3GV6A

Crystal structure of human chromobox homolog 6 (cbx6) with h3k9 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
ERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 6
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna binding protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3gv6A00
1SSOA 2HUGA 2Q8TA 1O80A 3H91A 1M8AA 1MSGA 3IFDA 2CVRA 1ZXTA 1DOMA 4IUPA 1QE6A 2B2WA 1CM9A 5JJZA 1MSHA 2SDFA 4QUFA 4MN3A 1IKMA 1KNAA 1MGSA 1BNZA 3KUPA 3KBXA 1F9PA 1B3AA 3I91A 2N88A 4X3KA 5E4XA 1ICWA 3TZDA 1F9QA 2KOLA 1Q3LA 4MHEA 1GUWA 1HA6A 2X6LA 4XT1B 1PLFA 2B2YC 3QO2A 4ZAIA 1B4OA 1G6ZA 1HRJA 2MP1A 4HAEA 2RSNA 3MWYW 4CJ1B 5EPLA 4ZLTF 1E0BA 3I90A 3DEPA 1ILPA 4CJ0B 2X6GA 4XT3B 1WTXA 1EQTA 1NAPA 1WTPA 3Q6SA 1IL8A 2Q8RE 1G2TA 1C8CA 2DY7A 4OIKA 1RODA 1X32A 1B2TA 2B2TA 1DOLA 5EPKA 2NZ1D 2NYZD 2L9HA 2MJ8A 2JP1A 2B2WC 2MGSA 1G2SA 1PFMA 4RA8A 5EJWA 1LV9A 5CBEE 1CA5A 3R93A 4CJ2C 4OIJA 1XYIA 1ESRA 3P7JA 1DONA 2DY8A 2K1BA 2VXWA 2D9UA 1CA6A 4X3UA 5D14A 1F9RA 4QUCA 5EQ0A 4R8IA 1WD1A 4HEDA 1ILQA 1X3QA 2K01A 4O42A 2KEDA 1DOKA 2KUMA 5EPJA 3UI2A 1QNKA 4ZK9B 1EIHA 1KNEA 1PFNA 1HUNA 1PFBA 1F9SA 1BF4A 1HHVA 5CORA 2X69A 1VMCA 2FMMA 1U4PA 4RWSC 3LWEA 1HFGA 1QG7A 4IUUA 1RTOA 1IKLA 3I3CA 1RJTA 1NR4A 2B2TC 4ZKBB 4UAIA 3MTSA 2IL8A 2B2VA 4XDXA 4HSVA 4HCSA 4X3SA 3GV3A 2HDLA 1EIGA 2L11A 5COYA 1BBXC 5CMDA 2K03A 1WTRA 1NR2A 1HUMA 3FPUB 1WD0A 3F2UA 2FJ2A 4IUQA 3ONAB 1EOTA 3FDTA 1EL0A 1SDFA 1U4RA 2RVLA 3TN2A 5EKIA 4RAUC 1NCVA 2HDMA 1A15A 4IUVA 4U68A 1U4MA 2K28A 3HP3A 1DZ1A 4IURA 1HFNA 2L1BA 2L12A 1AZPA 1BO0A 1RHPA 2B2UA 2MPMA 4IUTA 5AFWA 3GV6A 1AP0A 5T1GA 1WTWA 3N52A 1S4ZA 1XX8A 2FFKB 2J7ZA 1PDQA 2JYOA 5D65A 2L4NA 2RA4A 2B2VC 2EPBA 1B53A 3D6WA 3DM1A 5E4WC 2FHTA 2K04A 3I8ZA 4R9WA 1J9OA 1RTNA 2M2LA 2EOTA 4DN4M 1G91A 2KVMA 3G7LA 1WVLA 1TVXA 5T1IA 3IL8A 1VMPA 2H1EA 1JICA 2R3ZA 4NW2A 1O7ZA 1WTOA 1B50A 1U4LA 2XIWA 1SAPA 2N55A 2BDNA 1JE4A 1ML0D 2HCIA 3DEOA 1WTVA 2B2YA 2KEEA 2RSOA 2HCCA 1O7YA 2FINB 4ZKCB 3SVMA 5CBAE 1J8IA 1X3PA 2B2UC 4X3TA 2EE1A 2KECA 4LMQD 2NWGA 1WTQA 1F2LA 1AZQA 1MI2A 2K05A 5DNFA
chains in the Genus database with same CATH superfamily
1DM0B 2HUGA 1PH1A 3H91A 3DUZA 5LMUL 1M8AA 1SRUA 4KD4A 3U9SA 1NUCA 1BCPB 1A3VA 1PRTF 5IT9L 4IUPA 1CM9A 1AW7A 4QUFA 4M8AA 4A93B 1KRTA 1IXRA 4LFAQ 1SE4A 3LNNA 3RZDB 3NTIA 3PUVA 1PTOF 4X3KA 3S1QB 3CXCA 2Z6KC 5IWAQ 2R92G 1HA6A 1HXYD 2X6LA 4XT1B 1B4OA 4ID6A 1VCIA 4DUZQ 2UUBQ 4ZLTF 2L0CA 4JYAQ 2AQ1B 4RGOS 1PH6A 1IL8A 3H3VC 1RODA 1H9JA 5EPKA 1IW7D 2KENA 5C4XH 5CBEE 4RKBA 5CGKA 4A75A 1DD2A 4X64Q 1EWHA 1TWGB 1W3SA 3H3VH 2F4VQ 3J7AF 1JOKA 4JPBW 2JA6H 1SLJA 2Z4HA 1WJJA 3PSIA 1PFNA 3DWAA 2ALYB 5CORA 1EY4A 2Y0SB 2VQEL 4LF5Q 3STBD 3ERQA 1TWAB 2ATWA 1CSPA 3UDIA 5FOBB 2ASBA 3HKZE 1I3QH 1I6VC 2R7ZG 3S24A 5C4JB 1FNUA 4OGQC 4J15A 2CQAA 1VQKA 4OWWB 1SXTA 2EXDA 4DXFA 4RGNA 3EQLC 1UNSA 3SK6A 1NCVA 3O13A 5IGGA 4BBRB 4DGZA 1QUQA 1YIJA 2L12A 1RHPA 3NWSA 3GTJH 2D2CC 3VYUA 5T1GA 1H9SA 4CDFC 1PMRA 4KN7C 5IYCG 2L4NA 1ESFA 3BJUA 2A6HC 2EPBA 5CR3A 5GAGC 2LY7A 4KJOA 4DAPA 1L0WA 1FD7D 4A3GH 4QF4A 1PZKD 2LXKA 1BCPF 1TXYA 3SXHA 2RBMA 2BDNA 2G9DA 5C6AA 2B2YA 3KLSX 4ULLA 1VQPA 5CBAE 5C0XG 1AZQA 2R92B 2K05A 3J80L 1HZCA 4PNYA 4OHJA 3GTPH 1EWCA 1D8LA 1X56A 1ZYRC 2XRQD 3S1RB 5JEAH 2RHQB 1IBMQ 3CCSA 3K57A 1IKMA 4L63B 4RCNA 1MGSA 1V1QA 4B3SQ 1KDCA 5E4XA 3KLWA 3TZDA 3OOCA 5M5YH 1D2BA 1D7QA 5CV6A 2RHSB 2LSSA 4DV7L 2UU9L 3CAMA 5J3BA 1SYFA 5JPNC 3HOVG 2R93B 4JI8L 4X65Q 2IW3A 1E1TA 3S16H 1KAAA 3WOEA 2PI2E 2A69C 4B9XA 1DCZA 5EGTA 3R93A 3S1MH 3P7JA 4V0BA 3C2PA 4C3HH 3UE1A 3KK7A 2QEJC 2VUMH 3GO5A 2IHEA 1HNXL 1D5MC 1O7LA 1FVIA 3AB9A 3AU7A 5M5XB 1XPOA 1KC8C 5FO7B 4DV1Q 1IZ6A 3TSSA 1QG7A 4H44C 2OEOA 4ME3A 4AYBE 4P74A 1KLGD 1QVGA 3RLFA 2K33A 2QILA 3H0GH 5EBDA 2WAQG 1ET9A 2ZJRA 2VW9A 4GKJL 1EYAA 5A2QL 4O0AA 4A3DH 3EROA 4GOPB 4IURA 4GN4B 4EX5A 1K9MC 4I7ZC 4KHPQ 2CCZA 1KL9A 2PW5A 2EIFA 2EYLA 2E75C 2WB1E 4OWXB 4UP7A 2K04A 4HJ8A 1GO3E 1J9OA 4KV6A 3NK9A 2E8GA 3GD7A 3HOZG 2R3ZA 3A5ZB 4JI5Q 5EBCA 2KCTA 4ZYSA 4IO9A 1PH5A 5C44B 2JA5G 3CQZB 1EY8A 1EIFA 1O7YA 2ZXPA 1CZWA 3IFTA 1XNQQ 5DM73 3NUCA 2CH4A 5HGTA 5GAHC 3PO3G 4I7AA 2PZTA 3SGIA 1A62A 4NKLA 5JPMC 1IYVA 1VQGA 3R2TA 1OXTA 4DR6Q 3A56A 2UXCL 5IWAL 4DK3C 5IP9G 1KRSA 1SR3A 1LT6D 2CKZB 4DUZL 4A3FB 2UUBL 1F77A 4DAYB 3GTOH 4C3JB 1BNZA 4IFDH 3A8KE 3L7ZC 4LF8Q 2L5TA 2JK8A 3HEJA 2B2YC 3BS1A 1G6ZA 4DR3Q 3NTHA 1X3EA 1QZHA 2MQHA 1I6HB 4LK1C 4X64L 1WYDA 3AMUA 1Y1VG 2MFIA 3TP8A 4K6LA 1WOCA 1FJGQ 3I70A 2F4VL 5IP7H 1HZ9A 4X62Q 3S2HB 2OQ0A 3HKZB 4G7ZC 2TMPA 2AUJD 1YNNC 3AFQA 1XYIA 1YVCA 1O7IA 4DR4Q 3SK8A 2K01A 1N33L 3UI2A 3I4MG 4PZ8A 4C2MH 1I94Q 4DAVA 2ZM6L 2H4OA 3K8AA 1A2TA 1JCKB 3W2DA 1OXUA 1HTLD 2RCFA 3S14B 1STHA 2F0JA 3NXWA 1N9WA 5IYDG 2HDLA 2LFNA 1YZ6A 4AIMA 1EQVA 2KHIA 2K5DA 1NR2A 3PIO3 4F87A 1IYUA 3FPUB 4A3JG 2WKCA 2EJGC 1UE6A 1F2ZA 3U50C 1TU2B 3P75A 4KLKA 4RAUC 5BR8Q 4X66L 4UHVA 3VR5A 2P5ZX 2MPMA 4CBVA 2NZOA 1A6XA 2F0WA 4DKAC 1FR3A 2J7ZA 4DR1Q 2V4DA 3LGJA 3DM1A 1IHZA 1JT8A 1STGA 1TQOA 3Q23A 4UP9A 2YYZA 2KHJA 4MIUA 3GTQH 4G7OC 1K83H 3H3VI 3HOWB 4C3IB 1ML0D 4DNIA 4BBSB 3EJIA 3CCLA 5A35A 1FGUA 1L1OB 4JBKA 4N9PA 4B3TQ 2PMZE 1E2VA 4P73A 3CW2C 3F1ZA 1JR0D 1PYWD 1AE2A 1SMYC 4P2CB 4ZQ3A 4LF6Q 1XJVA 4B3SL 1SE3A 1NSNS 4QIWB 1I50B 3L9AX 3T56B 2R61A 2YTYA 2JA7G 4G57A 3T53B 1E2WA 2EYJA 3VR4A 2N49A 5GROA 2PZUA 1H95A 3HOXG 3I90A 2WKDA 1W6KA 4OONA 3S1NH 1WTPA 4JI1L 1UEAB 2XRSD 5CYUA 1YHBA 3T4AC 1RD9D 2NYZD 3CPFA 1Z6HA 2MJ8A 4AYBB 5JVH3 4R4OA 1DYQA 3T51B 3U9OA 2NVXB 2E2JB 5D14A 4RFBA 2XGTA 1HNZQ 3S15B 1PFBA 2F0TA 1EEFD 2B63G 1MD2D 1SNQA 2QDLA 4G4KA 4DXGA 5GADC 2F0PA 2B2VA 5C0XH 3VR2A 4R1JA 1CI3M 2O4XA 3OSOA 5COYA 1X54A 1EYDA 4WJWA 1BDOA 4KHPL 4ALPA 1JE5A 4OELB 3MFGA 3HP3A 1V9PA 1NBWA 2B2UA 5IYBH 1LM0A 1GOZA 1SFOB 3QR8A 4JI5L 3OMGA 5FLMG 2Z1CA 3MFYA 3HOVH 3SK4A 4DV5Q 1JOOA 1UAPA 4CDDC 4K2KA 4BY7B 2K5WA 1EY9A 1NTGA 3RLOA 3G7LA 3G71A 2F0QA 1XNQL 3Q0AA 2D0PA 2F0HA 2VL6A 3DHQA 2B8GA 4EVOA 3I4NG 2Q2HA 4KHZA 4A76A 3M4PA 3T1HQ 1EEID 2Z9HA 1EY0A 1TS2A 3UDFA 2EE1A 5I9PA 5D3IB 5E3FA 1JB7A 2RDGA 3TREA 2K5QA 3K5LA 1TWHB 2NVQH 3I73A 1L2FA 3NQIA 4DR2Q 1G8ZD 1W2BA 4DR3L 4K5XA 1AN8A 4RGMA 3MEFA 4G7HC 1XMOQ 2PQAA 3CC4A 1PV4A 1NJIC 3NP8A 4K2LA 5I2XA 2PO4A 1GUWA 4GKKL 1FJGL 4ZAIA 4OXPA 2UUAQ 2MP1A 4X62L 3T13A 2NVTH 1E1OA 1I4XA 2F4IA 5C5LA 4CJ0B 1NAPA 2EZVA 4B3MQ 1RF2D 2IPKD 2DY7A 2ZTCA 4A3EB 2NVYH 2WP8J 3VR6A 2SOBA 2RDFA 5M5WH 3I4LA 3A0JA 4RA8A 4B3RQ 5M3FG 1MKHA 1KD1C 2XNAC 1PH4A 3BDOA 1XWEA 3GTGB 3HOZH 3HG9A 5EPJA 1JJGA 1V1PA 2KEDA 2QF7A 4WJ3M 3HOUB 1EIHA 4EGVA 3CMEA 3V05A 4CKEA 4DV3L 4DUYQ 2JA5H 3BYYB 1NE3A 5ELDA 1SNCA 1IKLA 3BG3A 1B9NA 3FMCA 4A93G 1R9TB 3TDQA 4FF4A 3PO3H 4A3BH 4HCSA 3KF6B 4LNQA 4IPCA 1Q8IA 1EIGA 2SNSA 3QB3A 5BR8L 2BA0A 2A68C 4GNXA 1YHQA 4R8NA 1ZKOA 4O2DA 5I2YA 5IP9H 2E2HH 2HIVA 3PO2B 4BA2I 3RMHA 3U4ZA 4IFDI 2M9VA 1TS3A 1VS0A 3TN2A 1GUSA 2F0VA 2HDMA 4HJ9A 1DZ1A 1SJED 1OXSC 1YHAA 2NUCA 2NN6G 1SNMA 2PMZB 5IODA 4DR5Q 2JYOA 1H9RA 2RA4A 2B2VC 3HOYB 5KRUA 3CHBD 4XXEA 4NXNQ 4OO1G 1Y1VH 1Q86C 3HS0C 4LF9Q 2V1CC 4P75A 3LX0A 4B3TL 1JWUD 4QJFA 2A5HA 4WORA 1OTCA 4MZ9A 2Y0SG 4EQ5A 3RZOH 4LF6L 2JE6I 3ULLA 4JI3Q 4IJLA 1WTVA 2KEEA 1I4PA 1VQ4A 2B2UC 1CKNA 3S9WA 4DV2Q 4BA1I 3I4MH 4QCLA 1MI2A 5AJ3Q 1VQNA 1X6OA 1JC7A 2MO1A 1O80A 2OT2A 1CHPD 2JN4A 4JG2A 1CFMA 2K32A 1LTID 1GHKA 1SMXA 1VQ6A 1XNRQ 2FXQA 5IYDH 3OIPA 5J1ZA 4BBRG 4KI0A 3QIAA 3S17H 1EZ8A 4A3JH 1Q82C 2RSNA 5ELOA 2PPBC 3C46A 2LMCB 1DXMA 3NSWA 3ND9A 4IPGA 4LF7L 1S5DD 5IY0A 4IPHA 4F8MA 2NZ1D 1VQLA 4KD3A 1Y69U 1G2SA 2ZJQA 1UEBA 1TR5A 3OTOQ 1GM5A 3NQTA 4MTNA 1CA6A 4A3MH 4HEDA 3M3YB 4JI2Q 4ZK9B 1K8GA 1F9SA 1BF4A 4DA2A 1PH2A 1VMCA 1KXLA 1VDZA 4JV5L 3LWEA 4K14A 1RTOA 4HN7A 1SJHD 3MTSA 4KKUA 4YCVA 1WFQA 2BH2A 4PQXA 3ND8A 1BBXC 1CKOA 4RHRA 2EQSA 1MIUA 2Z6BA 2ID0A 2GN5A 1WCMB 2CWPA 2R93G 3OWFA 2JA7H 4DV5L 3J7A5 4DK6C 1D1KA 4LUZA 1A0IA 1KQSA 4L5QA 1WTWA 4Q5VA 3HOXH 1PDQA 1K8OA 3DXJC 3D4DA 1JOQA 2F0MA 3TMEA 2CW0C 3CCVA 1Q12A 4JI0L 1NNXA 4K8IA 1E2ZA 4GNXC 3ZYYX 1RKNA 3T1HL 4H0LC 3W5OA 2VQFQ 4RGTA 2BOSA 3JAME 3SVMA 3F2CA 3RD4A 1OO9B 4DR2L 1XTCD 2F3VA 1X9NA 2VB2X 4XQQA 2OXPA 4JW0A 2B63H 4IN3A 3CU7A 4APVA 5C0XI 1C7YA 2ZXOA 3KBGA 1QE6A 1BKBA 2A6EC 5BN4A 5E7NA 1PRTC 3H94A 5K36H 1YNJC 1I4QA 1PTOC 3CD6A 5M3MB 1Z47A 1XPUA 1Q46A 2Q8RE 3M9BA 4KHVA 4J8QA 1GHJA 2PNRC 4UDUC 1QILA 1PTOH 2JP1A 1K0RA 3G48A 3M4QA 5C44G 4KY7A 1B9MA 2QDBA 1CUKA 3C3LA 4Y7NH 4TQUS 4KY5A 1STBA 4QUCA 2ICIA 4L5RC 4O1NA 4JBJA 5C3XA 5FO9B 2C9OA 2K52A 1YITA 2JEAI 5C3EB 3I4NH 1TWFH 4A3FG 2MHVA 4PZ7A 1IBLQ 4QGUA 3I3CA 3GTMH 4LFBQ 5FKAC 4C3JG 2KCCA 2YU9B 3C1EA 1Z7TA 2E74C 4NDXA 4A3CG 1VQJA 1EQRA 3HFZB 5JJKA 1K83B 3I55A 1HNWL 1PHJA 1CKMA 3PUYA 4LF9L 1Q90A 3HKZG 3PF4A 1MBYA 5FO8B 3EA6A 3M4OB 3A8IE 4L6TB 3GTKB 1HTPA 4R9WA 1G91A 4YWLA 5T1IA 1M1KC 3RUZA 4DV2L 4HMIA 1SYBA 5M3FH 2KCNA 1BUVT 1N32Q 1TKWB 4BY1B 1BCPC 2CH4W 2EYPA 4IJHA 3AQQA 3S2DB 3J7YW 3OW7A 3J80i 1KTKA 1KLUD 4X3TA 1CT1D 1XNRL 1HQMC 5CV5A 1CQFA 3GTLB 3IRBA 3A5UA 1BBUA 1H9KA 4YHHQ 2ZXRA 1LUZA 4YWMA 1MSGA 1B7YB 4A93H 3D8GA 4IALA 2SEBD 4OEMB 3D31A 5I6WA 3S1QH 5ELNA 3J81E 1F9QA 4C1NK 4KTAA 3VYRA 2VNUD 1QJOA 3OW2A 2A1AA 4FDBA 1RDPD 4KN4C 3WWVA 3PGZA 1WTXA 1Q7YC 3FKIH 1N36Q 1WTHA 1X32A 3JAMc 1E24A 2DNEA 3RN2A 4LFAL 4XIGS 4CHTB 2NN6H 4ZUIA 3OIQA 4GOPA 4JI2L 3HOWG 1SNDA 1Q8KA 2AQ2B 4KKTA 4C3IG 4BBSG 2UXDQ 2BE5D 1TWGH 3OYYA 1DONA 4RKLA 4JYAL 2PCFB 1NY4A 3W3AA 4HSPA 4CKBA 1TWCH 1STEA 4J6HA 2HHHQ 2Q2UA 5LMNQ 1E3PA 2NZHA 1R4PB 1B8AA 3K7AB 4XQJA 1TWAH 2FMMA 3ER0A 3A7AB 2OTLA 1PYBA 2EDGA 1VQOA 2IL8A 1YI2A 3GDEA 3VR3A 1Y1WB 1EY6A 5C4JH 5ELEA 4X3SA 3GV3A 3KYHC 1GUNA 4Y52H 1PXUA 5H1SE 2WINB 2AQ3B 4NXMQ 1L0YB 4LF5L 3TRZA 3J81j 3FDTA 2E2IH 3PIP3 4BBRH 3BVZA 4IUTA 3E9IA 5ELCA 2JSOA 4AYBG 3SR1A 2FFKB 2VQFL 3BZDB 5CC4A 1S3OA 4IUNA 4A3LH 4N8FA 5IGFA 2M2LA 1K8AC 1QVFA 3STBC 2D62A 3NPPA 4HIOA 3G6JB 1B50A 3OMCA 1C0AA 4FXGC 2HCIA 5L37A 1XTDA 1LT4D 1SYDA 3PQIA 2XWBB 1FNWA 3K6OA 2R6GA 4FF3A 2R92H 2WB1G 5HY6A 1X55A 1W6JA 2F1MA 1VF5C 2NVYB 3S1RH 4ODGA 2BH8A 5F2DA 5JOBA 2VZAA 4A3IB 1X3GA 3CRKC 5M5WB 1M4VA 5JJZA 1MSHA 2SDFA 4MN3A 1ENCA 5LMNW 1MHWC 3KBXA 1F9PA 4R4CA 3BU2A 2AMCB 3SEBA 3KDFB 1U5KA 5IIFA 3MWYW 4TSSA 3U58A 3L2PA 5IGDA 2TSSA 2R93H 1KDAA 1IBML 4BY7G 1VQAA 4GLVB 3T16A 1G2TA 4JOIA 3RR5A 4GS3A 2ZTDA 4A3BB 1VQEA 3MXPA 4HJAA 2MGSA 4KY6A 4IQZA 2F0EA 2F0SA 4CJ2C 3U4VA 1EQQA 2K1BA 2IWHA 2IHFA 2R7ZH 3X3MA 3JC66 3KF8B 5IGEA 1IBLL 1LTLA 4X65L 2JA8B 4DU9A 3DWQA 3HGBA 4E6IA 3UDGA 4LFBL 2IX3A 1QNKA 4EQNA 1QNUA 4LF4Q 2X69A 5EKLA 1XMQQ 1Y8OB 2DJGC 3NBIA 1S40A 5C4XG 2BDOA 3J81c 3KOJA 1GUOA 4ZKBB 5DAUA 3EBEA 4GOPC 1L1OA 1J5EQ 2KCMA 4FXDA 2JA6G 5IYCH 3IKJA 1YJ9A 4ZUJA 4DV6Q 1JJCB 1L0XB 4R4TA 1EUJA 1B70B 3ONAB 1ICFB 1SE8A 1SDFA 4DV1L 1JMCA 4TRDA 2I46A 2DGYA 4FP5D 4A3EG 4GLAC 5C3WA 3A55A 4PMWA 3JAML 2C35B 3H6MA 1PZID 1GUTA 1VQIA 2YV5A 1N32L 3D6WA 2OTJA 1LTRD 1V1OA 4NPSA 2WB1B 1S5CD 4XYQA 3A7LA 3HOUG 4A3KB 5KNBA 4JI6Q 5LMUQ 1WTOA 3PCOB 4B08A 4R4QA 3CQZH 3HZXA 4YHHL 4ZKCB 1BQQT 2IT1A 2KECA 4FF1A 3K0XA 1O78A 2RDHA 1F2MA 4A3GG 4K8JA 1U0LA 4NP5A 4JK1C 2Z0SA 4AQYQ 2QW7A 4HIMA 1Q1EA 4A3FH 3PO2G 1K0SA 2F0OA 4N8X1 5G3LD 4C3JH 5K5PA 2GVBA 1T9HA 3SK5A 2F0UA 1N36L 1X3FA 4A3CH 5JAVA 3ZJYC 2EJFC 4L5SA 4HAEA 1TY0A 2I5MX 2N8NA 4DR6L 5EPLA 3TBIB 5I4DA 1CSQA 3HOYG 1I6HH 1EWIA 2PQAB 2UXDL 2O5JC 4LFCQ 4HTHA 5ELFA 3S2HH 3MA2B 4LF8L 3RN5A 1PH3A 5LMNL 5C4XB 5DLQE 3D0FA 2DY8A 2VXWA 4X3UA 1I5FA 2F03A 2KQ3A 3W1GA 4EQOA 1K3BC 4C56C 1YEZA 1SE2A 4LJZC 2JA6B 2A6HD 5GAEC 4Q0FA 5DM63 4JOIC 1HFGA 2RQXA 3S14H 1GUGA 4MNOA 3M7GA 2I5HA 1YNJD 4XDXA 4DR4L 1I3QB 1DJRD 1GD7A 2WFWA 4CKCA 2VUMG 1I94L 4H13C 3RNUA 2F3IA 1CK1A 1Z9FA 4HIDA 1Y8PB 1HR0Q 1A15A 1ZYRD 4CDEC 1UWVA 3GTJB 1M90C 4QQBX 3N52A 1S4ZA 1XX8A 3QWNA 4J1MA 5D65A 3TEHB 3RLNA 3L0OA 3VA5A 1STNA 4DAMA 5E4WC 3AEVA 1SROA 2SNMA 3KFUA 1L1OC 2O5IC 4DN4M 1KDBA 1WVLA 1VMPA 2H1EA 2A8VA 4A3GB 3HOWH 2NBFA 3C1FA 1ASYA 4C3IH 2UXBQ 4DR1L 4JI7Q 2JJQA 1PZJD 2I0QA 3J81L 1Y14B 3NEMA 3A74A 1A8VA 2A69D 4HCEA 3Q8DA 3GTPB 1I50H 1S5FD 1WCMG 4DV7Q 2UU9Q 4JI4Q 5BN5A 3VA7A 2AWNA 2PYKA 4JI8Q 5GQOA 5IOCA 3MXGA 5LL6X 1SNPA 3I91A 2J0TD 5KEEA 3QOLA 3MXNB 5LL6S 4MHEA 3CCQA 4RHSA 5M5YB 1E22A 3KF6A 1LTGD 3NBHA 2EYHA 4WFN3 1OXVA 4L5TA 3D3RA 2O2LD 1TIID 1EY5A 1VQHA 2F0IA 5LHY1 2EVBA 1A63A 3S16B 3OWEB 2QCPX 2KJXA 2VB3X 4R4IA 2NVXH 2AWOA 2E2JH 4LF4L 4RMFA 3DMUA 3X3NA 1HR0W 4JBMA 3S1MB 5G3LF 1LYLA 4C3HB 5EQ0A 3M85A 3S15H 1WD1A 2QA4A 1X3QA 2F52A 4IOCA 4GN3B 4JCVE 1IBKQ 4CDCC 1K28A 2GA4B 2VUMB 3PMFA 1VQMA 2KA7A 5HGQA 1BR9A 4GKJQ 3ERSX 1XXGA 4Z9CB 5KIXA 4UAIA 1VQFA 3WDNA 3ICEA 3I2ZA 2PNHA 4OX9Q 3M4YA 1HNZL 2MUYA 2YTVA 1YNXA 2B29A 1EFWA 4FO2A 4RCOA 3H0GB 1JJ2A 5M3MG 4FYDA 4IUQA 2F0KA 1EL0A 1EOTA 3L3OC 2ZJPA 1PA6A 2VY3A 5ISRA 3G4SA 4U68A 3ULPA 2L1BA 3PV0A 3CF5A 4A3DB 3GP7A 3K5MA 1SFOH 4B9WA 5FK9C 2GVAA 3AFPA 4JI6L 2AHOB 3PUZA 2E2DC 2CFMA 5EKKA 4BY7H 1B53A 2E5LQ 2R7DA 1S5ED 2FHTA 2UUCQ 3IAYA 1PH8A 2EOTA 5C5MA 2G5DA 4LUOA 3WOFA 3TZUA 5JEAJ 1O7ZA 4YCWA 3K0YA 4LW1A 2UXCQ 5C3EG 1TS5A 4RG1A 4X6AH 1RIPA 4AQYL 1UE1A 2RSOA 1LTSD 3VDYA 4K5VA 4V190 1YNND 1TWHH 3KLRA 1SSOA 3FKIB 2Q8TA 3MC0B 3ITPA 3CP0A 2F0GA 1ZXTA 1QUQB 4DK0A 1LTAD 4IOAA 3MVVA 2HT1A 3GTOB 1H9SB 2N88A 4LFCL 1ICWA 4KJNA 2NTTA 1V8QA 1VQDA 4UP8A 1TWCB 1SBBB 4YWKA 4YIJA 4CJ1B 3J7AV 1HA5A 3DEPA 1ILPA 1LLRD 3Q6SA 4A3EH 1N33Q 1C8CA 1XMOL 2K6AA 3P20A 1FGBD 3ULJA 1B2TA 2B2TA 3SDZA 2ZM6Q 1PFMA 4K6DA 5EJWA 4BY1G 1LV9A 2UUAL 3EFXD 3GTGH 4B3ML 4F88A 3HOUH 2WAQE 1VQCA 2E2IB 4RH6A 2K5NA 4C2MB 4OWTB 1U9RA 4B3RL 3FHWA 1R9TH 1RJTA 1NR4A 4BS9A 2EXZA 1VQ5A 3K7UC 5KNDA 4X66Q 3TP5A 1HR0L 1LT3D 5FLMH 3CCJA 2DN8A 4DK1A 1EU4A 1QCBD 3PO2H 3N6RA 1HUMA 3E0EA 3CPWA 4DUYL 4A4IA 4PG3A 4FNFA 1SMYD 2RVLA 4K0KQ 1SYEA 4DV4Q 2LXJA 3I56A 1D1IA 2JEBI 2DUDA 1HH2P 3HOYH 3A8JE 2UXBL 2EY2A 4FF2A 2A19A 3T1YQ 3VYTA 4JI7L 4YY3Q 3SHLA 3TP7A 3MHBA 1P16A 3FEWX 5I6YA 4POGA 4DR7Q 2AKWB 4DV0Q 1JWMD 3DWPA 1LT5D 3NHHA 1SAPA 3GTQB 4DR5L 1AH9A 5IYBG 2HIXA 4MTKA 2FINB 2RCNA 4IFDJ 5KNCA 2RKSA 1EOVA 1X3PA 4NXNL 4JI4L 1JB3A 4JBWA 1Y1WG 1P8LA 3EIVA 1QB5D 1K8MA 3LWUA 2K5HA 1PFSA 2OCEA 4QIWE 4WRDA 5EAYA 1AFPA 2I5LX 2I07B 1MJCA 4JI3L 4JI1Q 2MNAA 2F0FA 1HJPA 1STYA 2R7ZB 2JA9A 5AJ3L 1HRJA 1KAWA 1EZ6A 1E0BA 3EVQA 1R4QB 2QGQA 3H15A 3E3XA 2B3GA 3R8BA 3S1NB 2F3WA 4BXXG 1VQBA 3BYTB 4BWGB 3OPOA 3G6EA 1DOLA 3K81C 1EIYB 1CHQD 2K75A 4QMGA 1XPRA 2J4XA 1IBKL 3MXUA 4QL5A 3BDCA 4OIJA 4TVAB 3QOJA 2B8FA 2LKVA 3RZDH 3M3YH 1F9RA 4OL7A 3E9HA 4O42A 3UDXA 1HUNA 1OXXK 2B39A 4OX9L 1B1ZA 5FJ8G 2NB0A 2IX1A 2D0OA 4A3IG 1GJXA 3BVGA 3OTOL 1YJNA 2B2TC 2AUKA 5BN3A 1D5XC 1IYJB 3FVQA 5CMDA 1PH9A 2K03A 4IPDA 1N8RC 1KIXA 1UE5A 1WCMH 2XN9C 1J6QA 4UPAA 4OO1H 5FLXE 3NTKA 4PZ6A 1QOHA 4QY7A 2E5LL 1NMGA 2UUCL 2IY5B 1BO0A 1STAA 1AP0A 4A3BG 4DFAA 4EQPA 2CHBD 3F8TA 1BXTA 2JXMB 2EY1A 1B3QA 3HOVB 2Z4IA 4FVMA 4DPGA 4GZYC 3R3OA 1BOSA 2JA8G 2K7VA 3IL8A 3K59A 3F2BA 3QJYA 4UY8C 1U4LA 3M7NA 4TKOB 3QG1A 1IW7C 5KYIA 1DGSA 1ET6A 2G9HD 4ZRZA 1Y8NB 2NWGA 4DAYA 1F2LA 1E7ZA 4GKKQ 5DNFA 1F2YA 4HMJA 1RL2A 2NVQB 1SYGA 1GVPA 1EFID 2RF4A 3HRZC 5KGUA 3CCEA 4DNRB 3K5NA 2WIIB 3KUPA 1HZBA 1B3AA 2ZTEA 3CC7A 1FL0A 2ENBA 1PLFA 5JVG3 3CKIB 5M3MH 2WAQB 2K5VA 1TT2A 4IZ8A 2Q8IB 3FP9A 3DM3A 4GLXA 4XT3B 2HQEA 2NVTB 1EQTA 2A68D 1B44D 1GXDC 5IT9E 3V96A 4A3KG 1S72A 5C4ZA 4DV3Q 1EY7A 2XTIA 5C0XJ 4N9TA 2XVSA 4F7XA 1ILQA 2PW7A 1DOKA 3PUWA 3HOZB 1KNEA 1HCZA 2DNCA 2EYOA 4XQNA 5C3EH 2A74C 2JA5B 3TQYA 3BVMA 5CV4A 4RWSC 4IUUA 2YU9H 1A2UA 2D5DA 4KMUC 4K0KL 3AYHB 4DV4L 3PO3B 2A73B 4A3MG 2L11A 5DEHA 3P1HA 1I4HA 3D4WA 5J39A 2FJ2A 2E2HB 3VYSA 3NENA 3T1YL 4LWCA 2JQOA 1WI5A 4YY3L 1NMFA 5CV9A 1PVOA 5AFWA 2NTSA 2Q2IA 5M5XH 4DR7L 4DV0L 3M4OH 1LO5D 2H5XA 4LUVA 3E6ZX 2Q2TA 3GTKH 3KDFA 1YBYA 1KABA 1Y1VB 3I7FA 2KVMA 2WV6D 1TVXA 5KYLA 5CV8A 1JICA 3KLSA 4NW2A 3R2IA 4HIKA 1FYCA 2XIWA 1PH7A 4BY1H 1VF7A 4JVZA 1JE4A 2BA1A 2XWJB 3S2DH 3RZOB 3D4RA 3CCMA 2HCCA 1T5XD 3A54A 1J8IA 3NE5B 1N34Q 5FLXc 2PI2A 1VQ7A 3W1BA 3GTLH 4LAAA 3I4MB 3KF8A 3K5OA 4S3SA 3EN2A 2PZWA 3IFDA 3TS2A 1ENAA 1HZAA 2B2WA 1G51A 3CMAA 4LF7Q 1KNAA 1EYGA 1TY2A 5E1FA 3K80C 1LACA 5C44H 1IL2A 2K4KA 3S17B 2CWAA 3QO2A 5IGBA 1A3UA 1GKHA 2F0NA 2OQKA 4ILWA 4YCUA 3J80E 4A3JB 1JWSD 2X6GA 4ZCKA 1FNVA 4PMBA 4OIKA 3NWTA 3D6CA 1CZGA 2EY5A 1JQYD 3URYA 4JV5Q 1CTMA 5K36G 3E0JA 2EYMA 4HR7B 1CA5A 5IE8A 3HKSA 5IGCA 1ESRA 1SEBD 5ELBA 3PIPA 2D9UA 1AEXA 4R8IA 1JORA 2LS01 4A3MB 2KUMA 4XYOA 3Q22A 2CW0D 2MO0A 3K7AH 1BBWA 1H9MA 1G291 1ASZA 3KJPA 1LTTD 1U4PA 5JEAG 4L8JA 1Y1WH 5TSSA 3I4OA 4CGYB 3UE0A 2N3SA 2L15A 2Z8LA 3SE0A 3PIOA 4H02A 2VQEQ 1EU3A 4GN5A 3BDLA 2HHHL 5IT9c 4U673 3V2TA 5CV7A 1WD0A 3F2UA 1D6EC 1RCVD 4JI0Q 5EKIA 3JAMi 1HFNA 1C48A 4IUVA 2JA7B 2BE5C 2Y0SE 2QKIC 1AZPA 4ABNA 5J22A 1SNOA 2A6ED 2FMCA 2L55A 1PRTD 4PV1C 1K3RA 4NXML 3HOXB 1V1PB 2KHSA 1VQ9A 2E76C 3I8ZA 4C3HG 2DJFC 4BXXH 1PTOD 2F0LA 4DF7A 4P71A 5A2QE 2EJMA 4XTCS 3KJOA 3FPPA 2N55A 4NB3A 3DEOA 2Z6KA 3K58A 4ME5A 4GNXB 2VS1A 2ZT9C 2HQLA 4LMQD 2WACA 4I65A 1WTQA 2K50A 5NUCA 2XSCA 5FJ8H 5D3DA 2B63B 3H0GG 4A3IH 5I9OA 3CCUA 2KBNA 3DLLA 2CVRA 1DOMA 2NN6I 5JJLA 1G6PA 3MAQA 1VQ8A 1T5EA 3Q24A 2IJ0A 3GQBA 2ES2A 4A3DG 4OO1I 5C4HA 1Q81C 2KOLA 1Q3LA 4BBSH 2F0DA 2QEXA 4PMCA 1HQRD 1TS4A 4P72A 1ONLA 3J7ZC 1PRTB 1LABA 3H09A 4FXKC 4QB4A 1UUPA 3PUXA 1MJEA 1ZEQX 4HJ7A 1LTBD 2L9HA 2B2WC 3NBHB 1PTOB 1CKNB 2C5CA 1I4GA 4NMZA 3E5SA 3TP6A 1QZGA 4AH6A 2JA8H 4Y7NB 1PYSB 3TS0A 1HPCA 3FKIG 5FLXL 1HHVA 3MEHA 2HD3A 4KKSA 1TWFB 3I4NB 2PQEA 5M9OA 4C1NI 1UE7A 1HNWQ 1KHIA 3J80c 2OF1A 1QVCA 3OHXC 1HNXQ 3GTMB 2ICEC 4HSVA 1X65A 1SN8A 3BZCA 1BCPD 4IFDG 2YTXA 3F2DA 1CQVA 1BVSA 1C9OA 1WTRA 3NELA 4JC0A 1XMQL 1ENFA 5HURA 1U4RA 4H7BA 2EYFA 5JJIA 1U4MA 2K28A 3CC2A 1I4RA 3PF5A 4KK7A 2BCOA 3GV6A 4K5WA 5IP7G 1J5EL 2K14A 1II3A 2EY6A 2IX0A 4DNTB 4DV6L 3MXNA 4HJ5A 2R7FA 3BZKA 3CRLC 4POFA 3B6YA 3CCRA 1RTNA 1AE3A 2N78A 3MZ5A 4A3KH 1Q1BA 1EYCA 1N34L 1K73C 1SYCA 1V43A 1S5BD 2M00A 1YJWA 1QWYA 3J81i 4M1UB 5M3FB 3I72A 4WJ4A 1A3TA 1D5ZC 2OWOA 2CQOA 1C4QA 3FRPB 4A3LG
chains in the Genus database with same CATH topology
1DM0B 2HUGA 3H91A 3DUZA 1M8AA 4KD4A 3U9SA 1NUCA 1BCPB 1A3VA 1PRTF 5IT9L 4IUPA 1CM9A 1AW7A 4QUFA 4M8AA 4A93B 1SE4A 3LNNA 3RZDB 3NTIA 3PUVA 1PTOF 4X3KA 3S1QB 1HA6A 1HXYD 2X6LA 4XT1B 1B4OA 4ID6A 1VCIA 4ZLTF 2L0CA 2AQ1B 4RGOS 1IL8A 3H3VC 1RODA 1H9JA 5EPKA 1IW7D 5CBEE 4RKBA 5CGKA 1DD2A 1EWHA 1TWGB 3J7AF 1JOKA 2Z4HA 1PFNA 3DWAA 5CORA 1EY4A 2Y0SB 3ERQA 1TWAB 5FOBB 1I6VC 5C4JB 1FNUA 4OGQC 2CQAA 1SXTA 4DXFA 4RGNA 3EQLC 1UNSA 3SK6A 1NCVA 3O13A 5IGGA 4BBRB 4DGZA 2L12A 1RHPA 3NWSA 2D2CC 3VYUA 5T1GA 1H9SA 1PMRA 4KN7C 2L4NA 1ESFA 2A6HC 2EPBA 5CR3A 2LY7A 4KJOA 4DAPA 1FD7D 4QF4A 1PZKD 1BCPF 3SXHA 2RBMA 2BDNA 2G9DA 5C6AA 2B2YA 3KLSX 4ULLA 5CBAE 5C0XG 1AZQA 2R92B 2K05A 3J80L 4PNYA 4OHJA 1EWCA 1ZYRC 2XRQD 3S1RB 5JEAH 3K57A 1IKMA 4L63B 4RCNA 1MGSA 1KDCA 5E4XA 3TZDA 3OOCA 1D2BA 5CV6A 5JPNC 1SYFA 2R93B 2IW3A 1KAAA 3WOEA 2A69C 4B9XA 1DCZA 5EGTA 3R93A 3P7JA 4V0BA 3C2PA 3KK7A 2QEJC 3GO5A 1D5MC 1O7LA 3AB9A 3AU7A 5M5XB 5FO7B 3TSSA 1QG7A 4H44C 2OEOA 1KLGD 3RLFA 2K33A 2QILA 5EBDA 1ET9A 1EYAA 5A2QL 3EROA 4IURA 4I7ZC 2PW5A 2EYLA 2E75C 2K04A 1J9OA 4KV6A 3NK9A 3GD7A 2R3ZA 5EBCA 4ZYSA 5C44B 3CQZB 1EY8A 1O7YA 2ZXPA 1CZWA 3IFTA 5DM73 3NUCA 5HGTA 2PZTA 5JPMC 4NKLA 1IYVA 3R2TA 1OXTA 3A56A 1LT6D 4A3FB 1F77A 4C3JB 1BNZA 4IFDH 3A8KE 3L7ZC 2L5TA 3HEJA 3BS1A 2B2YC 1G6ZA 3NTHA 1I6HB 4LK1C 3AMUA 3TP8A 4K6LA 3I70A 3S2HB 3HKZB 4G7ZC 2TMPA 2AUJD 1YNNC 1XYIA 3SK8A 2K01A 3UI2A 4DAVA 2H4OA 1A2TA 1JCKB 3W2DA 1OXUA 1HTLD 3S14B 1STHA 2F0JA 3NXWA 2HDLA 2LFNA 1EQVA 2K5DA 1NR2A 3PIO3 4F87A 1IYUA 3FPUB 2WKCA 2EJGC 1F2ZA 1TU2B 3P75A 4RAUC 3VR5A 2MPMA 4CBVA 1A6XA 2F0WA 1FR3A 2J7ZA 2V4DA 3DM1A 1IHZA 1STGA 1TQOA 3Q23A 2YYZA 4MIUA 4G7OC 3HOWB 4C3IB 1ML0D 4BBSB 3EJIA 5A35A 4N9PA 1E2VA 1JR0D 1PYWD 4P2CB 1SMYC 4ZQ3A 1SE3A 1NSNS 4QIWB 1I50B 3L9AX 3T56B 2R61A 4G57A 3T53B 1E2WA 2EYJA 3VR4A 2PZUA 3I90A 2WKDA 1W6KA 1WTPA 1UEAB 2XRSD 5CYUA 3T4AC 1RD9D 4AYBB 2NYZD 1Z6HA 2MJ8A 5JVH3 1DYQA 3T51B 3U9OA 2NVXB 2E2JB 5D14A 4RFBA 3S15B 1PFBA 2F0TA 1EEFD 1MD2D 1SNQA 4G4KA 4DXGA 2F0PA 2B2VA 5C0XH 3VR2A 1CI3M 2O4XA 3OSOA 5COYA 1EYDA 4WJWA 1BDOA 3MFGA 3HP3A 2B2UA 1GOZA 1SFOB 3OMGA 2Z1CA 3MFYA 3SK4A 1JOOA 1UAPA 4K2KA 4BY7B 2K5WA 1EY9A 3G7LA 2F0QA 3Q0AA 2F0HA 3DHQA 2B8GA 4EVOA 4KHZA 1EEID 1EY0A 1TS2A 2EE1A 5I9PA 5D3IB 5E3FA 2RDGA 2K5QA 3K5LA 1TWHB 3I73A 3NQIA 1G8ZD 4K5XA 1AN8A 4RGMA 4G7HC 3NP8A 4K2LA 5I2XA 2PO4A 1GUWA 4ZAIA 2MP1A 3T13A 1I4XA 2F4IA 5C5LA 4CJ0B 1NAPA 2EZVA 1RF2D 2IPKD 2DY7A 4A3EB 2WP8J 3VR6A 2SOBA 2RDFA 3I4LA 4RA8A 2XNAC 3BDOA 1XWEA 3GTGB 3HG9A 5EPJA 1V1PA 2KEDA 2QF7A 3HOUB 1EIHA 4EGVA 3V05A 4CKEA 3BYYB 5ELDA 1SNCA 1IKLA 3BG3A 1B9NA 3FMCA 1R9TB 3TDQA 4FF4A 4HCSA 1Q8IA 1EIGA 2SNSA 3QB3A 2BA0A 2A68C 4R8NA 1ZKOA 5I2YA 3PO2B 4BA2I 3RMHA 4IFDI 2M9VA 1TS3A 3TN2A 1GUSA 2F0VA 2HDMA 1DZ1A 1SJED 1OXSC 2NUCA 2NN6G 1SNMA 2PMZB 5IODA 2JYOA 1H9RA 2RA4A 2B2VC 3HOYB 5KRUA 3CHBD 4XXEA 4OO1G 3HS0C 3LX0A 1JWUD 2A5HA 4WORA 2JE6I 1WTVA 2KEEA 1I4PA 2B2UC 3S9WA 4BA1I 4QCLA 1MI2A 1JC7A 1O80A 2OT2A 1CHPD 1CFMA 2K32A 1LTID 1GHKA 3OIPA 5J1ZA 4KI0A 3QIAA 1EZ8A 2RSNA 2PPBC 3C46A 2LMCB 1DXMA 3NSWA 3ND9A 1S5DD 4F8MA 2NZ1D 4KD3A 1Y69U 1G2SA 1TR5A 3NQTA 1CA6A 4HEDA 3M3YB 4ZK9B 1F9SA 1BF4A 4DA2A 1VMCA 1VDZA 3LWEA 4K14A 1RTOA 4HN7A 1SJHD 3MTSA 4KKUA 4PQXA 3ND8A 1BBXC 4RHRA 2ID0A 1WCMB 3OWFA 1D1KA 1WTWA 4Q5VA 1PDQA 1K8OA 3DXJC 3D4DA 1JOQA 2F0MA 3TMEA 2CW0C 1Q12A 4K8IA 1E2ZA 3ZYYX 1RKNA 4H0LC 4RGTA 2BOSA 3JAME 3SVMA 3RD4A 1OO9B 1XTCD 2F3VA 2VB2X 4XQQA 2OXPA 4IN3A 3CU7A 5C0XI 2ZXOA 3KBGA 1QE6A 2A6EC 5BN4A 1PRTC 3H94A 5K36H 1YNJC 1I4QA 1PTOC 5M3MB 1Z47A 2Q8RE 4KHVA 4J8QA 1GHJA 2PNRC 4UDUC 1QILA 1PTOH 2JP1A 4KY7A 1B9MA 2QDBA 3C3LA 4TQUS 4KY5A 1STBA 4QUCA 2ICIA 4O1NA 5C3XA 5FO9B 2C9OA 2JEAI 5C3EB 2MHVA 3I3CA 5FKAC 4C3JG 2KCCA 2YU9B 3C1EA 1Z7TA 2E74C 4NDXA 1K83B 3PUYA 1Q90A 1MBYA 5FO8B 3EA6A 3M4OB 3A8IE 4L6TB 3GTKB 1HTPA 4R9WA 1G91A 5T1IA 3RUZA 4HMIA 1SYBA 2KCNA 1BUVT 1TKWB 4BY1B 1BCPC 2EYPA 3S2DB 3J7YW 3OW7A 1KTKA 1KLUD 4X3TA 1CT1D 1HQMC 5CV5A 1CQFA 3GTLB 1H9KA 2ZXRA 1MSGA 3D8GA 4IALA 2SEBD 3D31A 5I6WA 3J81E 1F9QA 4C1NK 4KTAA 3VYRA 2VNUD 1QJOA 1RDPD 4KN4C 1WTXA 1X32A 2DNEA 4XIGS 4CHTB 2NN6H 4ZUIA 3OIQA 1SNDA 4C3IG 2AQ2B 4KKTA 2BE5D 1DONA 4RKLA 2PCFB 3W3AA 4HSPA 4CKBA 1STEA 4J6HA 1R4PB 3K7AB 4XQJA 2FMMA 3A7AB 2EDGA 2IL8A 3VR3A 1Y1WB 1EY6A 5ELEA 4X3SA 3GV3A 1GUNA 1PXUA 2WINB 2AQ3B 1L0YB 3FDTA 3PIP3 3BVZA 4IUTA 5ELCA 2JSOA 3SR1A 2FFKB 3BZDB 5CC4A 4IUNA 5IGFA 2M2LA 2D62A 3NPPA 3G6JB 1B50A 3OMCA 4FXGC 2HCIA 1LT4D 1SYDA 2XWBB 1FNWA 3K6OA 2R6GA 4FF3A 1W6JA 2F1MA 1VF5C 2NVYB 4ODGA 5F2DA 5JOBA 4A3IB 3CRKC 5M5WB 1M4VA 5JJZA 1MSHA 2SDFA 4MN3A 1ENCA 3KBXA 1F9PA 3SEBA 5IIFA 3MWYW 4TSSA 5IGDA 2TSSA 1KDAA 3T16A 1G2TA 4A3BB 3MXPA 2MGSA 4KY6A 4IQZA 2F0EA 2F0SA 4CJ2C 2K1BA 2IWHA 3X3MA 5IGEA 2JA8B 4DU9A 3DWQA 3HGBA 4E6IA 2IX3A 1QNKA 4EQNA 1QNUA 2X69A 5EKLA 1Y8OB 3NBIA 2BDOA 1GUOA 4ZKBB 5DAUA 4FXDA 3IKJA 4ZUJA 1L0XB 3ONAB 1SDFA 4TRDA 2I46A 4FP5D 5C3WA 3A55A 4PMWA 3JAML 3H6MA 1PZID 1GUTA 3D6WA 1LTRD 1V1OA 2WB1B 1S5CD 4XYQA 3A7LA 4A3KB 5KNBA 1WTOA 4B08A 3HZXA 4ZKCB 1BQQT 2IT1A 2KECA 4FF1A 1O78A 2RDHA 1F2MA 4K8JA 4NP5A 4JK1C 1Q1EA 2F0OA 5G3LD 5K5PA 3SK5A 2F0UA 5JAVA 2EJFC 4HAEA 1TY0A 5EPLA 3TBIB 5I4DA 2O5JC 4HTHA 5ELFA 3MA2B 5C4XB 2DY8A 2VXWA 4X3UA 2F03A 2KQ3A 4EQOA 4C56C 1SE2A 4LJZC 2JA6B 2A6HD 4Q0FA 5DM63 1HFGA 2RQXA 1GUGA 3M7GA 1YNJD 4XDXA 1I3QB 1DJRD 4CKCA 4H13C 1CK1A 1Y8PB 1A15A 1ZYRD 3GTJB 3N52A 1S4ZA 1XX8A 3QWNA 4J1MA 5D65A 3VA5A 1STNA 5E4WC 2SNMA 2O5IC 4DN4M 1KDBA 1WVLA 1VMPA 2H1EA 4A3GB 2NBFA 3C1FA 1PZJD 3J81L 2A69D 4HCEA 3GTPB 1S5FD 5BN5A 3VA7A 2AWNA 2PYKA 5IOCA 5LL6X 3MXGA 1SNPA 3I91A 2J0TD 5KEEA 3QOLA 5LL6S 4MHEA 4RHSA 5M5YB 1LTGD 3NBHA 2EYHA 4WFN3 1OXVA 3D3RA 2O2LD 1TIID 1EY5A 5LHY1 2F0IA 2EVBA 3S16B 3OWEB 2QCPX 2KJXA 2VB3X 2AWOA 3DMUA 3X3NA 3S1MB 5G3LF 4C3HB 5EQ0A 3M85A 1WD1A 1X3QA 2VUMB 2GA4B 3PMFA 2KA7A 1BR9A 1XXGA 4Z9CB 5KIXA 4UAIA 3WDNA 3M4YA 2MUYA 4FO2A 4RCOA 3H0GB 4FYDA 4IUQA 2F0KA 1EL0A 1EOTA 3L3OC 5ISRA 4U68A 2L1BA 3PV0A 4A3DB 3GP7A 3K5MA 4B9WA 5FK9C 3PUZA 2E2DC 5EKKA 1B53A 1S5ED 2FHTA 3IAYA 2EOTA 5C5MA 3WOFA 3TZUA 5JEAJ 1O7ZA 3K0YA 1TS5A 2RSOA 1LTSD 4K5VA 4V190 1YNND 3KLRA 1SSOA 3FKIB 2Q8TA 3MC0B 3ITPA 2F0GA 1ZXTA 4DK0A 1LTAD 3MVVA 3GTOB 1H9SB 2N88A 1ICWA 4KJNA 2NTTA 1V8QA 1TWCB 1SBBB 4YIJA 4CJ1B 3J7AV 1HA5A 3DEPA 1ILPA 1LLRD 3Q6SA 1C8CA 2K6AA 3P20A 1FGBD 1B2TA 2B2TA 3SDZA 1PFMA 4K6DA 5EJWA 1LV9A 3EFXD 4F88A 2E2IB 4RH6A 4C2MB 1U9RA 1RJTA 1NR4A 4BS9A 2EXZA 5KNDA 3TP5A 1LT3D 2DN8A 4DK1A 1EU4A 1QCBD 3N6RA 1HUMA 4FNFA 1SMYD 2RVLA 1SYEA 1D1IA 2JEBI 3A8JE 2EY2A 4FF2A 3VYTA 3SHLA 3TP7A 3MHBA 3FEWX 5I6YA 1JWMD 3DWPA 1LT5D 3NHHA 1SAPA 3GTQB 2FINB 4IFDJ 5KNCA 2RKSA 1X3PA 1JB3A 4JBWA 1QB5D 1K8MA 3LWUA 4WRDA 1AFPA 2I07B 2F0FA 1STYA 2R7ZB 1HRJA 1EZ6A 1E0BA 3EVQA 1R4QB 3S1NB 3R8BA 2F3WA 3BYTB 4BWGB 3OPOA 1DOLA 1CHQD 4QMGA 2J4XA 3MXUA 3BDCA 4OIJA 3QOJA 2B8FA 2LKVA 1F9RA 4OL7A 4O42A 1HUNA 1OXXK 2B39A 1B1ZA 2NB0A 2IX1A 1GJXA 3BVGA 2B2TC 2AUKA 5BN3A 1D5XC 3FVQA 5CMDA 2K03A 2XN9C 4OO1H 5FLXE 3NTKA 1QOHA 1BO0A 1STAA 1AP0A 4DFAA 4EQPA 2CHBD 1BXTA 2JXMB 2EY1A 3HOVB 2Z4IA 4FVMA 4GZYC 3R3OA 1BOSA 2K7VA 3IL8A 3K59A 3QJYA 1U4LA 3M7NA 4TKOB 3QG1A 1IW7C 5KYIA 1ET6A 2G9HD 4ZRZA 1Y8NB 2NWGA 4DAYA 1F2LA 5DNFA 1F2YA 4HMJA 2NVQB 1SYGA 5KGUA 1EFID 3HRZC 4DNRB 3K5NA 2WIIB 3KUPA 1B3AA 2ENBA 1PLFA 5JVG3 3CKIB 2WAQB 1TT2A 4IZ8A 2Q8IB 4XT3B 2HQEA 2NVTB 1EQTA 2A68D 1B44D 1GXDC 5IT9E 3V96A 5C4ZA 1EY7A 5C0XJ 4N9TA 2XVSA 4F7XA 1ILQA 2PW7A 1DOKA 3PUWA 3HOZB 1KNEA 1HCZA 2DNCA 2EYOA 4XQNA 2A74C 2JA5B 3BVMA 5CV4A 4RWSC 4IUUA 1A2UA 2D5DA 4KMUC 3PO3B 2A73B 2L11A 5DEHA 3P1HA 1I4HA 3D4WA 5J39A 2FJ2A 2E2HB 3VYSA 5CV9A 5AFWA 2NTSA 1LO5D 3E6ZX 1KABA 1Y1VB 2KVMA 2WV6D 1TVXA 5KYLA 5CV8A 1JICA 3KLSA 4NW2A 3R2IA 1FYCA 2XIWA 1VF7A 1JE4A 2BA1A 2XWJB 3RZOB 3D4RA 2HCCA 1T5XD 3A54A 1J8IA 3NE5B 4LAAA 3I4MB 3KF8A 3K5OA 4S3SA 2PZWA 3IFDA 1ENAA 2B2WA 1KNAA 1TY2A 5E1FA 1LACA 3S17B 3QO2A 5IGBA 1A3UA 2F0NA 4ILWA 4A3JB 3J80E 1JWSD 2X6GA 1FNVA 4PMBA 4OIKA 3NWTA 3D6CA 1CZGA 2EY5A 1JQYD 3URYA 5K36G 1CTMA 3E0JA 2EYMA 4HR7B 1CA5A 5IGCA 1ESRA 1SEBD 5ELBA 2D9UA 1AEXA 4R8IA 1JORA 2LS01 4A3MB 2KUMA 4XYOA 3Q22A 2CW0D 1H9MA 1G291 1LTTD 1U4PA 5JEAG 4L8JA 5TSSA 4CGYB 2Z8LA 3SE0A 1EU3A 3BDLA 4U673 3V2TA 5CV7A 1WD0A 3F2UA 1D6EC 1RCVD 5EKIA 1HFNA 1C48A 4IUVA 2JA7B 2BE5C 2QKIC 1AZPA 4ABNA 5J22A 1SNOA 2A6ED 2FMCA 2L55A 1PRTD 4PV1C 3HOXB 1V1PB 2KHSA 2E76C 3I8ZA 4C3HG 1PTOD 2F0LA 4DF7A 5A2QE 2EJMA 4XTCS 3FPPA 2N55A 3DEOA 3K58A 4ME5A 2ZT9C 4LMQD 2WACA 4I65A 1WTQA 5NUCA 2XSCA 5D3DA 2B63B 5I9OA 2CVRA 1DOMA 2NN6I 3MAQA 1T5EA 3Q24A 2IJ0A 3GQBA 4OO1I 5C4HA 2KOLA 1Q3LA 2F0DA 4PMCA 1HQRD 1TS4A 1ONLA 1PRTB 1LABA 3H09A 4FXKC 4QB4A 1UUPA 3PUXA 1ZEQX 1LTBD 2L9HA 2B2WC 1PTOB 2C5CA 1I4GA 4NMZA 3E5SA 3TP6A 4Y7NB 1HPCA 5FLXL 1HHVA 3MEHA 4KKSA 1TWFB 3I4NB 2PQEA 5M9OA 4C1NI 2OF1A 3OHXC 3GTMB 2ICEC 4HSVA 1BCPD 4IFDG 1CQVA 1WTRA 1ENFA 5HURA 1U4RA 4H7BA 2EYFA 1U4MA 2K28A 1I4RA 4KK7A 2BCOA 3GV6A 4K5WA 1II3A 2EY6A 2IX0A 4DNTB 3MXNA 3CRLC 1RTNA 3MZ5A 1Q1BA 1EYCA 1SYCA 1V43A 1S5BD 2M00A 1QWYA 4M1UB 5M3FB 3I72A 1A3TA 1D5ZC 1C4QA 3FRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSO A;  2HUG A;  2Q8T A;  1O80 A;  3H91 A;  1M8A A;  1MSG A;  3IFD A;  2CVR A;  1ZXT A;  1DOM A;  4IUP A;  1QE6 A;  2B2W A;  1CM9 A;  5JJZ A;  1MSH A;  2SDF A;  4QUF A;  4MN3 A;  1IKM A;  1KNA A;  1MGS A;  1BNZ A;  3KUP A;  3KBX A;  1F9P A;  1B3A A;  3I91 A;  2N88 A;  4X3K A;  5E4X A;  1ICW A;  3TZD A;  1F9Q A;  2KOL A;  1Q3L A;  4MHE A;  1GUW A;  1HA6 A;  2X6L A;  4XT1 B;  1PLF A;  2B2Y C;  3QO2 A;  4ZAI A;  1B4O A;  1G6Z A;  1HRJ A;  2MP1 A;  4HAE A;  2RSN A;  3MWY W;  4CJ1 B;  5EPL A;  4ZLT F;  1E0B A;  3I90 A;  3DEP A;  1ILP A;  4CJ0 B;  2X6G A;  4XT3 B;  1WTX A;  1EQT A;  1NAP A;  1WTP A;  3Q6S A;  1IL8 A;  2Q8R E;  1G2T A;  1C8C A;  2DY7 A;  4OIK A;  1ROD A;  1X32 A;  1B2T A;  2B2T A;  1DOL A;  5EPK A;  2NZ1 D;  2NYZ D;  2L9H A;  2MJ8 A;  2JP1 A;  2B2W C;  2MGS A;  1G2S A;  1PFM A;  4RA8 A;  5EJW A;  1LV9 A;  5CBE E;  1CA5 A;  3R93 A;  4CJ2 C;  4OIJ A;  1XYI A;  1ESR A;  3P7J A;  1DON A;  2DY8 A;  2K1B A;  2VXW A;  2D9U A;  1CA6 A;  4X3U A;  5D14 A;  1F9R A;  4QUC A;  5EQ0 A;  4R8I A;  1WD1 A;  4HED A;  1ILQ A;  1X3Q A;  2K01 A;  4O42 A;  2KED A;  1DOK A;  2KUM A;  5EPJ A;  3UI2 A;  1QNK A;  4ZK9 B;  1EIH A;  1KNE A;  1PFN A;  1HUN A;  1PFB A;  1F9S A;  1BF4 A;  1HHV A;  5COR A;  2X69 A;  1VMC A;  2FMM A;  1U4P A;  4RWS C;  3LWE A;  1HFG A;  1QG7 A;  4IUU A;  1RTO A;  1IKL A;  3I3C A;  1RJT A;  1NR4 A;  2B2T C;  4ZKB B;  4UAI A;  3MTS A;  2IL8 A;  2B2V A;  4XDX A;  4HSV A;  4HCS A;  4X3S A;  3GV3 A;  2HDL A;  1EIG A;  2L11 A;  5COY A;  1BBX C;  5CMD A;  2K03 A;  1WTR A;  1NR2 A;  1HUM A;  3FPU B;  1WD0 A;  3F2U A;  2FJ2 A;  4IUQ A;  3ONA B;  1EOT A;  3FDT A;  1EL0 A;  1SDF A;  1U4R A;  2RVL A;  3TN2 A;  5EKI A;  4RAU C;  1NCV A;  2HDM A;  1A15 A;  4IUV A;  4U68 A;  1U4M A;  2K28 A;  3HP3 A;  1DZ1 A;  4IUR A;  1HFN A;  2L1B A;  2L12 A;  1AZP A;  1BO0 A;  1RHP A;  2B2U A;  2MPM A;  4IUT A;  5AFW A;  3GV6 A;  1AP0 A;  5T1G A;  1WTW A;  3N52 A;  1S4Z A;  1XX8 A;  2FFK B;  2J7Z A;  1PDQ A;  2JYO A;  5D65 A;  2L4N A;  2RA4 A;  2B2V C;  2EPB A;  1B53 A;  3D6W A;  3DM1 A;  5E4W C;  2FHT A;  2K04 A;  3I8Z A;  4R9W A;  1J9O A;  1RTN A;  2M2L A;  2EOT A;  4DN4 M;  1G91 A;  2KVM A;  3G7L A;  1WVL A;  1TVX A;  5T1I A;  3IL8 A;  1VMP A;  2H1E A;  1JIC A;  2R3Z A;  4NW2 A;  1O7Z A;  1WTO A;  1B50 A;  1U4L A;  2XIW A;  1SAP A;  2N55 A;  2BDN A;  1JE4 A;  1ML0 D;  2HCI A;  3DEO A;  1WTV A;  2B2Y A;  2KEE A;  2RSO A;  2HCC A;  1O7Y A;  2FIN B;  4ZKC B;  3SVM A;  5CBA E;  1J8I A;  1X3P A;  2B2U C;  4X3T A;  2EE1 A;  2KEC A;  4LMQ D;  2NWG A;  1WTQ A;  1F2L A;  1AZQ A;  1MI2 A;  2K05 A;  5DNF A; 
#chains in the Genus database with same CATH topology
 1DM0 B;  2HUG A;  1PH1 A;  3H91 A;  3DUZ A;  5LMU L;  1M8A A;  1SRU A;  4KD4 A;  3U9S A;  1NUC A;  1BCP B;  1A3V A;  1PRT F;  5IT9 L;  4IUP A;  1CM9 A;  1AW7 A;  4QUF A;  4M8A A;  4A93 B;  1KRT A;  1IXR A;  4LFA Q;  1SE4 A;  3LNN A;  3RZD B;  3NTI A;  3PUV A;  1PTO F;  4X3K A;  3S1Q B;  3CXC A;  2Z6K C;  5IWA Q;  2R92 G;  1HA6 A;  1HXY D;  2X6L A;  4XT1 B;  1B4O A;  4ID6 A;  1VCI A;  4DUZ Q;  2UUB Q;  4ZLT F;  2L0C A;  4JYA Q;  2AQ1 B;  4RGO S;  1PH6 A;  1IL8 A;  3H3V C;  1ROD A;  1H9J A;  5EPK A;  1IW7 D;  2KEN A;  5C4X H;  5CBE E;  4RKB A;  5CGK A;  4A75 A;  1DD2 A;  4X64 Q;  1EWH A;  1TWG B;  1W3S A;  3H3V H;  2F4V Q;  3J7A F;  1JOK A;  4JPB W;  2JA6 H;  1SLJ A;  2Z4H A;  1WJJ A;  3PSI A;  1PFN A;  3DWA A;  2ALY B;  5COR A;  1EY4 A;  2Y0S B;  2VQE L;  4LF5 Q;  3STB D;  3ERQ A;  1TWA B;  2ATW A;  1CSP A;  3UDI A;  5FOB B;  2ASB A;  3HKZ E;  1I3Q H;  1I6V C;  2R7Z G;  3S24 A;  5C4J B;  1FNU A;  4OGQ C;  4J15 A;  2CQA A;  1VQK A;  4OWW B;  1SXT A;  2EXD A;  4DXF A;  4RGN A;  3EQL C;  1UNS A;  3SK6 A;  1NCV A;  3O13 A;  5IGG A;  4BBR B;  4DGZ A;  1QUQ A;  1YIJ A;  2L12 A;  1RHP A;  3NWS A;  3GTJ H;  2D2C C;  3VYU A;  5T1G A;  1H9S A;  4CDF C;  1PMR A;  4KN7 C;  5IYC G;  2L4N A;  1ESF A;  3BJU A;  2A6H C;  2EPB A;  5CR3 A;  5GAG C;  2LY7 A;  4KJO A;  4DAP A;  1L0W A;  1FD7 D;  4A3G H;  4QF4 A;  1PZK D;  2LXK A;  1BCP F;  1TXY A;  3SXH A;  2RBM A;  2BDN A;  2G9D A;  5C6A A;  2B2Y A;  3KLS X;  4ULL A;  1VQP A;  5CBA E;  5C0X G;  1AZQ A;  2R92 B;  2K05 A;  3J80 L;  1HZC A;  4PNY A;  4OHJ A;  3GTP H;  1EWC A;  1D8L A;  1X56 A;  1ZYR C;  2XRQ D;  3S1R B;  5JEA H;  2RHQ B;  1IBM Q;  3CCS A;  3K57 A;  1IKM A;  4L63 B;  4RCN A;  1MGS A;  1V1Q A;  4B3S Q;  1KDC A;  5E4X A;  3KLW A;  3TZD A;  3OOC A;  5M5Y H;  1D2B A;  1D7Q A;  5CV6 A;  2RHS B;  2LSS A;  4DV7 L;  2UU9 L;  3CAM A;  5J3B A;  1SYF A;  5JPN C;  3HOV G;  2R93 B;  4JI8 L;  4X65 Q;  2IW3 A;  1E1T A;  3S16 H;  1KAA A;  3WOE A;  2PI2 E;  2A69 C;  4B9X A;  1DCZ A;  5EGT A;  3R93 A;  3S1M H;  3P7J A;  4V0B A;  3C2P A;  4C3H H;  3UE1 A;  3KK7 A;  2QEJ C;  2VUM H;  3GO5 A;  2IHE A;  1HNX L;  1D5M C;  1O7L A;  1FVI A;  3AB9 A;  3AU7 A;  5M5X B;  1XPO A;  1KC8 C;  5FO7 B;  4DV1 Q;  1IZ6 A;  3TSS A;  1QG7 A;  4H44 C;  2OEO A;  4ME3 A;  4AYB E;  4P74 A;  1KLG D;  1QVG A;  3RLF A;  2K33 A;  2QIL A;  3H0G H;  5EBD A;  2WAQ G;  1ET9 A;  2ZJR A;  2VW9 A;  4GKJ L;  1EYA A;  5A2Q L;  4O0A A;  4A3D H;  3ERO A;  4GOP B;  4IUR A;  4GN4 B;  4EX5 A;  1K9M C;  4I7Z C;  4KHP Q;  2CCZ A;  1KL9 A;  2PW5 A;  2EIF A;  2EYL A;  2E75 C;  2WB1 E;  4OWX B;  4UP7 A;  2K04 A;  4HJ8 A;  1GO3 E;  1J9O A;  4KV6 A;  3NK9 A;  2E8G A;  3GD7 A;  3HOZ G;  2R3Z A;  3A5Z B;  4JI5 Q;  5EBC A;  2KCT A;  4ZYS A;  4IO9 A;  1PH5 A;  5C44 B;  2JA5 G;  3CQZ B;  1EY8 A;  1EIF A;  1O7Y A;  2ZXP A;  1CZW A;  3IFT A;  1XNQ Q;  5DM7 3;  3NUC A;  2CH4 A;  5HGT A;  5GAH C;  3PO3 G;  4I7A A;  2PZT A;  3SGI A;  1A62 A;  4NKL A;  5JPM C;  1IYV A;  1VQG A;  3R2T A;  1OXT A;  4DR6 Q;  3A56 A;  2UXC L;  5IWA L;  4DK3 C;  5IP9 G;  1KRS A;  1SR3 A;  1LT6 D;  2CKZ B;  4DUZ L;  4A3F B;  2UUB L;  1F77 A;  4DAY B;  3GTO H;  4C3J B;  1BNZ A;  4IFD H;  3A8K E;  3L7Z C;  4LF8 Q;  2L5T A;  2JK8 A;  3HEJ A;  2B2Y C;  3BS1 A;  1G6Z A;  4DR3 Q;  3NTH A;  1X3E A;  1QZH A;  2MQH A;  1I6H B;  4LK1 C;  4X64 L;  1WYD A;  3AMU A;  1Y1V G;  2MFI A;  3TP8 A;  4K6L A;  1WOC A;  1FJG Q;  3I70 A;  2F4V L;  5IP7 H;  1HZ9 A;  4X62 Q;  3S2H B;  2OQ0 A;  3HKZ B;  4G7Z C;  2TMP A;  2AUJ D;  1YNN C;  3AFQ A;  1XYI A;  1YVC A;  1O7I A;  4DR4 Q;  3SK8 A;  2K01 A;  1N33 L;  3UI2 A;  3I4M G;  4PZ8 A;  4C2M H;  1I94 Q;  4DAV A;  2ZM6 L;  2H4O A;  3K8A A;  1A2T A;  1JCK B;  3W2D A;  1OXU A;  1HTL D;  2RCF A;  3S14 B;  1STH A;  2F0J A;  3NXW A;  1N9W A;  5IYD G;  2HDL A;  2LFN A;  1YZ6 A;  4AIM A;  1EQV A;  2KHI A;  2K5D A;  1NR2 A;  3PIO 3;  4F87 A;  1IYU A;  3FPU B;  4A3J G;  2WKC A;  2EJG C;  1UE6 A;  1F2Z A;  3U50 C;  1TU2 B;  3P75 A;  4KLK A;  4RAU C;  5BR8 Q;  4X66 L;  4UHV A;  3VR5 A;  2P5Z X;  2MPM A;  4CBV A;  2NZO A;  1A6X A;  2F0W A;  4DKA C;  1FR3 A;  2J7Z A;  4DR1 Q;  2V4D A;  3LGJ A;  3DM1 A;  1IHZ A;  1JT8 A;  1STG A;  1TQO A;  3Q23 A;  4UP9 A;  2YYZ A;  2KHJ A;  4MIU A;  3GTQ H;  4G7O C;  1K83 H;  3H3V I;  3HOW B;  4C3I B;  1ML0 D;  4DNI A;  4BBS B;  3EJI A;  3CCL A;  5A35 A;  1FGU A;  1L1O B;  4JBK A;  4N9P A;  4B3T Q;  2PMZ E;  1E2V A;  4P73 A;  3CW2 C;  3F1Z A;  1JR0 D;  1PYW D;  1AE2 A;  1SMY C;  4P2C B;  4ZQ3 A;  4LF6 Q;  1XJV A;  4B3S L;  1SE3 A;  1NSN S;  4QIW B;  1I50 B;  3L9A X;  3T56 B;  2R61 A;  2YTY A;  2JA7 G;  4G57 A;  3T53 B;  1E2W A;  2EYJ A;  3VR4 A;  2N49 A;  5GRO A;  2PZU A;  1H95 A;  3HOX G;  3I90 A;  2WKD A;  1W6K A;  4OON A;  3S1N H;  1WTP A;  4JI1 L;  1UEA B;  2XRS D;  5CYU A;  1YHB A;  3T4A C;  1RD9 D;  2NYZ D;  3CPF A;  1Z6H A;  2MJ8 A;  4AYB B;  5JVH 3;  4R4O A;  1DYQ A;  3T51 B;  3U9O A;  2NVX B;  2E2J B;  5D14 A;  4RFB A;  2XGT A;  1HNZ Q;  3S15 B;  1PFB A;  2F0T A;  1EEF D;  2B63 G;  1MD2 D;  1SNQ A;  2QDL A;  4G4K A;  4DXG A;  5GAD C;  2F0P A;  2B2V A;  5C0X H;  3VR2 A;  4R1J A;  1CI3 M;  2O4X A;  3OSO A;  5COY A;  1X54 A;  1EYD A;  4WJW A;  1BDO A;  4KHP L;  4ALP A;  1JE5 A;  4OEL B;  3MFG A;  3HP3 A;  1V9P A;  1NBW A;  2B2U A;  5IYB H;  1LM0 A;  1GOZ A;  1SFO B;  3QR8 A;  4JI5 L;  3OMG A;  5FLM G;  2Z1C A;  3MFY A;  3HOV H;  3SK4 A;  4DV5 Q;  1JOO A;  1UAP A;  4CDD C;  4K2K A;  4BY7 B;  2K5W A;  1EY9 A;  1NTG A;  3RLO A;  3G7L A;  3G71 A;  2F0Q A;  1XNQ L;  3Q0A A;  2D0P A;  2F0H A;  2VL6 A;  3DHQ A;  2B8G A;  4EVO A;  3I4N G;  2Q2H A;  4KHZ A;  4A76 A;  3M4P A;  3T1H Q;  1EEI D;  2Z9H A;  1EY0 A;  1TS2 A;  3UDF A;  2EE1 A;  5I9P A;  5D3I B;  5E3F A;  1JB7 A;  2RDG A;  3TRE A;  2K5Q A;  3K5L A;  1TWH B;  2NVQ H;  3I73 A;  1L2F A;  3NQI A;  4DR2 Q;  1G8Z D;  1W2B A;  4DR3 L;  4K5X A;  1AN8 A;  4RGM A;  3MEF A;  4G7H C;  1XMO Q;  2PQA A;  3CC4 A;  1PV4 A;  1NJI C;  3NP8 A;  4K2L A;  5I2X A;  2PO4 A;  1GUW A;  4GKK L;  1FJG L;  4ZAI A;  4OXP A;  2UUA Q;  2MP1 A;  4X62 L;  3T13 A;  2NVT H;  1E1O A;  1I4X A;  2F4I A;  5C5L A;  4CJ0 B;  1NAP A;  2EZV A;  4B3M Q;  1RF2 D;  2IPK D;  2DY7 A;  2ZTC A;  4A3E B;  2NVY H;  2WP8 J;  3VR6 A;  2SOB A;  2RDF A;  5M5W H;  3I4L A;  3A0J A;  4RA8 A;  4B3R Q;  5M3F G;  1MKH A;  1KD1 C;  2XNA C;  1PH4 A;  3BDO A;  1XWE A;  3GTG B;  3HOZ H;  3HG9 A;  5EPJ A;  1JJG A;  1V1P A;  2KED A;  2QF7 A;  4WJ3 M;  3HOU B;  1EIH A;  4EGV A;  3CME A;  3V05 A;  4CKE A;  4DV3 L;  4DUY Q;  2JA5 H;  3BYY B;  1NE3 A;  5ELD A;  1SNC A;  1IKL A;  3BG3 A;  1B9N A;  3FMC A;  4A93 G;  1R9T B;  3TDQ A;  4FF4 A;  3PO3 H;  4A3B H;  4HCS A;  3KF6 B;  4LNQ A;  4IPC A;  1Q8I A;  1EIG A;  2SNS A;  3QB3 A;  5BR8 L;  2BA0 A;  2A68 C;  4GNX A;  1YHQ A;  4R8N A;  1ZKO A;  4O2D A;  5I2Y A;  5IP9 H;  2E2H H;  2HIV A;  3PO2 B;  4BA2 I;  3RMH A;  3U4Z A;  4IFD I;  2M9V A;  1TS3 A;  1VS0 A;  3TN2 A;  1GUS A;  2F0V A;  2HDM A;  4HJ9 A;  1DZ1 A;  1SJE D;  1OXS C;  1YHA A;  2NUC A;  2NN6 G;  1SNM A;  2PMZ B;  5IOD A;  4DR5 Q;  2JYO A;  1H9R A;  2RA4 A;  2B2V C;  3HOY B;  5KRU A;  3CHB D;  4XXE A;  4NXN Q;  4OO1 G;  1Y1V H;  1Q86 C;  3HS0 C;  4LF9 Q;  2V1C C;  4P75 A;  3LX0 A;  4B3T L;  1JWU D;  4QJF A;  2A5H A;  4WOR A;  1OTC A;  4MZ9 A;  2Y0S G;  4EQ5 A;  3RZO H;  4LF6 L;  2JE6 I;  3ULL A;  4JI3 Q;  4IJL A;  1WTV A;  2KEE A;  1I4P A;  1VQ4 A;  2B2U C;  1CKN A;  3S9W A;  4DV2 Q;  4BA1 I;  3I4M H;  4QCL A;  1MI2 A;  5AJ3 Q;  1VQN A;  1X6O A;  1JC7 A;  2MO1 A;  1O80 A;  2OT2 A;  1CHP D;  2JN4 A;  4JG2 A;  1CFM A;  2K32 A;  1LTI D;  1GHK A;  1SMX A;  1VQ6 A;  1XNR Q;  2FXQ A;  5IYD H;  3OIP A;  5J1Z A;  4BBR G;  4KI0 A;  3QIA A;  3S17 H;  1EZ8 A;  4A3J H;  1Q82 C;  2RSN A;  5ELO A;  2PPB C;  3C46 A;  2LMC B;  1DXM A;  3NSW A;  3ND9 A;  4IPG A;  4LF7 L;  1S5D D;  5IY0 A;  4IPH A;  4F8M A;  2NZ1 D;  1VQL A;  4KD3 A;  1Y69 U;  1G2S A;  2ZJQ A;  1UEB A;  1TR5 A;  3OTO Q;  1GM5 A;  3NQT A;  4MTN A;  1CA6 A;  4A3M H;  4HED A;  3M3Y B;  4JI2 Q;  4ZK9 B;  1K8G A;  1F9S A;  1BF4 A;  4DA2 A;  1PH2 A;  1VMC A;  1KXL A;  1VDZ A;  4JV5 L;  3LWE A;  4K14 A;  1RTO A;  4HN7 A;  1SJH D;  3MTS A;  4KKU A;  4YCV A;  1WFQ A;  2BH2 A;  4PQX A;  3ND8 A;  1BBX C;  1CKO A;  4RHR A;  2EQS A;  1MIU A;  2Z6B A;  2ID0 A;  2GN5 A;  1WCM B;  2CWP A;  2R93 G;  3OWF A;  2JA7 H;  4DV5 L;  3J7A 5;  4DK6 C;  1D1K A;  4LUZ A;  1A0I A;  1KQS A;  4L5Q A;  1WTW A;  4Q5V A;  3HOX H;  1PDQ A;  1K8O A;  3DXJ C;  3D4D A;  1JOQ A;  2F0M A;  3TME A;  2CW0 C;  3CCV A;  1Q12 A;  4JI0 L;  1NNX A;  4K8I A;  1E2Z A;  4GNX C;  3ZYY X;  1RKN A;  3T1H L;  4H0L C;  3W5O A;  2VQF Q;  4RGT A;  2BOS A;  3JAM E;  3SVM A;  3F2C A;  3RD4 A;  1OO9 B;  4DR2 L;  1XTC D;  2F3V A;  1X9N A;  2VB2 X;  4XQQ A;  2OXP A;  4JW0 A;  2B63 H;  4IN3 A;  3CU7 A;  4APV A;  5C0X I;  1C7Y A;  2ZXO A;  3KBG A;  1QE6 A;  1BKB A;  2A6E C;  5BN4 A;  5E7N A;  1PRT C;  3H94 A;  5K36 H;  1YNJ C;  1I4Q A;  1PTO C;  3CD6 A;  5M3M B;  1Z47 A;  1XPU A;  1Q46 A;  2Q8R E;  3M9B A;  4KHV A;  4J8Q A;  1GHJ A;  2PNR C;  4UDU C;  1QIL A;  1PTO H;  2JP1 A;  1K0R A;  3G48 A;  3M4Q A;  5C44 G;  4KY7 A;  1B9M A;  2QDB A;  1CUK A;  3C3L A;  4Y7N H;  4TQU S;  4KY5 A;  1STB A;  4QUC A;  2ICI A;  4L5R C;  4O1N A;  4JBJ A;  5C3X A;  5FO9 B;  2C9O A;  2K52 A;  1YIT A;  2JEA I;  5C3E B;  3I4N H;  1TWF H;  4A3F G;  2MHV A;  4PZ7 A;  1IBL Q;  4QGU A;  3I3C A;  3GTM H;  4LFB Q;  5FKA C;  4C3J G;  2KCC A;  2YU9 B;  3C1E A;  1Z7T A;  2E74 C;  4NDX A;  4A3C G;  1VQJ A;  1EQR A;  3HFZ B;  5JJK A;  1K83 B;  3I55 A;  1HNW L;  1PHJ A;  1CKM A;  3PUY A;  4LF9 L;  1Q90 A;  3HKZ G;  3PF4 A;  1MBY A;  5FO8 B;  3EA6 A;  3M4O B;  3A8I E;  4L6T B;  3GTK B;  1HTP A;  4R9W A;  1G91 A;  4YWL A;  5T1I A;  1M1K C;  3RUZ A;  4DV2 L;  4HMI A;  1SYB A;  5M3F H;  2KCN A;  1BUV T;  1N32 Q;  1TKW B;  4BY1 B;  1BCP C;  2CH4 W;  2EYP A;  4IJH A;  3AQQ A;  3S2D B;  3J7Y W;  3OW7 A;  3J80 i;  1KTK A;  1KLU D;  4X3T A;  1CT1 D;  1XNR L;  1HQM C;  5CV5 A;  1CQF A;  3GTL B;  3IRB A;  3A5U A;  1BBU A;  1H9K A;  4YHH Q;  2ZXR A;  1LUZ A;  4YWM A;  1MSG A;  1B7Y B;  4A93 H;  3D8G A;  4IAL A;  2SEB D;  4OEM B;  3D31 A;  5I6W A;  3S1Q H;  5ELN A;  3J81 E;  1F9Q A;  4C1N K;  4KTA A;  3VYR A;  2VNU D;  1QJO A;  3OW2 A;  2A1A A;  4FDB A;  1RDP D;  4KN4 C;  3WWV A;  3PGZ A;  1WTX A;  1Q7Y C;  3FKI H;  1N36 Q;  1WTH A;  1X32 A;  3JAM c;  1E24 A;  2DNE A;  3RN2 A;  4LFA L;  4XIG S;  4CHT B;  2NN6 H;  4ZUI A;  3OIQ A;  4GOP A;  4JI2 L;  3HOW G;  1SND A;  1Q8K A;  2AQ2 B;  4KKT A;  4C3I G;  4BBS G;  2UXD Q;  2BE5 D;  1TWG H;  3OYY A;  1DON A;  4RKL A;  4JYA L;  2PCF B;  1NY4 A;  3W3A A;  4HSP A;  4CKB A;  1TWC H;  1STE A;  4J6H A;  2HHH Q;  2Q2U A;  5LMN Q;  1E3P A;  2NZH A;  1R4P B;  1B8A A;  3K7A B;  4XQJ A;  1TWA H;  2FMM A;  3ER0 A;  3A7A B;  2OTL A;  1PYB A;  2EDG A;  1VQO A;  2IL8 A;  1YI2 A;  3GDE A;  3VR3 A;  1Y1W B;  1EY6 A;  5C4J H;  5ELE A;  4X3S A;  3GV3 A;  3KYH C;  1GUN A;  4Y52 H;  1PXU A;  5H1S E;  2WIN B;  2AQ3 B;  4NXM Q;  1L0Y B;  4LF5 L;  3TRZ A;  3J81 j;  3FDT A;  2E2I H;  3PIP 3;  4BBR H;  3BVZ A;  4IUT A;  3E9I A;  5ELC A;  2JSO A;  4AYB G;  3SR1 A;  2FFK B;  2VQF L;  3BZD B;  5CC4 A;  1S3O A;  4IUN A;  4A3L H;  4N8F A;  5IGF A;  2M2L A;  1K8A C;  1QVF A;  3STB C;  2D62 A;  3NPP A;  4HIO A;  3G6J B;  1B50 A;  3OMC A;  1C0A A;  4FXG C;  2HCI A;  5L37 A;  1XTD A;  1LT4 D;  1SYD A;  3PQI A;  2XWB B;  1FNW A;  3K6O A;  2R6G A;  4FF3 A;  2R92 H;  2WB1 G;  5HY6 A;  1X55 A;  1W6J A;  2F1M A;  1VF5 C;  2NVY B;  3S1R H;  4ODG A;  2BH8 A;  5F2D A;  5JOB A;  2VZA A;  4A3I B;  1X3G A;  3CRK C;  5M5W B;  1M4V A;  5JJZ A;  1MSH A;  2SDF A;  4MN3 A;  1ENC A;  5LMN W;  1MHW C;  3KBX A;  1F9P A;  4R4C A;  3BU2 A;  2AMC B;  3SEB A;  3KDF B;  1U5K A;  5IIF A;  3MWY W;  4TSS A;  3U58 A;  3L2P A;  5IGD A;  2TSS A;  2R93 H;  1KDA A;  1IBM L;  4BY7 G;  1VQA A;  4GLV B;  3T16 A;  1G2T A;  4JOI A;  3RR5 A;  4GS3 A;  2ZTD A;  4A3B B;  1VQE A;  3MXP A;  4HJA A;  2MGS A;  4KY6 A;  4IQZ A;  2F0E A;  2F0S A;  4CJ2 C;  3U4V A;  1EQQ A;  2K1B A;  2IWH A;  2IHF A;  2R7Z H;  3X3M A;  3JC6 6;  3KF8 B;  5IGE A;  1IBL L;  1LTL A;  4X65 L;  2JA8 B;  4DU9 A;  3DWQ A;  3HGB A;  4E6I A;  3UDG A;  4LFB L;  2IX3 A;  1QNK A;  4EQN A;  1QNU A;  4LF4 Q;  2X69 A;  5EKL A;  1XMQ Q;  1Y8O B;  2DJG C;  3NBI A;  1S40 A;  5C4X G;  2BDO A;  3J81 c;  3KOJ A;  1GUO A;  4ZKB B;  5DAU A;  3EBE A;  4GOP C;  1L1O A;  1J5E Q;  2KCM A;  4FXD A;  2JA6 G;  5IYC H;  3IKJ A;  1YJ9 A;  4ZUJ A;  4DV6 Q;  1JJC B;  1L0X B;  4R4T A;  1EUJ A;  1B70 B;  3ONA B;  1ICF B;  1SE8 A;  1SDF A;  4DV1 L;  1JMC A;  4TRD A;  2I46 A;  2DGY A;  4FP5 D;  4A3E G;  4GLA C;  5C3W A;  3A55 A;  4PMW A;  3JAM L;  2C35 B;  3H6M A;  1PZI D;  1GUT A;  1VQI A;  2YV5 A;  1N32 L;  3D6W A;  2OTJ A;  1LTR D;  1V1O A;  4NPS A;  2WB1 B;  1S5C D;  4XYQ A;  3A7L A;  3HOU G;  4A3K B;  5KNB A;  4JI6 Q;  5LMU Q;  1WTO A;  3PCO B;  4B08 A;  4R4Q A;  3CQZ H;  3HZX A;  4YHH L;  4ZKC B;  1BQQ T;  2IT1 A;  2KEC A;  4FF1 A;  3K0X A;  1O78 A;  2RDH A;  1F2M A;  4A3G G;  4K8J A;  1U0L A;  4NP5 A;  4JK1 C;  2Z0S A;  4AQY Q;  2QW7 A;  4HIM A;  1Q1E A;  4A3F H;  3PO2 G;  1K0S A;  2F0O A;  4N8X 1;  5G3L D;  4C3J H;  5K5P A;  2GVB A;  1T9H A;  3SK5 A;  2F0U A;  1N36 L;  1X3F A;  4A3C H;  5JAV A;  3ZJY C;  2EJF C;  4L5S A;  4HAE A;  1TY0 A;  2I5M X;  2N8N A;  4DR6 L;  5EPL A;  3TBI B;  5I4D A;  1CSQ A;  3HOY G;  1I6H H;  1EWI A;  2PQA B;  2UXD L;  2O5J C;  4LFC Q;  4HTH A;  5ELF A;  3S2H H;  3MA2 B;  4LF8 L;  3RN5 A;  1PH3 A;  5LMN L;  5C4X B;  5DLQ E;  3D0F A;  2DY8 A;  2VXW A;  4X3U A;  1I5F A;  2F03 A;  2KQ3 A;  3W1G A;  4EQO A;  1K3B C;  4C56 C;  1YEZ A;  1SE2 A;  4LJZ C;  2JA6 B;  2A6H D;  5GAE C;  4Q0F A;  5DM6 3;  4JOI C;  1HFG A;  2RQX A;  3S14 H;  1GUG A;  4MNO A;  3M7G A;  2I5H A;  1YNJ D;  4XDX A;  4DR4 L;  1I3Q B;  1DJR D;  1GD7 A;  2WFW A;  4CKC A;  2VUM G;  1I94 L;  4H13 C;  3RNU A;  2F3I A;  1CK1 A;  1Z9F A;  4HID A;  1Y8P B;  1HR0 Q;  1A15 A;  1ZYR D;  4CDE C;  1UWV A;  3GTJ B;  1M90 C;  4QQB X;  3N52 A;  1S4Z A;  1XX8 A;  3QWN A;  4J1M A;  5D65 A;  3TEH B;  3RLN A;  3L0O A;  3VA5 A;  1STN A;  4DAM A;  5E4W C;  3AEV A;  1SRO A;  2SNM A;  3KFU A;  1L1O C;  2O5I C;  4DN4 M;  1KDB A;  1WVL A;  1VMP A;  2H1E A;  2A8V A;  4A3G B;  3HOW H;  2NBF A;  3C1F A;  1ASY A;  4C3I H;  2UXB Q;  4DR1 L;  4JI7 Q;  2JJQ A;  1PZJ D;  2I0Q A;  3J81 L;  1Y14 B;  3NEM A;  3A74 A;  1A8V A;  2A69 D;  4HCE A;  3Q8D A;  3GTP B;  1I50 H;  1S5F D;  1WCM G;  4DV7 Q;  2UU9 Q;  4JI4 Q;  5BN5 A;  3VA7 A;  2AWN A;  2PYK A;  4JI8 Q;  5GQO A;  5IOC A;  3MXG A;  5LL6 X;  1SNP A;  3I91 A;  2J0T D;  5KEE A;  3QOL A;  3MXN B;  5LL6 S;  4MHE A;  3CCQ A;  4RHS A;  5M5Y B;  1E22 A;  3KF6 A;  1LTG D;  3NBH A;  2EYH A;  4WFN 3;  1OXV A;  4L5T A;  3D3R A;  2O2L D;  1TII D;  1EY5 A;  1VQH A;  2F0I A;  5LHY 1;  2EVB A;  1A63 A;  3S16 B;  3OWE B;  2QCP X;  2KJX A;  2VB3 X;  4R4I A;  2NVX H;  2AWO A;  2E2J H;  4LF4 L;  4RMF A;  3DMU A;  3X3N A;  1HR0 W;  4JBM A;  3S1M B;  5G3L F;  1LYL A;  4C3H B;  5EQ0 A;  3M85 A;  3S15 H;  1WD1 A;  2QA4 A;  1X3Q A;  2F52 A;  4IOC A;  4GN3 B;  4JCV E;  1IBK Q;  4CDC C;  1K28 A;  2GA4 B;  2VUM B;  3PMF A;  1VQM A;  2KA7 A;  5HGQ A;  1BR9 A;  4GKJ Q;  3ERS X;  1XXG A;  4Z9C B;  5KIX A;  4UAI A;  1VQF A;  3WDN A;  3ICE A;  3I2Z A;  2PNH A;  4OX9 Q;  3M4Y A;  1HNZ L;  2MUY A;  2YTV A;  1YNX A;  2B29 A;  1EFW A;  4FO2 A;  4RCO A;  3H0G B;  1JJ2 A;  5M3M G;  4FYD A;  4IUQ A;  2F0K A;  1EL0 A;  1EOT A;  3L3O C;  2ZJP A;  1PA6 A;  2VY3 A;  5ISR A;  3G4S A;  4U68 A;  3ULP A;  2L1B A;  3PV0 A;  3CF5 A;  4A3D B;  3GP7 A;  3K5M A;  1SFO H;  4B9W A;  5FK9 C;  2GVA A;  3AFP A;  4JI6 L;  2AHO B;  3PUZ A;  2E2D C;  2CFM A;  5EKK A;  4BY7 H;  1B53 A;  2E5L Q;  2R7D A;  1S5E D;  2FHT A;  2UUC Q;  3IAY A;  1PH8 A;  2EOT A;  5C5M A;  2G5D A;  4LUO A;  3WOF A;  3TZU A;  5JEA J;  1O7Z A;  4YCW A;  3K0Y A;  4LW1 A;  2UXC Q;  5C3E G;  1TS5 A;  4RG1 A;  4X6A H;  1RIP A;  4AQY L;  1UE1 A;  2RSO A;  1LTS D;  3VDY A;  4K5V A;  4V19 0;  1YNN D;  1TWH H;  3KLR A;  1SSO A;  3FKI B;  2Q8T A;  3MC0 B;  3ITP A;  3CP0 A;  2F0G A;  1ZXT A;  1QUQ B;  4DK0 A;  1LTA D;  4IOA A;  3MVV A;  2HT1 A;  3GTO B;  1H9S B;  2N88 A;  4LFC L;  1ICW A;  4KJN A;  2NTT A;  1V8Q A;  1VQD A;  4UP8 A;  1TWC B;  1SBB B;  4YWK A;  4YIJ A;  4CJ1 B;  3J7A V;  1HA5 A;  3DEP A;  1ILP A;  1LLR D;  3Q6S A;  4A3E H;  1N33 Q;  1C8C A;  1XMO L;  2K6A A;  3P20 A;  1FGB D;  3ULJ A;  1B2T A;  2B2T A;  3SDZ A;  2ZM6 Q;  1PFM A;  4K6D A;  5EJW A;  4BY1 G;  1LV9 A;  2UUA L;  3EFX D;  3GTG H;  4B3M L;  4F88 A;  3HOU H;  2WAQ E;  1VQC A;  2E2I B;  4RH6 A;  2K5N A;  4C2M B;  4OWT B;  1U9R A;  4B3R L;  3FHW A;  1R9T H;  1RJT A;  1NR4 A;  4BS9 A;  2EXZ A;  1VQ5 A;  3K7U C;  5KND A;  4X66 Q;  3TP5 A;  1HR0 L;  1LT3 D;  5FLM H;  3CCJ A;  2DN8 A;  4DK1 A;  1EU4 A;  1QCB D;  3PO2 H;  3N6R A;  1HUM A;  3E0E A;  3CPW A;  4DUY L;  4A4I A;  4PG3 A;  4FNF A;  1SMY D;  2RVL A;  4K0K Q;  1SYE A;  4DV4 Q;  2LXJ A;  3I56 A;  1D1I A;  2JEB I;  2DUD A;  1HH2 P;  3HOY H;  3A8J E;  2UXB L;  2EY2 A;  4FF2 A;  2A19 A;  3T1Y Q;  3VYT A;  4JI7 L;  4YY3 Q;  3SHL A;  3TP7 A;  3MHB A;  1P16 A;  3FEW X;  5I6Y A;  4POG A;  4DR7 Q;  2AKW B;  4DV0 Q;  1JWM D;  3DWP A;  1LT5 D;  3NHH A;  1SAP A;  3GTQ B;  4DR5 L;  1AH9 A;  5IYB G;  2HIX A;  4MTK A;  2FIN B;  2RCN A;  4IFD J;  5KNC A;  2RKS A;  1EOV A;  1X3P A;  4NXN L;  4JI4 L;  1JB3 A;  4JBW A;  1Y1W G;  1P8L A;  3EIV A;  1QB5 D;  1K8M A;  3LWU A;  2K5H A;  1PFS A;  2OCE A;  4QIW E;  4WRD A;  5EAY A;  1AFP A;  2I5L X;  2I07 B;  1MJC A;  4JI3 L;  4JI1 Q;  2MNA A;  2F0F A;  1HJP A;  1STY A;  2R7Z B;  2JA9 A;  5AJ3 L;  1HRJ A;  1KAW A;  1EZ6 A;  1E0B A;  3EVQ A;  1R4Q B;  2QGQ A;  3H15 A;  3E3X A;  2B3G A;  3R8B A;  3S1N B;  2F3W A;  4BXX G;  1VQB A;  3BYT B;  4BWG B;  3OPO A;  3G6E A;  1DOL A;  3K81 C;  1EIY B;  1CHQ D;  2K75 A;  4QMG A;  1XPR A;  2J4X A;  1IBK L;  3MXU A;  4QL5 A;  3BDC A;  4OIJ A;  4TVA B;  3QOJ A;  2B8F A;  2LKV A;  3RZD H;  3M3Y H;  1F9R A;  4OL7 A;  3E9H A;  4O42 A;  3UDX A;  1HUN A;  1OXX K;  2B39 A;  4OX9 L;  1B1Z A;  5FJ8 G;  2NB0 A;  2IX1 A;  2D0O A;  4A3I G;  1GJX A;  3BVG A;  3OTO L;  1YJN A;  2B2T C;  2AUK A;  5BN3 A;  1D5X C;  1IYJ B;  3FVQ A;  5CMD A;  1PH9 A;  2K03 A;  4IPD A;  1N8R C;  1KIX A;  1UE5 A;  1WCM H;  2XN9 C;  1J6Q A;  4UPA A;  4OO1 H;  5FLX E;  3NTK A;  4PZ6 A;  1QOH A;  4QY7 A;  2E5L L;  1NMG A;  2UUC L;  2IY5 B;  1BO0 A;  1STA A;  1AP0 A;  4A3B G;  4DFA A;  4EQP A;  2CHB D;  3F8T A;  1BXT A;  2JXM B;  2EY1 A;  1B3Q A;  3HOV B;  2Z4I A;  4FVM A;  4DPG A;  4GZY C;  3R3O A;  1BOS A;  2JA8 G;  2K7V A;  3IL8 A;  3K59 A;  3F2B A;  3QJY A;  4UY8 C;  1U4L A;  3M7N A;  4TKO B;  3QG1 A;  1IW7 C;  5KYI A;  1DGS A;  1ET6 A;  2G9H D;  4ZRZ A;  1Y8N B;  2NWG A;  4DAY A;  1F2L A;  1E7Z A;  4GKK Q;  5DNF A;  1F2Y A;  4HMJ A;  1RL2 A;  2NVQ B;  1SYG A;  1GVP A;  1EFI D;  2RF4 A;  3HRZ C;  5KGU A;  3CCE A;  4DNR B;  3K5N A;  2WII B;  3KUP A;  1HZB A;  1B3A A;  2ZTE A;  3CC7 A;  1FL0 A;  2ENB A;  1PLF A;  5JVG 3;  3CKI B;  5M3M H;  2WAQ B;  2K5V A;  1TT2 A;  4IZ8 A;  2Q8I B;  3FP9 A;  3DM3 A;  4GLX A;  4XT3 B;  2HQE A;  2NVT B;  1EQT A;  2A68 D;  1B44 D;  1GXD C;  5IT9 E;  3V96 A;  4A3K G;  1S72 A;  5C4Z A;  4DV3 Q;  1EY7 A;  2XTI A;  5C0X J;  4N9T A;  2XVS A;  4F7X A;  1ILQ A;  2PW7 A;  1DOK A;  3PUW A;  3HOZ B;  1KNE A;  1HCZ A;  2DNC A;  2EYO A;  4XQN A;  5C3E H;  2A74 C;  2JA5 B;  3TQY A;  3BVM A;  5CV4 A;  4RWS C;  4IUU A;  2YU9 H;  1A2U A;  2D5D A;  4KMU C;  4K0K L;  3AYH B;  4DV4 L;  3PO3 B;  2A73 B;  4A3M G;  2L11 A;  5DEH A;  3P1H A;  1I4H A;  3D4W A;  5J39 A;  2FJ2 A;  2E2H B;  3VYS A;  3NEN A;  3T1Y L;  4LWC A;  2JQO A;  1WI5 A;  4YY3 L;  1NMF A;  5CV9 A;  1PVO A;  5AFW A;  2NTS A;  2Q2I A;  5M5X H;  4DR7 L;  4DV0 L;  3M4O H;  1LO5 D;  2H5X A;  4LUV A;  3E6Z X;  2Q2T A;  3GTK H;  3KDF A;  1YBY A;  1KAB A;  1Y1V B;  3I7F A;  2KVM A;  2WV6 D;  1TVX A;  5KYL A;  5CV8 A;  1JIC A;  3KLS A;  4NW2 A;  3R2I A;  4HIK A;  1FYC A;  2XIW A;  1PH7 A;  4BY1 H;  1VF7 A;  4JVZ A;  1JE4 A;  2BA1 A;  2XWJ B;  3S2D H;  3RZO B;  3D4R A;  3CCM A;  2HCC A;  1T5X D;  3A54 A;  1J8I A;  3NE5 B;  1N34 Q;  5FLX c;  2PI2 A;  1VQ7 A;  3W1B A;  3GTL H;  4LAA A;  3I4M B;  3KF8 A;  3K5O A;  4S3S A;  3EN2 A;  2PZW A;  3IFD A;  3TS2 A;  1ENA A;  1HZA A;  2B2W A;  1G51 A;  3CMA A;  4LF7 Q;  1KNA A;  1EYG A;  1TY2 A;  5E1F A;  3K80 C;  1LAC A;  5C44 H;  1IL2 A;  2K4K A;  3S17 B;  2CWA A;  3QO2 A;  5IGB A;  1A3U A;  1GKH A;  2F0N A;  2OQK A;  4ILW A;  4YCU A;  3J80 E;  4A3J B;  1JWS D;  2X6G A;  4ZCK A;  1FNV A;  4PMB A;  4OIK A;  3NWT A;  3D6C A;  1CZG A;  2EY5 A;  1JQY D;  3URY A;  4JV5 Q;  1CTM A;  5K36 G;  3E0J A;  2EYM A;  4HR7 B;  1CA5 A;  5IE8 A;  3HKS A;  5IGC A;  1ESR A;  1SEB D;  5ELB A;  3PIP A;  2D9U A;  1AEX A;  4R8I A;  1JOR A;  2LS0 1;  4A3M B;  2KUM A;  4XYO A;  3Q22 A;  2CW0 D;  2MO0 A;  3K7A H;  1BBW A;  1H9M A;  1G29 1;  1ASZ A;  3KJP A;  1LTT D;  1U4P A;  5JEA G;  4L8J A;  1Y1W H;  5TSS A;  3I4O A;  4CGY B;  3UE0 A;  2N3S A;  2L15 A;  2Z8L A;  3SE0 A;  3PIO A;  4H02 A;  2VQE Q;  1EU3 A;  4GN5 A;  3BDL A;  2HHH L;  5IT9 c;  4U67 3;  3V2T A;  5CV7 A;  1WD0 A;  3F2U A;  1D6E C;  1RCV D;  4JI0 Q;  5EKI A;  3JAM i;  1HFN A;  1C48 A;  4IUV A;  2JA7 B;  2BE5 C;  2Y0S E;  2QKI C;  1AZP A;  4ABN A;  5J22 A;  1SNO A;  2A6E D;  2FMC A;  2L55 A;  1PRT D;  4PV1 C;  1K3R A;  4NXM L;  3HOX B;  1V1P B;  2KHS A;  1VQ9 A;  2E76 C;  3I8Z A;  4C3H G;  2DJF C;  4BXX H;  1PTO D;  2F0L A;  4DF7 A;  4P71 A;  5A2Q E;  2EJM A;  4XTC S;  3KJO A;  3FPP A;  2N55 A;  4NB3 A;  3DEO A;  2Z6K A;  3K58 A;  4ME5 A;  4GNX B;  2VS1 A;  2ZT9 C;  2HQL A;  4LMQ D;  2WAC A;  4I65 A;  1WTQ A;  2K50 A;  5NUC A;  2XSC A;  5FJ8 H;  5D3D A;  2B63 B;  3H0G G;  4A3I H;  5I9O A;  3CCU A;  2KBN A;  3DLL A;  2CVR A;  1DOM A;  2NN6 I;  5JJL A;  1G6P A;  3MAQ A;  1VQ8 A;  1T5E A;  3Q24 A;  2IJ0 A;  3GQB A;  2ES2 A;  4A3D G;  4OO1 I;  5C4H A;  1Q81 C;  2KOL A;  1Q3L A;  4BBS H;  2F0D A;  2QEX A;  4PMC A;  1HQR D;  1TS4 A;  4P72 A;  1ONL A;  3J7Z C;  1PRT B;  1LAB A;  3H09 A;  4FXK C;  4QB4 A;  1UUP A;  3PUX A;  1MJE A;  1ZEQ X;  4HJ7 A;  1LTB D;  2L9H A;  2B2W C;  3NBH B;  1PTO B;  1CKN B;  2C5C A;  1I4G A;  4NMZ A;  3E5S A;  3TP6 A;  1QZG A;  4AH6 A;  2JA8 H;  4Y7N B;  1PYS B;  3TS0 A;  1HPC A;  3FKI G;  5FLX L;  1HHV A;  3MEH A;  2HD3 A;  4KKS A;  1TWF B;  3I4N B;  2PQE A;  5M9O A;  4C1N I;  1UE7 A;  1HNW Q;  1KHI A;  3J80 c;  2OF1 A;  1QVC A;  3OHX C;  1HNX Q;  3GTM B;  2ICE C;  4HSV A;  1X65 A;  1SN8 A;  3BZC A;  1BCP D;  4IFD G;  2YTX A;  3F2D A;  1CQV A;  1BVS A;  1C9O A;  1WTR A;  3NEL A;  4JC0 A;  1XMQ L;  1ENF A;  5HUR A;  1U4R A;  4H7B A;  2EYF A;  5JJI A;  1U4M A;  2K28 A;  3CC2 A;  1I4R A;  3PF5 A;  4KK7 A;  2BCO A;  3GV6 A;  4K5W A;  5IP7 G;  1J5E L;  2K14 A;  1II3 A;  2EY6 A;  2IX0 A;  4DNT B;  4DV6 L;  3MXN A;  4HJ5 A;  2R7F A;  3BZK A;  3CRL C;  4POF A;  3B6Y A;  3CCR A;  1RTN A;  1AE3 A;  2N78 A;  3MZ5 A;  4A3K H;  1Q1B A;  1EYC A;  1N34 L;  1K73 C;  1SYC A;  1V43 A;  1S5B D;  2M00 A;  1YJW A;  1QWY A;  3J81 i;  4M1U B;  5M3F B;  3I72 A;  4WJ4 A;  1A3T A;  1D5Z C;  2OWO A;  2CQO A;  1C4Q A;  3FRP B;  4A3L G; 
#chains in the Genus database with same CATH homology
 1DM0 B;  2HUG A;  3H91 A;  3DUZ A;  1M8A A;  4KD4 A;  3U9S A;  1NUC A;  1BCP B;  1A3V A;  1PRT F;  5IT9 L;  4IUP A;  1CM9 A;  1AW7 A;  4QUF A;  4M8A A;  4A93 B;  1SE4 A;  3LNN A;  3RZD B;  3NTI A;  3PUV A;  1PTO F;  4X3K A;  3S1Q B;  1HA6 A;  1HXY D;  2X6L A;  4XT1 B;  1B4O A;  4ID6 A;  1VCI A;  4ZLT F;  2L0C A;  2AQ1 B;  4RGO S;  1IL8 A;  3H3V C;  1ROD A;  1H9J A;  5EPK A;  1IW7 D;  5CBE E;  4RKB A;  5CGK A;  1DD2 A;  1EWH A;  1TWG B;  3J7A F;  1JOK A;  2Z4H A;  1PFN A;  3DWA A;  5COR A;  1EY4 A;  2Y0S B;  3ERQ A;  1TWA B;  5FOB B;  1I6V C;  5C4J B;  1FNU A;  4OGQ C;  2CQA A;  1SXT A;  4DXF A;  4RGN A;  3EQL C;  1UNS A;  3SK6 A;  1NCV A;  3O13 A;  5IGG A;  4BBR B;  4DGZ A;  2L12 A;  1RHP A;  3NWS A;  2D2C C;  3VYU A;  5T1G A;  1H9S A;  1PMR A;  4KN7 C;  2L4N A;  1ESF A;  2A6H C;  2EPB A;  5CR3 A;  2LY7 A;  4KJO A;  4DAP A;  1FD7 D;  4QF4 A;  1PZK D;  1BCP F;  3SXH A;  2RBM A;  2BDN A;  2G9D A;  5C6A A;  2B2Y A;  3KLS X;  4ULL A;  5CBA E;  5C0X G;  1AZQ A;  2R92 B;  2K05 A;  3J80 L;  4PNY A;  4OHJ A;  1EWC A;  1ZYR C;  2XRQ D;  3S1R B;  5JEA H;  3K57 A;  1IKM A;  4L63 B;  4RCN A;  1MGS A;  1KDC A;  5E4X A;  3TZD A;  3OOC A;  1D2B A;  5CV6 A;  5JPN C;  1SYF A;  2R93 B;  2IW3 A;  1KAA A;  3WOE A;  2A69 C;  4B9X A;  1DCZ A;  5EGT A;  3R93 A;  3P7J A;  4V0B A;  3C2P A;  3KK7 A;  2QEJ C;  3GO5 A;  1D5M C;  1O7L A;  3AB9 A;  3AU7 A;  5M5X B;  5FO7 B;  3TSS A;  1QG7 A;  4H44 C;  2OEO A;  1KLG D;  3RLF A;  2K33 A;  2QIL A;  5EBD A;  1ET9 A;  1EYA A;  5A2Q L;  3ERO A;  4IUR A;  4I7Z C;  2PW5 A;  2EYL A;  2E75 C;  2K04 A;  1J9O A;  4KV6 A;  3NK9 A;  3GD7 A;  2R3Z A;  5EBC A;  4ZYS A;  5C44 B;  3CQZ B;  1EY8 A;  1O7Y A;  2ZXP A;  1CZW A;  3IFT A;  5DM7 3;  3NUC A;  5HGT A;  2PZT A;  5JPM C;  4NKL A;  1IYV A;  3R2T A;  1OXT A;  3A56 A;  1LT6 D;  4A3F B;  1F77 A;  4C3J B;  1BNZ A;  4IFD H;  3A8K E;  3L7Z C;  2L5T A;  3HEJ A;  3BS1 A;  2B2Y C;  1G6Z A;  3NTH A;  1I6H B;  4LK1 C;  3AMU A;  3TP8 A;  4K6L A;  3I70 A;  3S2H B;  3HKZ B;  4G7Z C;  2TMP A;  2AUJ D;  1YNN C;  1XYI A;  3SK8 A;  2K01 A;  3UI2 A;  4DAV A;  2H4O A;  1A2T A;  1JCK B;  3W2D A;  1OXU A;  1HTL D;  3S14 B;  1STH A;  2F0J A;  3NXW A;  2HDL A;  2LFN A;  1EQV A;  2K5D A;  1NR2 A;  3PIO 3;  4F87 A;  1IYU A;  3FPU B;  2WKC A;  2EJG C;  1F2Z A;  1TU2 B;  3P75 A;  4RAU C;  3VR5 A;  2MPM A;  4CBV A;  1A6X A;  2F0W A;  1FR3 A;  2J7Z A;  2V4D A;  3DM1 A;  1IHZ A;  1STG A;  1TQO A;  3Q23 A;  2YYZ A;  4MIU A;  4G7O C;  3HOW B;  4C3I B;  1ML0 D;  4BBS B;  3EJI A;  5A35 A;  4N9P A;  1E2V A;  1JR0 D;  1PYW D;  4P2C B;  1SMY C;  4ZQ3 A;  1SE3 A;  1NSN S;  4QIW B;  1I50 B;  3L9A X;  3T56 B;  2R61 A;  4G57 A;  3T53 B;  1E2W A;  2EYJ A;  3VR4 A;  2PZU A;  3I90 A;  2WKD A;  1W6K A;  1WTP A;  1UEA B;  2XRS D;  5CYU A;  3T4A C;  1RD9 D;  4AYB B;  2NYZ D;  1Z6H A;  2MJ8 A;  5JVH 3;  1DYQ A;  3T51 B;  3U9O A;  2NVX B;  2E2J B;  5D14 A;  4RFB A;  3S15 B;  1PFB A;  2F0T A;  1EEF D;  1MD2 D;  1SNQ A;  4G4K A;  4DXG A;  2F0P A;  2B2V A;  5C0X H;  3VR2 A;  1CI3 M;  2O4X A;  3OSO A;  5COY A;  1EYD A;  4WJW A;  1BDO A;  3MFG A;  3HP3 A;  2B2U A;  1GOZ A;  1SFO B;  3OMG A;  2Z1C A;  3MFY A;  3SK4 A;  1JOO A;  1UAP A;  4K2K A;  4BY7 B;  2K5W A;  1EY9 A;  3G7L A;  2F0Q A;  3Q0A A;  2F0H A;  3DHQ A;  2B8G A;  4EVO A;  4KHZ A;  1EEI D;  1EY0 A;  1TS2 A;  2EE1 A;  5I9P A;  5D3I B;  5E3F A;  2RDG A;  2K5Q A;  3K5L A;  1TWH B;  3I73 A;  3NQI A;  1G8Z D;  4K5X A;  1AN8 A;  4RGM A;  4G7H C;  3NP8 A;  4K2L A;  5I2X A;  2PO4 A;  1GUW A;  4ZAI A;  2MP1 A;  3T13 A;  1I4X A;  2F4I A;  5C5L A;  4CJ0 B;  1NAP A;  2EZV A;  1RF2 D;  2IPK D;  2DY7 A;  4A3E B;  2WP8 J;  3VR6 A;  2SOB A;  2RDF A;  3I4L A;  4RA8 A;  2XNA C;  3BDO A;  1XWE A;  3GTG B;  3HG9 A;  5EPJ A;  1V1P A;  2KED A;  2QF7 A;  3HOU B;  1EIH A;  4EGV A;  3V05 A;  4CKE A;  3BYY B;  5ELD A;  1SNC A;  1IKL A;  3BG3 A;  1B9N A;  3FMC A;  1R9T B;  3TDQ A;  4FF4 A;  4HCS A;  1Q8I A;  1EIG A;  2SNS A;  3QB3 A;  2BA0 A;  2A68 C;  4R8N A;  1ZKO A;  5I2Y A;  3PO2 B;  4BA2 I;  3RMH A;  4IFD I;  2M9V A;  1TS3 A;  3TN2 A;  1GUS A;  2F0V A;  2HDM A;  1DZ1 A;  1SJE D;  1OXS C;  2NUC A;  2NN6 G;  1SNM A;  2PMZ B;  5IOD A;  2JYO A;  1H9R A;  2RA4 A;  2B2V C;  3HOY B;  5KRU A;  3CHB D;  4XXE A;  4OO1 G;  3HS0 C;  3LX0 A;  1JWU D;  2A5H A;  4WOR A;  2JE6 I;  1WTV A;  2KEE A;  1I4P A;  2B2U C;  3S9W A;  4BA1 I;  4QCL A;  1MI2 A;  1JC7 A;  1O80 A;  2OT2 A;  1CHP D;  1CFM A;  2K32 A;  1LTI D;  1GHK A;  3OIP A;  5J1Z A;  4KI0 A;  3QIA A;  1EZ8 A;  2RSN A;  2PPB C;  3C46 A;  2LMC B;  1DXM A;  3NSW A;  3ND9 A;  1S5D D;  4F8M A;  2NZ1 D;  4KD3 A;  1Y69 U;  1G2S A;  1TR5 A;  3NQT A;  1CA6 A;  4HED A;  3M3Y B;  4ZK9 B;  1F9S A;  1BF4 A;  4DA2 A;  1VMC A;  1VDZ A;  3LWE A;  4K14 A;  1RTO A;  4HN7 A;  1SJH D;  3MTS A;  4KKU A;  4PQX A;  3ND8 A;  1BBX C;  4RHR A;  2ID0 A;  1WCM B;  3OWF A;  1D1K A;  1WTW A;  4Q5V A;  1PDQ A;  1K8O A;  3DXJ C;  3D4D A;  1JOQ A;  2F0M A;  3TME A;  2CW0 C;  1Q12 A;  4K8I A;  1E2Z A;  3ZYY X;  1RKN A;  4H0L C;  4RGT A;  2BOS A;  3JAM E;  3SVM A;  3RD4 A;  1OO9 B;  1XTC D;  2F3V A;  2VB2 X;  4XQQ A;  2OXP A;  4IN3 A;  3CU7 A;  5C0X I;  2ZXO A;  3KBG A;  1QE6 A;  2A6E C;  5BN4 A;  1PRT C;  3H94 A;  5K36 H;  1YNJ C;  1I4Q A;  1PTO C;  5M3M B;  1Z47 A;  2Q8R E;  4KHV A;  4J8Q A;  1GHJ A;  2PNR C;  4UDU C;  1QIL A;  1PTO H;  2JP1 A;  4KY7 A;  1B9M A;  2QDB A;  3C3L A;  4TQU S;  4KY5 A;  1STB A;  4QUC A;  2ICI A;  4O1N A;  5C3X A;  5FO9 B;  2C9O A;  2JEA I;  5C3E B;  2MHV A;  3I3C A;  5FKA C;  4C3J G;  2KCC A;  2YU9 B;  3C1E A;  1Z7T A;  2E74 C;  4NDX A;  1K83 B;  3PUY A;  1Q90 A;  1MBY A;  5FO8 B;  3EA6 A;  3M4O B;  3A8I E;  4L6T B;  3GTK B;  1HTP A;  4R9W A;  1G91 A;  5T1I A;  3RUZ A;  4HMI A;  1SYB A;  2KCN A;  1BUV T;  1TKW B;  4BY1 B;  1BCP C;  2EYP A;  3S2D B;  3J7Y W;  3OW7 A;  1KTK A;  1KLU D;  4X3T A;  1CT1 D;  1HQM C;  5CV5 A;  1CQF A;  3GTL B;  1H9K A;  2ZXR A;  1MSG A;  3D8G A;  4IAL A;  2SEB D;  3D31 A;  5I6W A;  3J81 E;  1F9Q A;  4C1N K;  4KTA A;  3VYR A;  2VNU D;  1QJO A;  1RDP D;  4KN4 C;  1WTX A;  1X32 A;  2DNE A;  4XIG S;  4CHT B;  2NN6 H;  4ZUI A;  3OIQ A;  1SND A;  4C3I G;  2AQ2 B;  4KKT A;  2BE5 D;  1DON A;  4RKL A;  2PCF B;  3W3A A;  4HSP A;  4CKB A;  1STE A;  4J6H A;  1R4P B;  3K7A B;  4XQJ A;  2FMM A;  3A7A B;  2EDG A;  2IL8 A;  3VR3 A;  1Y1W B;  1EY6 A;  5ELE A;  4X3S A;  3GV3 A;  1GUN A;  1PXU A;  2WIN B;  2AQ3 B;  1L0Y B;  3FDT A;  3PIP 3;  3BVZ A;  4IUT A;  5ELC A;  2JSO A;  3SR1 A;  2FFK B;  3BZD B;  5CC4 A;  4IUN A;  5IGF A;  2M2L A;  2D62 A;  3NPP A;  3G6J B;  1B50 A;  3OMC A;  4FXG C;  2HCI A;  1LT4 D;  1SYD A;  2XWB B;  1FNW A;  3K6O A;  2R6G A;  4FF3 A;  1W6J A;  2F1M A;  1VF5 C;  2NVY B;  4ODG A;  5F2D A;  5JOB A;  4A3I B;  3CRK C;  5M5W B;  1M4V A;  5JJZ A;  1MSH A;  2SDF A;  4MN3 A;  1ENC A;  3KBX A;  1F9P A;  3SEB A;  5IIF A;  3MWY W;  4TSS A;  5IGD A;  2TSS A;  1KDA A;  3T16 A;  1G2T A;  4A3B B;  3MXP A;  2MGS A;  4KY6 A;  4IQZ A;  2F0E A;  2F0S A;  4CJ2 C;  2K1B A;  2IWH A;  3X3M A;  5IGE A;  2JA8 B;  4DU9 A;  3DWQ A;  3HGB A;  4E6I A;  2IX3 A;  1QNK A;  4EQN A;  1QNU A;  2X69 A;  5EKL A;  1Y8O B;  3NBI A;  2BDO A;  1GUO A;  4ZKB B;  5DAU A;  4FXD A;  3IKJ A;  4ZUJ A;  1L0X B;  3ONA B;  1SDF A;  4TRD A;  2I46 A;  4FP5 D;  5C3W A;  3A55 A;  4PMW A;  3JAM L;  3H6M A;  1PZI D;  1GUT A;  3D6W A;  1LTR D;  1V1O A;  2WB1 B;  1S5C D;  4XYQ A;  3A7L A;  4A3K B;  5KNB A;  1WTO A;  4B08 A;  3HZX A;  4ZKC B;  1BQQ T;  2IT1 A;  2KEC A;  4FF1 A;  1O78 A;  2RDH A;  1F2M A;  4K8J A;  4NP5 A;  4JK1 C;  1Q1E A;  2F0O A;  5G3L D;  5K5P A;  3SK5 A;  2F0U A;  5JAV A;  2EJF C;  4HAE A;  1TY0 A;  5EPL A;  3TBI B;  5I4D A;  2O5J C;  4HTH A;  5ELF A;  3MA2 B;  5C4X B;  2DY8 A;  2VXW A;  4X3U A;  2F03 A;  2KQ3 A;  4EQO A;  4C56 C;  1SE2 A;  4LJZ C;  2JA6 B;  2A6H D;  4Q0F A;  5DM6 3;  1HFG A;  2RQX A;  1GUG A;  3M7G A;  1YNJ D;  4XDX A;  1I3Q B;  1DJR D;  4CKC A;  4H13 C;  1CK1 A;  1Y8P B;  1A15 A;  1ZYR D;  3GTJ B;  3N52 A;  1S4Z A;  1XX8 A;  3QWN A;  4J1M A;  5D65 A;  3VA5 A;  1STN A;  5E4W C;  2SNM A;  2O5I C;  4DN4 M;  1KDB A;  1WVL A;  1VMP A;  2H1E A;  4A3G B;  2NBF A;  3C1F A;  1PZJ D;  3J81 L;  2A69 D;  4HCE A;  3GTP B;  1S5F D;  5BN5 A;  3VA7 A;  2AWN A;  2PYK A;  5IOC A;  5LL6 X;  3MXG A;  1SNP A;  3I91 A;  2J0T D;  5KEE A;  3QOL A;  5LL6 S;  4MHE A;  4RHS A;  5M5Y B;  1LTG D;  3NBH A;  2EYH A;  4WFN 3;  1OXV A;  3D3R A;  2O2L D;  1TII D;  1EY5 A;  5LHY 1;  2F0I A;  2EVB A;  3S16 B;  3OWE B;  2QCP X;  2KJX A;  2VB3 X;  2AWO A;  3DMU A;  3X3N A;  3S1M B;  5G3L F;  4C3H B;  5EQ0 A;  3M85 A;  1WD1 A;  1X3Q A;  2VUM B;  2GA4 B;  3PMF A;  2KA7 A;  1BR9 A;  1XXG A;  4Z9C B;  5KIX A;  4UAI A;  3WDN A;  3M4Y A;  2MUY A;  4FO2 A;  4RCO A;  3H0G B;  4FYD A;  4IUQ A;  2F0K A;  1EL0 A;  1EOT A;  3L3O C;  5ISR A;  4U68 A;  2L1B A;  3PV0 A;  4A3D B;  3GP7 A;  3K5M A;  4B9W A;  5FK9 C;  3PUZ A;  2E2D C;  5EKK A;  1B53 A;  1S5E D;  2FHT A;  3IAY A;  2EOT A;  5C5M A;  3WOF A;  3TZU A;  5JEA J;  1O7Z A;  3K0Y A;  1TS5 A;  2RSO A;  1LTS D;  4K5V A;  4V19 0;  1YNN D;  3KLR A;  1SSO A;  3FKI B;  2Q8T A;  3MC0 B;  3ITP A;  2F0G A;  1ZXT A;  4DK0 A;  1LTA D;  3MVV A;  3GTO B;  1H9S B;  2N88 A;  1ICW A;  4KJN A;  2NTT A;  1V8Q A;  1TWC B;  1SBB B;  4YIJ A;  4CJ1 B;  3J7A V;  1HA5 A;  3DEP A;  1ILP A;  1LLR D;  3Q6S A;  1C8C A;  2K6A A;  3P20 A;  1FGB D;  1B2T A;  2B2T A;  3SDZ A;  1PFM A;  4K6D A;  5EJW A;  1LV9 A;  3EFX D;  4F88 A;  2E2I B;  4RH6 A;  4C2M B;  1U9R A;  1RJT A;  1NR4 A;  4BS9 A;  2EXZ A;  5KND A;  3TP5 A;  1LT3 D;  2DN8 A;  4DK1 A;  1EU4 A;  1QCB D;  3N6R A;  1HUM A;  4FNF A;  1SMY D;  2RVL A;  1SYE A;  1D1I A;  2JEB I;  3A8J E;  2EY2 A;  4FF2 A;  3VYT A;  3SHL A;  3TP7 A;  3MHB A;  3FEW X;  5I6Y A;  1JWM D;  3DWP A;  1LT5 D;  3NHH A;  1SAP A;  3GTQ B;  2FIN B;  4IFD J;  5KNC A;  2RKS A;  1X3P A;  1JB3 A;  4JBW A;  1QB5 D;  1K8M A;  3LWU A;  4WRD A;  1AFP A;  2I07 B;  2F0F A;  1STY A;  2R7Z B;  1HRJ A;  1EZ6 A;  1E0B A;  3EVQ A;  1R4Q B;  3S1N B;  3R8B A;  2F3W A;  3BYT B;  4BWG B;  3OPO A;  1DOL A;  1CHQ D;  4QMG A;  2J4X A;  3MXU A;  3BDC A;  4OIJ A;  3QOJ A;  2B8F A;  2LKV A;  1F9R A;  4OL7 A;  4O42 A;  1HUN A;  1OXX K;  2B39 A;  1B1Z A;  2NB0 A;  2IX1 A;  1GJX A;  3BVG A;  2B2T C;  2AUK A;  5BN3 A;  1D5X C;  3FVQ A;  5CMD A;  2K03 A;  2XN9 C;  4OO1 H;  5FLX E;  3NTK A;  1QOH A;  1BO0 A;  1STA A;  1AP0 A;  4DFA A;  4EQP A;  2CHB D;  1BXT A;  2JXM B;  2EY1 A;  3HOV B;  2Z4I A;  4FVM A;  4GZY C;  3R3O A;  1BOS A;  2K7V A;  3IL8 A;  3K59 A;  3QJY A;  1U4L A;  3M7N A;  4TKO B;  3QG1 A;  1IW7 C;  5KYI A;  1ET6 A;  2G9H D;  4ZRZ A;  1Y8N B;  2NWG A;  4DAY A;  1F2L A;  5DNF A;  1F2Y A;  4HMJ A;  2NVQ B;  1SYG A;  5KGU A;  1EFI D;  3HRZ C;  4DNR B;  3K5N A;  2WII B;  3KUP A;  1B3A A;  2ENB A;  1PLF A;  5JVG 3;  3CKI B;  2WAQ B;  1TT2 A;  4IZ8 A;  2Q8I B;  4XT3 B;  2HQE A;  2NVT B;  1EQT A;  2A68 D;  1B44 D;  1GXD C;  5IT9 E;  3V96 A;  5C4Z A;  1EY7 A;  5C0X J;  4N9T A;  2XVS A;  4F7X A;  1ILQ A;  2PW7 A;  1DOK A;  3PUW A;  3HOZ B;  1KNE A;  1HCZ A;  2DNC A;  2EYO A;  4XQN A;  2A74 C;  2JA5 B;  3BVM A;  5CV4 A;  4RWS C;  4IUU A;  1A2U A;  2D5D A;  4KMU C;  3PO3 B;  2A73 B;  2L11 A;  5DEH A;  3P1H A;  1I4H A;  3D4W A;  5J39 A;  2FJ2 A;  2E2H B;  3VYS A;  5CV9 A;  5AFW A;  2NTS A;  1LO5 D;  3E6Z X;  1KAB A;  1Y1V B;  2KVM A;  2WV6 D;  1TVX A;  5KYL A;  5CV8 A;  1JIC A;  3KLS A;  4NW2 A;  3R2I A;  1FYC A;  2XIW A;  1VF7 A;  1JE4 A;  2BA1 A;  2XWJ B;  3RZO B;  3D4R A;  2HCC A;  1T5X D;  3A54 A;  1J8I A;  3NE5 B;  4LAA A;  3I4M B;  3KF8 A;  3K5O A;  4S3S A;  2PZW A;  3IFD A;  1ENA A;  2B2W A;  1KNA A;  1TY2 A;  5E1F A;  1LAC A;  3S17 B;  3QO2 A;  5IGB A;  1A3U A;  2F0N A;  4ILW A;  4A3J B;  3J80 E;  1JWS D;  2X6G A;  1FNV A;  4PMB A;  4OIK A;  3NWT A;  3D6C A;  1CZG A;  2EY5 A;  1JQY D;  3URY A;  5K36 G;  1CTM A;  3E0J A;  2EYM A;  4HR7 B;  1CA5 A;  5IGC A;  1ESR A;  1SEB D;  5ELB A;  2D9U A;  1AEX A;  4R8I A;  1JOR A;  2LS0 1;  4A3M B;  2KUM A;  4XYO A;  3Q22 A;  2CW0 D;  1H9M A;  1G29 1;  1LTT D;  1U4P A;  5JEA G;  4L8J A;  5TSS A;  4CGY B;  2Z8L A;  3SE0 A;  1EU3 A;  3BDL A;  4U67 3;  3V2T A;  5CV7 A;  1WD0 A;  3F2U A;  1D6E C;  1RCV D;  5EKI A;  1HFN A;  1C48 A;  4IUV A;  2JA7 B;  2BE5 C;  2QKI C;  1AZP A;  4ABN A;  5J22 A;  1SNO A;  2A6E D;  2FMC A;  2L55 A;  1PRT D;  4PV1 C;  3HOX B;  1V1P B;  2KHS A;  2E76 C;  3I8Z A;  4C3H G;  1PTO D;  2F0L A;  4DF7 A;  5A2Q E;  2EJM A;  4XTC S;  3FPP A;  2N55 A;  3DEO A;  3K58 A;  4ME5 A;  2ZT9 C;  4LMQ D;  2WAC A;  4I65 A;  1WTQ A;  5NUC A;  2XSC A;  5D3D A;  2B63 B;  5I9O A;  2CVR A;  1DOM A;  2NN6 I;  3MAQ A;  1T5E A;  3Q24 A;  2IJ0 A;  3GQB A;  4OO1 I;  5C4H A;  2KOL A;  1Q3L A;  2F0D A;  4PMC A;  1HQR D;  1TS4 A;  1ONL A;  1PRT B;  1LAB A;  3H09 A;  4FXK C;  4QB4 A;  1UUP A;  3PUX A;  1ZEQ X;  1LTB D;  2L9H A;  2B2W C;  1PTO B;  2C5C A;  1I4G A;  4NMZ A;  3E5S A;  3TP6 A;  4Y7N B;  1HPC A;  5FLX L;  1HHV A;  3MEH A;  4KKS A;  1TWF B;  3I4N B;  2PQE A;  5M9O A;  4C1N I;  2OF1 A;  3OHX C;  3GTM B;  2ICE C;  4HSV A;  1BCP D;  4IFD G;  1CQV A;  1WTR A;  1ENF A;  5HUR A;  1U4R A;  4H7B A;  2EYF A;  1U4M A;  2K28 A;  1I4R A;  4KK7 A;  2BCO A;  3GV6 A;  4K5W A;  1II3 A;  2EY6 A;  2IX0 A;  4DNT B;  3MXN A;  3CRL C;  1RTN A;  3MZ5 A;  1Q1B A;  1EYC A;  1SYC A;  1V43 A;  1S5B D;  2M00 A;  1QWY A;  4M1U B;  5M3F B;  3I72 A;  1A3T A;  1D5Z C;  1C4Q A;  3FRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...