3GV6A

Crystal structure of human chromobox homolog 6 (cbx6) with h3k9 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
ERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 6
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna binding protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3gv6A00
5JJZA 2L4NA 1LV9A 4R9WA 4X3TA 1F9SA 3MWYW 2HDMA 4QUFA 5DNFA 1QE6A 1CM9A 1JICA 1M8AA 1F9RA 2NZ1D 1TVXA 2XIWA 1ZXTA 2EPBA 4IUPA 3TZDA 1B4OA 2Q8RE 2B2VC 1A15A 4UAIA 2K28A 3TN2A 1HFNA 1ML0D 4XT3B 1G2SA 1O80A 4QUCA 3Q6SA 2Q8TA 1DZ1A 1X3QA 2X6LA 2IL8A 1WTWA 1NR4A 4OIKA 4O42A 3HP3A 2SDFA 4U68A 5E4WC 2MP1A 4IUQA 5CMDA 2KECA 1ICWA 2X69A 5EPJA 1Q3LA 1QG7A 2X6GA 1EIHA 1WTRA 5D14A 1PFNA 2MPMA 5EKIA 1MI2A 2B2WC 4HCSA 5D65A 1AP0A 2B2YA 1S4ZA 2K05A 3MTSA 1XX8A 4IUUA 4CJ1B 1GUWA 2HUGA 1IKLA 3SVMA 2KEEA 5CBEE 1B50A 2MGSA 4ZLTF 2KEDA 1F2LA 4X3KA 1MSHA 2L11A 2RVLA 1AZPA 1U4PA 1PFMA 5E4XA 2RSOA 1HRJA 1EOTA 1VMPA 4HAEA 4IUVA 1O7YA 2H1EA 1RTOA 5T1GA 1DONA 1NAPA 2FMMA 1HHVA 1JE4A 4CJ2C 2NYZD 2FINB 2KUMA 3UI2A 5CBAE 2B2UC 3I8ZA 2JYOA 4HSVA 2FHTA 1RHPA 4HEDA 4LMQD 4XDXA 2HCIA 1WTPA 2MJ8A 2FFKB 5AFWA 2CVRA 2R3ZA 2DY7A 1G91A 3FPUB 2KOLA 4ZAIA 1C8CA 2HCCA 3N52A 5CORA 5EPKA 2N88A 4ZKCB 1B2TA 3KUPA 3DEOA 1IKMA 5EJWA 1X3PA 3GV3A 1WTOA 1ESRA 2B2TA 2JP1A 2RSNA 3I3CA 3R93A 4R8IA 1WTVA 1WTQA 1SDFA 4ZKBB 3FDTA 1X32A 2EE1A 1HUMA 4NW2A 4XT1B 1PLFA 4MN3A 1HA6A 2B2VA 1HUNA 1EQTA 1MSGA 1VMCA 2BDNA 2EOTA 2K1BA 4DN4M 1EIGA 3I91A 1EL0A 1MGSA 4X3UA 1O7ZA 1IL8A 2B2YC 1G6ZA 1KNAA 4RAUC 1BF4A 3KBXA 1B53A 1WVLA 2K03A 3I90A 3DM1A 2L12A 2KVMA 5EPLA 1KNEA 1RJTA 1U4LA 5COYA 1DOMA 1BBXC 1PDQA 1AZQA 2B2WA 1B3AA 3GV6A 1CA5A 2N55A 1DOLA 1U4RA 2K01A 1BNZA 1CA6A 2J7ZA 2NWGA 3D6WA 3F2UA 3H91A 1ILQA 1RTNA 4IUTA 4ZK9B 1ILPA 2M2LA 3LWEA 2DY8A 3IFDA 1NR2A 3QO2A 1RODA 1NCVA 1SAPA 3IL8A 4X3SA 5EQ0A 1U4MA 2D9UA 1BO0A 2HDLA 1E0BA 1F9PA 3P7JA 1PFBA 4IURA 1XYIA 1WD0A 1WD1A 1DOKA 2FJ2A 3G7LA 1J9OA 4MHEA 4OIJA 1HFGA 1J8IA 3DEPA 4RA8A 1WTXA 2K04A 1F9QA 2L1BA 2B2UA 4RWSC 2RA4A 5T1IA 1G2TA 2VXWA 3ONAB 1SSOA 2L9HA 4CJ0B 2B2TC 1QNKA
chains in the Genus database with same CATH superfamily
1SYFA 2QDBA 1RL2A 3TRZA 2A73B 3S2HB 2AQ2B 4JC0A 5GADC 1I94L 1PXUA 1GVPA 4FDBA 3TSSA 3KYHC 2Z4IA 4S3SA 5M5XH 1I94Q 5IGBA 3MEHA 3R2IA 2AWNA 4DAMA 5CMDA 5LMUL 4QF4A 3S1RH 4YWMA 2VS1A 1ASZA 3I4MG 3VR2A 5CR3A 1H9KA 3DWAA 2PMZB 5IYBH 1M1KC 1XX8A 1B3QA 3CCRA 4XTCS 1FYCA 3EVQA 3T16A 1VQ4A 4CDEC 4A3DH 3HS0C 3NP8A 3T4AC 5J1ZA 5M5WB 1TWCH 1XNQL 1VQ5A 1DONA 2VB2X 4LFCQ 2EJMA 3I4MB 1XNQQ 4LF7L 4AH6A 3CCUA 2MJ8A 3W5OA 2UUBL 4K6DA 4K0KL 2KA7A 4LF7Q 1PZJD 2UUBQ 3DEOA 4K0KQ 2BE5D 2F0LA 2OTJA 4HIKA 1UE6A 4MN3A 4JVZA 1FNWA 1VQEA 4HMJA 4DV3L 1HR0L 2PNRC 1C7YA 2SOBA 1STBA 1XTCD 4KN7C 4XQNA 4X3UA 1IL8A 3IKJA 3OMCA 4DV3Q 1HR0Q 3PF4A 3S1QB 1LTID 3S17B 1HZCA 5M5YH 2K50A 1Y8PB 1JJ2A 1YNJD 1D5XC 4DV0L 3F2UA 1B7YB 5IGCA 1BVSA 1DXMA 5EGTA 1D2BA 5IWAL 5EBCA 4QY7A 4BA1I 5CGKA 5IE8A 1Q1EA 1Q12A 1SXTA 3GTJH 2R93G 3QB3A 5IWAQ 3H3VC 4KY6A 5JPMC 3EIVA 1EU4A 4NXML 1YZ6A 3ONAB 5JOBA 3BDOA 2ICEC 3HKSA 2K33A 5JJZA 3HGBA 3HOUG 3GTOB 4OWXB 2OCEA 2IHEA 5KNCA 4HJ7A 5C5LA 3A7LA 2K5HA 3CAMA 1HQMC 4XT3B 2O2LD 1PTOC 3AMUA 1STGA 4OIKA 2R93B 1DM0B 1CSQA 2K52A 2CQOA 3PIO3 3T1HL 4L5RC 1IBML 2H5XA 3QOLA 1TWAB 3MXNB 4JI3L 1YHQA 3T1HQ 1F2MA 3HOUB 1IBMQ 4G4KA 3PUWA 4J8QA 4JI3Q 1LLRD 3M85A 4QCLA 4ZLTF 1LO5D 1U9RA 2MO1A 4DXFA 1MKHA 4ME5A 1VMPA 4ZRZA 2C9OA 4B9XA 1HHVA 1NAPA 3JAMi 3U9OA 1JJGA 3P20A 5AFWA 2R3ZA 2UUAL 4GLVB 1T5EA 2F3VA 4JPBW 1CKMA 5BN5A 1EY5A 4DGZA 2UUAQ 1D6EC 3KF8A 1MHWC 5CV8A 2G9DA 4PMBA 4H13C 5L37A 3S9WA 1WYDA 4R4CA 1FD7D 2E8GA 1HR0W 5GROA 5G3LF 4QJFA 1AE2A 3Q8DA 3QR8A 3OIPA 4LAAA 1D1IA 4DAYA 2NVXH 1VQLA 2E2JB 1S5FD 1VQJA 2NZHA 2N8NA 1X6OA 1GUGA 1SROA 4PMCA 3W3AA 3TP7A 1WFQA 4J15A 4A3KH 1DOMA 1EIYB 2MNAA 2F0TA 2K01A 4APVA 4JI5L 2LXJA 4LUOA 4KJNA 2EY1A 3CCSA 3MXGA 2AQ1B 1TT2A 3EROA 3NWSA 4JI5Q 1XYIA 4C3JH 1EY6A 3S14H 1K83H 1BDOA 4RA8A 5C0XJ 1A0IA 3M7NA 3EJIA 4IUNA 1QCBD 2I46A 4CJ0B 5LL6X 2B8FA 3DUZA 2Y0SE 3CPWA 2WIIB 2XIWA 2CWPA 2BH2A 2HQLA 2X6LA 1AEXA 2Z0SA 4DU9A 5IIFA 3M4OB 3DXJC 4O42A 1J5EL 2DJGC 3TMEA 3F2CA 1J5EQ 3HRZC 3HOVG 4P71A 4LF4L 5IYCH 2JQOA 2IPKD 1IW7D 4KJOA 3HOZG 2A69D 4DAPA 5AJ3L 1F2LA 3Q22A 4LF4Q 1AZPA 4Y7NB 3J7YW 4GKJL 3GTKB 3GTQB 4EVOA 5AJ3Q 2NVTB 4TSSA 4DR2L 1CKOA 4GKJQ 2Z8LA 4JBWA 1PH8A 3SR1A 4DR2Q 4HSVA 5I2YA 1B9NA 2WKCA 4GOPC 1K28A 4ZAIA 3Q23A 1XPOA 1V1PA 3CMAA 3HOZB 3CCQA 2K5VA 3VA5A 5CV5A 4HIMA 2NVQB 5K5PA 3J80L 4A3BG 5DEHA 1R4QB 2Z1CA 4FXGC 3SK8A 5ELOA 3R93A 3TQYA 3PO3G 3T53B 1BCPF 1U5KA 1X32A 1KLUD 1X3EA 2QDLA 2WKDA 2K7VA 1JWSD 5J39A 1XMQL 3E9IA 2XWBB 5FJ8G 4BY7H 1ZYRC 2F0NA 2NB0A 1XMQQ 3I4NG 3I70A 5DM63 1B53A 1I3QH 3CRLC 4K5VA 1VDZA 1YIJA 1Y1WG 4GLAC 1JE5A 1B3AA 2R7FA 1W2BA 1CA6A 4DV5Q 1SFOH 4G7ZC 1ILQA 1F77A 1RTNA 3TREA 3QO2A 3VR5A 4BBRH 4X3SA 2ZM6L 1FJGL 3KFUA 1E0BA 2K75A 4L8JA 1EZ6A 3NBHA 5JJKA 3QWNA 1W6KA 2BA1A 2F0SA 3GTPB 3I4NB 2ZXPA 3V05A 2WV6D 4LF8L 5FKAC 1HZBA 2EJFC 1Y1WB 1V1QA 3QJYA 1UNSA 4IPGA 2RQXA 5A2QE 4LF8Q 4GOPA 4X3TA 2VW9A 1QE6A 4FF4A 4QMGA 4MZ9A 4FO2A 3NBHB 4RGOS 1X3QA 3NHHA 2JA5H 3R8BA 3HP3A 3S2HH 3RMHA 4ID6A 2X6GA 3OWFA 4XXEA 5D14A 2MPMA 3FKIG 4GOPB 5D65A 1O78A 1VQAA 2K05A 1NMFA 4IUUA 1UE1A 2ZJRA 3E9HA 5C0XG 4A3EG 1Z6HA 2N78A 3MXUA 2MGSA 5D3DA 4A3FG 1J6QA 3M4YA 1TIID 2F0MA 2Y0SG 2EZVA 4JI6L 3PF5A 3Q24A 3I4LA 1SLJA 2I5HA 1E7ZA 4ZQ3A 4JI6Q 3MZ5A 1JE4A 4K8JA 3AB9A 1X9NA 1I4RA 4K5WA 4HCEA 1XPRA 3FKIB 2D62A 1PYSB 3MXPA 2DNEA 1C8CA 2XRQD 2HT1A 4A3EB 3N52A 2CH4W 4R4QA 1ENAA 5KYLA 5M5WH 4ZKCB 4A3FB 2Y0SB 1LABA 5E1FA 4YCVA 1ESRA 4KHVA 5E7NA 1SYDA 3I4MH 3IAYA 5DAUA 5LL6S 1PLFA 3SK5A 1Y1VH 4KK7A 3J81j 4X65L 3L7ZC 3DLLA 4Q0FA 2R7DA 4WFN3 4I7AA 1CTMA 1AN8A 3MFGA 2K03A 3I90A 2DGYA 1VQPA 2ZTDA 1EY9A 1PV4A 4OHJA 1EY7A 3L2PA 2WACA 1VQCA 1RDPD 4GN5A 3G71A 2J7ZA 2EQSA 2SNSA 1A2TA 1YITA 1RODA 1GUTA 1VQKA 3NSWA 4A3GH 3S1QH 3ERQA 1QILA 4AYBE 3PIPA 1TKWB 2BH8A 2E76C 3CQZH 3RUZA 5J22A 1Y14B 5JPNC 1EQRA 3BVZA 4JI0L 3K5LA 3S15H 3D4WA 5C4JB 1F9QA 3S2DB 4JI0Q 1Q8KA 3GTMB 5DNFA 3QIAA 5IGFA 4JYAQ 1Q82C 1XTDA 2MO0A 2PZUA 1A15A 3DWPA 4GS3A 1CSPA 2XTIA 1HNZL 1TQOA 2HHHQ 1R9TH 3GTOH 2X69A 5C3EH 1I50B 3J7A5 4DR6L 3A74A 4CKEA 1EYGA 4JW0A 1PZKD 4DR6Q 4CKCA 5FOBB 2KEEA 2R93H 1EOVA 2B39A 3DM3A 1KABA 3AQQA 2Q2IA 3K80C 5E4XA 1TWAH 2KENA 4K5XA 3CU7A 5M3FG 4HR7B 3GD7A 3HOUH 2ENBA 3BYTB 3GP7A 4N9PA 3VYSA 3I8ZA 1XXGA 4P73A 2YV5A 3VR4A 4OELB 4NDXA 3FPPA 4L6TB 2PW7A 3E6ZX 1VQNA 3FP9A 4X64Q 1EEID 5M3FB 3E0EA 3NELA 3PO2G 1WTQA 4HIOA 4P2CB 5KGUA 5F2DA 3FDTA 1VF5C 3BZDB 1KDBA 3J7ZC 4GNXC 1EQTA 1NBWA 3BZCA 2B2YC 4OWTB 2UU9L 5M9OA 1WVLA 5I2XA 3PUVA 3DM1A 2L55A 4I7ZC 2MHVA 4IALA 1K9MC 1UE5A 3PO2B 2UU9Q 2E2JH 4DV7L 5CC4A 4YIJA 1QJOA 1AFPA 2M2LA 1NY4A 2XWJB 2EIFA 3H3VH 2QGQA 4PZ8A 1BO0A 2HDLA 5FO8B 3OOCA 4BA2I 2C35B 4OIJA 4UP9A 3LNNA 1PA6A 5CV9A 1DGSA 3KOJA 4DV4Q 2JA7G 5T1IA 4ZUJA 2NVYB 3DMUA 1STHA 3A56A 1CZWA 2VUMG 4Q5VA 1WCMB 5FLXL 2QEXA 1YHBA 2Z4HA 3K7UC 1YHAA 2EPBA 1STEA 3EQLC 2EYOA 1PMRA 4DV6L 1MJCA 4RCOA 3PV0A 4V0BA 5HGQA 2JA7B 1LYLA 3OYYA 4X66L 4GNXA 2XSCA 1A6XA 2Z9HA 2VUMB 3VDYA 4JI8L 2Q2TA 4X66Q 2B2YA 2R92G 1L0YB 2HUGA 1V1OA 2PNHA 3TZUA 3M4OH 3HZXA 4JI8Q 3I56A 1KDCA 1K8MA 5IT9L 1N33L 5JEAG 1PZID 1GD7A 3BDLA 1QVFA 1PRTF 1VS0A 1HRJA 4PQXA 5CV6A 2E2HB 2I5MX 1LTSD 4LF6L 1N8RC 1EU3A 1CQFA 4AYBB 4GNXB 2F4VL 2BCOA 3UI2A 1LTAD 2PQEA 4LF6Q 3U50C 1HJPA 4DNIA 3H3VI 5ELCA 4P75A 4Y7NH 2F4VQ 3FMCA 2F0PA 4DK6C 2R92B 1OO9B 3DWQA 3GTQH 5CORA 2EY2A 2NVTH 5LMUQ 1VQ7A 1B2TA 4BBSG 3ZJYC 4IOAA 3S1MB 3GV3A 4IN3A 5GAHC 1PYBA 3MFYA 2TSSA 3HOVH 1ET9A 1I4QA 1QB5D 1SE3A 4RKLA 1STYA 3BVMA 4NW2A 3BJUA 3KLSX 3HOZH 3NTKA 1VQMA 1KD1C 1LT4D 4JBJA 4HTHA 1HUNA 2NVQH 1MSGA 4QIWB 1JR0D 1EL0A 2F1MA 5IP7G 3PGZA 2Q8IB 1O7IA 2YTXA 4BBSB 1CUKA 2PW5A 5ELFA 3E5SA 1BBXC 4X6AH 4R8NA 1E1TA 4ZCKA 1SE8A 1BNZA 1B44D 3A7AB 5K36G 5FO9B 4A3BH 5IGDA 4YHHL 2OT2A 2RF4A 5C4XH 4R4OA 3CCLA 2NTTA 4TKOB 3J7AF 3PO3H 1KXLA 3OWEB 4UY8C 1HFGA 2PQAA 4YHHQ 5FLXc 4WJWA 3W1BA 4FXKC 1G2TA 1H9JA 4O1NA 1QNKA 4EQNA 5FJ8H 3UDFA 2Q2UA 1LV9A 2HDMA 3TP8A 3J81i 2A6ED 2KHIA 2KHSA 1M8AA 1JOOA 4DNRB 3GTPH 3I4NH 2JK8A 4A93G 4UAIA 1S5DD 1A2UA 3H09A 3SE0A 2KJXA 1Y1WH 4K8IA 2HIVA 3PSIA 4DV0Q 4PMWA 1ASYA 1CT1D 2PQAB 3NWTA 2F0FA 1LTBD 5IT9c 1P8LA 4NPSA 4OL7A 4CDCC 2RCFA 4EX5A 3MTSA 3X3MA 4KTAA 1K0RA 4DUYL 4GZYC 1STNA 1BCPC 4QGUA 3SK6A 2IX3A 4A93B 4NXMQ 1TS5A 1ICFB 1SMYD 2Z6BA 2RSOA 4HAEA 4DUZL 5FLXE 1TWGB 1I4XA 3D3RA 1CFMA 2FMMA 5I9PA 1K8AC 2NYZD 4DUZQ 3FHWA 1TWFH 2XNAC 1M4VA 3CHBD 2E2IB 5C3XA 3NPPA 2CVRA 1G91A 2RDHA 1S5ED 1N32L 4C3HG 2JSOA 5EKKA 1TR5A 4JBMA 3AYHB 1N32Q 1WTVA 1JQYD 2JEAI 1VQOA 3FKIH 1E2WA 1VQHA 2EE1A 3HOYG 5IT9E 1XMOL 1K3BC 5C0XH 4A3EH 4BXXG 4Y52H 4KY5A 4JBKA 1D1KA 3C1FA 3A54A 4A3FH 1CQVA 2EOTA 2BDNA 1Q86C 3CPFA 3AFPA 4BWGB 1XMOQ 2XRSD 3T13A 1O7ZA 4C3HB 1LUZA 2A68D 1GHKA 2K14A 4NXNL 4B3SL 4OXPA 2Q2HA 2EXDA 4FP5D 2QCPX 4B3SQ 1K8GA 4H7BA 3S16B 3HOYB 3RNUA 1JOKA 3BG3A 1HQRD 3OTOL 4MIUA 2AQ3B 3UDGA 3L9AX 2JE6I 1TWHB 4LNQA 1LT6D 3OTOQ 3JAMc 2R6GA 4ODGA 4FYDA 5A2QL 1L1OC 2OEOA 3MHBA 1A3VA 4LF5L 1M90C 1OXTA 5CV7A 3KF8B 3G48A 2NZOA 4LF5Q 1BCPB 2QF7A 4G57A 4A3JB 2F0UA 4L63B 4IO9A 1E22A 1K3RA 3B6YA 4DAYB 4X62L 3V2TA 1HXYD 2CW0D 1PTOB 2SDFA 3OSOA 4LF9L 1HH2P 2MP1A 4IUQA 3GTMH 1WI5A 1QG7A 3C3LA 2K4KA 5C0XI 5FLMG 1KC8C 4LF9Q 4UP8A 1D8LA 4OWWB 4MTNA 1KAWA 2VQFL 1HZAA 2L11A 1Q1BA 4IJHA 5HURA 1SBBB 5C4HA 5BN3A 3JAME 2BE5C 3VYTA 1QZGA 4PNYA 1I50H 3AFQA 2ES2A 3AU7A 2VQFQ 1Q46A 1YNNC 4G7OC 2UUCL 5CBAE 2KUMA 1B8AA 1KIXA 1VQBA 2E74C 3VR3A 1WTPA 2UUCQ 2YU9H 2DY7A 2RHSB 2HCCA 1CI3M 4IPCA 3A5UA 1GHJA 5IY0A 3LWUA 1L1OA 4IFDJ 3VA7A 1IKMA 1I5FA 5A35A 1WTOA 1I4GA 2RSNA 1YNJC 1VQ8A 1HNXL 3STBD 4POGA 1KL9A 4LW1A 5I9OA 3RD4A 2WINB 4KD4A 5IYBG 3IRBA 1X3GA 2EYJA 3KJPA 4DR7L 4NKLA 2G9HD 4DN4M 5M5XB 1EIGA 5ELNA 3GO5A 5M3FH 4EQOA 1L1OB 4UDUC 1WOCA 3RR5A 3NTIA 4C2MH 2KVMA 2ZJQA 3VYUA 5CYUA 1EYCA 4N9TA 3GTGH 4YCWA 4RFBA 4BY1H 2UXDL 1PVOA 3H91A 1ILPA 1BUVT 3LWEA 2AKWB 2RDFA 1BBWA 1TS4A 1NCVA 2F52A 2AUKA 1CK1A 4LJZC 1PHJA 2F0WA 3C46A 4F7XA 1UAPA 4V190 1YBYA 5C4ZA 3A8KE 3EA6A 2K5DA 4RH6A 1STAA 2HD3A 1V1PB 2L1BA 1X56A 1MIUA 1U0LA 1GKHA 1SMXA 3CW2C 4EQPA 1CM9A 2E2DC 2V1CC 2CHBD 5BR8L 3S1NH 1A3UA 1SNPA 3I55A 4IQZA 1ML0D 4DV2L 4C3IH 1O80A 1L0WA 2NVYH 5BR8Q 3OMGA 4U673 1LT5D 5EKLA 2KHJA 3ND8A 5E4WC 5C6AA 4DV2Q 3NENA 3R3OA 2GVBA 2ZM6Q 1Q3LA 2D5DA 4XYOA 1FJGQ 2EY6A 1WTRA 1PH4A 1JMCA 4BS9A 3TS2A 1XJVA 1V8QA 1YJWA 4ILWA 1H9SA 3WDNA 4R4TA 2D0OA 5JAVA 3KK7A 2PYKA 1E2ZA 1EOTA 4KN4C 1VQ6A 1O7YA 1RTOA 4KKSA 3WOFA 1RIPA 4H02A 2ASBA 2FINB 3EBEA 5LMNL 3FEWX 2K5NA 4HIDA 4WJ4A 1EZ8A 2WP8J 5JVH3 1H9SB 3U9SA 5LMNQ 2OF1A 4HMIA 4M1UB 3E0JA 3H0GG 4JOIA 3GTJB 1QOHA 1ZKOA 2QILA 4RGTA 5M3MG 2JP1A 3OHXC 1F2ZA 2GN5A 3TS0A 4KKUA 1HUMA 3ND9A 1X55A 4IOCA 3J80i 1TY2A 2ZXRA 4JCVE 4HJ9A 3H0GB 1C48A 1EYAA 2KCMA 1IL2A 5EPLA 5M3MB 4CHTB 3UDIA 2J4XA 1CA5A 1U4RA 2N3SA 2NWGA 2AHOB 4RHRA 4F88A 4MNOA 1KAAA 4ZK9B 4GKKL 4IFDG 3PIP3 4L5QA 4DXGA 1U4MA 2VQEL 3HKZE 3K5OA 1PFBA 1AW7A 1EY8A 2QA4A 4FF2A 4GKKQ 1NUCA 4MHEA 3NTHA 3SEBA 1L2FA 2VQEQ 3G6JB 2IWHA 2M00A 4X65Q 1FVIA 2B2TC 1IYVA 1DD2A 1PRTC 1IW7C 1JICA 5IP7H 5HY6A 4DNTB 2ZXOA 3CCEA 1LTLA 1TVXA 2R7ZG 3BZKA 1UUPA 2Q8RE 1SYBA 2I5LX 5IGGA 3V96A 1DZ1A 1NR4A 3GTLB 3S17H 3O13A 4A3KG 1C9OA 1YEZA 3I4OA 4B3TL 1ICWA 5GQOA 3URYA 2O4XA 2NVXB 4B3TQ 5JEAJ 1HA5A 3UE1A 4ALPA 1VQGA 4R1JA 1C4QA 4B3RL 5G3LD 2R7ZB 1YVCA 1QVCA 3PUXA 1JB7A 2DUDA 1PH7A 3HOXG 3CCMA 4TQUS 4A3KB 1A62A 5LMNW 4GLXA 2OWOA 2GVAA 4O0AA 2AWOA 3A55A 3K7AB 4KKTA 3U4VA 4HEDA 4A93H 3L0OA 4XDXA 1FGBD 1HNZQ 1SJHD 3ULJA 2A6HC 2PMZE 5EPKA 4C3JB 1TWGH 3S14B 1K83B 2NBFA 2A8VA 4EQ5A 5EJWA 1SNCA 5KNBA 2B2TA 3HOXB 2DN8A 2C5CA 3I3CA 3C2PA 1GJXA 5IYDG 3KF6A 3RN5A 3CKIB 1IBLL 5ISRA 2E2IH 3ULPA 1X65A 2K5QA 4CDFC 5IP9G 1DJRD 3U58A 3M7GA 1JT8A 5IGEA 1IBLQ 1VMCA 2PPBC 1E3PA 2D2CC 1IZ6A 1KNAA 1QZHA 2O5IC 5E3FA 1RD9D 3TP6A 5GAGC 4JI2L 2RKSA 1CKNA 3HOWG 3MC0B 1RJTA 5COYA 2F0JA 2XN9C 3CD6A 4AQYL 1D7QA 1PRTB 4JI2Q 1KTKA 4B08A 1OXVA 5KEEA 4AQYQ 4R4IA 4C3HH 3K58A 3IL8A 1O7LA 1BBUA 4JI1L 1QUQA 1K8OA 3VR6A 1FR3A 3BYYB 3HOWB 1CKNB 3S16H 1SN8A 3HOYH 1LACA 4JI1Q 4BXXH 2VXWA 5DLQE 4A3IG 2OTLA 2L9HA 1TU2B 4PZ6A 2ZTCA 4ABNA 1TWHH 2GA4B 4J1MA 4DR1L 3MAQA 1WCMG 1VCIA 3M3YB 2P5ZX 4DV7Q 1QUQB 4UP7A 2LKVA 3HFZB 1VF7A 2H4OA 3SGIA 3LGJA 5J3BA 4A3IB 2L15A 4OO1G 1GUNA 1E24A 1GUWA 1SRUA 3ULLA 3RZDB 1LTTD 1S5CD 2VB3X 2JA8G 1UEBA 5CBEE 1V9PA 1PTOH 4LWCA 2RVLA 1NTGA 4E6IA 3OPOA 1PFMA 1Y8OB 4ZUIA 1PTOD 2JXMB 4KLKA 3D8GA 4DV1L 1K73C 1G6PA 4H0LC 1SEBD 1GUOA 2OXPA 1PH3A 2CFMA 1SFOB 3EFXD 1N34L 1Q81C 4OGQC 4AYBG 5DM73 4DV6Q 1I6HB 2IW3A 5C44G 2F0DA 1JOQA 1N34Q 5ELBA 4A3LG 2F0OA 2JA8B 2B3GA 4Z9CB 5NUCA 2UXCL 2N88A 5IODA 2XGTA 2EYFA 4RHSA 3U4ZA 5FLMH 1X3FA 4NB3A 1SDFA 1SNQA 1EYDA 4YWLA 4YY3L 4JI7L 1YJNA 1N33Q 2NUCA 4K2KA 1Z9FA 3J81L 1UE7A 3PQIA 4A76A 4JI7Q 4YY3Q 5C44B 3T1YL 1I4PA 2ZTEA 4PZ7A 1G51A 3NE5B 1TY0A 4IZ8A 1II3A 3X3NA 3GTKH 3T1YQ 4FXDA 1JWMD 4PV1C 4A3CG 1JJCB 3W1GA 2V4DA 1SNOA 3LX0A 3ZYYX 5D3IB 3CCVA 3OW2A 1ZEQX 1S72A 1NR2A 2ALYB 3A8IE 1DCZA 2D9UA 4IURA 2IJ0A 3K0XA 1WD0A 3ERSX 2ZJPA 1DOKA 1S3OA 3QOJA 1J9OA 3SXHA 5I4DA 3F8TA 1LTRD 1MJEA 2EYMA 1SSOA 1XNRL 2F3WA 1Y69U 1Y1VG 4QUFA 2F0VA 4WJ3M 3KLSA 4FVMA 3H94A 2I07B 1XNRQ 4LFCL 4DA2A 1ZXTA 4IUPA 1B4OA 1SYCA 3RZOB 1D5MC 1EQVA 2BA0A 3SHLA 2KQ3A 1EIHA 2YTVA 1X54A 5EBDA 1Y1VB 1IBKL 3M9BA 3CRKC 4P72A 2B2WC 2K5WA 4A3GG 1S4ZA 3TP5A 3JAML 1B50A 1IBKQ 4KD3A 3NBIA 3KLWA 1MSHA 3BU2A 1YNND 1OXXK 1SR3A 1E1OA 3E3XA 2K32A 2H1EA 5LHY1 1W6JA 2F0KA 1JCKB 3K59A 1FNVA 1GM5A 4A3GB 2FFKB 3ITPA 4CGYB 1T9HA 1QVGA 1UEAB 3CQZB 3AEVA 2EY5A 1B1ZA 3S15B 2N49A 2IT1A 1MBYA 4DF7A 3K57A 3J81c 5C3EG 1PH5A 1D5ZC 4FF3A 2RBMA 2UXBL 4DUYQ 2RDGA 4P74A 4GN3B 5KYIA 2UXBQ 2PI2E 1E2VA 2JA9A 4KHZA 2F03A 1IXRA 4IJLA 1G6ZA 1MGSA 1VQIA 1HCZA 4NP5A 1PH9A 4LFBL 1I4HA 2IHFA 1EWHA 2KCTA 4RAUC 3MXNA 3NQTA 4I65A 2EJGC 3SDZA 3FVQA 1BF4A 2OQ0A 1JC7A 1ENFA 3A5ZB 4CDDC 1OTCA 4LFBQ 1R9TB 5C3EB 1AZQA 2B2WA 3BS1A 2O5JC 4DK3C 4DPGA 1FGUA 4IUTA 2AUJD 2IX1A 2ATWA 3BVGA 3H0GH 1F9PA 2NN6G 4TVAB 2LXKA 1NMGA 5M3MH 1ZYRD 2A5HA 5JJIA 4RG1A 4DAVA 3T56B 2PZWA 3J81E 4RWSC 4LK1C 1BKBA 3CF5A 4R9WA 1S40A 4XQQA 3ER0A 4NXNQ 3NEMA 2E75C 2L0CA 3BDCA 3D4DA 4WRDA 5GAEC 1HFNA 2EVBA 2WAQE 1ENCA 1PFSA 1IYUA 3HG9A 3CXCA 4RKBA 4A3JG 5C5MA 1OXSC 1JWUD 3RLNA 1CHPD 1G291 4ME3A 3UE0A 4IFDH 3PIOA 1Z47A 5I6WA 1PFNA 2WB1E 2RCNA 1AP0A 4A3MG 3F1ZA 4CJ1B 1SYEA 2MFIA 2MUYA 3GTLH 4M8AA 2QEJC 2KEDA 4X3KA 1EWIA 1SE2A 2SEBD 1U4PA 4UPAA 3I72A 5FK9C 5C4JH 2DNCA 3PCOB 2G5DA 4DKAC 3S2DH 3QG1A 3A8JE 1I6VC 4POFA 1SNMA 2R7ZH 4C56C 2FHTA 4X62Q 2HCIA 4UHVA 3K5NA 5C3WA 3F2BA 4A3MB 4B3ML 3FPUB 2KOLA 3MVVA 4MTKA 4XIGS 1FL0A 1F2YA 4B3MQ 3KUPA 1WTHA 2QKIC 2JA6G 2K6AA 1CZGA 3K7AH 1SNDA 4ZKBB 4RGMA 2B63G 3CC2A 1ONLA 3JC66 4GN4B 4LUVA 3K6OA 4KY7A 4NMZA 3G4SA 2SNMA 3RLOA 2K1BA 3K0YA 4TRDA 2LY7A 4YCUA 3HOXH 4JV5L 1PYWD 1B70B 2PCFB 1RKNA 4XYQA 1ESFA 2JA6B 4IFDI 4JV5Q 2N55A 1DOLA 2B63B 3PUZA 2A6EC 2F0GA 2VNUD 4A75A 3GQBA 1HNWL 1HNXQ 3SK4A 2FJ2A 2PI2A 5IYDH 1HNWQ 1WTXA 4FF1A 4A3DG 1AE3A 3GDEA 4LUZA 5IP9H 4DR7Q 1PRTD 1XPUA 2A1AA 3CC4A 1EFID 1JB3A 4DFAA 1LT3D 3S1RB 2EYLA 1VQ9A 2NZ1D 2B8GA 4KHPL 3J7AV 3TN2A 2K28A 5JVG3 3HOWH 1SMYC 4QUCA 3WWVA 4KHPQ 2UXDQ 3HOVB 4A3DB 3P1HA 2KECA 4KMUC 1EFWA 3PO2H 1LM0A 1GXDC 1VQDA 4ZYSA 4JOIC 1TWCB 4HCSA 3M3YH 3A0JA 5C4XG 2ICIA 3CCJA 1BXTA 2BOSA 4A3IH 2JEBI 1NNXA 2WAQG 1RCVD 2YTYA 4A4IA 2JYOA 1PTOF 3RN2A 3RZDH 1N36L 3D0FA 1WCMH 1YJ9A 1H95A 2A6HD 3IFTA 2F4IA 4N8X1 4A3BB 2NTSA 4DV5L 2A68C 1EY4A 1N36Q 1DYQA 5C4XB 2WB1G 3PO3B 1AH9A 2A19A 1ET6A 2AMCB 1A8VA 1HPCA 1B9MA 4QQBX 4OO1H 4O2DA 4PG3A 2JA7H 1PH1A 1I6HH 5JJLA 2WAQB 5M5YB 2VUMH 2JA8H 2F0EA 1QWYA 1HTLD 3I91A 4JG2A 2BDOA 5I6YA 1KQSA 2WB1B 2CWAA 5IOCA 2CCZA 3D31A 2E2HH 1SJED 1GOZA 1KNEA 2EYHA 4QL5A 2CQAA 2L5TA 4RMFA 2YYZA 5C44H 4OEMB 1KLGD 3NUCA 3K81C 4A3LH 3F2DA 3K5MA 3CC7A 2R92H 2I0QA 2DJFC 1K0SA 2CW0C 3L3OC 1WD1A 5JEAH 1BR9A 4ULLA 4B9WA 2EDGA 3UDXA 3S1MH 2FMCA 1L0XB 2OQKA 3M4QA 2Z6KC 2KCCA 1TWFB 1R4PB 2F0HA 3MA2B 4OONA 1CHQD 2B2VC 4F87A 1G2SA 2KBNA 4A3CH 2CKZB 1SE4A 1WTWA 1TS2A 4BBSH 1LTGD 4OO1I 1A3TA 3J80c 4HN7A 4J6HA 3HEJA 3OW7A 1MI2A 2HQEA 3RZOH 4JI4L 1Y8NB 2KCNA 3I73A 3S24A 2A69C 5HGTA 2LS01 4JI4Q 3RLFA 5TSSA 3STBC 1QNUA 3I7FA 2VY3A 4CJ2C 5BN4A 1S5BD 2B2UC 1NSNS 4LMQD 5K36H 3W2DA 2PZTA 1RF2D 3KDFA 4QB4A 1EQQA 2R61A 3CP0A 3TEHB 4HJAA 1X3PA 2Z6KA 2IX0A 3FRPB 4C3JG 4R8IA 1BOSA 2D0PA 5H1SE 3J80E 4B3RQ 3N6RA 5KNDA 4OX9L 4DK1A 2MQHA 2B2VA 3ICEA 3VYRA 3G6EA 1G8ZD 4KV6A 4OX9Q 4AIMA 2JN4A 1TXYA 3KDFB 1YNXA 4JYAL 3KBXA 2IY5B 3D4RA 3TBIB 1OXUA 1Q7YC 1HZ9A 1PDQA 3GV6A 1N9WA 2VZAA 2HHHL 1KRTA 1UWVA 4CBVA 3PUYA 5KIXA 2RHQB 5EQ0A 1Q90A 1SYGA 5ELEA 5IYCG 1H9MA 1V43A 1EY0A 2F0IA 4QIWE 3EN2A 1TS3A 4DR5L 1KDAA 2LFNA 1WJJA 1PH6A 3H6MA 1PH2A 3DEPA 2ID0A 2K04A 2B2UA 1YI2A 1GO3E 4DR5Q 1EEFD 2L4NA 1F9SA 3MWYW 2XVSA 4L5SA 1EUJA 3NQIA 4C1NK 4RCNA 2YU9B 4N8FA 3KF6B 3WOEA 1JORA 1F9RA 3NK9A 3TZDA 3DHQA 2M9VA 2Q8TA 3Q6SA 2IL8A 3Q0AA 4HSPA 3KJOA 2ZT9C 1P16A 4U68A 1IYJB 1XWEA 4K2LA 2EYPA 2LSSA 5EPJA 4BY1G 3H15A 4F8MA 1FNUA 4X64L 2B29A 5EKIA 2NN6H 5KRUA 3TDQA 4EGVA 1IKLA 3SVMA 1W3SA 1EWCA 1NJIC 4CKBA 4K6LA 4IPHA 4BY7G 4C2MB 4IUVA 4YWKA 5T1GA 2A74C 2LMCB 3GTGB 1IHZA 4DR1Q 4DR4L 4BY1B 3HKZG 4FNFA 4WORA 1RHPA 3MEFA 4DR4Q 4A3JH 2F3IA 3D6CA 3CMEA 2E5LL 4C3IG 4BBRG 1GUSA 2VL6A 1BCPD 1T5XD 2J0TD 4BY7B 2E5LQ 1C0AA 3OIQA 4KI0A 5ELDA 1MD2D 4K14A 4C1NI 1I3QB 4L5TA 3KLRA 4A3MH 4HJ8A 4XT1B 3NXWA 3HKZB 2TMPA 4LFAL 1HA6A 4XQJA 4JK1C 4DV4L 5FO7B 3S1NB 4DV1Q 4DR3L 4LFAQ 4G7HC 4C3IB 4BBRB 1EIFA 2EXZA 1A63A 1VQFA 1KRSA 4DR3Q 1NE3A 1BQQT 2L12A 1U4LA 3K8AA 4HJ5A 5CV4A 3KBGA 2JA5G 1H9RA 5EAYA 4RGNA 3D6WA 1Q8IA 2JJQA 2NN6I 3PMFA 2UXCQ 3C1EA 3M4PA 2DY8A 3I2ZA 3IFDA 4DK0A 1SAPA 3T51B 1Z7TA 2CH4A 2FXQA 2HIXA 2WFWA 3P7JA 4IPDA 2JA6H 2F0QA 2PO4A 3G7LA 1HTPA 3P75A 1J8IA 2B63H 2RA4A 1KHIA 3R2TA 4H44C 2JA5B 2QW7A
chains in the Genus database with same CATH topology
1SYFA 2QDBA 2A73B 3S2HB 2AQ2B 1PXUA 3TSSA 2Z4IA 4S3SA 5IGBA 3MEHA 3R2IA 2AWNA 5CMDA 4QF4A 3VR2A 5CR3A 1H9KA 3DWAA 2PMZB 1XX8A 4XTCS 1FYCA 3EVQA 3T16A 3HS0C 3NP8A 3T4AC 5J1ZA 5M5WB 1DONA 2VB2X 2EJMA 3I4MB 2MJ8A 4K6DA 2KA7A 1PZJD 3DEOA 2BE5D 2F0LA 4MN3A 1FNWA 4HMJA 2PNRC 2SOBA 1STBA 1XTCD 4KN7C 4XQNA 4X3UA 1IL8A 3IKJA 3OMCA 3S1QB 1LTID 3S17B 1Y8PB 1YNJD 1D5XC 3F2UA 5IGCA 1DXMA 5EGTA 1D2BA 5EBCA 4BA1I 5CGKA 1Q1EA 1Q12A 1SXTA 3QB3A 3H3VC 4KY6A 5JPMC 1EU4A 3ONAB 5JOBA 3BDOA 2ICEC 2K33A 5JJZA 3HGBA 3GTOB 5KNCA 5C5LA 3A7LA 1HQMC 4XT3B 2O2LD 1PTOC 3AMUA 1STGA 4OIKA 2R93B 1DM0B 3PIO3 3QOLA 1TWAB 1F2MA 3HOUB 4G4KA 3PUWA 4J8QA 1LLRD 3M85A 4QCLA 4ZLTF 1LO5D 1U9RA 4DXFA 4ME5A 1VMPA 4ZRZA 2C9OA 4B9XA 1HHVA 1NAPA 3U9OA 3P20A 5AFWA 2R3ZA 1T5EA 2F3VA 5BN5A 1EY5A 4DGZA 1D6EC 3KF8A 5CV8A 2G9DA 4PMBA 4H13C 3S9WA 1FD7D 5G3LF 4LAAA 3OIPA 1D1IA 4DAYA 2E2JB 1S5FD 1GUGA 4PMCA 3W3AA 3TP7A 1DOMA 2F0TA 2K01A 4KJNA 2EY1A 3MXGA 2AQ1B 1TT2A 3EROA 3NWSA 1XYIA 1EY6A 1BDOA 4RA8A 5C0XJ 3M7NA 3EJIA 4IUNA 1QCBD 2I46A 4CJ0B 5LL6X 2B8FA 3DUZA 2WIIB 2XIWA 2X6LA 1AEXA 3M4OB 4DU9A 5IIFA 3DXJC 4O42A 3TMEA 3HRZC 2IPKD 1IW7D 4KJOA 2A69D 4DAPA 1F2LA 3Q22A 1AZPA 4Y7NB 3J7YW 3GTKB 3GTQB 4EVOA 2NVTB 4TSSA 2Z8LA 4JBWA 3SR1A 4HSVA 5I2YA 1B9NA 2WKCA 4ZAIA 3Q23A 1V1PA 3HOZB 3VA5A 5CV5A 2NVQB 5K5PA 3J80L 5DEHA 1R4QB 2Z1CA 4FXGC 3SK8A 3R93A 3T53B 1BCPF 1X32A 1KLUD 2WKDA 2K7VA 1JWSD 5J39A 2XWBB 1ZYRC 2F0NA 2NB0A 3I70A 5DM63 1B53A 4K5VA 3CRLC 1VDZA 1B3AA 1CA6A 4G7ZC 1ILQA 1F77A 1RTNA 3QO2A 3VR5A 4X3SA 1E0BA 4L8JA 1EZ6A 3NBHA 3QWNA 1W6KA 2BA1A 2F0SA 3GTPB 3I4NB 2ZXPA 3V05A 2WV6D 5FKAC 2EJFC 1Y1WB 3QJYA 1UNSA 2RQXA 5A2QE 4X3TA 1QE6A 4FF4A 4QMGA 4FO2A 4RGOS 1X3QA 3NHHA 3R8BA 3HP3A 3RMHA 4ID6A 2X6GA 3OWFA 4XXEA 5D14A 2MPMA 5D65A 1O78A 2K05A 4IUUA 5C0XG 1Z6HA 3MXUA 2MGSA 5D3DA 3M4YA 1TIID 2F0MA 2EZVA 3Q24A 3I4LA 4ZQ3A 3MZ5A 1JE4A 4K8JA 3AB9A 1I4RA 4K5WA 4HCEA 3FKIB 2D62A 3MXPA 2DNEA 1C8CA 2XRQD 4A3EB 3N52A 1ENAA 5KYLA 4ZKCB 4A3FB 2Y0SB 1LABA 5E1FA 1ESRA 4KHVA 1SYDA 3IAYA 5DAUA 5LL6S 1PLFA 3SK5A 4KK7A 3L7ZC 4Q0FA 4WFN3 1CTMA 1AN8A 3MFGA 2K03A 3I90A 1EY9A 4OHJA 1EY7A 2WACA 1RDPD 2J7ZA 2SNSA 1A2TA 1RODA 1GUTA 3NSWA 3ERQA 1QILA 1TKWB 2E76C 3RUZA 5J22A 5JPNC 3BVZA 3K5LA 3D4WA 5C4JB 1F9QA 3S2DB 3GTMB 5DNFA 3QIAA 5IGFA 2PZUA 1A15A 3DWPA 1TQOA 2X69A 1I50B 4CKEA 1PZKD 4CKCA 5FOBB 2KEEA 2B39A 1KABA 5E4XA 4K5XA 3CU7A 4HR7B 3GD7A 2ENBA 3BYTB 3GP7A 4N9PA 3VYSA 3I8ZA 1XXGA 3VR4A 4NDXA 3FPPA 4L6TB 2PW7A 3E6ZX 1EEID 5M3FB 1WTQA 4P2CB 5KGUA 5F2DA 3FDTA 1VF5C 3BZDB 1KDBA 1EQTA 2B2YC 5M9OA 1WVLA 5I2XA 3PUVA 3DM1A 2L55A 4I7ZC 2MHVA 4IALA 3PO2B 5CC4A 4YIJA 1QJOA 1AFPA 2M2LA 2XWJB 1BO0A 2HDLA 5FO8B 3OOCA 4BA2I 4OIJA 3LNNA 5CV9A 5T1IA 4ZUJA 2NVYB 3DMUA 1STHA 3A56A 1CZWA 4Q5VA 1WCMB 5FLXL 2Z4HA 2EPBA 1STEA 3EQLC 2EYOA 1PMRA 4RCOA 3PV0A 4V0BA 2JA7B 2XSCA 1A6XA 2VUMB 2B2YA 1L0YB 2HUGA 1V1OA 3TZUA 3HZXA 1KDCA 1K8MA 5IT9L 5JEAG 1PZID 3BDLA 1PRTF 1HRJA 4PQXA 5CV6A 2E2HB 1LTSD 1EU3A 1CQFA 4AYBB 2BCOA 3UI2A 1LTAD 2PQEA 5ELCA 3FMCA 2F0PA 2R92B 1OO9B 3DWQA 5CORA 2EY2A 1B2TA 3S1MB 3GV3A 4IN3A 3MFYA 2TSSA 1ET9A 1I4QA 1QB5D 1SE3A 4RKLA 1STYA 3BVMA 4NW2A 3KLSX 3NTKA 1LT4D 4HTHA 1HUNA 1MSGA 4QIWB 1JR0D 1EL0A 2F1MA 2Q8IB 4BBSB 2PW5A 5ELFA 3E5SA 1BBXC 4R8NA 1BNZA 1B44D 3A7AB 5K36G 5FO9B 5IGDA 2OT2A 2NTTA 4TKOB 3J7AF 3OWEB 1HFGA 4WJWA 4FXKC 1G2TA 1H9JA 4O1NA 1QNKA 4EQNA 1LV9A 2HDMA 3TP8A 2A6ED 2KHSA 1M8AA 1JOOA 4DNRB 4UAIA 1S5DD 1A2UA 3H09A 3SE0A 2KJXA 4K8IA 4PMWA 1CT1D 3NWTA 2F0FA 1LTBD 4OL7A 3MTSA 3X3MA 4KTAA 4GZYC 1STNA 1BCPC 3SK6A 2IX3A 4A93B 1TS5A 1SMYD 2RSOA 4HAEA 5FLXE 1TWGB 1I4XA 3D3RA 1CFMA 2FMMA 5I9PA 2NYZD 2XNAC 1M4VA 3CHBD 2E2IB 5C3XA 3NPPA 2CVRA 1G91A 2RDHA 1S5ED 4C3HG 2JSOA 5EKKA 1TR5A 1WTVA 1JQYD 2JEAI 1E2WA 2EE1A 5IT9E 5C0XH 4KY5A 1D1KA 3C1FA 3A54A 1CQVA 2EOTA 2BDNA 4BWGB 2XRSD 3T13A 1O7ZA 4C3HB 2A68D 1GHKA 4FP5D 2QCPX 4H7BA 3S16B 3HOYB 1JOKA 3BG3A 1HQRD 4MIUA 2AQ3B 3L9AX 2JE6I 1TWHB 1LT6D 2R6GA 4ODGA 4FYDA 5A2QL 2OEOA 3MHBA 1A3VA 1OXTA 5CV7A 1BCPB 2QF7A 4G57A 4A3JB 2F0UA 4L63B 3V2TA 1HXYD 2CW0D 1PTOB 2SDFA 3OSOA 2MP1A 4IUQA 1QG7A 3C3LA 5C0XI 5HURA 1Q1BA 2L11A 5C4HA 1SBBB 5BN3A 3JAME 2BE5C 3VYTA 4PNYA 3AU7A 1YNNC 4G7OC 5CBAE 2KUMA 2E74C 3VR3A 1WTPA 2DY7A 2HCCA 1CI3M 1GHJA 3LWUA 4IFDJ 3VA7A 1IKMA 5A35A 1WTOA 1I4GA 2RSNA 1YNJC 5I9OA 3RD4A 2WINB 4KD4A 2EYJA 4NKLA 2G9HD 4DN4M 5M5XB 1EIGA 3GO5A 4EQOA 4UDUC 3NTIA 2KVMA 3VYUA 5CYUA 1EYCA 4N9TA 4RFBA 3H91A 1ILPA 1BUVT 3LWEA 2RDFA 1TS4A 1NCVA 2AUKA 1CK1A 4LJZC 2F0WA 3C46A 4F7XA 1UAPA 4V190 5C4ZA 3A8KE 3EA6A 2K5DA 4RH6A 1STAA 1V1PB 2L1BA 4EQPA 1CM9A 2E2DC 2CHBD 1A3UA 1SNPA 4IQZA 1ML0D 1O80A 3OMGA 4U673 1LT5D 5EKLA 3ND8A 5E4WC 5C6AA 3R3OA 1Q3LA 2D5DA 4XYOA 2EY6A 1WTRA 4BS9A 1V8QA 4ILWA 1H9SA 3WDNA 5JAVA 3KK7A 2PYKA 1E2ZA 1EOTA 4KN4C 1O7YA 1RTOA 4KKSA 3WOFA 2FINB 3FEWX 1EZ8A 2WP8J 5JVH3 1H9SB 3U9SA 2OF1A 4HMIA 4M1UB 3E0JA 3GTJB 1QOHA 1ZKOA 2QILA 4RGTA 2JP1A 3OHXC 1F2ZA 4KKUA 1HUMA 3ND9A 1TY2A 2ZXRA 3H0GB 1C48A 1EYAA 5EPLA 5M3MB 4CHTB 2J4XA 1CA5A 1U4RA 2NWGA 4RHRA 4F88A 1KAAA 4ZK9B 4IFDG 3PIP3 4DXGA 1U4MA 3K5OA 1PFBA 1AW7A 1EY8A 4FF2A 1NUCA 4MHEA 3NTHA 3SEBA 3G6JB 2IWHA 2M00A 2B2TC 1IYVA 1DD2A 1PRTC 1IW7C 1JICA 4DNTB 2ZXOA 1TVXA 1UUPA 2Q8RE 1SYBA 5IGGA 3V96A 1DZ1A 1NR4A 3GTLB 3O13A 1ICWA 3URYA 2O4XA 2NVXB 5JEAJ 1HA5A 1C4QA 5G3LD 2R7ZB 3PUXA 4TQUS 4A3KB 2AWOA 3A55A 3K7AB 4KKTA 4HEDA 4XDXA 1FGBD 1SJHD 2A6HC 4C3JB 5EPKA 3S14B 1K83B 2NBFA 5EJWA 1SNCA 5KNBA 2B2TA 3HOXB 2DN8A 2C5CA 3I3CA 3C2PA 1GJXA 3CKIB 5ISRA 2K5QA 1DJRD 3M7GA 5IGEA 1VMCA 2PPBC 2D2CC 1KNAA 2O5IC 5E3FA 1RD9D 3TP6A 2RKSA 3MC0B 1RJTA 5COYA 2F0JA 2XN9C 1PRTB 1KTKA 4B08A 1OXVA 5KEEA 3K58A 3IL8A 1O7LA 1K8OA 3VR6A 1FR3A 3BYYB 3HOWB 1LACA 2VXWA 2L9HA 1TU2B 4ABNA 2GA4B 4J1MA 3MAQA 1VCIA 3M3YB 2LKVA 1VF7A 2H4OA 4A3IB 4OO1G 1GUNA 1GUWA 3RZDB 1LTTD 1S5CD 2VB3X 5CBEE 1PTOH 2RVLA 4E6IA 3OPOA 1PFMA 1Y8OB 4ZUIA 1PTOD 2JXMB 3D8GA 4H0LC 1SEBD 1GUOA 2OXPA 1SFOB 3EFXD 4OGQC 5DM73 1I6HB 2IW3A 2F0DA 1JOQA 5ELBA 2F0OA 2JA8B 4Z9CB 5NUCA 2N88A 5IODA 2EYFA 4RHSA 1SDFA 1SNQA 1EYDA 2NUCA 4K2KA 3J81L 5C44B 1I4PA 3NE5B 1TY0A 4IZ8A 1II3A 3X3NA 4FXDA 1JWMD 4PV1C 2V4DA 1SNOA 3LX0A 3ZYYX 5D3IB 1ZEQX 1NR2A 3A8IE 1DCZA 2D9UA 4IURA 2IJ0A 1WD0A 1DOKA 3QOJA 1J9OA 5I4DA 3SXHA 1LTRD 2EYMA 1SSOA 2F3WA 1Y69U 4QUFA 2F0VA 3KLSA 4FVMA 3H94A 2I07B 4DA2A 1ZXTA 4IUPA 1B4OA 1SYCA 3RZOB 1D5MC 1EQVA 2BA0A 3SHLA 2KQ3A 1EIHA 5EBDA 1Y1VB 3CRKC 2B2WC 2K5WA 1S4ZA 3TP5A 3JAML 1B50A 4KD3A 3NBIA 1MSHA 1YNND 1OXXK 2K32A 2H1EA 5LHY1 1W6JA 2F0KA 1JCKB 3K59A 1FNVA 4A3GB 2FFKB 3ITPA 4CGYB 3CQZB 2EY5A 1B1ZA 3S15B 2IT1A 1MBYA 4DF7A 3K57A 1D5ZC 4FF3A 2RBMA 2RDGA 5KYIA 1E2VA 4KHZA 2F03A 1G6ZA 1MGSA 4NP5A 1HCZA 1I4HA 1EWHA 4RAUC 3MXNA 3NQTA 4I65A 2EJGC 3SDZA 3FVQA 1BF4A 1JC7A 1ENFA 1R9TB 5C3EB 1AZQA 2B2WA 3BS1A 2O5JC 4IUTA 2AUJD 2IX1A 3BVGA 1F9PA 2NN6G 1ZYRD 2A5HA 4DAVA 3T56B 2PZWA 3J81E 4RWSC 4LK1C 4R9WA 4XQQA 2E75C 2L0CA 3BDCA 3D4DA 4WRDA 1HFNA 2EVBA 1ENCA 3HG9A 1IYUA 4RKBA 5C5MA 1OXSC 1JWUD 1CHPD 1G291 4IFDH 1Z47A 5I6WA 1PFNA 1AP0A 4CJ1B 1SYEA 2MUYA 4M8AA 2QEJC 2KEDA 4X3KA 1SE2A 2SEBD 1U4PA 3I72A 5FK9C 2DNCA 3QG1A 3A8JE 1I6VC 1SNMA 4C56C 2FHTA 2HCIA 3K5NA 4A3MB 5C3WA 3FPUB 2KOLA 3MVVA 4XIGS 1F2YA 3KUPA 2QKIC 2K6AA 1CZGA 1SNDA 4ZKBB 4RGMA 1ONLA 3K6OA 4KY7A 4NMZA 2SNMA 2K1BA 3K0YA 4TRDA 2LY7A 1PYWD 2PCFB 1RKNA 4XYQA 1ESFA 2JA6B 4IFDI 2N55A 1DOLA 2B63B 3PUZA 2A6EC 2F0GA 2VNUD 3GQBA 3SK4A 2FJ2A 1WTXA 4FF1A 1PRTD 1EFID 1JB3A 4DFAA 1LT3D 3S1RB 2EYLA 2NZ1D 2B8GA 3J7AV 3TN2A 2K28A 5JVG3 1SMYC 4QUCA 3HOVB 4A3DB 3P1HA 2KECA 4KMUC 1GXDC 4ZYSA 1TWCB 4HCSA 2ICIA 1BXTA 2BOSA 2JEBI 1RCVD 2JYOA 1PTOF 2A6HD 3IFTA 2F4IA 4A3BB 2NTSA 2A68C 1EY4A 1DYQA 5C4XB 3PO3B 1ET6A 1HPCA 1B9MA 4OO1H 2WAQB 5M5YB 2F0EA 1QWYA 1HTLD 3I91A 2BDOA 5I6YA 2WB1B 5IOCA 3D31A 1SJED 1GOZA 1KNEA 2EYHA 2CQAA 2L5TA 2YYZA 1KLGD 3NUCA 3K5MA 2CW0C 3L3OC 1WD1A 5JEAH 1BR9A 4ULLA 4B9WA 2EDGA 2FMCA 1L0XB 2KCCA 1TWFB 1R4PB 2F0HA 3MA2B 1CHQD 2B2VC 4F87A 1G2SA 1SE4A 1WTWA 1TS2A 1LTGD 4OO1I 1A3TA 4HN7A 4J6HA 3HEJA 3OW7A 1MI2A 2HQEA 1Y8NB 2KCNA 3I73A 2A69C 5HGTA 2LS01 3RLFA 5TSSA 1QNUA 4CJ2C 5BN4A 1S5BD 2B2UC 1NSNS 4LMQD 5K36H 3W2DA 2PZTA 1RF2D 4QB4A 2R61A 1X3PA 3FRPB 2IX0A 4C3JG 4R8IA 1BOSA 3J80E 3N6RA 5KNDA 4DK1A 2B2VA 3VYRA 1G8ZD 4KV6A 3KBXA 3D4RA 3TBIB 1OXUA 1PDQA 3GV6A 4CBVA 3PUYA 5KIXA 5EQ0A 1Q90A 1SYGA 5ELEA 1H9MA 1V43A 1EY0A 2F0IA 1TS3A 1KDAA 2LFNA 3H6MA 3DEPA 2ID0A 2K04A 2B2UA 1EEFD 2L4NA 1F9SA 3MWYW 2XVSA 3NQIA 4C1NK 4RCNA 2YU9B 3WOEA 1JORA 1F9RA 3NK9A 3TZDA 3DHQA 2M9VA 2Q8TA 3Q6SA 2IL8A 3Q0AA 4HSPA 2ZT9C 4U68A 4K2LA 1XWEA 2EYPA 5EPJA 4F8MA 1FNUA 5EKIA 2NN6H 5KRUA 3TDQA 4EGVA 1IKLA 3SVMA 1EWCA 4CKBA 4K6LA 4C2MB 4IUVA 5T1GA 2A74C 2LMCB 3GTGB 1IHZA 4BY1B 4FNFA 4WORA 1RHPA 3D6CA 4C3IG 1GUSA 1BCPD 1T5XD 2J0TD 4BY7B 3OIQA 4KI0A 5ELDA 1MD2D 4K14A 4C1NI 1I3QB 3KLRA 4XT1B 3NXWA 3HKZB 2TMPA 1HA6A 4XQJA 4JK1C 5FO7B 3S1NB 4G7HC 4C3IB 4BBRB 2EXZA 1BQQT 2L12A 1U4LA 5CV4A 3KBGA 1H9RA 4RGNA 3D6WA 1Q8IA 2NN6I 3PMFA 3C1EA 2DY8A 3IFDA 4DK0A 1SAPA 3T51B 1Z7TA 3P7JA 2F0QA 2PO4A 3G7LA 1HTPA 3P75A 1J8IA 2RA4A 3R2TA 4H44C 2JA5B 1UEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJZ A;  2L4N A;  1LV9 A;  4R9W A;  4X3T A;  1F9S A;  3MWY W;  2HDM A;  4QUF A;  5DNF A;  1QE6 A;  1CM9 A;  1JIC A;  1M8A A;  1F9R A;  2NZ1 D;  1TVX A;  2XIW A;  1ZXT A;  2EPB A;  4IUP A;  3TZD A;  1B4O A;  2Q8R E;  2B2V C;  1A15 A;  4UAI A;  2K28 A;  3TN2 A;  1HFN A;  1ML0 D;  4XT3 B;  1G2S A;  1O80 A;  4QUC A;  3Q6S A;  2Q8T A;  1DZ1 A;  1X3Q A;  2X6L A;  2IL8 A;  1WTW A;  1NR4 A;  4OIK A;  4O42 A;  3HP3 A;  2SDF A;  4U68 A;  5E4W C;  2MP1 A;  4IUQ A;  5CMD A;  2KEC A;  1ICW A;  2X69 A;  5EPJ A;  1Q3L A;  1QG7 A;  2X6G A;  1EIH A;  1WTR A;  5D14 A;  1PFN A;  2MPM A;  5EKI A;  1MI2 A;  2B2W C;  4HCS A;  5D65 A;  1AP0 A;  2B2Y A;  1S4Z A;  2K05 A;  3MTS A;  1XX8 A;  4IUU A;  4CJ1 B;  1GUW A;  2HUG A;  1IKL A;  3SVM A;  2KEE A;  5CBE E;  1B50 A;  2MGS A;  4ZLT F;  2KED A;  1F2L A;  4X3K A;  1MSH A;  2L11 A;  2RVL A;  1AZP A;  1U4P A;  1PFM A;  5E4X A;  2RSO A;  1HRJ A;  1EOT A;  1VMP A;  4HAE A;  4IUV A;  1O7Y A;  2H1E A;  1RTO A;  5T1G A;  1DON A;  1NAP A;  2FMM A;  1HHV A;  1JE4 A;  4CJ2 C;  2NYZ D;  2FIN B;  2KUM A;  3UI2 A;  5CBA E;  2B2U C;  3I8Z A;  2JYO A;  4HSV A;  2FHT A;  1RHP A;  4HED A;  4LMQ D;  4XDX A;  2HCI A;  1WTP A;  2MJ8 A;  2FFK B;  5AFW A;  2CVR A;  2R3Z A;  2DY7 A;  1G91 A;  3FPU B;  2KOL A;  4ZAI A;  1C8C A;  2HCC A;  3N52 A;  5COR A;  5EPK A;  2N88 A;  4ZKC B;  1B2T A;  3KUP A;  3DEO A;  1IKM A;  5EJW A;  1X3P A;  3GV3 A;  1WTO A;  1ESR A;  2B2T A;  2JP1 A;  2RSN A;  3I3C A;  3R93 A;  4R8I A;  1WTV A;  1WTQ A;  1SDF A;  4ZKB B;  3FDT A;  1X32 A;  2EE1 A;  1HUM A;  4NW2 A;  4XT1 B;  1PLF A;  4MN3 A;  1HA6 A;  2B2V A;  1HUN A;  1EQT A;  1MSG A;  1VMC A;  2BDN A;  2EOT A;  2K1B A;  4DN4 M;  1EIG A;  3I91 A;  1EL0 A;  1MGS A;  4X3U A;  1O7Z A;  1IL8 A;  2B2Y C;  1G6Z A;  1KNA A;  4RAU C;  1BF4 A;  3KBX A;  1B53 A;  1WVL A;  2K03 A;  3I90 A;  3DM1 A;  2L12 A;  2KVM A;  5EPL A;  1KNE A;  1RJT A;  1U4L A;  5COY A;  1DOM A;  1BBX C;  1PDQ A;  1AZQ A;  2B2W A;  1B3A A;  3GV6 A;  1CA5 A;  2N55 A;  1DOL A;  1U4R A;  2K01 A;  1BNZ A;  1CA6 A;  2J7Z A;  2NWG A;  3D6W A;  3F2U A;  3H91 A;  1ILQ A;  1RTN A;  4IUT A;  4ZK9 B;  1ILP A;  2M2L A;  3LWE A;  2DY8 A;  3IFD A;  1NR2 A;  3QO2 A;  1ROD A;  1NCV A;  1SAP A;  3IL8 A;  4X3S A;  5EQ0 A;  1U4M A;  2D9U A;  1BO0 A;  2HDL A;  1E0B A;  1F9P A;  3P7J A;  1PFB A;  4IUR A;  1XYI A;  1WD0 A;  1WD1 A;  1DOK A;  2FJ2 A;  3G7L A;  1J9O A;  4MHE A;  4OIJ A;  1HFG A;  1J8I A;  3DEP A;  4RA8 A;  1WTX A;  2K04 A;  1F9Q A;  2L1B A;  2B2U A;  4RWS C;  2RA4 A;  5T1I A;  1G2T A;  2VXW A;  3ONA B;  1SSO A;  2L9H A;  4CJ0 B;  2B2T C;  1QNK A; 
#chains in the Genus database with same CATH topology
 1SYF A;  2QDB A;  1RL2 A;  3TRZ A;  2A73 B;  3S2H B;  2AQ2 B;  4JC0 A;  5GAD C;  1I94 L;  1PXU A;  1GVP A;  4FDB A;  3TSS A;  3KYH C;  2Z4I A;  4S3S A;  5M5X H;  1I94 Q;  5IGB A;  3MEH A;  3R2I A;  2AWN A;  4DAM A;  5CMD A;  5LMU L;  4QF4 A;  3S1R H;  4YWM A;  2VS1 A;  1ASZ A;  3I4M G;  3VR2 A;  5CR3 A;  1H9K A;  3DWA A;  2PMZ B;  5IYB H;  1M1K C;  1XX8 A;  1B3Q A;  3CCR A;  4XTC S;  1FYC A;  3EVQ A;  3T16 A;  1VQ4 A;  4CDE C;  4A3D H;  3HS0 C;  3NP8 A;  3T4A C;  5J1Z A;  5M5W B;  1TWC H;  1XNQ L;  1VQ5 A;  1DON A;  2VB2 X;  4LFC Q;  2EJM A;  3I4M B;  1XNQ Q;  4LF7 L;  4AH6 A;  3CCU A;  2MJ8 A;  3W5O A;  2UUB L;  4K6D A;  4K0K L;  2KA7 A;  4LF7 Q;  1PZJ D;  2UUB Q;  3DEO A;  4K0K Q;  2BE5 D;  2F0L A;  2OTJ A;  4HIK A;  1UE6 A;  4MN3 A;  4JVZ A;  1FNW A;  1VQE A;  4HMJ A;  4DV3 L;  1HR0 L;  2PNR C;  1C7Y A;  2SOB A;  1STB A;  1XTC D;  4KN7 C;  4XQN A;  4X3U A;  1IL8 A;  3IKJ A;  3OMC A;  4DV3 Q;  1HR0 Q;  3PF4 A;  3S1Q B;  1LTI D;  3S17 B;  1HZC A;  5M5Y H;  2K50 A;  1Y8P B;  1JJ2 A;  1YNJ D;  1D5X C;  4DV0 L;  3F2U A;  1B7Y B;  5IGC A;  1BVS A;  1DXM A;  5EGT A;  1D2B A;  5IWA L;  5EBC A;  4QY7 A;  4BA1 I;  5CGK A;  5IE8 A;  1Q1E A;  1Q12 A;  1SXT A;  3GTJ H;  2R93 G;  3QB3 A;  5IWA Q;  3H3V C;  4KY6 A;  5JPM C;  3EIV A;  1EU4 A;  4NXM L;  1YZ6 A;  3ONA B;  5JOB A;  3BDO A;  2ICE C;  3HKS A;  2K33 A;  5JJZ A;  3HGB A;  3HOU G;  3GTO B;  4OWX B;  2OCE A;  2IHE A;  5KNC A;  4HJ7 A;  5C5L A;  3A7L A;  2K5H A;  3CAM A;  1HQM C;  4XT3 B;  2O2L D;  1PTO C;  3AMU A;  1STG A;  4OIK A;  2R93 B;  1DM0 B;  1CSQ A;  2K52 A;  2CQO A;  3PIO 3;  3T1H L;  4L5R C;  1IBM L;  2H5X A;  3QOL A;  1TWA B;  3MXN B;  4JI3 L;  1YHQ A;  3T1H Q;  1F2M A;  3HOU B;  1IBM Q;  4G4K A;  3PUW A;  4J8Q A;  4JI3 Q;  1LLR D;  3M85 A;  4QCL A;  4ZLT F;  1LO5 D;  1U9R A;  2MO1 A;  4DXF A;  1MKH A;  4ME5 A;  1VMP A;  4ZRZ A;  2C9O A;  4B9X A;  1HHV A;  1NAP A;  3JAM i;  3U9O A;  1JJG A;  3P20 A;  5AFW A;  2R3Z A;  2UUA L;  4GLV B;  1T5E A;  2F3V A;  4JPB W;  1CKM A;  5BN5 A;  1EY5 A;  4DGZ A;  2UUA Q;  1D6E C;  3KF8 A;  1MHW C;  5CV8 A;  2G9D A;  4PMB A;  4H13 C;  5L37 A;  3S9W A;  1WYD A;  4R4C A;  1FD7 D;  2E8G A;  1HR0 W;  5GRO A;  5G3L F;  4QJF A;  1AE2 A;  3Q8D A;  3QR8 A;  3OIP A;  4LAA A;  1D1I A;  4DAY A;  2NVX H;  1VQL A;  2E2J B;  1S5F D;  1VQJ A;  2NZH A;  2N8N A;  1X6O A;  1GUG A;  1SRO A;  4PMC A;  3W3A A;  3TP7 A;  1WFQ A;  4J15 A;  4A3K H;  1DOM A;  1EIY B;  2MNA A;  2F0T A;  2K01 A;  4APV A;  4JI5 L;  2LXJ A;  4LUO A;  4KJN A;  2EY1 A;  3CCS A;  3MXG A;  2AQ1 B;  1TT2 A;  3ERO A;  3NWS A;  4JI5 Q;  1XYI A;  4C3J H;  1EY6 A;  3S14 H;  1K83 H;  1BDO A;  4RA8 A;  5C0X J;  1A0I A;  3M7N A;  3EJI A;  4IUN A;  1QCB D;  2I46 A;  4CJ0 B;  5LL6 X;  2B8F A;  3DUZ A;  2Y0S E;  3CPW A;  2WII B;  2XIW A;  2CWP A;  2BH2 A;  2HQL A;  2X6L A;  1AEX A;  2Z0S A;  4DU9 A;  5IIF A;  3M4O B;  3DXJ C;  4O42 A;  1J5E L;  2DJG C;  3TME A;  3F2C A;  1J5E Q;  3HRZ C;  3HOV G;  4P71 A;  4LF4 L;  5IYC H;  2JQO A;  2IPK D;  1IW7 D;  4KJO A;  3HOZ G;  2A69 D;  4DAP A;  5AJ3 L;  1F2L A;  3Q22 A;  4LF4 Q;  1AZP A;  4Y7N B;  3J7Y W;  4GKJ L;  3GTK B;  3GTQ B;  4EVO A;  5AJ3 Q;  2NVT B;  4TSS A;  4DR2 L;  1CKO A;  4GKJ Q;  2Z8L A;  4JBW A;  1PH8 A;  3SR1 A;  4DR2 Q;  4HSV A;  5I2Y A;  1B9N A;  2WKC A;  4GOP C;  1K28 A;  4ZAI A;  3Q23 A;  1XPO A;  1V1P A;  3CMA A;  3HOZ B;  3CCQ A;  2K5V A;  3VA5 A;  5CV5 A;  4HIM A;  2NVQ B;  5K5P A;  3J80 L;  4A3B G;  5DEH A;  1R4Q B;  2Z1C A;  4FXG C;  3SK8 A;  5ELO A;  3R93 A;  3TQY A;  3PO3 G;  3T53 B;  1BCP F;  1U5K A;  1X32 A;  1KLU D;  1X3E A;  2QDL A;  2WKD A;  2K7V A;  1JWS D;  5J39 A;  1XMQ L;  3E9I A;  2XWB B;  5FJ8 G;  4BY7 H;  1ZYR C;  2F0N A;  2NB0 A;  1XMQ Q;  3I4N G;  3I70 A;  5DM6 3;  1B53 A;  1I3Q H;  3CRL C;  4K5V A;  1VDZ A;  1YIJ A;  1Y1W G;  4GLA C;  1JE5 A;  1B3A A;  2R7F A;  1W2B A;  1CA6 A;  4DV5 Q;  1SFO H;  4G7Z C;  1ILQ A;  1F77 A;  1RTN A;  3TRE A;  3QO2 A;  3VR5 A;  4BBR H;  4X3S A;  2ZM6 L;  1FJG L;  3KFU A;  1E0B A;  2K75 A;  4L8J A;  1EZ6 A;  3NBH A;  5JJK A;  3QWN A;  1W6K A;  2BA1 A;  2F0S A;  3GTP B;  3I4N B;  2ZXP A;  3V05 A;  2WV6 D;  4LF8 L;  5FKA C;  1HZB A;  2EJF C;  1Y1W B;  1V1Q A;  3QJY A;  1UNS A;  4IPG A;  2RQX A;  5A2Q E;  4LF8 Q;  4GOP A;  4X3T A;  2VW9 A;  1QE6 A;  4FF4 A;  4QMG A;  4MZ9 A;  4FO2 A;  3NBH B;  4RGO S;  1X3Q A;  3NHH A;  2JA5 H;  3R8B A;  3HP3 A;  3S2H H;  3RMH A;  4ID6 A;  2X6G A;  3OWF A;  4XXE A;  5D14 A;  2MPM A;  3FKI G;  4GOP B;  5D65 A;  1O78 A;  1VQA A;  2K05 A;  1NMF A;  4IUU A;  1UE1 A;  2ZJR A;  3E9H A;  5C0X G;  4A3E G;  1Z6H A;  2N78 A;  3MXU A;  2MGS A;  5D3D A;  4A3F G;  1J6Q A;  3M4Y A;  1TII D;  2F0M A;  2Y0S G;  2EZV A;  4JI6 L;  3PF5 A;  3Q24 A;  3I4L A;  1SLJ A;  2I5H A;  1E7Z A;  4ZQ3 A;  4JI6 Q;  3MZ5 A;  1JE4 A;  4K8J A;  3AB9 A;  1X9N A;  1I4R A;  4K5W A;  4HCE A;  1XPR A;  3FKI B;  2D62 A;  1PYS B;  3MXP A;  2DNE A;  1C8C A;  2XRQ D;  2HT1 A;  4A3E B;  3N52 A;  2CH4 W;  4R4Q A;  1ENA A;  5KYL A;  5M5W H;  4ZKC B;  4A3F B;  2Y0S B;  1LAB A;  5E1F A;  4YCV A;  1ESR A;  4KHV A;  5E7N A;  1SYD A;  3I4M H;  3IAY A;  5DAU A;  5LL6 S;  1PLF A;  3SK5 A;  1Y1V H;  4KK7 A;  3J81 j;  4X65 L;  3L7Z C;  3DLL A;  4Q0F A;  2R7D A;  4WFN 3;  4I7A A;  1CTM A;  1AN8 A;  3MFG A;  2K03 A;  3I90 A;  2DGY A;  1VQP A;  2ZTD A;  1EY9 A;  1PV4 A;  4OHJ A;  1EY7 A;  3L2P A;  2WAC A;  1VQC A;  1RDP D;  4GN5 A;  3G71 A;  2J7Z A;  2EQS A;  2SNS A;  1A2T A;  1YIT A;  1ROD A;  1GUT A;  1VQK A;  3NSW A;  4A3G H;  3S1Q H;  3ERQ A;  1QIL A;  4AYB E;  3PIP A;  1TKW B;  2BH8 A;  2E76 C;  3CQZ H;  3RUZ A;  5J22 A;  1Y14 B;  5JPN C;  1EQR A;  3BVZ A;  4JI0 L;  3K5L A;  3S15 H;  3D4W A;  5C4J B;  1F9Q A;  3S2D B;  4JI0 Q;  1Q8K A;  3GTM B;  5DNF A;  3QIA A;  5IGF A;  4JYA Q;  1Q82 C;  1XTD A;  2MO0 A;  2PZU A;  1A15 A;  3DWP A;  4GS3 A;  1CSP A;  2XTI A;  1HNZ L;  1TQO A;  2HHH Q;  1R9T H;  3GTO H;  2X69 A;  5C3E H;  1I50 B;  3J7A 5;  4DR6 L;  3A74 A;  4CKE A;  1EYG A;  4JW0 A;  1PZK D;  4DR6 Q;  4CKC A;  5FOB B;  2KEE A;  2R93 H;  1EOV A;  2B39 A;  3DM3 A;  1KAB A;  3AQQ A;  2Q2I A;  3K80 C;  5E4X A;  1TWA H;  2KEN A;  4K5X A;  3CU7 A;  5M3F G;  4HR7 B;  3GD7 A;  3HOU H;  2ENB A;  3BYT B;  3GP7 A;  4N9P A;  3VYS A;  3I8Z A;  1XXG A;  4P73 A;  2YV5 A;  3VR4 A;  4OEL B;  4NDX A;  3FPP A;  4L6T B;  2PW7 A;  3E6Z X;  1VQN A;  3FP9 A;  4X64 Q;  1EEI D;  5M3F B;  3E0E A;  3NEL A;  3PO2 G;  1WTQ A;  4HIO A;  4P2C B;  5KGU A;  5F2D A;  3FDT A;  1VF5 C;  3BZD B;  1KDB A;  3J7Z C;  4GNX C;  1EQT A;  1NBW A;  3BZC A;  2B2Y C;  4OWT B;  2UU9 L;  5M9O A;  1WVL A;  5I2X A;  3PUV A;  3DM1 A;  2L55 A;  4I7Z C;  2MHV A;  4IAL A;  1K9M C;  1UE5 A;  3PO2 B;  2UU9 Q;  2E2J H;  4DV7 L;  5CC4 A;  4YIJ A;  1QJO A;  1AFP A;  2M2L A;  1NY4 A;  2XWJ B;  2EIF A;  3H3V H;  2QGQ A;  4PZ8 A;  1BO0 A;  2HDL A;  5FO8 B;  3OOC A;  4BA2 I;  2C35 B;  4OIJ A;  4UP9 A;  3LNN A;  1PA6 A;  5CV9 A;  1DGS A;  3KOJ A;  4DV4 Q;  2JA7 G;  5T1I A;  4ZUJ A;  2NVY B;  3DMU A;  1STH A;  3A56 A;  1CZW A;  2VUM G;  4Q5V A;  1WCM B;  5FLX L;  2QEX A;  1YHB A;  2Z4H A;  3K7U C;  1YHA A;  2EPB A;  1STE A;  3EQL C;  2EYO A;  1PMR A;  4DV6 L;  1MJC A;  4RCO A;  3PV0 A;  4V0B A;  5HGQ A;  2JA7 B;  1LYL A;  3OYY A;  4X66 L;  4GNX A;  2XSC A;  1A6X A;  2Z9H A;  2VUM B;  3VDY A;  4JI8 L;  2Q2T A;  4X66 Q;  2B2Y A;  2R92 G;  1L0Y B;  2HUG A;  1V1O A;  2PNH A;  3TZU A;  3M4O H;  3HZX A;  4JI8 Q;  3I56 A;  1KDC A;  1K8M A;  5IT9 L;  1N33 L;  5JEA G;  1PZI D;  1GD7 A;  3BDL A;  1QVF A;  1PRT F;  1VS0 A;  1HRJ A;  4PQX A;  5CV6 A;  2E2H B;  2I5M X;  1LTS D;  4LF6 L;  1N8R C;  1EU3 A;  1CQF A;  4AYB B;  4GNX B;  2F4V L;  2BCO A;  3UI2 A;  1LTA D;  2PQE A;  4LF6 Q;  3U50 C;  1HJP A;  4DNI A;  3H3V I;  5ELC A;  4P75 A;  4Y7N H;  2F4V Q;  3FMC A;  2F0P A;  4DK6 C;  2R92 B;  1OO9 B;  3DWQ A;  3GTQ H;  5COR A;  2EY2 A;  2NVT H;  5LMU Q;  1VQ7 A;  1B2T A;  4BBS G;  3ZJY C;  4IOA A;  3S1M B;  3GV3 A;  4IN3 A;  5GAH C;  1PYB A;  3MFY A;  2TSS A;  3HOV H;  1ET9 A;  1I4Q A;  1QB5 D;  1SE3 A;  4RKL A;  1STY A;  3BVM A;  4NW2 A;  3BJU A;  3KLS X;  3HOZ H;  3NTK A;  1VQM A;  1KD1 C;  1LT4 D;  4JBJ A;  4HTH A;  1HUN A;  2NVQ H;  1MSG A;  4QIW B;  1JR0 D;  1EL0 A;  2F1M A;  5IP7 G;  3PGZ A;  2Q8I B;  1O7I A;  2YTX A;  4BBS B;  1CUK A;  2PW5 A;  5ELF A;  3E5S A;  1BBX C;  4X6A H;  4R8N A;  1E1T A;  4ZCK A;  1SE8 A;  1BNZ A;  1B44 D;  3A7A B;  5K36 G;  5FO9 B;  4A3B H;  5IGD A;  4YHH L;  2OT2 A;  2RF4 A;  5C4X H;  4R4O A;  3CCL A;  2NTT A;  4TKO B;  3J7A F;  3PO3 H;  1KXL A;  3OWE B;  4UY8 C;  1HFG A;  2PQA A;  4YHH Q;  5FLX c;  4WJW A;  3W1B A;  4FXK C;  1G2T A;  1H9J A;  4O1N A;  1QNK A;  4EQN A;  5FJ8 H;  3UDF A;  2Q2U A;  1LV9 A;  2HDM A;  3TP8 A;  3J81 i;  2A6E D;  2KHI A;  2KHS A;  1M8A A;  1JOO A;  4DNR B;  3GTP H;  3I4N H;  2JK8 A;  4A93 G;  4UAI A;  1S5D D;  1A2U A;  3H09 A;  3SE0 A;  2KJX A;  1Y1W H;  4K8I A;  2HIV A;  3PSI A;  4DV0 Q;  4PMW A;  1ASY A;  1CT1 D;  2PQA B;  3NWT A;  2F0F A;  1LTB D;  5IT9 c;  1P8L A;  4NPS A;  4OL7 A;  4CDC C;  2RCF A;  4EX5 A;  3MTS A;  3X3M A;  4KTA A;  1K0R A;  4DUY L;  4GZY C;  1STN A;  1BCP C;  4QGU A;  3SK6 A;  2IX3 A;  4A93 B;  4NXM Q;  1TS5 A;  1ICF B;  1SMY D;  2Z6B A;  2RSO A;  4HAE A;  4DUZ L;  5FLX E;  1TWG B;  1I4X A;  3D3R A;  1CFM A;  2FMM A;  5I9P A;  1K8A C;  2NYZ D;  4DUZ Q;  3FHW A;  1TWF H;  2XNA C;  1M4V A;  3CHB D;  2E2I B;  5C3X A;  3NPP A;  2CVR A;  1G91 A;  2RDH A;  1S5E D;  1N32 L;  4C3H G;  2JSO A;  5EKK A;  1TR5 A;  4JBM A;  3AYH B;  1N32 Q;  1WTV A;  1JQY D;  2JEA I;  1VQO A;  3FKI H;  1E2W A;  1VQH A;  2EE1 A;  3HOY G;  5IT9 E;  1XMO L;  1K3B C;  5C0X H;  4A3E H;  4BXX G;  4Y52 H;  4KY5 A;  4JBK A;  1D1K A;  3C1F A;  3A54 A;  4A3F H;  1CQV A;  2EOT A;  2BDN A;  1Q86 C;  3CPF A;  3AFP A;  4BWG B;  1XMO Q;  2XRS D;  3T13 A;  1O7Z A;  4C3H B;  1LUZ A;  2A68 D;  1GHK A;  2K14 A;  4NXN L;  4B3S L;  4OXP A;  2Q2H A;  2EXD A;  4FP5 D;  2QCP X;  4B3S Q;  1K8G A;  4H7B A;  3S16 B;  3HOY B;  3RNU A;  1JOK A;  3BG3 A;  1HQR D;  3OTO L;  4MIU A;  2AQ3 B;  3UDG A;  3L9A X;  2JE6 I;  1TWH B;  4LNQ A;  1LT6 D;  3OTO Q;  3JAM c;  2R6G A;  4ODG A;  4FYD A;  5A2Q L;  1L1O C;  2OEO A;  3MHB A;  1A3V A;  4LF5 L;  1M90 C;  1OXT A;  5CV7 A;  3KF8 B;  3G48 A;  2NZO A;  4LF5 Q;  1BCP B;  2QF7 A;  4G57 A;  4A3J B;  2F0U A;  4L63 B;  4IO9 A;  1E22 A;  1K3R A;  3B6Y A;  4DAY B;  4X62 L;  3V2T A;  1HXY D;  2CW0 D;  1PTO B;  2SDF A;  3OSO A;  4LF9 L;  1HH2 P;  2MP1 A;  4IUQ A;  3GTM H;  1WI5 A;  1QG7 A;  3C3L A;  2K4K A;  5C0X I;  5FLM G;  1KC8 C;  4LF9 Q;  4UP8 A;  1D8L A;  4OWW B;  4MTN A;  1KAW A;  2VQF L;  1HZA A;  2L11 A;  1Q1B A;  4IJH A;  5HUR A;  1SBB B;  5C4H A;  5BN3 A;  3JAM E;  2BE5 C;  3VYT A;  1QZG A;  4PNY A;  1I50 H;  3AFQ A;  2ES2 A;  3AU7 A;  2VQF Q;  1Q46 A;  1YNN C;  4G7O C;  2UUC L;  5CBA E;  2KUM A;  1B8A A;  1KIX A;  1VQB A;  2E74 C;  3VR3 A;  1WTP A;  2UUC Q;  2YU9 H;  2DY7 A;  2RHS B;  2HCC A;  1CI3 M;  4IPC A;  3A5U A;  1GHJ A;  5IY0 A;  3LWU A;  1L1O A;  4IFD J;  3VA7 A;  1IKM A;  1I5F A;  5A35 A;  1WTO A;  1I4G A;  2RSN A;  1YNJ C;  1VQ8 A;  1HNX L;  3STB D;  4POG A;  1KL9 A;  4LW1 A;  5I9O A;  3RD4 A;  2WIN B;  4KD4 A;  5IYB G;  3IRB A;  1X3G A;  2EYJ A;  3KJP A;  4DR7 L;  4NKL A;  2G9H D;  4DN4 M;  5M5X B;  1EIG A;  5ELN A;  3GO5 A;  5M3F H;  4EQO A;  1L1O B;  4UDU C;  1WOC A;  3RR5 A;  3NTI A;  4C2M H;  2KVM A;  2ZJQ A;  3VYU A;  5CYU A;  1EYC A;  4N9T A;  3GTG H;  4YCW A;  4RFB A;  4BY1 H;  2UXD L;  1PVO A;  3H91 A;  1ILP A;  1BUV T;  3LWE A;  2AKW B;  2RDF A;  1BBW A;  1TS4 A;  1NCV A;  2F52 A;  2AUK A;  1CK1 A;  4LJZ C;  1PHJ A;  2F0W A;  3C46 A;  4F7X A;  1UAP A;  4V19 0;  1YBY A;  5C4Z A;  3A8K E;  3EA6 A;  2K5D A;  4RH6 A;  1STA A;  2HD3 A;  1V1P B;  2L1B A;  1X56 A;  1MIU A;  1U0L A;  1GKH A;  1SMX A;  3CW2 C;  4EQP A;  1CM9 A;  2E2D C;  2V1C C;  2CHB D;  5BR8 L;  3S1N H;  1A3U A;  1SNP A;  3I55 A;  4IQZ A;  1ML0 D;  4DV2 L;  4C3I H;  1O80 A;  1L0W A;  2NVY H;  5BR8 Q;  3OMG A;  4U67 3;  1LT5 D;  5EKL A;  2KHJ A;  3ND8 A;  5E4W C;  5C6A A;  4DV2 Q;  3NEN A;  3R3O A;  2GVB A;  2ZM6 Q;  1Q3L A;  2D5D A;  4XYO A;  1FJG Q;  2EY6 A;  1WTR A;  1PH4 A;  1JMC A;  4BS9 A;  3TS2 A;  1XJV A;  1V8Q A;  1YJW A;  4ILW A;  1H9S A;  3WDN A;  4R4T A;  2D0O A;  5JAV A;  3KK7 A;  2PYK A;  1E2Z A;  1EOT A;  4KN4 C;  1VQ6 A;  1O7Y A;  1RTO A;  4KKS A;  3WOF A;  1RIP A;  4H02 A;  2ASB A;  2FIN B;  3EBE A;  5LMN L;  3FEW X;  2K5N A;  4HID A;  4WJ4 A;  1EZ8 A;  2WP8 J;  5JVH 3;  1H9S B;  3U9S A;  5LMN Q;  2OF1 A;  4HMI A;  4M1U B;  3E0J A;  3H0G G;  4JOI A;  3GTJ B;  1QOH A;  1ZKO A;  2QIL A;  4RGT A;  5M3M G;  2JP1 A;  3OHX C;  1F2Z A;  2GN5 A;  3TS0 A;  4KKU A;  1HUM A;  3ND9 A;  1X55 A;  4IOC A;  3J80 i;  1TY2 A;  2ZXR A;  4JCV E;  4HJ9 A;  3H0G B;  1C48 A;  1EYA A;  2KCM A;  1IL2 A;  5EPL A;  5M3M B;  4CHT B;  3UDI A;  2J4X A;  1CA5 A;  1U4R A;  2N3S A;  2NWG A;  2AHO B;  4RHR A;  4F88 A;  4MNO A;  1KAA A;  4ZK9 B;  4GKK L;  4IFD G;  3PIP 3;  4L5Q A;  4DXG A;  1U4M A;  2VQE L;  3HKZ E;  3K5O A;  1PFB A;  1AW7 A;  1EY8 A;  2QA4 A;  4FF2 A;  4GKK Q;  1NUC A;  4MHE A;  3NTH A;  3SEB A;  1L2F A;  2VQE Q;  3G6J B;  2IWH A;  2M00 A;  4X65 Q;  1FVI A;  2B2T C;  1IYV A;  1DD2 A;  1PRT C;  1IW7 C;  1JIC A;  5IP7 H;  5HY6 A;  4DNT B;  2ZXO A;  3CCE A;  1LTL A;  1TVX A;  2R7Z G;  3BZK A;  1UUP A;  2Q8R E;  1SYB A;  2I5L X;  5IGG A;  3V96 A;  1DZ1 A;  1NR4 A;  3GTL B;  3S17 H;  3O13 A;  4A3K G;  1C9O A;  1YEZ A;  3I4O A;  4B3T L;  1ICW A;  5GQO A;  3URY A;  2O4X A;  2NVX B;  4B3T Q;  5JEA J;  1HA5 A;  3UE1 A;  4ALP A;  1VQG A;  4R1J A;  1C4Q A;  4B3R L;  5G3L D;  2R7Z B;  1YVC A;  1QVC A;  3PUX A;  1JB7 A;  2DUD A;  1PH7 A;  3HOX G;  3CCM A;  4TQU S;  4A3K B;  1A62 A;  5LMN W;  4GLX A;  2OWO A;  2GVA A;  4O0A A;  2AWO A;  3A55 A;  3K7A B;  4KKT A;  3U4V A;  4HED A;  4A93 H;  3L0O A;  4XDX A;  1FGB D;  1HNZ Q;  1SJH D;  3ULJ A;  2A6H C;  2PMZ E;  5EPK A;  4C3J B;  1TWG H;  3S14 B;  1K83 B;  2NBF A;  2A8V A;  4EQ5 A;  5EJW A;  1SNC A;  5KNB A;  2B2T A;  3HOX B;  2DN8 A;  2C5C A;  3I3C A;  3C2P A;  1GJX A;  5IYD G;  3KF6 A;  3RN5 A;  3CKI B;  1IBL L;  5ISR A;  2E2I H;  3ULP A;  1X65 A;  2K5Q A;  4CDF C;  5IP9 G;  1DJR D;  3U58 A;  3M7G A;  1JT8 A;  5IGE A;  1IBL Q;  1VMC A;  2PPB C;  1E3P A;  2D2C C;  1IZ6 A;  1KNA A;  1QZH A;  2O5I C;  5E3F A;  1RD9 D;  3TP6 A;  5GAG C;  4JI2 L;  2RKS A;  1CKN A;  3HOW G;  3MC0 B;  1RJT A;  5COY A;  2F0J A;  2XN9 C;  3CD6 A;  4AQY L;  1D7Q A;  1PRT B;  4JI2 Q;  1KTK A;  4B08 A;  1OXV A;  5KEE A;  4AQY Q;  4R4I A;  4C3H H;  3K58 A;  3IL8 A;  1O7L A;  1BBU A;  4JI1 L;  1QUQ A;  1K8O A;  3VR6 A;  1FR3 A;  3BYY B;  3HOW B;  1CKN B;  3S16 H;  1SN8 A;  3HOY H;  1LAC A;  4JI1 Q;  4BXX H;  2VXW A;  5DLQ E;  4A3I G;  2OTL A;  2L9H A;  1TU2 B;  4PZ6 A;  2ZTC A;  4ABN A;  1TWH H;  2GA4 B;  4J1M A;  4DR1 L;  3MAQ A;  1WCM G;  1VCI A;  3M3Y B;  2P5Z X;  4DV7 Q;  1QUQ B;  4UP7 A;  2LKV A;  3HFZ B;  1VF7 A;  2H4O A;  3SGI A;  3LGJ A;  5J3B A;  4A3I B;  2L15 A;  4OO1 G;  1GUN A;  1E24 A;  1GUW A;  1SRU A;  3ULL A;  3RZD B;  1LTT D;  1S5C D;  2VB3 X;  2JA8 G;  1UEB A;  5CBE E;  1V9P A;  1PTO H;  4LWC A;  2RVL A;  1NTG A;  4E6I A;  3OPO A;  1PFM A;  1Y8O B;  4ZUI A;  1PTO D;  2JXM B;  4KLK A;  3D8G A;  4DV1 L;  1K73 C;  1G6P A;  4H0L C;  1SEB D;  1GUO A;  2OXP A;  1PH3 A;  2CFM A;  1SFO B;  3EFX D;  1N34 L;  1Q81 C;  4OGQ C;  4AYB G;  5DM7 3;  4DV6 Q;  1I6H B;  2IW3 A;  5C44 G;  2F0D A;  1JOQ A;  1N34 Q;  5ELB A;  4A3L G;  2F0O A;  2JA8 B;  2B3G A;  4Z9C B;  5NUC A;  2UXC L;  2N88 A;  5IOD A;  2XGT A;  2EYF A;  4RHS A;  3U4Z A;  5FLM H;  1X3F A;  4NB3 A;  1SDF A;  1SNQ A;  1EYD A;  4YWL A;  4YY3 L;  4JI7 L;  1YJN A;  1N33 Q;  2NUC A;  4K2K A;  1Z9F A;  3J81 L;  1UE7 A;  3PQI A;  4A76 A;  4JI7 Q;  4YY3 Q;  5C44 B;  3T1Y L;  1I4P A;  2ZTE A;  4PZ7 A;  1G51 A;  3NE5 B;  1TY0 A;  4IZ8 A;  1II3 A;  3X3N A;  3GTK H;  3T1Y Q;  4FXD A;  1JWM D;  4PV1 C;  4A3C G;  1JJC B;  3W1G A;  2V4D A;  1SNO A;  3LX0 A;  3ZYY X;  5D3I B;  3CCV A;  3OW2 A;  1ZEQ X;  1S72 A;  1NR2 A;  2ALY B;  3A8I E;  1DCZ A;  2D9U A;  4IUR A;  2IJ0 A;  3K0X A;  1WD0 A;  3ERS X;  2ZJP A;  1DOK A;  1S3O A;  3QOJ A;  1J9O A;  3SXH A;  5I4D A;  3F8T A;  1LTR D;  1MJE A;  2EYM A;  1SSO A;  1XNR L;  2F3W A;  1Y69 U;  1Y1V G;  4QUF A;  2F0V A;  4WJ3 M;  3KLS A;  4FVM A;  3H94 A;  2I07 B;  1XNR Q;  4LFC L;  4DA2 A;  1ZXT A;  4IUP A;  1B4O A;  1SYC A;  3RZO B;  1D5M C;  1EQV A;  2BA0 A;  3SHL A;  2KQ3 A;  1EIH A;  2YTV A;  1X54 A;  5EBD A;  1Y1V B;  1IBK L;  3M9B A;  3CRK C;  4P72 A;  2B2W C;  2K5W A;  4A3G G;  1S4Z A;  3TP5 A;  3JAM L;  1B50 A;  1IBK Q;  4KD3 A;  3NBI A;  3KLW A;  1MSH A;  3BU2 A;  1YNN D;  1OXX K;  1SR3 A;  1E1O A;  3E3X A;  2K32 A;  2H1E A;  5LHY 1;  1W6J A;  2F0K A;  1JCK B;  3K59 A;  1FNV A;  1GM5 A;  4A3G B;  2FFK B;  3ITP A;  4CGY B;  1T9H A;  1QVG A;  1UEA B;  3CQZ B;  3AEV A;  2EY5 A;  1B1Z A;  3S15 B;  2N49 A;  2IT1 A;  1MBY A;  4DF7 A;  3K57 A;  3J81 c;  5C3E G;  1PH5 A;  1D5Z C;  4FF3 A;  2RBM A;  2UXB L;  4DUY Q;  2RDG A;  4P74 A;  4GN3 B;  5KYI A;  2UXB Q;  2PI2 E;  1E2V A;  2JA9 A;  4KHZ A;  2F03 A;  1IXR A;  4IJL A;  1G6Z A;  1MGS A;  1VQI A;  1HCZ A;  4NP5 A;  1PH9 A;  4LFB L;  1I4H A;  2IHF A;  1EWH A;  2KCT A;  4RAU C;  3MXN A;  3NQT A;  4I65 A;  2EJG C;  3SDZ A;  3FVQ A;  1BF4 A;  2OQ0 A;  1JC7 A;  1ENF A;  3A5Z B;  4CDD C;  1OTC A;  4LFB Q;  1R9T B;  5C3E B;  1AZQ A;  2B2W A;  3BS1 A;  2O5J C;  4DK3 C;  4DPG A;  1FGU A;  4IUT A;  2AUJ D;  2IX1 A;  2ATW A;  3BVG A;  3H0G H;  1F9P A;  2NN6 G;  4TVA B;  2LXK A;  1NMG A;  5M3M H;  1ZYR D;  2A5H A;  5JJI A;  4RG1 A;  4DAV A;  3T56 B;  2PZW A;  3J81 E;  4RWS C;  4LK1 C;  1BKB A;  3CF5 A;  4R9W A;  1S40 A;  4XQQ A;  3ER0 A;  4NXN Q;  3NEM A;  2E75 C;  2L0C A;  3BDC A;  3D4D A;  4WRD A;  5GAE C;  1HFN A;  2EVB A;  2WAQ E;  1ENC A;  1PFS A;  1IYU A;  3HG9 A;  3CXC A;  4RKB A;  4A3J G;  5C5M A;  1OXS C;  1JWU D;  3RLN A;  1CHP D;  1G29 1;  4ME3 A;  3UE0 A;  4IFD H;  3PIO A;  1Z47 A;  5I6W A;  1PFN A;  2WB1 E;  2RCN A;  1AP0 A;  4A3M G;  3F1Z A;  4CJ1 B;  1SYE A;  2MFI A;  2MUY A;  3GTL H;  4M8A A;  2QEJ C;  2KED A;  4X3K A;  1EWI A;  1SE2 A;  2SEB D;  1U4P A;  4UPA A;  3I72 A;  5FK9 C;  5C4J H;  2DNC A;  3PCO B;  2G5D A;  4DKA C;  3S2D H;  3QG1 A;  3A8J E;  1I6V C;  4POF A;  1SNM A;  2R7Z H;  4C56 C;  2FHT A;  4X62 Q;  2HCI A;  4UHV A;  3K5N A;  5C3W A;  3F2B A;  4A3M B;  4B3M L;  3FPU B;  2KOL A;  3MVV A;  4MTK A;  4XIG S;  1FL0 A;  1F2Y A;  4B3M Q;  3KUP A;  1WTH A;  2QKI C;  2JA6 G;  2K6A A;  1CZG A;  3K7A H;  1SND A;  4ZKB B;  4RGM A;  2B63 G;  3CC2 A;  1ONL A;  3JC6 6;  4GN4 B;  4LUV A;  3K6O A;  4KY7 A;  4NMZ A;  3G4S A;  2SNM A;  3RLO A;  2K1B A;  3K0Y A;  4TRD A;  2LY7 A;  4YCU A;  3HOX H;  4JV5 L;  1PYW D;  1B70 B;  2PCF B;  1RKN A;  4XYQ A;  1ESF A;  2JA6 B;  4IFD I;  4JV5 Q;  2N55 A;  1DOL A;  2B63 B;  3PUZ A;  2A6E C;  2F0G A;  2VNU D;  4A75 A;  3GQB A;  1HNW L;  1HNX Q;  3SK4 A;  2FJ2 A;  2PI2 A;  5IYD H;  1HNW Q;  1WTX A;  4FF1 A;  4A3D G;  1AE3 A;  3GDE A;  4LUZ A;  5IP9 H;  4DR7 Q;  1PRT D;  1XPU A;  2A1A A;  3CC4 A;  1EFI D;  1JB3 A;  4DFA A;  1LT3 D;  3S1R B;  2EYL A;  1VQ9 A;  2NZ1 D;  2B8G A;  4KHP L;  3J7A V;  3TN2 A;  2K28 A;  5JVG 3;  3HOW H;  1SMY C;  4QUC A;  3WWV A;  4KHP Q;  2UXD Q;  3HOV B;  4A3D B;  3P1H A;  2KEC A;  4KMU C;  1EFW A;  3PO2 H;  1LM0 A;  1GXD C;  1VQD A;  4ZYS A;  4JOI C;  1TWC B;  4HCS A;  3M3Y H;  3A0J A;  5C4X G;  2ICI A;  3CCJ A;  1BXT A;  2BOS A;  4A3I H;  2JEB I;  1NNX A;  2WAQ G;  1RCV D;  2YTY A;  4A4I A;  2JYO A;  1PTO F;  3RN2 A;  3RZD H;  1N36 L;  3D0F A;  1WCM H;  1YJ9 A;  1H95 A;  2A6H D;  3IFT A;  2F4I A;  4N8X 1;  4A3B B;  2NTS A;  4DV5 L;  2A68 C;  1EY4 A;  1N36 Q;  1DYQ A;  5C4X B;  2WB1 G;  3PO3 B;  1AH9 A;  2A19 A;  1ET6 A;  2AMC B;  1A8V A;  1HPC A;  1B9M A;  4QQB X;  4OO1 H;  4O2D A;  4PG3 A;  2JA7 H;  1PH1 A;  1I6H H;  5JJL A;  2WAQ B;  5M5Y B;  2VUM H;  2JA8 H;  2F0E A;  1QWY A;  1HTL D;  3I91 A;  4JG2 A;  2BDO A;  5I6Y A;  1KQS A;  2WB1 B;  2CWA A;  5IOC A;  2CCZ A;  3D31 A;  2E2H H;  1SJE D;  1GOZ A;  1KNE A;  2EYH A;  4QL5 A;  2CQA A;  2L5T A;  4RMF A;  2YYZ A;  5C44 H;  4OEM B;  1KLG D;  3NUC A;  3K81 C;  4A3L H;  3F2D A;  3K5M A;  3CC7 A;  2R92 H;  2I0Q A;  2DJF C;  1K0S A;  2CW0 C;  3L3O C;  1WD1 A;  5JEA H;  1BR9 A;  4ULL A;  4B9W A;  2EDG A;  3UDX A;  3S1M H;  2FMC A;  1L0X B;  2OQK A;  3M4Q A;  2Z6K C;  2KCC A;  1TWF B;  1R4P B;  2F0H A;  3MA2 B;  4OON A;  1CHQ D;  2B2V C;  4F87 A;  1G2S A;  2KBN A;  4A3C H;  2CKZ B;  1SE4 A;  1WTW A;  1TS2 A;  4BBS H;  1LTG D;  4OO1 I;  1A3T A;  3J80 c;  4HN7 A;  4J6H A;  3HEJ A;  3OW7 A;  1MI2 A;  2HQE A;  3RZO H;  4JI4 L;  1Y8N B;  2KCN A;  3I73 A;  3S24 A;  2A69 C;  5HGT A;  2LS0 1;  4JI4 Q;  3RLF A;  5TSS A;  3STB C;  1QNU A;  3I7F A;  2VY3 A;  4CJ2 C;  5BN4 A;  1S5B D;  2B2U C;  1NSN S;  4LMQ D;  5K36 H;  3W2D A;  2PZT A;  1RF2 D;  3KDF A;  4QB4 A;  1EQQ A;  2R61 A;  3CP0 A;  3TEH B;  4HJA A;  1X3P A;  2Z6K A;  2IX0 A;  3FRP B;  4C3J G;  4R8I A;  1BOS A;  2D0P A;  5H1S E;  3J80 E;  4B3R Q;  3N6R A;  5KND A;  4OX9 L;  4DK1 A;  2MQH A;  2B2V A;  3ICE A;  3VYR A;  3G6E A;  1G8Z D;  4KV6 A;  4OX9 Q;  4AIM A;  2JN4 A;  1TXY A;  3KDF B;  1YNX A;  4JYA L;  3KBX A;  2IY5 B;  3D4R A;  3TBI B;  1OXU A;  1Q7Y C;  1HZ9 A;  1PDQ A;  3GV6 A;  1N9W A;  2VZA A;  2HHH L;  1KRT A;  1UWV A;  4CBV A;  3PUY A;  5KIX A;  2RHQ B;  5EQ0 A;  1Q90 A;  1SYG A;  5ELE A;  5IYC G;  1H9M A;  1V43 A;  1EY0 A;  2F0I A;  4QIW E;  3EN2 A;  1TS3 A;  4DR5 L;  1KDA A;  2LFN A;  1WJJ A;  1PH6 A;  3H6M A;  1PH2 A;  3DEP A;  2ID0 A;  2K04 A;  2B2U A;  1YI2 A;  1GO3 E;  4DR5 Q;  1EEF D;  2L4N A;  1F9S A;  3MWY W;  2XVS A;  4L5S A;  1EUJ A;  3NQI A;  4C1N K;  4RCN A;  2YU9 B;  4N8F A;  3KF6 B;  3WOE A;  1JOR A;  1F9R A;  3NK9 A;  3TZD A;  3DHQ A;  2M9V A;  2Q8T A;  3Q6S A;  2IL8 A;  3Q0A A;  4HSP A;  3KJO A;  2ZT9 C;  1P16 A;  4U68 A;  1IYJ B;  1XWE A;  4K2L A;  2EYP A;  2LSS A;  5EPJ A;  4BY1 G;  3H15 A;  4F8M A;  1FNU A;  4X64 L;  2B29 A;  5EKI A;  2NN6 H;  5KRU A;  3TDQ A;  4EGV A;  1IKL A;  3SVM A;  1W3S A;  1EWC A;  1NJI C;  4CKB A;  4K6L A;  4IPH A;  4BY7 G;  4C2M B;  4IUV A;  4YWK A;  5T1G A;  2A74 C;  2LMC B;  3GTG B;  1IHZ A;  4DR1 Q;  4DR4 L;  4BY1 B;  3HKZ G;  4FNF A;  4WOR A;  1RHP A;  3MEF A;  4DR4 Q;  4A3J H;  2F3I A;  3D6C A;  3CME A;  2E5L L;  4C3I G;  4BBR G;  1GUS A;  2VL6 A;  1BCP D;  1T5X D;  2J0T D;  4BY7 B;  2E5L Q;  1C0A A;  3OIQ A;  4KI0 A;  5ELD A;  1MD2 D;  4K14 A;  4C1N I;  1I3Q B;  4L5T A;  3KLR A;  4A3M H;  4HJ8 A;  4XT1 B;  3NXW A;  3HKZ B;  2TMP A;  4LFA L;  1HA6 A;  4XQJ A;  4JK1 C;  4DV4 L;  5FO7 B;  3S1N B;  4DV1 Q;  4DR3 L;  4LFA Q;  4G7H C;  4C3I B;  4BBR B;  1EIF A;  2EXZ A;  1A63 A;  1VQF A;  1KRS A;  4DR3 Q;  1NE3 A;  1BQQ T;  2L12 A;  1U4L A;  3K8A A;  4HJ5 A;  5CV4 A;  3KBG A;  2JA5 G;  1H9R A;  5EAY A;  4RGN A;  3D6W A;  1Q8I A;  2JJQ A;  2NN6 I;  3PMF A;  2UXC Q;  3C1E A;  3M4P A;  2DY8 A;  3I2Z A;  3IFD A;  4DK0 A;  1SAP A;  3T51 B;  1Z7T A;  2CH4 A;  2FXQ A;  2HIX A;  2WFW A;  3P7J A;  4IPD A;  2JA6 H;  2F0Q A;  2PO4 A;  3G7L A;  1HTP A;  3P75 A;  1J8I A;  2B63 H;  2RA4 A;  1KHI A;  3R2T A;  4H44 C;  2JA5 B;  2QW7 A; 
#chains in the Genus database with same CATH homology
 1SYF A;  2QDB A;  2A73 B;  3S2H B;  2AQ2 B;  1PXU A;  3TSS A;  2Z4I A;  4S3S A;  5IGB A;  3MEH A;  3R2I A;  2AWN A;  5CMD A;  4QF4 A;  3VR2 A;  5CR3 A;  1H9K A;  3DWA A;  2PMZ B;  1XX8 A;  4XTC S;  1FYC A;  3EVQ A;  3T16 A;  3HS0 C;  3NP8 A;  3T4A C;  5J1Z A;  5M5W B;  1DON A;  2VB2 X;  2EJM A;  3I4M B;  2MJ8 A;  4K6D A;  2KA7 A;  1PZJ D;  3DEO A;  2BE5 D;  2F0L A;  4MN3 A;  1FNW A;  4HMJ A;  2PNR C;  2SOB A;  1STB A;  1XTC D;  4KN7 C;  4XQN A;  4X3U A;  1IL8 A;  3IKJ A;  3OMC A;  3S1Q B;  1LTI D;  3S17 B;  1Y8P B;  1YNJ D;  1D5X C;  3F2U A;  5IGC A;  1DXM A;  5EGT A;  1D2B A;  5EBC A;  4BA1 I;  5CGK A;  1Q1E A;  1Q12 A;  1SXT A;  3QB3 A;  3H3V C;  4KY6 A;  5JPM C;  1EU4 A;  3ONA B;  5JOB A;  3BDO A;  2ICE C;  2K33 A;  5JJZ A;  3HGB A;  3GTO B;  5KNC A;  5C5L A;  3A7L A;  1HQM C;  4XT3 B;  2O2L D;  1PTO C;  3AMU A;  1STG A;  4OIK A;  2R93 B;  1DM0 B;  3PIO 3;  3QOL A;  1TWA B;  1F2M A;  3HOU B;  4G4K A;  3PUW A;  4J8Q A;  1LLR D;  3M85 A;  4QCL A;  4ZLT F;  1LO5 D;  1U9R A;  4DXF A;  4ME5 A;  1VMP A;  4ZRZ A;  2C9O A;  4B9X A;  1HHV A;  1NAP A;  3U9O A;  3P20 A;  5AFW A;  2R3Z A;  1T5E A;  2F3V A;  5BN5 A;  1EY5 A;  4DGZ A;  1D6E C;  3KF8 A;  5CV8 A;  2G9D A;  4PMB A;  4H13 C;  3S9W A;  1FD7 D;  5G3L F;  4LAA A;  3OIP A;  1D1I A;  4DAY A;  2E2J B;  1S5F D;  1GUG A;  4PMC A;  3W3A A;  3TP7 A;  1DOM A;  2F0T A;  2K01 A;  4KJN A;  2EY1 A;  3MXG A;  2AQ1 B;  1TT2 A;  3ERO A;  3NWS A;  1XYI A;  1EY6 A;  1BDO A;  4RA8 A;  5C0X J;  3M7N A;  3EJI A;  4IUN A;  1QCB D;  2I46 A;  4CJ0 B;  5LL6 X;  2B8F A;  3DUZ A;  2WII B;  2XIW A;  2X6L A;  1AEX A;  3M4O B;  4DU9 A;  5IIF A;  3DXJ C;  4O42 A;  3TME A;  3HRZ C;  2IPK D;  1IW7 D;  4KJO A;  2A69 D;  4DAP A;  1F2L A;  3Q22 A;  1AZP A;  4Y7N B;  3J7Y W;  3GTK B;  3GTQ B;  4EVO A;  2NVT B;  4TSS A;  2Z8L A;  4JBW A;  3SR1 A;  4HSV A;  5I2Y A;  1B9N A;  2WKC A;  4ZAI A;  3Q23 A;  1V1P A;  3HOZ B;  3VA5 A;  5CV5 A;  2NVQ B;  5K5P A;  3J80 L;  5DEH A;  1R4Q B;  2Z1C A;  4FXG C;  3SK8 A;  3R93 A;  3T53 B;  1BCP F;  1X32 A;  1KLU D;  2WKD A;  2K7V A;  1JWS D;  5J39 A;  2XWB B;  1ZYR C;  2F0N A;  2NB0 A;  3I70 A;  5DM6 3;  1B53 A;  4K5V A;  3CRL C;  1VDZ A;  1B3A A;  1CA6 A;  4G7Z C;  1ILQ A;  1F77 A;  1RTN A;  3QO2 A;  3VR5 A;  4X3S A;  1E0B A;  4L8J A;  1EZ6 A;  3NBH A;  3QWN A;  1W6K A;  2BA1 A;  2F0S A;  3GTP B;  3I4N B;  2ZXP A;  3V05 A;  2WV6 D;  5FKA C;  2EJF C;  1Y1W B;  3QJY A;  1UNS A;  2RQX A;  5A2Q E;  4X3T A;  1QE6 A;  4FF4 A;  4QMG A;  4FO2 A;  4RGO S;  1X3Q A;  3NHH A;  3R8B A;  3HP3 A;  3RMH A;  4ID6 A;  2X6G A;  3OWF A;  4XXE A;  5D14 A;  2MPM A;  5D65 A;  1O78 A;  2K05 A;  4IUU A;  5C0X G;  1Z6H A;  3MXU A;  2MGS A;  5D3D A;  3M4Y A;  1TII D;  2F0M A;  2EZV A;  3Q24 A;  3I4L A;  4ZQ3 A;  3MZ5 A;  1JE4 A;  4K8J A;  3AB9 A;  1I4R A;  4K5W A;  4HCE A;  3FKI B;  2D62 A;  3MXP A;  2DNE A;  1C8C A;  2XRQ D;  4A3E B;  3N52 A;  1ENA A;  5KYL A;  4ZKC B;  4A3F B;  2Y0S B;  1LAB A;  5E1F A;  1ESR A;  4KHV A;  1SYD A;  3IAY A;  5DAU A;  5LL6 S;  1PLF A;  3SK5 A;  4KK7 A;  3L7Z C;  4Q0F A;  4WFN 3;  1CTM A;  1AN8 A;  3MFG A;  2K03 A;  3I90 A;  1EY9 A;  4OHJ A;  1EY7 A;  2WAC A;  1RDP D;  2J7Z A;  2SNS A;  1A2T A;  1ROD A;  1GUT A;  3NSW A;  3ERQ A;  1QIL A;  1TKW B;  2E76 C;  3RUZ A;  5J22 A;  5JPN C;  3BVZ A;  3K5L A;  3D4W A;  5C4J B;  1F9Q A;  3S2D B;  3GTM B;  5DNF A;  3QIA A;  5IGF A;  2PZU A;  1A15 A;  3DWP A;  1TQO A;  2X69 A;  1I50 B;  4CKE A;  1PZK D;  4CKC A;  5FOB B;  2KEE A;  2B39 A;  1KAB A;  5E4X A;  4K5X A;  3CU7 A;  4HR7 B;  3GD7 A;  2ENB A;  3BYT B;  3GP7 A;  4N9P A;  3VYS A;  3I8Z A;  1XXG A;  3VR4 A;  4NDX A;  3FPP A;  4L6T B;  2PW7 A;  3E6Z X;  1EEI D;  5M3F B;  1WTQ A;  4P2C B;  5KGU A;  5F2D A;  3FDT A;  1VF5 C;  3BZD B;  1KDB A;  1EQT A;  2B2Y C;  5M9O A;  1WVL A;  5I2X A;  3PUV A;  3DM1 A;  2L55 A;  4I7Z C;  2MHV A;  4IAL A;  3PO2 B;  5CC4 A;  4YIJ A;  1QJO A;  1AFP A;  2M2L A;  2XWJ B;  1BO0 A;  2HDL A;  5FO8 B;  3OOC A;  4BA2 I;  4OIJ A;  3LNN A;  5CV9 A;  5T1I A;  4ZUJ A;  2NVY B;  3DMU A;  1STH A;  3A56 A;  1CZW A;  4Q5V A;  1WCM B;  5FLX L;  2Z4H A;  2EPB A;  1STE A;  3EQL C;  2EYO A;  1PMR A;  4RCO A;  3PV0 A;  4V0B A;  2JA7 B;  2XSC A;  1A6X A;  2VUM B;  2B2Y A;  1L0Y B;  2HUG A;  1V1O A;  3TZU A;  3HZX A;  1KDC A;  1K8M A;  5IT9 L;  5JEA G;  1PZI D;  3BDL A;  1PRT F;  1HRJ A;  4PQX A;  5CV6 A;  2E2H B;  1LTS D;  1EU3 A;  1CQF A;  4AYB B;  2BCO A;  3UI2 A;  1LTA D;  2PQE A;  5ELC A;  3FMC A;  2F0P A;  2R92 B;  1OO9 B;  3DWQ A;  5COR A;  2EY2 A;  1B2T A;  3S1M B;  3GV3 A;  4IN3 A;  3MFY A;  2TSS A;  1ET9 A;  1I4Q A;  1QB5 D;  1SE3 A;  4RKL A;  1STY A;  3BVM A;  4NW2 A;  3KLS X;  3NTK A;  1LT4 D;  4HTH A;  1HUN A;  1MSG A;  4QIW B;  1JR0 D;  1EL0 A;  2F1M A;  2Q8I B;  4BBS B;  2PW5 A;  5ELF A;  3E5S A;  1BBX C;  4R8N A;  1BNZ A;  1B44 D;  3A7A B;  5K36 G;  5FO9 B;  5IGD A;  2OT2 A;  2NTT A;  4TKO B;  3J7A F;  3OWE B;  1HFG A;  4WJW A;  4FXK C;  1G2T A;  1H9J A;  4O1N A;  1QNK A;  4EQN A;  1LV9 A;  2HDM A;  3TP8 A;  2A6E D;  2KHS A;  1M8A A;  1JOO A;  4DNR B;  4UAI A;  1S5D D;  1A2U A;  3H09 A;  3SE0 A;  2KJX A;  4K8I A;  4PMW A;  1CT1 D;  3NWT A;  2F0F A;  1LTB D;  4OL7 A;  3MTS A;  3X3M A;  4KTA A;  4GZY C;  1STN A;  1BCP C;  3SK6 A;  2IX3 A;  4A93 B;  1TS5 A;  1SMY D;  2RSO A;  4HAE A;  5FLX E;  1TWG B;  1I4X A;  3D3R A;  1CFM A;  2FMM A;  5I9P A;  2NYZ D;  2XNA C;  1M4V A;  3CHB D;  2E2I B;  5C3X A;  3NPP A;  2CVR A;  1G91 A;  2RDH A;  1S5E D;  4C3H G;  2JSO A;  5EKK A;  1TR5 A;  1WTV A;  1JQY D;  2JEA I;  1E2W A;  2EE1 A;  5IT9 E;  5C0X H;  4KY5 A;  1D1K A;  3C1F A;  3A54 A;  1CQV A;  2EOT A;  2BDN A;  4BWG B;  2XRS D;  3T13 A;  1O7Z A;  4C3H B;  2A68 D;  1GHK A;  4FP5 D;  2QCP X;  4H7B A;  3S16 B;  3HOY B;  1JOK A;  3BG3 A;  1HQR D;  4MIU A;  2AQ3 B;  3L9A X;  2JE6 I;  1TWH B;  1LT6 D;  2R6G A;  4ODG A;  4FYD A;  5A2Q L;  2OEO A;  3MHB A;  1A3V A;  1OXT A;  5CV7 A;  1BCP B;  2QF7 A;  4G57 A;  4A3J B;  2F0U A;  4L63 B;  3V2T A;  1HXY D;  2CW0 D;  1PTO B;  2SDF A;  3OSO A;  2MP1 A;  4IUQ A;  1QG7 A;  3C3L A;  5C0X I;  5HUR A;  1Q1B A;  2L11 A;  5C4H A;  1SBB B;  5BN3 A;  3JAM E;  2BE5 C;  3VYT A;  4PNY A;  3AU7 A;  1YNN C;  4G7O C;  5CBA E;  2KUM A;  2E74 C;  3VR3 A;  1WTP A;  2DY7 A;  2HCC A;  1CI3 M;  1GHJ A;  3LWU A;  4IFD J;  3VA7 A;  1IKM A;  5A35 A;  1WTO A;  1I4G A;  2RSN A;  1YNJ C;  5I9O A;  3RD4 A;  2WIN B;  4KD4 A;  2EYJ A;  4NKL A;  2G9H D;  4DN4 M;  5M5X B;  1EIG A;  3GO5 A;  4EQO A;  4UDU C;  3NTI A;  2KVM A;  3VYU A;  5CYU A;  1EYC A;  4N9T A;  4RFB A;  3H91 A;  1ILP A;  1BUV T;  3LWE A;  2RDF A;  1TS4 A;  1NCV A;  2AUK A;  1CK1 A;  4LJZ C;  2F0W A;  3C46 A;  4F7X A;  1UAP A;  4V19 0;  5C4Z A;  3A8K E;  3EA6 A;  2K5D A;  4RH6 A;  1STA A;  1V1P B;  2L1B A;  4EQP A;  1CM9 A;  2E2D C;  2CHB D;  1A3U A;  1SNP A;  4IQZ A;  1ML0 D;  1O80 A;  3OMG A;  4U67 3;  1LT5 D;  5EKL A;  3ND8 A;  5E4W C;  5C6A A;  3R3O A;  1Q3L A;  2D5D A;  4XYO A;  2EY6 A;  1WTR A;  4BS9 A;  1V8Q A;  4ILW A;  1H9S A;  3WDN A;  5JAV A;  3KK7 A;  2PYK A;  1E2Z A;  1EOT A;  4KN4 C;  1O7Y A;  1RTO A;  4KKS A;  3WOF A;  2FIN B;  3FEW X;  1EZ8 A;  2WP8 J;  5JVH 3;  1H9S B;  3U9S A;  2OF1 A;  4HMI A;  4M1U B;  3E0J A;  3GTJ B;  1QOH A;  1ZKO A;  2QIL A;  4RGT A;  2JP1 A;  3OHX C;  1F2Z A;  4KKU A;  1HUM A;  3ND9 A;  1TY2 A;  2ZXR A;  3H0G B;  1C48 A;  1EYA A;  5EPL A;  5M3M B;  4CHT B;  2J4X A;  1CA5 A;  1U4R A;  2NWG A;  4RHR A;  4F88 A;  1KAA A;  4ZK9 B;  4IFD G;  3PIP 3;  4DXG A;  1U4M A;  3K5O A;  1PFB A;  1AW7 A;  1EY8 A;  4FF2 A;  1NUC A;  4MHE A;  3NTH A;  3SEB A;  3G6J B;  2IWH A;  2M00 A;  2B2T C;  1IYV A;  1DD2 A;  1PRT C;  1IW7 C;  1JIC A;  4DNT B;  2ZXO A;  1TVX A;  1UUP A;  2Q8R E;  1SYB A;  5IGG A;  3V96 A;  1DZ1 A;  1NR4 A;  3GTL B;  3O13 A;  1ICW A;  3URY A;  2O4X A;  2NVX B;  5JEA J;  1HA5 A;  1C4Q A;  5G3L D;  2R7Z B;  3PUX A;  4TQU S;  4A3K B;  2AWO A;  3A55 A;  3K7A B;  4KKT A;  4HED A;  4XDX A;  1FGB D;  1SJH D;  2A6H C;  4C3J B;  5EPK A;  3S14 B;  1K83 B;  2NBF A;  5EJW A;  1SNC A;  5KNB A;  2B2T A;  3HOX B;  2DN8 A;  2C5C A;  3I3C A;  3C2P A;  1GJX A;  3CKI B;  5ISR A;  2K5Q A;  1DJR D;  3M7G A;  5IGE A;  1VMC A;  2PPB C;  2D2C C;  1KNA A;  2O5I C;  5E3F A;  1RD9 D;  3TP6 A;  2RKS A;  3MC0 B;  1RJT A;  5COY A;  2F0J A;  2XN9 C;  1PRT B;  1KTK A;  4B08 A;  1OXV A;  5KEE A;  3K58 A;  3IL8 A;  1O7L A;  1K8O A;  3VR6 A;  1FR3 A;  3BYY B;  3HOW B;  1LAC A;  2VXW A;  2L9H A;  1TU2 B;  4ABN A;  2GA4 B;  4J1M A;  3MAQ A;  1VCI A;  3M3Y B;  2LKV A;  1VF7 A;  2H4O A;  4A3I B;  4OO1 G;  1GUN A;  1GUW A;  3RZD B;  1LTT D;  1S5C D;  2VB3 X;  5CBE E;  1PTO H;  2RVL A;  4E6I A;  3OPO A;  1PFM A;  1Y8O B;  4ZUI A;  1PTO D;  2JXM B;  3D8G A;  4H0L C;  1SEB D;  1GUO A;  2OXP A;  1SFO B;  3EFX D;  4OGQ C;  5DM7 3;  1I6H B;  2IW3 A;  2F0D A;  1JOQ A;  5ELB A;  2F0O A;  2JA8 B;  4Z9C B;  5NUC A;  2N88 A;  5IOD A;  2EYF A;  4RHS A;  1SDF A;  1SNQ A;  1EYD A;  2NUC A;  4K2K A;  3J81 L;  5C44 B;  1I4P A;  3NE5 B;  1TY0 A;  4IZ8 A;  1II3 A;  3X3N A;  4FXD A;  1JWM D;  4PV1 C;  2V4D A;  1SNO A;  3LX0 A;  3ZYY X;  5D3I B;  1ZEQ X;  1NR2 A;  3A8I E;  1DCZ A;  2D9U A;  4IUR A;  2IJ0 A;  1WD0 A;  1DOK A;  3QOJ A;  1J9O A;  5I4D A;  3SXH A;  1LTR D;  2EYM A;  1SSO A;  2F3W A;  1Y69 U;  4QUF A;  2F0V A;  3KLS A;  4FVM A;  3H94 A;  2I07 B;  4DA2 A;  1ZXT A;  4IUP A;  1B4O A;  1SYC A;  3RZO B;  1D5M C;  1EQV A;  2BA0 A;  3SHL A;  2KQ3 A;  1EIH A;  5EBD A;  1Y1V B;  3CRK C;  2B2W C;  2K5W A;  1S4Z A;  3TP5 A;  3JAM L;  1B50 A;  4KD3 A;  3NBI A;  1MSH A;  1YNN D;  1OXX K;  2K32 A;  2H1E A;  5LHY 1;  1W6J A;  2F0K A;  1JCK B;  3K59 A;  1FNV A;  4A3G B;  2FFK B;  3ITP A;  4CGY B;  3CQZ B;  2EY5 A;  1B1Z A;  3S15 B;  2IT1 A;  1MBY A;  4DF7 A;  3K57 A;  1D5Z C;  4FF3 A;  2RBM A;  2RDG A;  5KYI A;  1E2V A;  4KHZ A;  2F03 A;  1G6Z A;  1MGS A;  4NP5 A;  1HCZ A;  1I4H A;  1EWH A;  4RAU C;  3MXN A;  3NQT A;  4I65 A;  2EJG C;  3SDZ A;  3FVQ A;  1BF4 A;  1JC7 A;  1ENF A;  1R9T B;  5C3E B;  1AZQ A;  2B2W A;  3BS1 A;  2O5J C;  4IUT A;  2AUJ D;  2IX1 A;  3BVG A;  1F9P A;  2NN6 G;  1ZYR D;  2A5H A;  4DAV A;  3T56 B;  2PZW A;  3J81 E;  4RWS C;  4LK1 C;  4R9W A;  4XQQ A;  2E75 C;  2L0C A;  3BDC A;  3D4D A;  4WRD A;  1HFN A;  2EVB A;  1ENC A;  3HG9 A;  1IYU A;  4RKB A;  5C5M A;  1OXS C;  1JWU D;  1CHP D;  1G29 1;  4IFD H;  1Z47 A;  5I6W A;  1PFN A;  1AP0 A;  4CJ1 B;  1SYE A;  2MUY A;  4M8A A;  2QEJ C;  2KED A;  4X3K A;  1SE2 A;  2SEB D;  1U4P A;  3I72 A;  5FK9 C;  2DNC A;  3QG1 A;  3A8J E;  1I6V C;  1SNM A;  4C56 C;  2FHT A;  2HCI A;  3K5N A;  4A3M B;  5C3W A;  3FPU B;  2KOL A;  3MVV A;  4XIG S;  1F2Y A;  3KUP A;  2QKI C;  2K6A A;  1CZG A;  1SND A;  4ZKB B;  4RGM A;  1ONL A;  3K6O A;  4KY7 A;  4NMZ A;  2SNM A;  2K1B A;  3K0Y A;  4TRD A;  2LY7 A;  1PYW D;  2PCF B;  1RKN A;  4XYQ A;  1ESF A;  2JA6 B;  4IFD I;  2N55 A;  1DOL A;  2B63 B;  3PUZ A;  2A6E C;  2F0G A;  2VNU D;  3GQB A;  3SK4 A;  2FJ2 A;  1WTX A;  4FF1 A;  1PRT D;  1EFI D;  1JB3 A;  4DFA A;  1LT3 D;  3S1R B;  2EYL A;  2NZ1 D;  2B8G A;  3J7A V;  3TN2 A;  2K28 A;  5JVG 3;  1SMY C;  4QUC A;  3HOV B;  4A3D B;  3P1H A;  2KEC A;  4KMU C;  1GXD C;  4ZYS A;  1TWC B;  4HCS A;  2ICI A;  1BXT A;  2BOS A;  2JEB I;  1RCV D;  2JYO A;  1PTO F;  2A6H D;  3IFT A;  2F4I A;  4A3B B;  2NTS A;  2A68 C;  1EY4 A;  1DYQ A;  5C4X B;  3PO3 B;  1ET6 A;  1HPC A;  1B9M A;  4OO1 H;  2WAQ B;  5M5Y B;  2F0E A;  1QWY A;  1HTL D;  3I91 A;  2BDO A;  5I6Y A;  2WB1 B;  5IOC A;  3D31 A;  1SJE D;  1GOZ A;  1KNE A;  2EYH A;  2CQA A;  2L5T A;  2YYZ A;  1KLG D;  3NUC A;  3K5M A;  2CW0 C;  3L3O C;  1WD1 A;  5JEA H;  1BR9 A;  4ULL A;  4B9W A;  2EDG A;  2FMC A;  1L0X B;  2KCC A;  1TWF B;  1R4P B;  2F0H A;  3MA2 B;  1CHQ D;  2B2V C;  4F87 A;  1G2S A;  1SE4 A;  1WTW A;  1TS2 A;  1LTG D;  4OO1 I;  1A3T A;  4HN7 A;  4J6H A;  3HEJ A;  3OW7 A;  1MI2 A;  2HQE A;  1Y8N B;  2KCN A;  3I73 A;  2A69 C;  5HGT A;  2LS0 1;  3RLF A;  5TSS A;  1QNU A;  4CJ2 C;  5BN4 A;  1S5B D;  2B2U C;  1NSN S;  4LMQ D;  5K36 H;  3W2D A;  2PZT A;  1RF2 D;  4QB4 A;  2R61 A;  1X3P A;  3FRP B;  2IX0 A;  4C3J G;  4R8I A;  1BOS A;  3J80 E;  3N6R A;  5KND A;  4DK1 A;  2B2V A;  3VYR A;  1G8Z D;  4KV6 A;  3KBX A;  3D4R A;  3TBI B;  1OXU A;  1PDQ A;  3GV6 A;  4CBV A;  3PUY A;  5KIX A;  5EQ0 A;  1Q90 A;  1SYG A;  5ELE A;  1H9M A;  1V43 A;  1EY0 A;  2F0I A;  1TS3 A;  1KDA A;  2LFN A;  3H6M A;  3DEP A;  2ID0 A;  2K04 A;  2B2U A;  1EEF D;  2L4N A;  1F9S A;  3MWY W;  2XVS A;  3NQI A;  4C1N K;  4RCN A;  2YU9 B;  3WOE A;  1JOR A;  1F9R A;  3NK9 A;  3TZD A;  3DHQ A;  2M9V A;  2Q8T A;  3Q6S A;  2IL8 A;  3Q0A A;  4HSP A;  2ZT9 C;  4U68 A;  4K2L A;  1XWE A;  2EYP A;  5EPJ A;  4F8M A;  1FNU A;  5EKI A;  2NN6 H;  5KRU A;  3TDQ A;  4EGV A;  1IKL A;  3SVM A;  1EWC A;  4CKB A;  4K6L A;  4C2M B;  4IUV A;  5T1G A;  2A74 C;  2LMC B;  3GTG B;  1IHZ A;  4BY1 B;  4FNF A;  4WOR A;  1RHP A;  3D6C A;  4C3I G;  1GUS A;  1BCP D;  1T5X D;  2J0T D;  4BY7 B;  3OIQ A;  4KI0 A;  5ELD A;  1MD2 D;  4K14 A;  4C1N I;  1I3Q B;  3KLR A;  4XT1 B;  3NXW A;  3HKZ B;  2TMP A;  1HA6 A;  4XQJ A;  4JK1 C;  5FO7 B;  3S1N B;  4G7H C;  4C3I B;  4BBR B;  2EXZ A;  1BQQ T;  2L12 A;  1U4L A;  5CV4 A;  3KBG A;  1H9R A;  4RGN A;  3D6W A;  1Q8I A;  2NN6 I;  3PMF A;  3C1E A;  2DY8 A;  3IFD A;  4DK0 A;  1SAP A;  3T51 B;  1Z7T A;  3P7J A;  2F0Q A;  2PO4 A;  3G7L A;  1HTP A;  3P75 A;  1J8I A;  2RA4 A;  3R2T A;  4H44 C;  2JA5 B;  1UEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...