A;  4L0W A;  2EC4 A;  4HJM A;  4AJ6 A;  4NHZ A;  2H01 A;  2RUF A;  3US3 A;  5JCW A;  2WFC A;  3WT1 A;  2CV4 A;  4I8B A;  1XBS A;  3LFL A;  1SK1 A;  3GKK A;  4MJB A;  3ISO A;  1S3R A;  3UEM A;  2H73 A;  3M3M A;  3FZA A;  2JL4 A;  3P7X A;  4QL7 A;  4RI7 A;  5G5F A;  4ZIJ A;  1ZZY A;  2LKU A;  1SYX A;  1VF3 A;  4EDY A;  4PXO A;  5ELG A;  2AUV A;  1WOU A;  2ZNM A;  1LBK A;  2YOI A;  3JCM L;  1F6M C;  2NPB A;  2C8U A;  4YQM A;  3VI5 A;  4GLT A;  2LNS A;  5J9B A;  5J3R A;  4GWR A;  4QQ7 A;  5D9W A;  1GL8 A;  4HSC X;  3FZ9 A;  2E0Q A;  4PNF A;  5F0G A;  2VM2 A;  4H86 A;  4F9Z A;  2K6V A;  2H1D A;  1SL1 B;  1FW1 A;  1PN0 A;  1JLW A;  2TRX A;  2AV4 A;  1PX7 A;  4PUA A;  5G5E A;  2VCX A;  3SBC A;  3PPU A;  5G1L A;  3E0U A;  6GSY A;  3G7I A;  19GS A;  2MMZ A;  1K0O A;  3H4K A;  3R3E A;  4GRF A;  2LRN A;  4EVM A;  1SK2 A;  2HRK A;  4GCI A;  2VM1 A;  1KEB A;  3I6A A;  1T1V A;  5ECH B;  2DKH A;  3UJ1 A;  1B9Y C;  2F8F A;  4O5Q A;  4RI6 A;  2IJY A;  3IE3 A;  4TR0 A;  4HQZ A;  3DML A;  3UVH A;  2OAC A;  3R2Q A;  1VGL A;  4BIK A;  4MDC A;  2OJL A;  2UZ8 A;  4PUR A;  8GSS A;  1PFO A;  3QCP A;  3FKF A;  7GSS A;  3TKQ A;  3ZFL A;  1PN9 A;  2VD0 A;  2GZZ A;  2PN8 A;  2IN3 A;  1GUL A;  1GUK A;  2QA2 A;  2YWM A;  4K5S A;  2LJR A;  2DC5 A;  4HS1 A;  2R6K A;  2YCD A;  4L5L A;  3DXB A;  1Q4J A;  1JLV A;  5LCZ A;  16GS A;  2X8H A;  4XHM A;  2CAQ A;  4AGS A;  1HYU A;  4IBP A;  4ML1 A;  2VCZ A;  2JZR A;  2ON5 A;  2J9H A;  4HDE A;  4HEA 2;  5AGY A;  3F63 A;  4AJ7 A;  1GTU A;  5IMV A;  1UA5 A;  3ERF A;  4YQV A;  3GYK A;  5H5R A;  4HJ2 A;  2R0P A;  4DEJ A;  3IOS A;  2H8L A;  4EE0 A;  1W4V A;  1PA3 A;  3WGD A;  3CXG A;  2HE3 A;  2K9F A;  1TI1 A;  4BPY A;  1TI3 A;  3ZIT A;  2HZE A;  2VAF A;  1SL0 B;  2DML A;  2N5F A;  4FH8 A;  1O8W A;  3GN3 A;  1K0N A;  3TCO A;  4BWS A;  1N2A A;  4MJC A;  4O5R A;  1M2D A;  2WDU A;  1B9X C;  1UC7 A;  2B3S A;  4Z2T A;  2V1M A;  3LGC A;  3ZIV A;  1A23 A;  2VCT A;  5DQS A;  2H74 A;  2I4A A;  2VCV A;  5IO0 A;  3I9V 2;  2XPE A;  2IPA A;  2VLV A;  1IYH A;  3DEX A;  1SKW B;  5CYY A;  3MIX A;  1DSB A;  3S9F A;  5ECO B;  3SWL A;  3V1W A;  4OCF A;  3ZVJ D;  2B5E A;  4BVY B;  1XW5 A;  1VF2 A;  3TRX A;  2CVK A;  1OAZ A;  3ZTL A;  4OMV A;  2FWH A;  1BED A;  5A4U A;  4MNN A;  5IIZ A;  1WIK A;  3TKS A;  3GFK A;  4ZXG A;  1AXD A;  2Z9S A;  2R2J A;  1FHE A;  4FYC A;  3LEF A;  5DCG A;  2C3T A;  1TRU A;  4IN0 A;  3EUR A;  2L57 A;  1K0M A;  1M7T A;  1FB0 A;  4D73 B;  1G6W A;  4XS1 A;  3TJJ A;  2X64 A;  3KMN A;  4JED A;  4XIH A;  3TRP A;  2MYG A;  1HQO A;  5ABR A;  1XVW A;  3KP9 A;  1Z6N A;  1FAA A;  3HVN A;  3PH9 A;  4KGI A;  2HNL A;  1XWA A;  4MAB A;  1XZO A;  3TDG A;  2IMF A;  3IXR A;  2FNO A;  1MDI A;  2I3Y A;  5B8B A;  1XCC A; 
#chains in the Genus database with same CATH homology
 4KF9 A;  5ENU A;  1AQX A;  4ZIL A;  2A2R A;  1M2A A;  3G7Y A;  1JZO A;  4Z2U A;  2YPM A;  1X5E A;  2VL2 C;  2OE0 A;  2CAI A;  3C71 A;  4ECJ A;  4OO5 A;  4A5P A;  2XBQ A;  2OA7 A;  2GST A;  1SKR B;  5D8I A;  4KSM A;  2LJA A;  1FVK A;  5F07 A;  2REM A;  1X5D A;  3D21 A;  2R5G A;  1XW9 A;  3GTU B;  2DJ2 A;  3ZMK A;  4I5Q A;  4YQU A;  1U6T A;  2GDR A;  3APS A;  5IM9 A;  1HNA A;  1EOH A;  2ES7 A;  4EXJ A;  3IC8 A;  2VL9 A;  1A8Y A;  4N0V A;  3EWL A;  2ALB A;  4IP1 A;  2I1U A;  1O8X A;  5G30 A;  4DVC A;  1OE7 A;  3CMI A;  4V2N A;  2ZCT A;  5HR3 A;  2RLI A;  1SJ6 A;  1EEJ A;  4ZB6 A;  4POK A;  3UIW A;  1W89 A;  5ID2 B;  4OFT A;  1PL1 A;  4EIP A;  3F3R A;  3H1N A;  4ECI A;  2JAC A;  5DCH A;  4K0G A;  4HZ2 A;  1OC9 B;  2LJK A;  1TRS A;  3MSZ A;  4NWY A;  1VRS D;  2H30 A;  3DKS A;  1LU4 A;  2YJH A;  4PNG A;  4KW6 A;  4E8H A;  17GS A;  3U5R E;  4XS4 B;  1AUC A;  1YF0 A;  4WBR D;  4GXZ A;  1O85 A;  1USB A;  4BL7 B;  2G0F A;  3VWU A;  4KAE A;  2LRC A;  5IMA A;  4K6X A;  2X8G A;  4JR4 A;  1H75 A;  2DBC A;  5A5K A;  1FVJ A;  4QL9 A;  1MEK A;  1YF1 A;  3W8S A;  2DJ0 A;  3GUS A;  5DAK A;  2FD3 A;  2CX3 A;  2HZF A;  4ZB8 A;  4KX4 A;  4K7O A;  2O87 A;  1ST9 A;  3HZ8 A;  5FHI A;  5DAL A;  4MH2 A;  2F3M A;  3IRA A;  1TRV A;  5G1K A;  4PUF C;  1PL2 A;  4ISD A;  2C0F A;  2OE1 A;  5L71 A;  1TU8 A;  4WXT A;  4PGT A;  6GSS A;  1K0C A;  4FYU A;  3BCI A;  5EL8 A;  2CVB A;  2K8V A;  3CTF A;  4G0L A;  1XOB A;  6GSX A;  1U3I A;  1GNW A;  1NW2 A;  2FA4 A;  3IBH A;  2B7J A;  4MP4 A;  6GST A;  1ERV A;  3GH6 A;  2CQ9 A;  4OFN A;  4DSS B;  3P90 A;  5HFK A;  1N8J A;  3H93 A;  3DWV A;  1X9M B;  3GA4 A;  4F82 A;  1MDK A;  2PBJ A;  6GSU A;  3IV4 A;  4KE3 A;  6GSV A;  5EY6 A;  2JSZ A;  1XWG A;  1F2E A;  2IFQ A;  3KGK A;  4L8E A;  5C04 A;  1ILO A;  2AB6 A;  1I9D A;  4MZW A;  1FO5 A;  1ABA A;  4JE1 A;  4GTU A;  1TJD A;  2O85 A;  2HSY A;  1OYJ A;  5G2Z A;  1X9S B;  2QGV A;  5A4V A;  2CVD A;  3DVW A;  3J7Y b;  1GSQ A;  3WGX A;  1E2Y A;  2YWI A;  3TOT A;  2RUE A;  5F8B A;  1ERU A;  4BWQ A;  4EKZ A;  4K5R A;  3WD6 A;  1R26 A;  5B8A A;  1MTC A;  5HR0 A;  2HT9 A;  4XRA A;  5J4U A;  2IWT A;  2P5R A;  3EU4 A;  2H1G A;  2VL2 A;  1OC8 A;  1KNG A;  5ECK B;  3UVT A;  1C72 A;  4KCE A;  1SJZ A;  5IOX A;  2L4C A;  2H76 A;  3EVI A;  2C3Q A;  2PU9 C;  2LEG A;  5E4W A;  3LQ7 A;  4ULX A;  1VF1 A;  4K9Z A;  4IJI A;  3LWA A;  4I6X A;  4MCU A;  3F4R A;  1Z7P A;  4X1U A;  5KN0 A;  4G19 A;  5LNK e;  1WE0 A;  3TKS C;  1YEP A;  4ID0 A;  1I5G A;  1GTA A;  1YQ1 A;  4EL1 A;  4J2F A;  4XS6 A;  2V6K A;  3GRX A;  5BRT A;  3P8W A;  3GL3 A;  5COH A;  1TRW A;  4LL1 B;  1M0U A;  4L5O A;  2PWJ A;  3ME8 A;  4HU9 A;  3LYP A;  2MMA A;  4WET A;  3IK7 A;  2RM6 A;  3HYP A;  4ZBA A;  3EIN A;  3GV1 A;  4X4J A;  1ERT A;  1EP8 A;  3IHG A;  4KDX A;  2OBI A;  3FR9 A;  5BMU A;  2C80 A;  3RDW A;  2NBS A;  4BVY A;  2OBK A;  1OKT A;  3GKN A;  18GS A;  1SD8 A;  1NHO A;  3O76 A;  2PMT A;  2FWE A;  1YEX A;  2X49 A;  1A2J A;  5CRW A;  2F8A A;  1RK4 A;  1A2L A;  3QDN A;  3KXO A;  4MMM A;  2DIZ A;  3FR6 A;  3IHQ A;  3G9B A;  3EE2 A;  3TJB A;  4Z7X A;  3LXZ A;  2FWG A;  1QFN A;  4TXO A;  2E2G A;  2VUP A;  4IW9 A;  1TK8 B;  1OE8 A;  3LJR A;  1J9B A;  2LQQ A;  3M8N A;  4Z2R A;  3WGE A;  1X9W B;  2OAD A;  1DBY A;  5ECP B;  1GSU A;  1YJ6 A;  2L5O A;  4GSN A;  3H8Q A;  3HY2 A;  3ZYW A;  3HKR A;  3VLN A;  3M9J A;  4V1A p;  1EV9 A;  1Y6E A;  3VWW A;  4WBJ A;  3HCZ A;  3W6G A;  1GRX A;  1TOF A;  3EMP A;  4IHU A;  1TK5 B;  3QFB C;  3HJM A;  2K8S A;  4F03 A;  5KN2 A;  2GSQ A;  2CZ2 A;  1MD4 A;  2AJQ B;  1BG5 A;  3L9S A;  4ECC A;  4MZB A;  3QPM A;  3D4T A;  3ZLP A;  3TUE A;  5JCU A;  5DJL A;  4DSQ A;  3GHA A;  2ON7 A;  4F2I A;  4KDU A;  4O7H A;  1KTE A;  3GL5 A;  3ZIJ A;  2P5Q A;  3C1R A;  1GSD A;  4TR1 A;  3FRC A;  2A2P A;  3KJY A;  3LW9 A;  1GLQ A;  4MLY A;  2V32 A;  2FCH A;  5D73 A;  1ERW A;  3ME7 A;  11GS A;  1EGR A;  2VCW A;  4MA9 A;  1HD2 A;  3VI7 A;  4NV5 A;  2YWO A;  1AIU A;  3NIV A;  2C4J A;  1CQH A;  4CHS A;  3KP8 A;  1GLP A;  2GGT A;  4MJA A;  1XFL A;  2E2M A;  2V2G A;  3NOF A;  2GSR A;  5GZZ B;  1GWC A;  2IMK A;  4TKY A;  4N0Z A;  1YZX A;  4PQ1 A;  1G0T A;  1F37 A;  2KP2 A;  3CTG A;  1THO A;  2EIO A;  4BVX A;  1SKS B;  3K8N A;  3HVX A;  1BX9 A;  1HNC A;  4G9H A;  2KP1 A;  2CZ3 A;  1AAZ A;  2PPT A;  4JZQ A;  2MMN A;  2HLS A;  1WPI A;  1JZW A;  3GUR A;  4XS4 A;  1K0B A;  4Q5N A;  2C0E A;  3VPQ A;  5B6N A;  2WUL A;  1ZGN A;  1TKD B;  3AY8 A;  2H1B A;  1S3D A;  2PGT A;  1SYR A;  2H72 A;  2GZY A;  4TVE A;  1A24 A;  5ELA A;  2HFD A;  1JZD A;  5DDL A;  1EZK A;  1UVZ A;  2NTO A;  3E3E A;  3WYW A;  3C8E A;  1PMT A;  2H0G A;  4YH2 A;  1T4Z A;  3BCK A;  2ZUP A;  2AHE A;  2GT6 A;  1TTZ A;  2DMM A;  1EP7 A;  2YAN A;  3FMW A;  3VWX A;  3GH9 A;  1SEN A;  2XC2 A;  3KH9 A;  1RW1 A;  3CBU A;  1Z9H A;  5ECL B;  3HJP A;  2H0I A;  1V58 A;  4G10 A;  1RQM A;  4EIQ A;  3QD9 A;  4KND A;  3PR8 A;  2M80 A;  4I2U A;  1AC1 A;  3IC4 A;  4V1A g;  4OWY A;  3N9J A;  1FOH A;  3L9U A;  2H6Y A;  1MD3 A;  3CSH A;  3VWV A;  2WCI A;  1JZR A;  4K2D A;  4TN8 A;  2P31 A;  1AQW A;  2A4H A;  2R37 A;  5J5N A;  3RAZ A;  4TOP A;  1A8L A;  3BJ5 A;  1QQ2 A;  3F6F A;  3UMA A;  3ERG A;  1O73 A;  4FQU A;  4TR4 A;  4HU7 A;  2WJU A;  3FYG A;  4J56 E;  5J9C A;  4N10 A;  2M46 A;  2MBS A;  4RQX A;  3M0F A;  1GSE A;  4EC0 A;  3CRT A;  3KZQ A;  3RBT A;  3CSI A;  3MAK A;  4JU5 A;  3TJF A;  1S3A A;  1BYE A;  2YWN A;  1Z7R A;  2GLR A;  1ZMA A;  2BTO T;  4JBB A;  2LV3 A;  4K2X A;  1GH2 A;  1A2M A;  1WRY A;  4F0C A;  2HZE B;  1AQV A;  4ILF A;  4RQR A;  4CY6 A;  4EDZ A;  3EYT A;  4NPB A;  2FGX A;  4TR3 A;  1GNE A;  3MNG A;  1XPV A;  1O7U A;  2QA1 A;  2GTU A;  1ZYN A;  5KOW A;  4IQ1 A;  1XVQ A;  4IKH A;  3F6D A;  3O3T A;  3ZL5 A;  1EWX A;  1O6J A;  4MPG A;  3ZRE A;  2VLU A;  4FO5 A;  2DJJ A;  3DD3 A;  4K7I A;  4WKW A;  3L78 A;  3KM6 A;  3MYD A;  1S3C A;  3PGT A;  4NV2 A;  1V2A A;  3HJO A;  10GS A;  5D96 A;  1SU9 A;  1Z5Y E;  3D5J A;  1DE1 A;  3FW2 A;  3DIE A;  3KH7 A;  1A0F A;  5FT3 A;  1B4P A;  3TOU A;  5KEJ A;  1T00 A;  2HRF A;  4L0U A;  3APQ A;  2R0G A;  4POM A;  5G31 A;  1GP1 A;  2LNT A;  1XWC A;  4HQS A;  2PVQ A;  5CRD A;  2IIY A;  1YKC A;  4Q5R A;  3TKP A;  5GAP D;  2DKI A;  4KH7 A;  3GX8 A;  1M9B A;  1GSS A;  3VUR A;  3L4N A;  2A4V A;  20GS A;  1IYI A;  2DJ1 A;  1NM3 A;  4MF5 A;  3RHC A;  2C0G A;  2TIR A;  1G6Y A;  4PX1 A;  1SK0 A;  1QUW A;  3ED3 A;  2YV9 A;  1J08 A;  2DIY A;  2CA8 A;  2L5L A;  1TK0 B;  4ML6 A;  1WP0 A;  4NHW A;  4ZBB A;  3KD0 A;  3FEU A;  2DJ3 A;  1KBN A;  3GSS A;  4IS0 A;  4MZC A;  3I69 A;  3RHB A;  2B7K A;  5DQY A;  2HYX A;  2R3X A;  2H19 A;  2YNX A;  2LS5 A;  3MDK A;  1TU7 A;  2CX4 A;  4J57 E;  3EU3 A;  2WRT A;  3HD5 A;  2KUC A;  3HVV A;  2OKA A;  1V40 A;  1UN2 A;  1X0R A;  3QFA C;  3ZVJ A;  4USS A;  1GSY A;  1XIY A;  4HI7 A;  1ACV A;  2HI7 A;  2G2Q A;  2I9H A;  2YZH A;  5H5S A;  1GUM A;  5IMC A;  1QMV A;  4OFM A;  3F0I A;  5HQP A;  5IO2 A;  2H1A A;  2BJX A;  4Q5Q A;  5CRG A;  4O32 A;  3TJK A;  2H6X A;  3PIN A;  5IMD A;  3ZML A;  4KCA A;  3LG6 A;  2VIM A;  2L6D A;  2L4Q A;  4IQA A;  4RUV A;  5IMF A;  1PQN A;  2QSI A;  4K7N A;  2B5X A;  4YAV A;  2F9S A;  3TJG A;  3DVX A;  1T3B A;  5J41 A;  3FZ5 A;  1NSW A;  1EGO A;  1R4W A;  2GSS A;  2YZU A;  2JAD A;  3A3T A;  5ECM B;  3CYN A;  3UAR A;  2VL3 A;  1EV4 A;  3M1G A;  1R5A A;  4I2T A;  5CAX A;  5GAN D;  3IK9 A;  2XHF A;  3D22 A;  2YP6 A;  3TRQ A;  2VOC A;  2C0D A;  3F8U A;  3P2A A;  3HZ4 A;  2GT5 A;  3HVS A;  5HR1 A;  1SL2 B;  3UOM A;  1XWK A;  3HHV A;  4BA7 A;  3HDC A;  5DAK B;  1O81 A;  4LMV A;  4YKF A;  4AJ8 A;  5DAL B;  2FUG 2;  1XOA A;  1PRX A;  3NZN A;  4TXV A;  3LXT A;  2IMD A;  3A5W A;  2IME A;  2LTK A;  4K1F A;  1ML6 A;  2K18 A;  4XRD A;  3D4M A;  3F9U A;  4X0X A;  3CSJ A;  3EMX A;  2IL3 A;  4MJE A;  1SD9 A;  4GF0 A;  2CT6 A;  3Q74 A;  4NMU A;  4EO3 A;  4G2E A;  2RM5 A;  4CY8 A;  3KCM A;  4O5U A;  2MZC A;  4V2L A;  2QKE A;  3QMX A;  4D73 A;  3C73 A;  1GTI A;  4CW9 A;  3UL3 A;  4JR6 A;  5DVB A;  4WR5 A;  3MWH A;  3M9K A;  2N5A A;  2FY6 A;  4G0K A;  2IFQ B;  3DGQ A;  1Z3E A;  1A0R P;  1JHB A;  2L59 A;  1U3A A;  2V6O A;  1B8X A;  3FY7 A;  3A2X A;  3L9V A;  2C1Y A;  3KIJ A;  2YV7 A;  1K0D A;  1URM A;  2O8V B;  4OD7 A;  4GQF A;  3IAM 2;  2XPD A;  1Y25 A;  4CDO A;  2EIR A;  3RPN A;  4ACS A;  2B6M A;  1T8E B;  3BD2 A;  3DRN A;  2M72 A;  4ICY A;  3EC3 A;  1R7H A;  4N11 A;  1ZYP A;  4O92 A;  4WF4 A;  3O6T A;  3GTU A;  2VCQ A;  5F05 A;  3F4T A;  1CQG A;  2PVO C;  1PD2 1;  2AAW A;  1YKA A;  2X99 A;  2GS3 A;  2H6Z A;  2WS2 A;  4GQC A;  5KOX A;  4HZ4 A;  1V57 A;  4F0B A;  9GSS A;  3QOU A;  5F06 A;  2FA8 A;  4KUN A;  5KN1 A;  3D0Z A;  2HXK A;  2FLS A;  2X4A A;  1BQ7 A;  2YJ7 A;  4FYB A;  5DJM A;  2HSH A;  1R5P A;  2B1K A;  1OVN A;  4GSS A;  3GX0 A;  1FG4 A;  4Q5F A;  2GZP A;  1WWJ A;  5FWG A;  1GTB A;  3GST A;  1FB6 A;  1U87 A;  2R0C A;  3IPZ A;  4WEY A;  4MH3 A;  3OR5 A;  4NAX A;  2KOK A;  2H0H A;  1BAY A;  2L6C A;  3Q18 A;  1JFU A;  4AF2 A;  4HOJ A;  5ID2 A;  2FWF A;  2I81 A;  5HFG A;  1PKW A;  2BMX A;  2LRT A;  1MDJ A;  3GKM A;  4E8E A;  3VFI A;  1F9M A;  3FK8 A;  1OC9 A;  3FZ4 A;  3LSZ A;  1PX6 A;  4OO4 A;  5JWQ B;  3U6V A;  13GS A;  1GSF A;  4GST A;  3APO A;  4POL A;  1TXX A;  3QAW A;  5AIX A;  1XW6 A;  1FOV A;  1EEM A;  3IA1 A;  3KTB A;  2O89 A;  5AN1 A;  2MMO A;  5GSS A;  3UBL A;  4BL7 A;  1VF4 A;  3GIX A;  5IMZ A;  5B7C A;  2O7K A;  2PER A;  4LMW A;  5D93 A;  3A5I A;  3Q6O A;  5CO3 A;  4MPF A;  5AIS A;  3ZFB A;  2R4V A;  5CNW A;  5D9V A;  2MBT A;  2A2S A;  1ZCP A;  3ZZX A;  4EF0 A;  3BOA A;  2NVL A;  3HXS A;  5INY A;  1PSQ A;  3E9J B;  1PGT A;  1T4Y A;  2PUK C;  5DBQ A;  3A2V A;  4I97 A;  4ZBD A;  3LYK A;  2KLX A;  3F3Q A;  4PQI A;  2LST A;  3GMF A;  2F51 A;  4ZL8 A;  4KB3 A;  2IMI A;  2RII A;  4TXO B;  1PKZ A;  4K0N A;  1SJI A;  4XCS A;  1F3A A;  3KTL A;  4POB A;  2B1L A;  4WR4 A;  3FHK A;  4LA1 A;  3HA9 A;  3TKS E;  3Q19 A;  4G0I A;  1WJK A;  2HRA A;  4DSS A;  1WMJ A;  4TRX A;  5CRH A;  4ZB9 A;  3L0H A;  1X5C A;  2D2Z A;  2H66 A;  3TB2 A;  2TRC P;  3A2W A;  4KA0 A;  1DUG A;  1G7E A;  4FIW A;  2VD1 A;  1AW9 A;  2WGR A;  2VO4 A;  4PQH A;  3CRU A;  5EVO A;  2JZS A;  1QXH A;  3ZRD A;  2GQL A;  1U88 A;  3UBK A;  1K3Y A;  3GKX A;  1T7P B;  4JRR A;  3H79 A;  3QAV A;  4ZL9 A;  2AYT A;  1G7O A;  1OKD A;  3IR4 A;  1BJX A;  1YY7 A;  14GS A;  4TR1 B;  5AIV A;  4MF7 A;  1M2B A;  3VPT A;  1E6B A;  5D9T A;  2LUS A;  5ECN B;  1B4Q A;  4XTS A;  3W8J A;  3IAS 2;  12GS A;  4ECB A;  2GVP A;  2H75 A;  1Z6M A;  3I43 A;  2H71 A;  5HFI A;  2GQM A;  1EOG A;  1K0A A;  3F4S A;  5HR2 A;  1ZYE A;  3D6I A;  4P3Y B;  3QAG A;  3FR3 A;  1YDK A;  4YKG A;  4LLR A;  5ECS A;  2QC7 A;  1HNB A;  2WB9 A;  6GSW A;  2KHP A;  1QK8 A;  5LD0 A;  1V98 A;  4NXI A;  5E59 A;  2WZ9 A;  2FHE A;  2YN1 A;  2XBI A;  3G7J A;  4BVX B;  2V41 A;  2VLT A;  1TDI A;  5IPG A;  4IP6 A;  3ERW A;  1ON4 A;  3IDV A;  2P0G A;  3KMO A;  2EIQ A;  4MF6 A;  4N30 A;  1H4O A;  5CP1 A;  1B48 A;  2JU5 A;  4MK3 A;  5CRE A;  1Q98 A;  1GUH A;  5EPF A;  1M99 A;  1QGV A;  5H5Q A;  4IEL A;  2DJK A;  3QR6 A;  3TKR A;  5ECR B;  2DSA A;  1TW9 A;  4ZL7 A;  2X8C A;  4IGJ A;  1NHY A;  1XXU A;  5ECQ B;  3EPT A;  3TGZ A;  3N5O A;  4PTS A;  5IOW A;  1LJR A;  4TW5 A;  1DE2 A;  1K3L A;  3J7Y k;  4V2M A;  3DYR A;  2HRN A;  5D9X A;  5KN3 A;  1F3B A;  2NDO A;  5ECI B;  1M9A A;  4K8M A;  4IVF A;  1OC3 A;  4YAP A;  2C3N A;  4HUA A;  1K3O A;  3VK9 A;  1V9W A;  1XWB A;  4WF5 A;  4KSO A;  1THX A;  4KDY A;  2GQK A;  2E7P A;  4OCE A;  2J23 A;  5JCG A;  5GST A;  5JWO B;  22GS A;  1TP9 A;  2OE3 A;  5B6M A;  2N5B A;  3LOR A;  1ZYQ B;  5A4W A;  1ZOF A;  3WT2 A;  4EUY A;  2JZT A;  3C1S A;  3KEB A;  4LL4 B;  3C7M A;  5IPH A;  2LQO A;  3RPP A;  2HSM A;  4DSR A;  2JSY A;  2DLX A;  2H70 A;  5IQY A;  4X43 A;  3BBY A;  1ZL9 A;  4IJ3 A;  3GNJ A;  5JWR B;  5C00 A;  3UAP A;  1J0F A;  2B5Y A;  4L0W A;  2EC4 A;  4HJM A;  4AJ6 A;  4NHZ A;  2H01 A;  2RUF A;  3US3 A;  5JCW A;  2WFC A;  3WT1 A;  2CV4 A;  4I8B A;  1XBS A;  3LFL A;  1SK1 A;  3GKK A;  4MJB A;  3ISO A;  3UEM A;  2H73 A;  3M3M A;  3FZA A;  2JL4 A;  3P7X A;  4QL7 A;  4RI7 A;  5G5F A;  4ZIJ A;  1ZZY A;  2LKU A;  1SYX A;  1VF3 A;  4EDY A;  4PXO A;  5ELG A;  2AUV A;  1WOU A;  2ZNM A;  1LBK A;  2YOI A;  3JCM L;  1F6M C;  2NPB A;  2C8U A;  4YQM A;  3VI5 A;  4GLT A;  2LNS A;  5J9B A;  5J3R A;  4GWR A;  4QQ7 A;  5D9W A;  1GL8 A;  3FZ9 A;  2E0Q A;  4PNF A;  5F0G A;  2VM2 A;  4H86 A;  4F9Z A;  2K6V A;  2H1D A;  1SL1 B;  1FW1 A;  1PN0 A;  1JLW A;  2TRX A;  2AV4 A;  1PX7 A;  4PUA A;  5G5E A;  2VCX A;  3SBC A;  3PPU A;  5G1L A;  3E0U A;  6GSY A;  3G7I A;  19GS A;  2MMZ A;  1K0O A;  3H4K A;  3R3E A;  4GRF A;  2LRN A;  4EVM A;  1SK2 A;  2HRK A;  4GCI A;  2VM1 A;  1KEB A;  3I6A A;  1T1V A;  5ECH B;  2DKH A;  3UJ1 A;  1B9Y C;  2F8F A;  4O5Q A;  4RI6 A;  2IJY A;  3IE3 A;  4TR0 A;  4HQZ A;  3DML A;  3UVH A;  2OAC A;  3R2Q A;  1VGL A;  4MDC A;  2OJL A;  2UZ8 A;  4PUR A;  8GSS A;  3QCP A;  3FKF A;  7GSS A;  3TKQ A;  3ZFL A;  1PN9 A;  2VD0 A;  2GZZ A;  2PN8 A;  2IN3 A;  1GUL A;  1GUK A;  2QA2 A;  2YWM A;  4K5S A;  2LJR A;  2DC5 A;  4HS1 A;  2R6K A;  2YCD A;  4L5L A;  3DXB A;  1Q4J A;  1JLV A;  5LCZ A;  16GS A;  2X8H A;  4XHM A;  2CAQ A;  4AGS A;  1HYU A;  4IBP A;  4ML1 A;  2VCZ A;  2JZR A;  2ON5 A;  2J9H A;  4HDE A;  4HEA 2;  5AGY A;  3F63 A;  4AJ7 A;  1GTU A;  5IMV A;  1UA5 A;  3ERF A;  4YQV A;  3GYK A;  5H5R A;  4HJ2 A;  2R0P A;  4DEJ A;  3IOS A;  2H8L A;  4EE0 A;  1W4V A;  1PA3 A;  3WGD A;  3CXG A;  2HE3 A;  2K9F A;  1TI1 A;  4BPY A;  1TI3 A;  3ZIT A;  2HZE A;  2VAF A;  1SL0 B;  2DML A;  2N5F A;  4FH8 A;  1O8W A;  3GN3 A;  1K0N A;  3TCO A;  4BWS A;  1N2A A;  4MJC A;  4O5R A;  1M2D A;  2WDU A;  1B9X C;  1UC7 A;  2B3S A;  4Z2T A;  2V1M A;  3LGC A;  3ZIV A;  1A23 A;  2VCT A;  5DQS A;  2H74 A;  2I4A A;  2VCV A;  5IO0 A;  3I9V 2;  2XPE A;  2IPA A;  2VLV A;  1IYH A;  3DEX A;  1SKW B;  5CYY A;  3MIX A;  1DSB A;  3S9F A;  5ECO B;  3SWL A;  3V1W A;  4OCF A;  3ZVJ D;  2B5E A;  4BVY B;  1XW5 A;  1VF2 A;  3TRX A;  2CVK A;  1OAZ A;  3ZTL A;  4OMV A;  2FWH A;  1BED A;  5A4U A;  4MNN A;  5IIZ A;  1WIK A;  3TKS A;  3GFK A;  4ZXG A;  1AXD A;  2Z9S A;  2R2J A;  1FHE A;  4FYC A;  3LEF A;  5DCG A;  2C3T A;  1TRU A;  4IN0 A;  3EUR A;  2L57 A;  1K0M A;  1M7T A;  1FB0 A;  4D73 B;  1G6W A;  4XS1 A;  3TJJ A;  2X64 A;  3KMN A;  4JED A;  4XIH A;  3TRP A;  2MYG A;  1HQO A;  5ABR A;  1XVW A;  3KP9 A;  1Z6N A;  1FAA A;  3PH9 A;  4KGI A;  2HNL A;  1XWA A;  4MAB A;  1XZO A;  3TDG A;  2IMF A;  3IXR A;  2FNO A;  1MDI A;  2I3Y A;  5B8B A;  1XCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...