3GVAA

Crystal structure analysis of s. pombe atl
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
107
structure length
107
Chain Sequence
RMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyltransferase-like protein 1
publication title Flipping of alkylated DNA damage bridges base and nucleotide excision repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 35
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gvaA00
5L3BA 3I59B 2FBKA 3SFZA 5DUIA 3F3XA 3AAFA 3IKVA 2FRHA 5BMZA 4HF2A 4IXAA 2HGCA 1ZH5A 1T2KA 3LAPA 3COAC 4M9ZA 2PJPA 1PUEE 3HUGA 3LA3A 1IZ1A 3MEXA 2WV0A 2MC3A 3E97A 2FA5A 2HS5A 5H6QA 2YX4A 2XUBA 2D1VA 3R4KA 5D4RA 2UZKA 1HXDA 4EJOA 2A69F 4EJVA 2QUFA 4YIIA 1Z6TA 2VC1A 4P9UA 2CO5A 4O5VA 1MZBA 4RAYA 1YS6A 3GVAA 4EVIA 1BM9A 3FMRA 1J9IA 2M8EA 4OIRF 2RGVA 1QO0D 1U5TC 3ZMDA 3E6MA 1XSVA 2DU9A 4CYDA 1YQAA 3K1MA 3KP5A 5D5XB 5E8IA 3N4MA 3ABTA 3BZ6A 3U2RA 2K86A 2EFNA 3M1EA 1BI0A 3OOPA 5IT9Z 1QNTA 2YSRA 1ZGAA 2CYYA 1ZRFA 1T98A 2DFIA 3DV8A 2DQLA 3HRTA 4HV5A 2OZUA 1TNTA 2XHKA 3CO7C 5D4SA 1HSTA 1HW5A 1LDDA 5CVUA 4KICA 4UXNA 2ESHA 5K5RA 3V8JA 3F8MA 5HLGA 1F1ZA 3K9TA 1QGPA 5LGNA 1V3FA 3FHZA 5HDNA 1MGTA 2IA1A 3PQJA 1FYLA 5TJJA 5L3GA 2G7UA 2HYGD 5D6FA 4KA4A 2Z9OA 2HQRA 4OINF 3P9CA 4CICA 1OPCA 3JAMZ 1RIOH 2PG4A 2ZXJA 5BOXA 1CF7A 1YIOA 4M6YA 2P8TA 4YIFA 3HRSA 3CO6C 4IRHA 4KFCA 3K0LA 4ASNA 2XROA 2IA2A 3PQKA 2V1DA 2MH2A 3KP4A 4LLGF 5E17F 5FO5A 1XB4A 4HOBA 3T0YA 2FNPA 4HV6A 4P96A 4LG0B 4FX4A 4B09A 5ED4A 4BNCA 2GZWA 1UHWA 3G3ZA 1AWCA 5L3CA 3WU0A 4L9VA 1Z9CA 1WSUA 1MD0A 2XVCA 4UV9A 2XKPA 5DCFA 3CDHA 3TO6A 5E8GA 4CXFA 4HLYA 2M87A 3C7JA 2HZTA 3J80Z 4P9FA 1LJ9A 4BHBA 2YU3A 3RKXA 4GO1A 4LMYA 3GZ5A 1ZG1A 3BJ6A 2PN6A 4WK8F 1J59A 1IXSB 3BP8A 1GVJA 1RUNA 5AIPA 4GXOA 2L4MA 3R0AA 4LB6B 4KIFA 4HX8A 2P5LC 3MZHA 2DO7A 5E20A 1G6NA 4E70A 1FBSA 4KIGA 2M5WA 4RGXA 4HZFA 1BOAA 3KZYA 2LKPA 3T8TA 1G4DA 2XASA 1BC8C 5CVRA 1T6SA 1IW7F 3SZPA 1OYIA 3F21A 4A5NA 2CQKA 2R7FA 3LFKA 1R5GA 3HRUA 4NHJA 1H9TA 1UB9A 4XRFA 1PP8F 4LGWA 2HEOA 1W4MA 3CTAA 1ZGJA 1EV7A 2L01A 1USSA 1SD7A 3I4PA 3DXJF 3R6SA 3BROA 3IL2A 2EB7A 1BJAA 1NHAA 2J5PA 4AVPA 2Q0OA 5BPIA 4MGRA 2V1XA 3LA7A 3KP3A 3K2ZA 3N97A 1O7LA 5D5WB 3WODF 1SD6A 1EH7A 4EGYA 5HLHA 1P92A 1DUXC 1B6AA 2GIVA 2CG4A 2F5FA 5HOOA 3HSEA 1LEAA 1IXRC 3B02A 4ZZLA 2PBIA 3REOA 2VE8A 1T39A 3DQVC 2CFXA 4R1HA 3RKWA 1ZLKA 3TKYA 1FSHA 2NS0A 1RUOA 4AIHA 3I71A 3K69A 3TOAA 3TOBA 5ICCA 5H20A 3JTHA 3O3KA 3EUHA 4AIJA 3GX4X 3E3VA 5FFXA 3D5LA 5L3FA 4RB2C 1K78B 3HSRA 4G6QA 2HTSA 1EH6A 2VT3A 3GO5A 1ZG5A 5K5OA 4I01A 3U9GA 2QENA 2YPRA 1W5SA 2EFQA 1Y0UA 1IXCA 3EDPA 3ULQB 2O61A 5AIQA 2ZMEB 2UWMA 2IJLA 2PQ8A 3MFKA 4G94A 5F6FA 3KFWX 2NYXA 4KYWA 3WTWC 3IHUA 3S2WA 5HS7A 3GW2A 4M71A 3V7CA 2OA4A 5F1RA 2DI3A 4P55A 2OD5A 4EM0B 3KEOA 4MQ9F 1R00A 4N9HA 5ILSA 3F6OA 4KT5C 3HOTA 2A07F 1XN7A 3NRVA 1KQ0A 1FC3A 1YW8A 1MDMA 3TDZC 2ADUA 1ULYA 4KIBA 3J7AO 5LGTA 1IF1A 3W6KB 1RI7A 3J81K 4RGSA 4BAYA 5D8KB 5DYMA 3ECOA 3V7SA 4BHPA 1ZRDA 2ZNZA 2EA2A 3GUDA 2CSOA 5DUKA 3KLNA 4IHTA 2QM3A 1CGPA 4M73A 1KQ9A 1E2XA 3GF2A 2Z3YA 2HQNA 4U0YA 2FMYA 4OIOF 5LBQA 1L0OC 5J6XA 3I58A 2VXZA 3KEQA 2EA4A 4XBFA 1FPQA 2HR3A 3L09A 3LSTA 4D0PA 3F6VA 5KVRA 2XV4S 2KKOA 2XAHA 5CYVA 2GQQA 4OU0A 3TDUC 4UNOA 5JR3A 1H9GA 3WTXC 3C3WA 5D6EA 1EH8A 1REPC 1FLIA 1P6RA 1KYZA 2XAFA 3EYIA 3DEUA 3LWFA 4I0AA 3O6BB 3ZPLA 3RYRA 3ZMUA 3WTSC 2MD5A 3F23A 5ILUA 1HKSA 1KA8A 4MTEA 2QBYB 3I64A 2QBYA 1O3RA 3F8BA 5LHHA 3CUQA 5ICFA 1LDKB 2A6EF 1X3UA 5FLXK 2P5KA 5LHIA 3G73A 3ISPA 1BIAA 2BBYA 3E6DA 1ZRCA 4FHTA 2STWA 5H6RA 2FSWA 1R1TA 5DD8A 1XCVA 3IRQA 3V8LA 1QZZA 1XSDA 2RC4A 4MEXF 3KP7A 2KRFA 2V6CA 2F5EA 3IC7A 3WGGA 3ZQ7A 3BJAA 1B9MA 1F9NA 2RV8A 3IRRA 1FWZA 5A2QK 1ZAOA 1ONVA 2WTEA 2Q2EA 3Q9SA 1ZN2A 3L7WA 1B4AA 2ZFWA 2FF4A 1DDNA 5L3EA 2LF8A 2FU4A 4IHSA 2YX7A 4P5OA 3I53A 1F5TA 2W57A 4S05A 4HLXA 4N0BA 3L2CA 2F2EA 4JBAA 4MHGA 2X4HA 4OIQF 4GYIA 3BOQA 1YW7A 3GWZA 3WGIA 4TV7A 1YG2A 3ZMZA 3P9IA 1D3YA 3HYIA 2K7LA 4G7ZF 2FE3A 1BC7C 5HDGA 1IN5A 2XKOA 4Q4ZF 2ZO4A 1WWXA 2XIGA 4IRGA 4KUMA 4A6DA 2FOKA 4S04A 2HFHA 4M9SA 1CF7B 1KU9A 1FBUA 3GFMA 4BQAA 4Q5SF 3DPLC 3H3ZA 2BGCA 3TO9A 2A3SA 4HF1A 1O3SA 2B0LA 2VE9A 4OMZA 3F8FA 4B8XA 5HS9A 1HSJA 5K5QA 3EYYA 1UFMA 1Z91A 4WXCA 3HTSB 1LVAA 1FBQA 3WU1B 3MCZA 4XSZF 3I0TA 1BI2A 5FD5A 1D5VA 5HS8A 1I1SA 2M45A 2CGPA 3VB2A 1L3LA 1R36A 3MWMA 4AWXB 2ZKZA 3WTYC 4AD9A 1JHFA 2VOOA 1G3TA 1I1GA 4F7ZA 4Q48A 3D0SA 2R3SA 3Q9VA 3ABUA 4GYGA 5AONA 3WE2A 3ECHA 3QU3A 2O0YA 2IRFG 2LF7A 3RYPA 4LLLA 4YFXF 1R5HA 1D8JA 1P4AA 4BXUA 2EFOA 2XAQA 3RJPA 2EWNA 4L18B 3MQ0A 3O2PE 3FM3A 4HYEA 1W7PD 3FZVA 5K1YA 1GXQA 3K1PA 1UHMA 5IT9K 5LEKA 1IN8A 3V8KA 3KE2A 2ELHA 3HOSA 3M7GA 3HHGA 3EQLF 5TRDA 4BH9A 5CJ9A 2FEZA 4QWQA 4A12A 2A5YB 2C6YA 2M30A 3GFIA 1U6GA 1ON2A 2K4BA 3GXOA 1KU2A 2HOEA 3DP7A 3BY6A 1U5TA 2Y48A 3F72A 2YR2A 5LGUA 5CLSA 4ENJA 2VT2A 3JAMK 2QLZA 2L3DA 2MLKA 4WX9A 2JT1A 2P6SA 2MH9A 3T8RA 1Z1DA 2G9WA 4G8XA 3LQQA 4UVBA 2MBFA 3M8FA 4LFUA 2HYFA 2VOPA 5ICEA 2RKHA 5FGMA 4HW0A 4AIKA 2AS5F 1I27A 2ESNA 1O7FA 2DW4A 4ETSA 4Z2YA 3VOEA 3WTUC 2BEOA 1YS7A 4O3MA 2PEXA 4A0XA 2Z33A 1RZ4A 1BN5A 1U8RA 4U0WA 2ACJA 1H0MA 4ON0A 3MAJA 1MJAA 1HQCA 1JE8A 1TBXA 4YFKF 4L9NA 2FNAA 4HBLA 1FP1D 2HDCA 1HKTA 2FBHA 1J5YA 5J8CA 2X0LA 2VBXA 4ZYEA 2RN7A 3CJNA 4A2UA 5LRSA 3M9AA 3P9KA 2KIFA 3J80K 5E1WA 1DPRA 5DD4A 1R7JA 1XDUA 1YYVA 3FWEA 3DPTA 5D5UB 4RS8A 2GXGA 3WTVC 2H6BA 4PGGA 4MQVA 4U7BA 4LK1F 2A68F 3KZZA 4L5IA 3ZN0A 2VN2A 1SAXA 3SXYA 4I02A 1TNSA 4MNUA 4OMYA 3QRFF 3M8EA 3ML6A 2EFWA 4HX4A 3LA2A 3L00A 4Y17A 1HW2A 3NEUA 1FNNA 2K27A 2IP2A 3RPQA 4EM2A 4GGGA 2O6GE 1Q1HA 2WC2A 4U0VA 2NNYA 1Z05A 1W7PA 4MTDA 1R58A 4U7DA 4M6XA 1D8KA 5EEGA 5HLIA 1FSEA 1FYMA 2MA3A 1JGSA 1MDMB 2JPBA 2FXAA 1XMAA 2KJBA 3E5QA 1KQ8A 3LAJA 3ZMSA 3WE3A 5HDKA 4Y13A 4HAMA 1BBYA 2QQ9A 4I09A 1J7KA 1A04A 5LHGA 4Q47A 2L54A 1S7AA 3CLOA 3VFZA 2ZNYA 1FYKA 1KYWA 2EV0A 2Z99A 2NAZA 3HSFA 5DCMB 1UCRA 3C18A 3BPXA 5DCMA 4WF2A 4UVAA 1XGMA 1G3YA 4G7HF 3ROUA 1FY7A 1Z6RA 4LJZF 4G6DA 6PAXA 4L9TA 2V1UA 4M74A 3R61A 2EJRA 2JSCA 2ISZA 2ISYA 2DT5A 2DBBA 2HWVA 1IRFA 2GXBA 1S6LA 1SFXA 2IA0A 5HVQC 1SFEA 2ZJ2A 3VODA 1V4RA 3FXQA 4KN7X 1BIBA 5L3DA 1E17A 3BDDA 1J75A 2W84A 1ZHFA 1IN4A 4EV0A 2Y0MA 1S7OA 4EGZA 2DAOA 2F5DA 2O03A 3OV8A 3DKWA 3HHHA 3GEZA 1I5ZA 1QPMA 1P2FA 1T0FA 1J2XA 1IRGA 4DQ2A 4R8HA 1S8NA 3DFGA 3ZN1A 1K7AA 4M72A 1K6OA 2E1CA 3CUQB 4HF0A 3SHFA 2KIUA 4IRIA 1KU7A 2DPDA 4HX7A 2PMUA 2COMA 2V9VA 1S29A 4I7HA 4OOIA 1YO5C 4PDKA 3I59A 5BQTA 4CGZA 2DLLA 2OAZA 4ESFA 2H27A 4JQFA 2P4WA 1ZARA 2QQAA 1YFHA 2GA1A 3F8NA 4A5MA 1J0RA 2QWWA 2NNNA 4L9JA 3BJOA 1ZYRF 3KLOA 2BE5F 2O3FA 3VEPA 3E6BA 3ZMVA 1FX7A 2CW0F 3FMQA 1P4WA 4ESJA 1WKMA 3GZ6A 2V79A 2E7XA 3QOPA 4I2OA 3P7NA 2H6CA 3E5XA 2BV6A 5ICGA 1OYYA 4HQMA 3RPUA 3QP6A 4IJAA 1ZLJA 2NRAC 3T5XA 1B59A 1TLHB 3GYHX 5BPDA 2W25A 2ZBKA 1MJ9A 3HIFA 1LDJA 2VC0A 1C0WA 1YTYA 3JW4A 3BWGA 3L9FA 1DPUA 4I0BA 4EJTA 1IUYA 4U88A 2LNBA 1JXSA 3GLXA 4ZYGA 2K4JA 3I54A 3QAHA 4FX0A 5DV5A 1FZPB 4BYYA 4RGRA 1IAWA 3F22A 2LSOA 2VBWA 2PFBA 2MLGA 2FBIA 2IVMA 2DTRA 2M1BA 2ZCWA 2JPCA 4YG2F 3R0JA 3FF5A 4RAZA 1MKMA 1PP7U 2W24A 3BPVA 1IN7A 1LQ1A 1HKQA 4CDGA 4M9XA 1QZYA 1AOYA 1K79A 3JSPA 4L0ZB 5FFZA 4OIPF 4GCVA 2RQPA 5JVTA 2E1NA 2H94A 3B73A 1XGOA 2ETHA 1OKRA 3HRMA 1XD7A 4LG0A 3QPTA 3ZMTA 2OQRA 5E18F 2K02A 3E5UA 3KP6A 1FT9A 1TQMA 4DNCA 1TW2A 5JFRA 2HKOA 1XDSA 4BHCA 4ENMA 2VONA 2Y75A 1LNWA 3CUOA 2P7VB 3ZP5A 4ENNA 3RDIA 4CZZA 2RNJA 4CHUA 3IWZA 4L0YB 3GFLA 1SFUA 1KGSA 1TW3A 3RKYA 4EM1A 3RIRA 1O3QA 1T38A 3E6CC 1U78A 2GWRA 2P7CB 2P5VA 2EV6A 2VBZA 2EFPA 3JSOA 2JZYA 2XGXA 2JRTA 4NQWA 1R1VA 4XLNF 4ZYHA 5IT3A 3QU6A 3DF8A 1B1BA 2D1HA 1F4KA 4EJWA 1U5TB 2DPUA 2FMLA 1LEBA 3Q5FA 2XRNA 4O6JA 4UVCA 3EETA 4IPAA 3QP5A 5CVIA 1GXPA 4IF4A 4N9IA 4PCQA 3TO7A 1SMTA 2GAUA 5JI6A 1XMKA 2BYVE 2QYOA 4PZJA 4XLPF 2RVCA 2QQBA 2Q8KA 4RB3C 3ERED 5LLQA 4KMFA 1SD4A 2IPQX 3KCCA 5D8LB 3KETA 2IT0A 3W6JB 2J5OA 4HDUA 2EK5A 2XAGA 4ZH4F 2PMHA 1I6XA 1GHCA 3R60A 2PI0A 3KP2A 3J81Z 5J8FA 4WXHA 1KU3A 4IVNA 1LB2A 3WTZA 5CVJA 2HKXA 2G7HA 2LDUA 4UHTA 1MJBA 4LK0F 1YLFA 5LRRA 1R23A 3C1DA 3HTUA 4XSXF 1DP7P 4KNYA 2KIMA 3WTTC 3FMSA 4G7OF 1ODDA 1XGNA 3QPHA 3H92A 5ERIA 2WWYA 1WRJA 4NB5A 1ZREA 4K2EA 3FX3A 3WG9A 4EJUA 1OR7A 2L02A 1U2WA 5KK1A 2QVOA 1TTYA 4RB1A 3PFIA 1XSXA 4KDPA 1TQIA 1JHHA 1OYWA 2OQGA 4ZYDA 3CUQC 5D5VB 3GFJA 1S3JA 3NQOA 1BI1A 1OMIA 4QLCU 1STZA 1BI3A 4RGUA 3RTRA 5FB2A 1ZG3A 5FD6A 2XAJA 4L5JA 1K78A 5JHUA 1HW1A 2F5CA 1SMYF 2EV5A 2W85A 4RB0A 3V4GA 4G9YA 2A61A 1W7PB 4H0EA 2JTVA 4HA8A 3SZTA 4UUVA 2ZMEA 4A0YA 4ZZDA 5F64A 2H09A 4WCGA 5E1XA 1XGSA 1TQPA 5FLXZ 1VTNC 1G3WA 2D45A 1QQIA 4JK1X 3SQNA 1FOKA 4HQEA 3FXUA 1HBXG 4KMUX 1SD5A 1YW9A 2HTJA 2VODA 1WI9A 3JTGA 4LLNA 3I5UA 1G3SA 2STTA 5DDGA 4LD5A 4A6EA 3ELKA 2CWEA 5EEHA 1P4XA 3WGHA 4R79A 3TQNA 1ON1A 4ESBA 2QZ8A 2OZ6A 4HDVA 5E1ZB 1PDNC 5A2QZ 2KJCA 3V7RA 2IW5A 2DK5A 5ILVA 4YFNF 3IKTA 4FT8A 4LB5A 1XCBA 2PLYA 1Z7UA 2Z5UA 2E7WA 3LQRA 2R7DA 1USTA 3RI4A 2VBYA 3TGNA 2UXNA 3MZYA 4I98B 4CO8A 2P6TA 4A0ZA 1O3TA 2RDPA 4WXDA 1WQ2A 1IN6A 1R1UA 4ENKA 2TDXA 2DK8A 2D2WA 2FQ3A 1R22A 2OU2A 1B9NA 2A6HF 3FM5A 1RNLA 2DQRA 1W5TA 5CVVA 5DEQA 1U3EM 1QBJA 2OBPA 2UXXA 4KN4X 2AXLA 3T1BA 3K1NA 5BS6A 3F8CA 4Y15A 4WWCA 4MEYF 1FP2A 1O57A 4UV8A 3H3UA 3U1DA 4PGHA 4EMSA 2GA2A 4EQQA 3FXRA 5LEJA 3IWFA 2O8XA 2L4AA
chains in the Genus database with same CATH superfamily
3S3OA 5L3BA 3I59B 2FBKA 3PUFA 3SFZA 5KHDA 3F3XA 5DUIA 3AAFA 3S8PA 3IKVA 2FRHA 1YHQI 5BMZA 4HF2A 4IXAA 2HGCA 2HVQA 3AFHA 1ZH5A 4PJJA 2CUFA 5HNHA 1T2KA 5IOYA 3LAPA 3COAC 2Y0SA 2WAFA 4M9ZA 4XNFA 2ZJPF 3DTKA 2PJPA 1ETWA 1PUEE 2IS4A 3A01B 3HUGA 2V6EA 4KITB 3LA3A 1YI2I 5GAHJ 2XPUA 1IZ1A 3MEXA 2WV0A 4GRIA 3RSNA 2MC3A 1IRXA 2GBYA 3E97A 2FA5A 2HS5A 5H6QA 2YX4A 2XUBA 2D1VA 3R4KA 2VQCA 1WI3A 5D4RA 2UZKA 1LFBA 1HXDA 2A69F 4EJOA 4X0GA 4EJVA 1ORKA 1K61A 2QUFA 4YIIA 1P7JA 1Z6TA 2DMPA 1RC9A 2VC1A 4P9UA 2CO5A 4O5VA 1MZBA 4RAYA 1HDDC 1YS6A 4X1EA 2GOMA 3GVAA 3PL8A 4EVIA 1BM9A 2ECBA 3FMRA 1J9IA 4BEHA 1HOMA 2M8EA 4OIRF 2RGVA 2DJIA 1QO0D 3A0BC 1T08B 3OYNA 1U5TC 2AQEA 3ZMDA 3E6MA 4FETA 1XSVA 2CFOA 2DU9A 4CYDA 1YQAA 3K1MA 2VQHA 3KP5A 5D5XB 5E8IA 4OWRB 5B1BH 2R7OA 3N4MA 2KRHA 4D9JA 1UJ8A 3ABTA 3H3VK 3BZ6A 3U2RA 2DFFA 2K86A 2EFNA 1VZ0A 1B8IB 3M1EA 1BI0A 3PUBA 3OOPA 3ZCOA 1SANA 3DLAA 3FXMA 1FOYA 5IT9Z 1QNTA 2YSRA 5FKLA 1GLNA 2EZHA 2EZIA 3CF5F 1ZGAA 2CS3A 1X19A 2CYYA 1ZRFA 1T98A 2DFIA 3OYMA 3DV8A 2DQLA 3HRTA 3ESWB 1ETXA 4HV5A 2OZUA 1TNTA 2XHKA 3CO7C 1FMWA 2M7BA 2OUMA 5D4SA 2VASA 2M4KA 3L2VA 3FKJA 2JA8J 1HSTA 3K70D 1HW5A 4FASD 1LDDA 5CVUA 4KICA 2K9QA 1VQ5I 4DYCA 4UXNA 2ESHA 5K5RA 3E0JB 3V8JA 1YIJI 3F8MA 5HLGA 1F1ZA 3K9TA 1BR2A 1QGPA 5LGNA 3JCUC 4IQ4A 1V3FA 3FHZA 1ETVA 5HDNA 1MGTA 2IA1A 5B5EC 1Y1VJ 3PQJA 1FYLA 5TJJA 3CJTB 1D1BA 5L3GA 2G7UA 2HYGD 3K4MA 5D6FA 4KA4A 2M9HA 2Z9OA 1QA6A 3PO2J 2HQRA 4OINF 3P9CA 1GDTA 4CICA 1W0UA 1BR1A 2X9DA 1TWGJ 3IUOA 4E7KA 3CC7I 3FHNA 1OPCA 1TT5B 3K4BA 3JRDA 2UV1A 1R71A 3JAMZ 3EPZA 1RIOH 2PG4A 2ZXJA 3FISA 5BOXA 1CF7A 2H8RA 1YIOA 4M6YA 3KEYA 1T56A 2RAEA 1V5FA 2G0EA 1A5JA 2P8TA 2BW3A 4LIVA 4YIFA 2KDZA 3HRSA 4XN0A 3CO6C 4IRHA 4KFCA 4A69C 5KCMA 2E5NA 4XLAA 4V2FA 1OR7C 2W4SA 2K9MA 2QEXI 1Q1VA 3K0LA 2BHYA 2JUCA 2KL4A 4ASNA 5KAIC 2XROA 1AU7A 2IA2A 1OCZH 1QHHD 3PQKA 2LBFB 3UNGC 2V1DA 1ZKGA 2MH2A 3KP4A 4UUTA 4LLGF 4IX7A 5E17F 2WA0A 5FO5A 1XB4A 4HOBA 3T0YA 2FNPA 4HV6A 4P96A 4LG0B 1Y39A 2NVYJ 1YJWI 2HPIA 2KRCA 4FX4A 4B09A 5ED4A 2R7VA 4BNCA 2GZWA 3H0GJ 5J1UA 4Y52J 1UHWA 1WJAA 1Z21A 3BG6A 3G3ZA 1AWCA 4CCNA 2D5VA 5L3CA 2O8KA 3WU0A 2O5RA 4L9VA 1Z9CA 2KFDA 2WB1A 1WSUA 2VPRA 1FTZA 2X6OA 4A3KJ 4I76A 1MD0A 3CCUI 3S93A 2XVCA 2A05A 4UV9A 2XKPA 5DCFA 2EINH 3CDHA 3TO6A 5E8GA 4CXFA 5C4JJ 4HLYA 2M87A 2EIKH 4CSWA 3HM5A 3C7JA 1TL8A 3TP0A 2BY2A 1MSEC 3LSRA 2HZTA 2Y31A 2MC4A 4XICA 4BBSJ 4CUGA 4P9FA 3J80Z 2ZMEC 2E2JJ 1LJ9A 3SJMA 4BHBA 2YU3A 3RKXA 4GO1A 4LMYA 3GZ5A 1TWCJ 2R5YA 4XRSA 1ZG1A 4HNTA 3CCJI 3BJ6A 3FDYA 2PN6A 5IY5H 4CZCA 4N4NB 2R0QC 4J19A 4WK8F 1J59A 1IXSB 3BP8A 1GVJA 4XONA 1RUNA 4NQWB 5AIPA 4GXOA 2CQ7A 4XLEA 3OL4A 2L4MA 3R0AA 2M4GA 5F0FA 5IYDJ 1YJ9I 4C2TA 4LB6B 1VQKI 4PK4A 4KIFA 1JGGA 1ZTRA 1VQPI 4HX8A 2P5LC 2V1NA 1WJCA 3JRCA 5FLVA 3KPHA 2LMDA 5BNGA 2MSYA 3MZHA 3CMMA 2BOLA 4RM2A 1G8XA 2DO7A 1MBKA 5E20A 2MW8A 3ASOH 3OSFA 4XN3A 1G6NA 1QRYA 1YRNB 4E70A 1FBSA 2CQNA 5M5WJ 3S16J 4BJ6C 1JT0A 4KIGA 1UAAA 1MMNA 1WH5A 2M5WA 4RGXA 5DS9A 4HZFA 3W2VA 1BOAA 3KZYA 3VSKA 2LKPA 1TWHJ 3T8TA 1G4DA 2XASA 1XX5A 1BC8C 3CZ6A 1X2MA 2AXTC 2M7AA 5CVRA 4B43A 2LY9A 1T6SA 3C2GA 1IW7F 2M3AA 3SZPA 3PNYA 1OYIA 3F21A 4ZDPA 4A3DJ 4A5NA 3OS1A 2CQKA 2VJ4A 3D5SC 2CH0A 3HB9A 2R7FA 5J40A 2B9SA 3PNVA 3LFKA 1R5GA 3HRUA 1WJFA 5EYRA 4NHJA 1BJZA 1H9TA 1UB9A 4XRFA 1PP8F 2I5UA 4LGWA 2HEOA 1QHGA 1W4MA 3CTAA 4UUSB 1R4NB 1EV7A 1ZGJA 3QYFA 2UUZA 2L01A 1USSA 2ZJQF 1SD7A 3LSMA 3ABLH 3CD6I 5GPCA 3I4PA 2DOAA 3DXJF 3R6SA 3BROA 3IL2A 2EB7A 3DEEA 2KZGA 3OY9A 1BJAA 1NHAA 2J5PA 4AVPA 2VI6A 4AIDA 1V5EA 1JKOC 2Y69H 1VQ8I 1WJDA 2Q0OA 2ELKA 2DFHA 5BPIA 3FXJA 3PSFA 2R7QA 3QOEA 4MGRA 2V1XA 2XC7A 2RQQA 2F48A 5F0CA 1Y8QB 3LA7A 3KP3A 3K2ZA 3N97A 1YX5A 1O7LA 5D5WB 3WODF 3CCQI 1J09A 1SD6A 3HBLA 1EH7A 5HLHA 4EGYA 1P92A 4E7HA 1DUXC 2LTPA 2XGCA 1B6AA 4D5CA 2LD5A 3PJRA 3TMOA 1D0XA 2Z16A 2GIVA 5F27A 2CG4A 3H1CA 2F5FA 2JVHA 2Y9YA 2L7KA 5HOOA 3HSEA 5DM7F 2OTJI 1LEAA 1IXRC 3B02A 1I39A 3HOWJ 2LVSA 1VI0A 4ZZLA 2L5QA 2PBIA 3REOA 2VE8A 3TW6A 1T39A 2DA2A 2YUSA 2GIZA 3DQVC 2CFXA 4R1HA 2BY0A 2ZSIB 3RKWA 1ZLKA 5HLTA 1DGWY 3TKYA 1FSHA 3GTPJ 2NS0A 1H8AC 4AIHA 1RUOA 2H1LA 3A1YA 3I71A 4C3JJ 3K69A 3TOAA 3TOBA 5ICCA 3HJEA 5H20A 1SFKA 3JTHA 4NUBA 2E1MC 1VQ6I 3ZQHA 2MGQA 2L4AA 3O3KA 1UELB 1ZK8A 2OV7A 3EUHA 4AIJA 2JA6J 3GX4X 3E3VA 5FFXA 3D5LA 5L3FA 1PUFB 3BT9A 4RB2C 1K78B 2YS9A 3HSRA 3OYGA 3AKZA 3ZOBA 2QGUA 4G6QA 2HTSA 1EH6A 2VT3A 3GO5A 1ZG5A 5K5OA 4I01A 3U9GA 2QENA 4ZYAA 2YPRA 1POGA 4IHYA 1W5SA 4C3IJ 2EFQA 4RM3A 4IOAF 2CW8A 2WAQA 1Y0UA 1IXCA 3EDPA 3ULQB 2O61A 4XOTA 5AIQA 2CV1A 2FD5A 3A03A 3VSLA 3CC4I 3BG9A 2ZMEB 4XL9A 4BACA 4IKFA 2UWMA 2IJLA 1MIJA 2MG4A 2PQ8A 3HKZN 1IDZA 3S14J 3MFKA 4G94A 5F6FA 3KFWX 1BR4A 2F4IA 2NYXA 4KYWA 3ASNH 3IHUA 3WTWC 2CV2A 3S2WA 5HS7A 5TGTA 3GW2A 4M71A 4P1WA 3V7CA 3Q0VA 2OA4A 1NG6A 5F1RA 2DI3A 4P55A 2K40A 4C3HJ 2OD5A 4EM0B 3KEOA 4MQ9F 1R00A 1ENHA 4N9HA 2XSJC 4IHWA 5ILSA 3F6OA 3OWTA 4KT5C 2I8DA 3F0CA 3M1CA 2B63J 4G6TB 3HOTA 2A07F 2LLKA 1XN7A 3NRVA 4UB8C 1HDPA 1KQ0A 1FC3A 2XDVA 1YW8A 4OAYA 2EIJH 2RNGA 3BCBA 1H89C 1MDMA 3TDZC 5F04A 2ADUA 1ULYA 4KIBA 3BR3A 1OLTA 3J7AO 2HI3A 5LGTA 1IF1A 3W6KB 2W1OA 1RI7A 3P5JA 3J81K 4RGSA 4EATA 3TW7A 4BAYA 3DTEA 1G2HA 5D8KB 1X4OA 5DYMA 3OIOA 3JRIA 1MNEA 3ECOA 1GV5A 2JUGA 1ZGWA 2P81A 3CCRI 3V7SA 4BHPA 9ANTA 1ZRDA 1D0YA 2ZNZA 1WVRA 2EA2A 2K3PA 1RPWA 2QA4I 3GUDA 1VQ4I 2CSOA 2LK2A 5DUKA 1M1EB 2L9SA 3KLNA 5GAGJ 4IHTA 4M3FA 2EIMH 2QM3A 1CGPA 2HVRA 5K7FA 4M73A 1KQ9A 3QWLA 4Y33A 1E2XA 4NC7A 3GF2A 4RA2A 5K7ZA 2FUG2 5EG0A 4Z6YA 2Z3YA 2HQNA 4PUSA 4U0YA 2FMYA 1BA5A 4E7JA 4XOPA 4OIOF 2Q1ZB 3CMAI 4CYCA 2BXYA 5LBQA 1L0OC 4B47A 3SZGA 1GVDA 5J6XA 5E3NA 2QSFX 4CCOA 3I58A 2VXZA 1IV6A 3KEQA 3LMMA 3VPRA 2EA4A 2FOWA 1FPQA 4XKWA 4XBFA 2HR3A 3L09A 3LSTA 2E2HJ 4D0PA 2LKXA 1APLC 2BVLA 3F6VA 2R7ZJ 5KVRA 3WG7H 5K7HA 1OJLA 2KKOA 2XAHA 2XV4S 3ZR8X 3NARA 5CYVA 3OYAA 2GQQA 4OU0A 1Z3YA 3GTLJ 3TDUC 4UNOA 3DWLE 5JR3A 1H9GA 1WJ5A 5M3MJ 3C3WA 3WTXC 2KHMA 5D6EA 4F91B 2R4GA 3I3LA 2DA6A 4DIQA 1XS9A 2R5ZB 4BQQA 4CH7A 1EH8A 1REPC 1WFXA 1QVUA 1FLIA 1P6RA 1R49A 1LKXA 1KYZA 4BQOA 2XAFA 1VQLI 2KLOA 3EYIA 3DEUA 2QF7A 3DU6A 2HVSA 3LWFA 4I0AA 1YX3A 3O6BB 3ZPLA 3RYRA 1P7IA 2LG4A 4DZJA 4JX6A 3ZMUA 4E7SA 3WTSC 2MD5A 3F23A 2BHZA 5ILUA 2QSGX 4IHVA 2FQ4A 1HKSA 1KA8A 1TT0A 4MTEA 1VQMI 2QBYB 3I64A 2QBYA 1O3RA 3F8BA 4NC8A 5LHHA 1K6YA 3G4SI 3CUQA 3MKLA 5ICFA 3OYDA 2DTZA 1CQTA 2I10A 1LDKB 2A6EF 4RLFA 1X3UA 1W36D 5FLXK 2P5KA 4LIUA 3S1NJ 2K3FA 3BG7A 2KIQA 5LHIA 2NOJB 3HUGB 3G73A 3OYFA 3ISPA 1BIAA 2QKLB 4A3CJ 1JUSA 2HU9A 3HOXJ 1SC7A 2BBYA 3E6DA 1BOBA 1ZRCA 4FHTA 4MFEA 2STWA 1DQUA 5H6RA 1W1WE 2FSWA 3BR6A 1R1TA 1EF4A 4A3MJ 5DD8A 1XCVA 3IRQA 3V8LA 1QZZA 2DT6A 3GZNB 5E3OA 1XSDA 2JA7J 2RC4A 1Z0XA 4BEHB 4UB6C 3HOVJ 4MEXF 1JKPC 2HQAA 3KP7A 2KRFA 3L2WA 2JRMA 2V6CA 2F5EA 3IC7A 3WGGA 3ZQ7A 3JRHA 3L2QA 3CCVI 3BJAA 1B9MA 1F9NA 2RV8A 3KZIC 3IRRA 1UMQA 1FWZA 4W1UA 1MH4A 2LOOA 5A2QK 1ZAOA 1ONVA 2ME0A 1MMDA 2DODA 2EPFA 1GUUA 5CPRB 2WTEA 3L2UA 3LSJA 4BGDA 2Q2EA 4KISA 3Q9SA 4NNJA 1ZN2A 3S3MA 3L7WA 3FK6A 1B4AA 4M6VA 5FKKA 2ZFWA 2FF4A 5DTDA 1DDNA 4A3GJ 1VQOI 1T33A 5L3EA 2LF8A 3NAUA 1UG2A 3H35A 2FU4A 4IHSA 3BC8A 2YX7A 4P5OA 4QIWN 4ZTJA 3I53A 1F5TA 2WBMA 2W57A 4YEJA 4S05A 3CCSI 4HLXA 4N0BA 3L2CA 2F2EA 4JBAA 4MHGA 4BBRJ 2IS2A 5F0HA 2X4HA 4OIQF 2LR8A 4GYIA 3BOQA 1Y1WJ 2AO9A 1YW7A 3AG2H 3GWZA 3WGIA 4TV7A 1YG2A 3ZMZA 3P9IA 3V42A 1D3YA 3HYIA 2K7LA 4CCMA 5E79C 2FE3A 4G7ZF 1BC7C 5HDGA 1IN5A 2XKOA 4Q4ZF 2ZO4A 1WWXA 1Z7LA 2XIGA 4IRGA 2HDWA 3HG9A 1VQNI 3PO3J 1D1AA 3CP8A 4KUMA 3RQ4A 4A6DA 3G6EI 2FOKA 4FQGA 2IBDA 4S04A 1MBJA 4RDUA 3JRGA 2HFHA 4M9SA 1CF7B 1KU9A 3AG4H 3MVPA 1FBUA 3CCMI 1I50J 2GM4A 3GFMA 2BW3B 1U0JA 3HDDA 2BXZA 4BQAA 4Q5SF 3DPLC 3H3ZA 2BGCA 3TO9A 2A3SA 4HF1A 1O3SA 2B0LA 1VQ9I 2VE9A 4OMZA 3F8FA 4B8XA 4GDFA 1ETKA 5HS9A 1HSJA 5K5QA 3EYYA 2DOFA 1UFMA 3CCLI 2EZKA 1MNDA 3LSIA 3NWSA 1Z91A 4WXCA 3HTSB 1A31A 2VJJA 1LVAA 4D5FA 2JQ7A 2LY1A 1FBQA 1NG7A 3WU1B 1ERDA 1Y6IA 3MCZA 3CJRB 4XSZF 3I0TA 2JVGA 1BI2A 2XRLA 5FD5A 1WH7A 4IO9F 1A35A 4ZJZA 3IH3A 1D5VA 5HS8A 1I1SA 2M45A 2CGPA 1TP4A 5EEAA 3ZQGA 3VB2A 3S17J 3C2BA 1L3LA 4DBQA 4FTHA 1R36A 2L9RA 4AUXA 3MWMA 1TWFJ 4AWXB 2ZKZA 1XC5A 1SVOA 2KISA 1GT0C 4ZTFA 3WTYC 2L7FP 4AD9A 2YU9J 3OIPA 1X1DA 1JHFA 4DBRA 3CCEI 4AVZA 1LE8A 2VOOA 1G3TA 2QQ8A 1I1GA 3LSGA 4F7ZA 2W7NA 4Q48A 3D0SA 3GBGA 2R3SA 3Q9VA 4PJNA 3ABUA 4RAFA 4GYGA 5AONA 4XRMA 2F5VA 2COBA 3WE2A 4E7ZA 5DM6F 2JWTA 3ECHA 2O0YA 3QU3A 1ITYA 3K4JA 2IRFG 1V5GA 2LF7A 3RYPA 4LLLA 4YFXF 1R5HA 2F6CA 4QTRA 1D8JA 1P4AA 4BXUA 4Y4RA 2EFOA 2XAQA 2R5YB 3RJPA 2BY3A 3WHCA 5C44J 4RLQA 1HF0A 2EWNA 4L18B 3MQ0A 3O2PE 3FM3A 2E60A 1ZQ3P 1S9HA 1BW6A 4HYEA 2BY1A 1W7PD 3BR1A 3FZVA 5K1YA 1GXQA 2IEKA 3K1PA 1UHMA 5IT9K 5LEKA 4PJMA 2LREA 1IN8A 3V8KA 1Y56A 5J1RA 3KE2A 2ELHA 5J4YA 3HOSA 3M7GA 1DGRM 3HHGA 2HOTA 1JJ8C 3EQLF 1AA7A 3FBIB 5TRDA 2R7UA 1O4XA 4I99C 4BH9A 5HNFA 5CJ9A 2FEZA 3BZCA 3PIOF 4QWQA 4A12A 4B3AA 1AKHA 4B1RA 2A5YB 2C6YA 2R7XA 2EQRA 2M30A 3KYLA 3GFIA 1IG7A 1U6GA 1ZELA 4BDYA 1ON2A 2K4BA 3A0HC 3GXOA 3LFUA 1KU2A 2HOEA 5GTIC 2DMTA 3DP7A 3BY6A 3VYTB 3ZQLA 3PNTA 1U5TA 3OYHA 2M34A 2Y48A 2CW7A 2XF5A 3F72A 4BE1A 4DJAA 2YR2A 2X6WA 5LGUA 5CLSA 3OYEA 4ENJA 4CCLA 5JLXA 4MFDA 4BY7J 3BLYA 1T95A 2VT2A 3JAMK 3EUAA 2QLZA 4IOCF 2CQXA 2DFEA 2VKEA 2L3DA 2MLKA 1A6QA 4WX9A 2JT1A 3GTJJ 2P6SA 4FE4A 2MH9A 3T8RA 2WY7Q 3HKZA 1Y8RB 1Z1DA 2G9WA 1IRZA 4G8XA 3KYDB 3LQQA 4RBOA 3SYTA 1R6RA 1F36A 5M3FJ 1X1PA 4UVBA 3AL0B 2MBFA 4BS9A 3M8FA 4MIMA 5JHFA 3H9QA 1VNDA 4F3QA 4LFUA 3K4LA 2HYFA 2VKVA 3OL3A 2VOPA 4LOCA 1S5LC 2VKDA 2NVTJ 5ICEA 2RKHA 2H8WA 5FGMA 4HW0A 4AIKA 2AS5F 1JTXA 1HCRA 2NVQJ 1I27A 2ESNA 4PSXA 1X1CA 2F4MB 4L5EA 4KT6A 1O7FA 2VXDA 2DW4A 2CMPA 4ETSA 4Z2YA 1ZR2A 3VOEA 3MZ8A 3WTUC 2BEOA 1YS7A 1K4TA 3DBRB 4O3MA 3BQZA 2PEXA 4A0XA 1XPXA 2Z33A 1RZ4A 2VJIA 3HPHA 3S3NA 4HSRA 1BN5A 1U8RA 4M3EA 4U0WA 2ACJA 1E3HA 4ON0A 1H0MA 3MAJA 4E7LA 1MNMC 3GLLA 1MJAA 4DYRA 1HQCA 1JE8A 1TBXA 4YFKF 4L9NA 2FNAA 2PX9A 4HBLA 1A6IA 1FP1D 2HDCA 5FKOA 3JREA 1HKTA 4XKVA 3ZQCA 2FBHA 1J5YA 2JSPA 5J8CA 2X0LA 3S1RJ 2VBXA 1PYVA 4MLOA 1FOWA 4ZYEA 1JKQC 1MW7A 3QPLA 2OJED 2RN7A 3CJNA 4A2UA 5LRSA 3M9AA 3P9KA 1OCTC 2EBIA 4XQFA 2KIFA 3J80K 5E1WA 1DPRA 1V55H 1JUPA 4S0HB 3OOUA 5DD4A 1R7JA 1XDUA 1YYVA 2L9NA 3FWEA 3OYBA 3DPTA 5D5UB 4RS8A 3FXLA 4XMYA 3S1QJ 3DLLF 1N78A 3HL2A 2GXGA 3WTVC 2H6BA 4IEJA 4PGGA 2LRDA 4LK1F 4MQVA 4U7BA 4A3FJ 3HOYJ 1Y0NA 2A68F 3CF2A 3KZZA 2IGNA 4L5IA 3ZN0A 2M0CA 2VN2A 4CCKA 4RMNA 1LFUP 1SAXA 3SXYA 4I02A 2Z1DA 2EH3A 1TNSA 1ETQA 5TISC 4MNUA 1I3QJ 2LH9A 4OMYA 3QRFF 3M8EA 3ML6A 5IYCJ 2W48A 2EFWA 2VLAA 4HX4A 3LA2A 4DW6A 1OISA 3L00A 4Y17A 1HW2A 3DPUA 3NEUA 1FNNA 1RR7A 3HEFA 4V19K 2VIXA 3M07A 2K27A 2IP2A 3IH4A 3RPQA 4EM2A 3HC7A 3L2RA 4GGGA 4W97A 2O6GE 1Q1HA 3D5RC 3A2KA 2WC2A 3IP4B 4U0VA 3BQYA 5IP9J 3G71I 1DU0A 2K5CA 1LPQA 5GP9A 2NNYA 1Z05A 1W7PA 4MTDA 1R58A 4U7DA 4H4KC 4M6XA 1D8KA 2DCEA 3N05A 5EEGA 5GTHC 5HLIA 2N8GA 1QZEA 1FSEA 2CJJA 2ZXIA 1FYMA 5FRNA 2L2OA 2MA3A 2DYSH 4RAGA 3UKGA 3RPUD 1JGSA 2CUJA 1MDMB 2JPBA 3GTMJ 2FXAA 3BR2A 1XMAA 2KJBA 3E5QA 2WADA 1KQ8A 2PMZN 3LAJA 3ZMSA 3WE3A 2VQGA 5HDKA 3WU2C 1V54H 3MKZA 4Y13A 2GLOA 4HAMA 3LSKA 1BBYA 4NBQA 2LC2A 2LYCA 1UHSA 2QQ9A 2ID3A 4I09A 1J7KA 4C30A 4J00A 2LY2A 1A04A 4JOMA 5LHGA 2M8GX 4Q47A 1IC8A 3K10A 2L54A 1SVLA 3H5AA 1S7AA 3CLOA 4FISA 3VFZA 2ZNYA 5LFAA 1FYKA 1A36A 4YRVA 1KYWA 2EV0A 2BVMA 1MBGA 1E3PA 2Z99A 4BU2A 1EKEA 3U21A 1NTCA 5EJCA 2NAZA 2W00A 3HSFA 5DCMB 1UCRA 3C18A 2ZFUA 1KZHA 3TEDA 3BPXA 5DCMA 3IAS2 4WF2A 4PSWA 1EJ9A 5IP6A 5EG0B 4XLHA 4UVAA 1XGMA 1SEUA 1G3YA 1RETA 4G7HF 3G1LA 4A3LJ 3ROUA 1FY7A 2MYSA 4IL6C 4CYCB 3CMEI 1IO2A 3K6GA 1Z6RA 4LJZF 4A3BJ 3CMYA 2XGEA 4G6DA 6PAXA 2A5WA 2DMNA 4L9TA 3CQZJ 2DA4A 3HOUJ 2V1UA 1AHDP 1B72A 4M74A 3SFIA 3D1NI 3BG5A 3R61A 2EJRA 3J7YJ 2JSCA 3CC2I 1X2NA 3BTCA 2VKHA 2ISZA 4YIRX 5J47A 2ISYA 3LL7A 2DT5A 2XAUA 2QSHX 3I4MJ 2DBBA 2HWVA 4Y7NJ 1HC8A 1IRFA 5GADJ 1YITI 2GXBA 1OCOH 1S6LA 1SFXA 2IA0A 2LFBA 2Z2SB 2VB6A 5FKNA 2HZDA 5HVQC 3QYEA 1SFEA 2ZJ2A 4ZDOA 2XB0X 1PJRA 3EUKL 3G1MA 1V4RA 3VODA 3FXQA 4KN7X 2ZC2A 3M3YJ 3H5RA 1BIBA 5L3DA 1E17A 3BDDA 3DTIA 1J75A 5F1JA 1SAUA 1ZHFA 2W84A 1IN4A 1FIPA 4AU7A 4V2GA 3RZDJ 3BZKA 4EV0A 2PJRA 2VL8A 4HNUA 4JX5A 2E5ZA 2Y0MA 3PIPF 2HOSA 1S7OA 5EGOA 3QQAA 1X3WB 3SDBA 4EGZA 3SEZA 2DAOA 2ZXWH 2F5DA 2O03A 3OV8A 4M3GA 3DKWA 3HHHA 2DDBA 3GEZA 1I5ZA 4IQJA 1QPMA 3S2DJ 1P2FA 1T0FA 4E4HA 2DMUA 1SFOJ 4M3BA 4BKXA 2K85A 1J2XA 2V9PA 1IRGA 2L0KA 2OPTA 2W82A 4DQ2A 4R8HA 1S8NA 2O9LA 2DJNA 3DFGA 2X6YA 4EEFG 1JUMA 2KDOA 3ZN1A 1K7AA 4M72A 1K6OA 2E1CA 3CUQB 1H88C 4HF0A 2Y30A 3SHFA 2KIUA 3RQIA 4IRIA 1KU7A 2DPDA 4M3DA 4I6ZA 4HX7A 2PMUA 2COMA 2V9VA 1S29A 4I7HA 4BXXJ 2HXOA 2H1KA 4OOIA 3W3CA 2X1CA 4A3IJ 1FMVA 1YO5C 4PDKA 1S7EA 3I59A 5BQTA 4E6KG 4CGZA 2DOEA 1GV2A 2DLLA 2OAZA 4ESFA 2CU7A 2H27A 4JQFA 3WHBA 2P4WA 1ZARA 1WJBA 4AYBN 2QQAA 3K4CA 1YFHA 1U9OA 1NK3P 1FIAA 3H0DA 2GA1A 3F8NA 4A5MA 1J0RA 2QWWA 3A01A 3FK7A 4LG3A 4BJ5C 1RR8C 2NNNA 1IDYA 4L9JA 1IGNA 3BJOA 1ZYRF 4A3EJ 4UY8I 1U9NA 3KLOA 3ONQA 4JP0A 4PFPA 4CCJA 1VF9A 2BE5F 2O3FA 3VEPA 5B66C 3E6BA 3FXOA 3ZMVA 1FX7A 1D0ZA 2CW0F 2Q2EB 3OR1C 3FMQA 1P4WA 4ESJA 1WKMA 5FKMA 3GZ6A 1XMXA 3W2WA 2IGMA 5CQGA 2V79A 2E7XA 3FIWA 3QOPA 4I2OA 1FOXA 2VJ5A 3I56I 3P7NA 2H6CA 3E5XA 2BV6A 2IGOA 5ICGA 2MD0A 1OYYA 4HQMA 5F08A 3RPUA 1IUFA 3QP6A 4PJ0C 4OAZA 4IJAA 1ZLJA 2NRAC 4BQNA 3ZRGA 3T5XA 1B59A 3IAM2 1TLHB 3GYHX 5BPDA 1IJWC 5J3LA 3VYSB 4XM3A 3OYJA 2W25A 3ZXSA 1B8IA 2XB5A 1T8IA 2ZBKA 3RKQA 4YELA 5EF6A 1MJ9A 3HIFA 3KIOA 3C2HA 1LDJA 2VC0A 3H9JA 5B3SH 1C0WA 4II3A 5IYBJ 1YTYA 3JW4A 3K70C 3BWGA 3L9FA 3AL0C 1DPUA 3CCYA 4I0BA 4EJTA 1IUYA 2R7WA 4U88A 3S1MJ 2MABA 1MMSA 2LNBA 2JK3A 5IP7J 1JXSA 5JVGF 3GLXA 2X1DA 2K4JA 4ZYGA 3I54A 3QAHA 4FX0A 5DV5A 1FZPB 2CUZA 5C4XJ 4BYYA 4II2A 1QPIA 4RGRA 3SDGA 3GTGJ 3ZQFA 1IAWA 3VWBA 2XF6A 2K9NA 3F22A 2LSOA 1K4SA 2VBWA 2PFBA 3HGGA 1E0EA 3HGYA 1ACIA 3I9V2 2MLGA 3JRFA 2FBIA 2IVMA 2KMUA 2DTRA 2M1BA 1WPKA 2ZCWA 2DA5A 3FXKA 3JRAA 3DBHB 3H36A 3FKIJ 3TBIA 2JPCA 4XORA 4YG2F 3R0JA 2E35A 3FF5A 4RAZA 2M0MA 1MKMA 1PP7U 2X6XA 2Y0SN 1WCMJ 2W24A 4DGWB 3BPVA 2X85A 1IN7A 2DYRH 1LQ1A 2V26A 3AG3H 1HKQA 3G1OA 1MBFA 3B6CA 4M9XA 4CDGA 4QSHA 1QZYA 3OYKA 1AOYA 2KZVA 1S72I 1X3ZB 2ELJA 1K79A 2JA5J 2AHQA 5EDNA 4N4OB 3JSPA 4L0ZB 5FFZA 1NH3A 4OIPF 4GCVA 2RQPA 5JVTA 2KQRA 2HNHA 3EUHC 4IHXA 1SVMA 3J7ZI 4IZZA 2XF7A 2E1NA 4PJLA 4XRSG 4BE2A 2H94A 3B73A 2LBFA 2ZSHB 2OF7A 1XGOA 2ETHA 4HNVA 1OFCX 2RREA 4BUPA 1HA8A 1QVTA 1OKRA 2A6TA 2WY8Q 3HRMA 3IV5A 1YJNI 1LE8B 1XD7A 4LG0A 4ZDLA 3GCMA 1QU3A 3QPTA 3BR5A 3ZMTA 4DZPA 2OQRA 5E18F 1VFCA 2K02A 2IXSA 4ITVA 3E5UA 3KP6A 4HSTA 1FT9A 2IAIA 1FJLA 1TQMA 1IV8A 3ZQQA 4DNCA 1TW2A 5JFRA 1R5ID 3OMYA 2HKOA 1XDSA 4BHCA 4ENMA 2VONA 1FEXA 2Y75A 1LNWA 3S15J 3DKYA 3K4KA 2OC6A 5E3LA 3CUOA 1WGXA 2P7VB 3ZP5A 2E34A 4ENNA 1JI8A 3RDIA 4CZZA 2L7MP 2RNJA 5JLWA 4CHUA 3IWZA 4L0YB 3CDLA 3RCOA 3GFLA 1SFUA 3K7AJ 3E7LA 1KGSA 2OCCH 1TW3A 3RKYA 4EM1A 2NS7A 3RIRA 3F9KA 2V4JC 4C9YA 1O3QA 3CJQB 3VYUB 1T38A 2ZJRF 3E6CC 3Q3SA 1U78A 3I4NJ 1E3OC 3HZJA 4F55A 1AKHB 2GWRA 2P0WA 1WHUA 1YOVB 2EV6A 2P5VA 2P7CB 2CV0A 2VBZA 2EFPA 3JSOA 2JZYA 1MMAA 2XGXA 2JRTA 3DCFA 3TL4X 4NQWA 4D7NA 1R1VA 2GXAA 4XLNF 3ZGKA 1Z3XA 4ZYHA 5IT3A 2DT7B 3HPGA 3QU6A 3ABMH 3DF8A 1B1BA 2D1HA 2GOXB 1F4KA 4EJWA 2ID6A 3O8GA 1U5TB 5EZGA 2DPUA 2FX0A 2FMLA 3ERMA 4JYKA 2NVXJ 1LEBA 3Q5FA 4A93J 3DBLB 2XRNA 4O6JA 5FJ8J 3QODA 4XR6A 4UVCA 3EETA 4IPAA 3H9GA 1YRNA 3DKXA 3QP5A 5CVIA 2FJ1A 3X2QH 3OS0A 1RESA 1ETOA 2K9SA 4DOZA 4IF4A 1X58A 1GXPA 3HOZJ 2OCEA 2WAEA 4N9IA 4PCQA 4F93B 3TO7A 1SMTA 4D1QA 2GAUA 5JI6A 1XMKA 4BL0B 2BYVE 1P9QC 2E71A 1Z67A 2QYOA 4PZJA 4XLPF 2RVCA 2QQBA 2Q8KA 4RB3C 3ERED 5LLQA 4B3XA 5GPAA 4KMFA 1SD4A 2IPQX 2X51A 3KCCA 5D8LB 1VQ7I 3JR9A 2AQFA 3KETA 2DMQA 3W6JB 2IT0A 2R7TA 2J5OA 4HDUA 2EK5A 4BJTA 2XAGA 4ZH4F 2TCTA 2M2EA 2PMHA 1I6XA 3DEWA 2HPMA 1GHCA 3R60A 2XPVA 4UUSA 2WB1N 2PI0A 3KP2A 4B48A 3DU5A 3FBNB 2IGKA 3J81Z 4QPOA 5J8FA 1UG0A 4HRIA 2ZB9A 4WXHA 1KU3A 3O8HA 5M5YJ 3M4OJ 5KNLA 4IVNA 1LB2A 1MMGA 3IH2A 3WTZA 5CVJA 2HKXA 2TRTA 4ABZA 2G7HA 2LDUA 4HEA2 4UHTA 1MJBA 4LK0F 1YLFA 5LRRA 2PMZA 1R23A 3B6AA 3C1DA 3HTUA 4XSXF 1DP7P 4KNYA 4U87A 2B7EA 2KIMA 2NXNB 3WTTC 3FMSA 3BTJA 4G7OF 4CA0A 1ODDA 1XGNA 3QPHA 3H92A 3LSPA 3TP3A 2R92J 1JTYA 5ERIA 2WWYA 2IS1A 1WRJA 4C2UA 1JJ6C 4NB5A 5FRMA 1ZREA 4K2EA 2DA1A 1W5CC 3FX3A 3WG9A 1MBEA 3OS2A 2DA3A 4EJUA 1OR7A 2L02A 1U2WA 5KK1A 1T0FC 2QVOA 1LUJB 2R93J 2ICWG 3GTOJ 1I6HJ 2HXIA 1TTYA 4RB1A 2R7SA 1KONA 2DN0A 3PFIA 1XSXA 4KDPA 1BL0A 1D1CA 1TQIA 4ZC3A 1JHHA 2F4OB 2X48A 4HG2A 3OSGA 1OYWA 2OQGA 4ZYDA 3CUQC 3CP2A 5D5VB 2JA2A 4B44A 1OCCH 3GFJA 3S2HJ 4NC6A 1BW5A 1S3JA 1X1BA 2L7ZA 3NQOA 3S32A 1BI1A 1OMIA 4QLCU 4FCYA 1NK2P 3VDXA 1D5YA 1STZA 4XK4A 5E3MA 1DP3A 3L1PA 1WZ2A 5IOZA 3I55I 2DXIA 1BI3A 1EA3A 4J01A 4RGUA 2QCOA 3RTRA 4F92B 5FB2A 2HYJA 2VPLA 1ZG3A 5FD6A 1PVEA 1JKRC 1PUFA 2XAJA 4L5JA 1K78A 2DA7A 5IPAA 2KT0A 1JT6A 5JHUA 3QYBA 2LP0A 4DYQA 4XIDA 3LNQA 3KX2A 1HW1A 2F5CA 5EZHA 1SMYF 3BTIA 2EV5A 4XLCA 5CKTA 2VQLA 2W85A 1MH3A 4BE0A 2XGDA 4RB0A 3V4GA 1WJEA 4G9YA 3K4NA 5J1YA 2X1EA 2A61A 1W7PB 1N25A 3W2AA 3MN2A 4H0EA 2JTVA 4NDLA 3MKWB 3BR0A 4HA8A 3SZTA 1R9TJ 3U1KA 4UUVA 2NVUB 2XPWA 4A3JJ 2ZMEA 3ABKH 2E2IJ 4A0YA 4ZZDA 2V9KA 5F64A 2NOGA 5C3EJ 2H09A 4WCGA 2CQQA 5E1XA 3OIQA 1LFPA 1XGSA 1TQPA 2E19A 5FLXZ 3GTKJ 1RKWA 3OYLA 2Y9ZA 3MMYB 1VTNC 1G3WA 2O7OA 1QQIA 3LOCA 4JK1X 2D45A 3SQNA 1FOKA 4XKCA 5FROA 4BDZA 4HQEA 2OTLI 3FXUA 1HBXG 1I3AA 4G12A 3BG3A 4KMUX 2JJ7A 4AC0A 1YE9A 1SD5A 1MSFC 1YW9A 2HTJA 2VODA 2DDAA 1WI9A 2EZLA 3JTGA 4AM3A 2R7RA 4LLNA 3I5UA 1G3SA 2LKSA 1MBHA 4ANJA 2STTA 3A02A 1N77A 1XTAA 2ECCA 3Q0WA 5DDGA 4LD5A 4F52A 3CESA 4BXFA 4A6EA 5LD2C 3ELKA 3PM1A 1TC3C 2CWEA 4D7MA 5EEHA 2NS8A 1P4XA 2JN6A 4LITA 3WGHA 3UR3C 4R79A 3BTLA 3TQNA 1ON1A 2QZ8A 3BCAA 2OZ6A 3HXLA 1ETYA 1R4MB 4HPQA 5E1ZB 4ESBA 5GAEJ 5A2QZ 4HDVA 1PDNC 3RZOJ 3PSIA 4AYBA 2KJCA 3V7RA 4BY1J 2QKMB 3G2BA 1LVKA 3AG1H 2IW5A 2JMWA 4XKBA 2XSDC 1OQYA 4FE7A 4MO7A 2DK5A 5J4VA 5ILVA 4YFNF 1B72B 1OCRH 3SEQA 3IKTA 3OYCA 2BZTA 2E36A 5HODA 4FT8A 4LB5A 5CQEA 2HOAA 2KPMA 1XCBA 2PLYA 5H2FC 1Z7UA 2Z5UA 4B4CA 1HLVA 3CDIA 2E7WA 3LQRA 2R7DA 5KAFC 1W0TA 2EILH 1FTTA 3W6VA 1USTA 1X4PA 2VBYA 3TGNA 1X1AA 3RI4A 3E1SA 2UXNA 3Q0UA 3MZYA 1TZLA 4I98B 3NWTA 2IS6A 4CO8A 2P6TA 4A0ZA 1O3TA 2RDPA 4WXDA 1WQ2A 2Y2ZA 2WAQN 1IN6A 1R1UA 3MKYB 2PJRB 1Z77A 2CRGA 2TDXA 4ENKA 2DK8A 1RKTA 2D2WA 2FQ3A 5EGOB 1ZR4A 4GFBA 2V7FA 1R22A 2OU2A 1TWAJ 3J7AY 1B9NA 3GMEA 2A6HF 3FM5A 1N75A 1RNLA 3OR2C 2DQRA 2VUMJ 1W5TA 1G59A 5CVVA 5M5XJ 1F43A 3H5NA 3QPSA 4QPQA 5DEQA 1U3EM 1OCPA 2CUEA 1QBJA 1DU6A 2HDDA 3VYRB 2OBPA 2UXXA 4KN4X 1K83J 1XG1A 4Y3OA 2R5ZA 2KP6A 2AXLA 3LSHA 4KJZA 4XLFA 3T1BA 3K1NA 2E1OA 5BS6A 4X6AJ 4PFOA 3F8CA 4Y15A 3OYIA 3A4CA 3ZQIA 3M8JA 4WWCA 4MEYF 2ME6A 1FP2A 2HQ5A 2ZXHA 1O57A 1U8BA 3CLQA 3K2AA 5B1AH 4UV8A 4C2MJ 2K9LA 2L9VA 5FLMJ 3JRBA 3H3UA 3KYCB 1UZCA 2E1MB 4PGHA 3U1DA 2WV1A 4E7IA 4EMSA 1RRJA 2GA2A 4EQQA 3FXRA 5LEJA 1W36C 3IWFA 3MD2A 3GTQJ 3PFYA 2O8XA 2MFZA 4JX4A
chains in the Genus database with same CATH topology
5L3BA 3I59B 2FBKA 3SFZA 5DUIA 3F3XA 3AAFA 3IKVA 2FRHA 5BMZA 4HF2A 4IXAA 2HGCA 1ZH5A 1T2KA 3LAPA 3COAC 4M9ZA 2PJPA 1PUEE 3HUGA 3LA3A 1IZ1A 3MEXA 2WV0A 2MC3A 3E97A 2FA5A 2HS5A 5H6QA 2YX4A 2XUBA 2D1VA 3R4KA 5D4RA 2UZKA 1HXDA 4EJOA 2A69F 4EJVA 2QUFA 4YIIA 1Z6TA 2VC1A 4P9UA 2CO5A 4O5VA 1MZBA 4RAYA 1YS6A 3GVAA 4EVIA 1BM9A 3FMRA 1J9IA 2M8EA 4OIRF 2RGVA 1QO0D 1U5TC 3ZMDA 3E6MA 1XSVA 2DU9A 4CYDA 1YQAA 3K1MA 3KP5A 5D5XB 5E8IA 3N4MA 3ABTA 3BZ6A 3U2RA 2K86A 2EFNA 3M1EA 1BI0A 3OOPA 5IT9Z 1QNTA 2YSRA 1ZGAA 2CYYA 1ZRFA 1T98A 2DFIA 3DV8A 2DQLA 3HRTA 4HV5A 2OZUA 1TNTA 2XHKA 3CO7C 5D4SA 1HSTA 1HW5A 1LDDA 5CVUA 4KICA 4UXNA 2ESHA 5K5RA 3V8JA 3F8MA 5HLGA 1F1ZA 3K9TA 1QGPA 5LGNA 1V3FA 3FHZA 5HDNA 1MGTA 2IA1A 3PQJA 1FYLA 5TJJA 5L3GA 2G7UA 2HYGD 5D6FA 4KA4A 2Z9OA 2HQRA 4OINF 3P9CA 4CICA 1OPCA 3JAMZ 1RIOH 2PG4A 2ZXJA 5BOXA 1CF7A 1YIOA 4M6YA 2P8TA 4YIFA 3HRSA 3CO6C 4IRHA 4KFCA 3K0LA 4ASNA 2XROA 2IA2A 3PQKA 2V1DA 2MH2A 3KP4A 4LLGF 5E17F 5FO5A 1XB4A 4HOBA 3T0YA 2FNPA 4HV6A 4P96A 4LG0B 4FX4A 4B09A 5ED4A 4BNCA 2GZWA 1UHWA 3G3ZA 1AWCA 5L3CA 3WU0A 4L9VA 1Z9CA 1WSUA 1MD0A 2XVCA 4UV9A 2XKPA 5DCFA 3CDHA 3TO6A 5E8GA 4CXFA 4HLYA 2M87A 3C7JA 2HZTA 3J80Z 4P9FA 1LJ9A 4BHBA 2YU3A 3RKXA 4GO1A 4LMYA 3GZ5A 1ZG1A 3BJ6A 2PN6A 4WK8F 1J59A 1IXSB 3BP8A 1GVJA 1RUNA 5AIPA 4GXOA 2L4MA 3R0AA 4LB6B 4KIFA 4HX8A 2P5LC 3MZHA 2DO7A 5E20A 1G6NA 4E70A 1FBSA 4KIGA 2M5WA 4RGXA 4HZFA 1BOAA 3KZYA 2LKPA 3T8TA 1G4DA 2XASA 1BC8C 5CVRA 1T6SA 1IW7F 3SZPA 1OYIA 3F21A 4A5NA 2CQKA 2R7FA 3LFKA 1R5GA 3HRUA 4NHJA 1H9TA 1UB9A 4XRFA 1PP8F 4LGWA 2HEOA 1W4MA 3CTAA 1ZGJA 1EV7A 2L01A 1USSA 1SD7A 3I4PA 3DXJF 3R6SA 3BROA 3IL2A 2EB7A 1BJAA 1NHAA 2J5PA 4AVPA 2Q0OA 5BPIA 4MGRA 2V1XA 3LA7A 3KP3A 3K2ZA 3N97A 1O7LA 5D5WB 3WODF 1SD6A 1EH7A 4EGYA 5HLHA 1P92A 1DUXC 1B6AA 2GIVA 2CG4A 2F5FA 5HOOA 3HSEA 1LEAA 1IXRC 3B02A 4ZZLA 2PBIA 3REOA 2VE8A 1T39A 3DQVC 2CFXA 4R1HA 3RKWA 1ZLKA 3TKYA 1FSHA 2NS0A 1RUOA 4AIHA 3I71A 3K69A 3TOAA 3TOBA 5ICCA 5H20A 3JTHA 3O3KA 3EUHA 4AIJA 3GX4X 3E3VA 5FFXA 3D5LA 5L3FA 4RB2C 1K78B 3HSRA 4G6QA 2HTSA 1EH6A 2VT3A 3GO5A 1ZG5A 5K5OA 4I01A 3U9GA 2QENA 2YPRA 1W5SA 2EFQA 1Y0UA 1IXCA 3EDPA 3ULQB 2O61A 5AIQA 2ZMEB 2UWMA 2IJLA 2PQ8A 3MFKA 4G94A 5F6FA 3KFWX 2NYXA 4KYWA 3WTWC 3IHUA 3S2WA 5HS7A 3GW2A 4M71A 3V7CA 2OA4A 5F1RA 2DI3A 4P55A 2OD5A 4EM0B 3KEOA 4MQ9F 1R00A 4N9HA 5ILSA 3F6OA 4KT5C 3HOTA 2A07F 1XN7A 3NRVA 1KQ0A 1FC3A 1YW8A 1MDMA 3TDZC 2ADUA 1ULYA 4KIBA 3J7AO 5LGTA 1IF1A 3W6KB 1RI7A 3J81K 4RGSA 4BAYA 5D8KB 5DYMA 3ECOA 3V7SA 4BHPA 1ZRDA 2ZNZA 2EA2A 3GUDA 2CSOA 5DUKA 3KLNA 4IHTA 2QM3A 1CGPA 4M73A 1KQ9A 1E2XA 3GF2A 2Z3YA 2HQNA 4U0YA 2FMYA 4OIOF 5LBQA 1L0OC 5J6XA 3I58A 2VXZA 3KEQA 2EA4A 4XBFA 1FPQA 2HR3A 3L09A 3LSTA 4D0PA 3F6VA 5KVRA 2XV4S 2KKOA 2XAHA 5CYVA 2GQQA 4OU0A 3TDUC 4UNOA 5JR3A 1H9GA 3WTXC 3C3WA 5D6EA 1EH8A 1REPC 1FLIA 1P6RA 1KYZA 2XAFA 3EYIA 3DEUA 3LWFA 4I0AA 3O6BB 3ZPLA 3RYRA 3ZMUA 3WTSC 2MD5A 3F23A 5ILUA 1HKSA 1KA8A 4MTEA 2QBYB 3I64A 2QBYA 1O3RA 3F8BA 5LHHA 3CUQA 5ICFA 1LDKB 2A6EF 1X3UA 5FLXK 2P5KA 5LHIA 3G73A 3ISPA 1BIAA 2BBYA 3E6DA 1ZRCA 4FHTA 2STWA 5H6RA 2FSWA 1R1TA 5DD8A 1XCVA 3IRQA 3V8LA 1QZZA 1XSDA 2RC4A 4MEXF 3KP7A 2KRFA 2V6CA 2F5EA 3IC7A 3WGGA 3ZQ7A 3BJAA 1B9MA 1F9NA 2RV8A 3IRRA 1FWZA 5A2QK 1ZAOA 1ONVA 2WTEA 2Q2EA 3Q9SA 1ZN2A 3L7WA 1B4AA 2ZFWA 2FF4A 1DDNA 5L3EA 2LF8A 2FU4A 4IHSA 2YX7A 4P5OA 3I53A 1F5TA 2W57A 4S05A 4HLXA 4N0BA 3L2CA 2F2EA 4JBAA 4MHGA 2X4HA 4OIQF 4GYIA 3BOQA 1YW7A 3GWZA 3WGIA 4TV7A 1YG2A 3ZMZA 3P9IA 1D3YA 3HYIA 2K7LA 4G7ZF 2FE3A 1BC7C 5HDGA 1IN5A 2XKOA 4Q4ZF 2ZO4A 1WWXA 2XIGA 4IRGA 4KUMA 4A6DA 2FOKA 4S04A 2HFHA 4M9SA 1CF7B 1KU9A 1FBUA 3GFMA 4BQAA 4Q5SF 3DPLC 3H3ZA 2BGCA 3TO9A 2A3SA 4HF1A 1O3SA 2B0LA 2VE9A 4OMZA 3F8FA 4B8XA 5HS9A 1HSJA 5K5QA 3EYYA 1UFMA 1Z91A 4WXCA 3HTSB 1LVAA 1FBQA 3WU1B 3MCZA 4XSZF 3I0TA 1BI2A 5FD5A 1D5VA 5HS8A 1I1SA 2M45A 2CGPA 3VB2A 1L3LA 1R36A 3MWMA 4AWXB 2ZKZA 3WTYC 4AD9A 1JHFA 2VOOA 1G3TA 1I1GA 4F7ZA 4Q48A 3D0SA 2R3SA 3Q9VA 3ABUA 4GYGA 5AONA 3WE2A 3ECHA 3QU3A 2O0YA 2IRFG 2LF7A 3RYPA 4LLLA 4YFXF 1R5HA 1D8JA 1P4AA 4BXUA 2EFOA 2XAQA 3RJPA 2EWNA 4L18B 3MQ0A 3O2PE 3FM3A 4HYEA 1W7PD 3FZVA 5K1YA 1GXQA 3K1PA 1UHMA 5IT9K 5LEKA 1IN8A 3V8KA 3KE2A 2ELHA 3HOSA 3M7GA 3HHGA 3EQLF 5TRDA 4BH9A 5CJ9A 2FEZA 4QWQA 4A12A 2A5YB 2C6YA 2M30A 3GFIA 1U6GA 1ON2A 2K4BA 3GXOA 1KU2A 2HOEA 3DP7A 3BY6A 1U5TA 2Y48A 3F72A 2YR2A 5LGUA 5CLSA 4ENJA 2VT2A 3JAMK 2QLZA 2L3DA 2MLKA 4WX9A 2JT1A 2P6SA 2MH9A 3T8RA 1Z1DA 2G9WA 4G8XA 3LQQA 4UVBA 2MBFA 3M8FA 4LFUA 2HYFA 2VOPA 5ICEA 2RKHA 5FGMA 4HW0A 4AIKA 2AS5F 1I27A 2ESNA 1O7FA 2DW4A 4ETSA 4Z2YA 3VOEA 3WTUC 2BEOA 1YS7A 4O3MA 2PEXA 4A0XA 2Z33A 1RZ4A 1BN5A 1U8RA 4U0WA 2ACJA 1H0MA 4ON0A 3MAJA 1MJAA 1HQCA 1JE8A 1TBXA 4YFKF 4L9NA 2FNAA 4HBLA 1FP1D 2HDCA 1HKTA 2FBHA 1J5YA 5J8CA 2X0LA 2VBXA 4ZYEA 2RN7A 3CJNA 4A2UA 5LRSA 3M9AA 3P9KA 2KIFA 3J80K 5E1WA 1DPRA 5DD4A 1R7JA 1XDUA 1YYVA 3FWEA 3DPTA 5D5UB 4RS8A 2GXGA 3WTVC 2H6BA 4PGGA 4MQVA 4U7BA 4LK1F 2A68F 3KZZA 4L5IA 3ZN0A 2VN2A 1SAXA 3SXYA 4I02A 1TNSA 4MNUA 4OMYA 3QRFF 3M8EA 3ML6A 2EFWA 4HX4A 3LA2A 3L00A 4Y17A 1HW2A 3NEUA 1FNNA 2K27A 2IP2A 3RPQA 4EM2A 4GGGA 2O6GE 1Q1HA 2WC2A 4U0VA 2NNYA 1Z05A 1W7PA 4MTDA 1R58A 4U7DA 4M6XA 1D8KA 5EEGA 5HLIA 1FSEA 1FYMA 2MA3A 1JGSA 1MDMB 2JPBA 2FXAA 1XMAA 2KJBA 3E5QA 1KQ8A 3LAJA 3ZMSA 3WE3A 5HDKA 4Y13A 4HAMA 1BBYA 2QQ9A 4I09A 1J7KA 1A04A 5LHGA 4Q47A 2L54A 1S7AA 3CLOA 3VFZA 2ZNYA 1FYKA 1KYWA 2EV0A 2Z99A 2NAZA 3HSFA 5DCMB 1UCRA 3C18A 3BPXA 5DCMA 4WF2A 4UVAA 1XGMA 1G3YA 4G7HF 3ROUA 1FY7A 1Z6RA 4LJZF 4G6DA 6PAXA 4L9TA 2V1UA 4M74A 3R61A 2EJRA 2JSCA 2ISZA 2ISYA 2DT5A 2DBBA 2HWVA 1IRFA 2GXBA 1S6LA 1SFXA 2IA0A 5HVQC 1SFEA 2ZJ2A 3VODA 1V4RA 3FXQA 4KN7X 1BIBA 5L3DA 1E17A 3BDDA 1J75A 2W84A 1ZHFA 1IN4A 4EV0A 2Y0MA 1S7OA 4EGZA 2DAOA 2F5DA 2O03A 3OV8A 3DKWA 3HHHA 3GEZA 1I5ZA 1QPMA 1P2FA 1T0FA 1J2XA 1IRGA 4DQ2A 4R8HA 1S8NA 3DFGA 3ZN1A 1K7AA 4M72A 1K6OA 2E1CA 3CUQB 4HF0A 3SHFA 2KIUA 4IRIA 1KU7A 2DPDA 4HX7A 2PMUA 2COMA 2V9VA 1S29A 4I7HA 4OOIA 1YO5C 4PDKA 3I59A 5BQTA 4CGZA 2DLLA 2OAZA 4ESFA 2H27A 4JQFA 2P4WA 1ZARA 2QQAA 1YFHA 2GA1A 3F8NA 4A5MA 1J0RA 2QWWA 2NNNA 4L9JA 3BJOA 1ZYRF 3KLOA 2BE5F 2O3FA 3VEPA 3E6BA 3ZMVA 1FX7A 2CW0F 3FMQA 1P4WA 4ESJA 1WKMA 3GZ6A 2V79A 2E7XA 3QOPA 4I2OA 3P7NA 2H6CA 3E5XA 2BV6A 5ICGA 1OYYA 4HQMA 3RPUA 3QP6A 4IJAA 1ZLJA 2NRAC 3T5XA 1B59A 1TLHB 3GYHX 5BPDA 2W25A 2ZBKA 1MJ9A 3HIFA 1LDJA 2VC0A 1C0WA 1YTYA 3JW4A 3BWGA 3L9FA 1DPUA 4I0BA 4EJTA 1IUYA 4U88A 2LNBA 1JXSA 3GLXA 4ZYGA 2K4JA 3I54A 3QAHA 4FX0A 5DV5A 1FZPB 4BYYA 4RGRA 1IAWA 3F22A 2LSOA 2VBWA 2PFBA 2MLGA 2FBIA 2IVMA 2DTRA 2M1BA 2ZCWA 2JPCA 4YG2F 3R0JA 3FF5A 4RAZA 1MKMA 1PP7U 2W24A 3BPVA 1IN7A 1LQ1A 1HKQA 4CDGA 4M9XA 1QZYA 1AOYA 1K79A 3JSPA 4L0ZB 5FFZA 4OIPF 4GCVA 2RQPA 5JVTA 2E1NA 2H94A 3B73A 1XGOA 2ETHA 1OKRA 3HRMA 1XD7A 4LG0A 3QPTA 3ZMTA 2OQRA 5E18F 2K02A 3E5UA 3KP6A 1FT9A 1TQMA 4DNCA 1TW2A 5JFRA 2HKOA 1XDSA 4BHCA 4ENMA 2VONA 2Y75A 1LNWA 3CUOA 2P7VB 3ZP5A 4ENNA 3RDIA 4CZZA 2RNJA 4CHUA 3IWZA 4L0YB 3GFLA 1SFUA 1KGSA 1TW3A 3RKYA 4EM1A 3RIRA 1O3QA 1T38A 3E6CC 1U78A 2GWRA 2P7CB 2P5VA 2EV6A 2VBZA 2EFPA 3JSOA 2JZYA 2XGXA 2JRTA 4NQWA 1R1VA 4XLNF 4ZYHA 5IT3A 3QU6A 3DF8A 1B1BA 2D1HA 1F4KA 4EJWA 1U5TB 2DPUA 2FMLA 1LEBA 3Q5FA 2XRNA 4O6JA 4UVCA 3EETA 4IPAA 3QP5A 5CVIA 1GXPA 4IF4A 4N9IA 4PCQA 3TO7A 1SMTA 2GAUA 5JI6A 1XMKA 2BYVE 2QYOA 4PZJA 4XLPF 2RVCA 2QQBA 2Q8KA 4RB3C 3ERED 5LLQA 4KMFA 1SD4A 2IPQX 3KCCA 5D8LB 3KETA 2IT0A 3W6JB 2J5OA 4HDUA 2EK5A 2XAGA 4ZH4F 2PMHA 1I6XA 1GHCA 3R60A 2PI0A 3KP2A 3J81Z 5J8FA 4WXHA 1KU3A 4IVNA 1LB2A 3WTZA 5CVJA 2HKXA 2G7HA 2LDUA 4UHTA 1MJBA 4LK0F 1YLFA 5LRRA 1R23A 3C1DA 3HTUA 4XSXF 1DP7P 4KNYA 2KIMA 3WTTC 3FMSA 4G7OF 1ODDA 1XGNA 3QPHA 3H92A 5ERIA 2WWYA 1WRJA 4NB5A 1ZREA 4K2EA 3FX3A 3WG9A 4EJUA 1OR7A 2L02A 1U2WA 5KK1A 2QVOA 1TTYA 4RB1A 3PFIA 1XSXA 4KDPA 1TQIA 1JHHA 1OYWA 2OQGA 4ZYDA 3CUQC 5D5VB 3GFJA 1S3JA 3NQOA 1BI1A 1OMIA 4QLCU 1STZA 1BI3A 4RGUA 3RTRA 5FB2A 1ZG3A 5FD6A 2XAJA 4L5JA 1K78A 5JHUA 1HW1A 2F5CA 1SMYF 2EV5A 2W85A 4RB0A 3V4GA 4G9YA 2A61A 1W7PB 4H0EA 2JTVA 4HA8A 3SZTA 4UUVA 2ZMEA 4A0YA 4ZZDA 5F64A 2H09A 4WCGA 5E1XA 1XGSA 1TQPA 5FLXZ 1VTNC 1G3WA 2D45A 1QQIA 4JK1X 3SQNA 1FOKA 4HQEA 3FXUA 1HBXG 4KMUX 1SD5A 1YW9A 2HTJA 2VODA 1WI9A 3JTGA 4LLNA 3I5UA 1G3SA 2STTA 5DDGA 4LD5A 4A6EA 3ELKA 2CWEA 5EEHA 1P4XA 3WGHA 4R79A 3TQNA 1ON1A 4ESBA 2QZ8A 2OZ6A 4HDVA 5E1ZB 1PDNC 5A2QZ 2KJCA 3V7RA 2IW5A 2DK5A 5ILVA 4YFNF 3IKTA 4FT8A 4LB5A 1XCBA 2PLYA 1Z7UA 2Z5UA 2E7WA 3LQRA 2R7DA 1USTA 3RI4A 2VBYA 3TGNA 2UXNA 3MZYA 4I98B 4CO8A 2P6TA 4A0ZA 1O3TA 2RDPA 4WXDA 1WQ2A 1IN6A 1R1UA 4ENKA 2TDXA 2DK8A 2D2WA 2FQ3A 1R22A 2OU2A 1B9NA 2A6HF 3FM5A 1RNLA 2DQRA 1W5TA 5CVVA 5DEQA 1U3EM 1QBJA 2OBPA 2UXXA 4KN4X 2AXLA 3T1BA 3K1NA 5BS6A 3F8CA 4Y15A 4WWCA 4MEYF 1FP2A 1O57A 4UV8A 3H3UA 3U1DA 4PGHA 4EMSA 2GA2A 4EQQA 3FXRA 5LEJA 3IWFA 2O8XA 2L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3B A;  3I59 B;  2FBK A;  3SFZ A;  5DUI A;  3F3X A;  3AAF A;  3IKV A;  2FRH A;  5BMZ A;  4HF2 A;  4IXA A;  2HGC A;  1ZH5 A;  1T2K A;  3LAP A;  3COA C;  4M9Z A;  2PJP A;  1PUE E;  3HUG A;  3LA3 A;  1IZ1 A;  3MEX A;  2WV0 A;  2MC3 A;  3E97 A;  2FA5 A;  2HS5 A;  5H6Q A;  2YX4 A;  2XUB A;  2D1V A;  3R4K A;  5D4R A;  2UZK A;  1HXD A;  4EJO A;  2A69 F;  4EJV A;  2QUF A;  4YII A;  1Z6T A;  2VC1 A;  4P9U A;  2CO5 A;  4O5V A;  1MZB A;  4RAY A;  1YS6 A;  3GVA A;  4EVI A;  1BM9 A;  3FMR A;  1J9I A;  2M8E A;  4OIR F;  2RGV A;  1QO0 D;  1U5T C;  3ZMD A;  3E6M A;  1XSV A;  2DU9 A;  4CYD A;  1YQA A;  3K1M A;  3KP5 A;  5D5X B;  5E8I A;  3N4M A;  3ABT A;  3BZ6 A;  3U2R A;  2K86 A;  2EFN A;  3M1E A;  1BI0 A;  3OOP A;  5IT9 Z;  1QNT A;  2YSR A;  1ZGA A;  2CYY A;  1ZRF A;  1T98 A;  2DFI A;  3DV8 A;  2DQL A;  3HRT A;  4HV5 A;  2OZU A;  1TNT A;  2XHK A;  3CO7 C;  5D4S A;  1HST A;  1HW5 A;  1LDD A;  5CVU A;  4KIC A;  4UXN A;  2ESH A;  5K5R A;  3V8J A;  3F8M A;  5HLG A;  1F1Z A;  3K9T A;  1QGP A;  5LGN A;  1V3F A;  3FHZ A;  5HDN A;  1MGT A;  2IA1 A;  3PQJ A;  1FYL A;  5TJJ A;  5L3G A;  2G7U A;  2HYG D;  5D6F A;  4KA4 A;  2Z9O A;  2HQR A;  4OIN F;  3P9C A;  4CIC A;  1OPC A;  3JAM Z;  1RIO H;  2PG4 A;  2ZXJ A;  5BOX A;  1CF7 A;  1YIO A;  4M6Y A;  2P8T A;  4YIF A;  3HRS A;  3CO6 C;  4IRH A;  4KFC A;  3K0L A;  4ASN A;  2XRO A;  2IA2 A;  3PQK A;  2V1D A;  2MH2 A;  3KP4 A;  4LLG F;  5E17 F;  5FO5 A;  1XB4 A;  4HOB A;  3T0Y A;  2FNP A;  4HV6 A;  4P96 A;  4LG0 B;  4FX4 A;  4B09 A;  5ED4 A;  4BNC A;  2GZW A;  1UHW A;  3G3Z A;  1AWC A;  5L3C A;  3WU0 A;  4L9V A;  1Z9C A;  1WSU A;  1MD0 A;  2XVC A;  4UV9 A;  2XKP A;  5DCF A;  3CDH A;  3TO6 A;  5E8G A;  4CXF A;  4HLY A;  2M87 A;  3C7J A;  2HZT A;  3J80 Z;  4P9F A;  1LJ9 A;  4BHB A;  2YU3 A;  3RKX A;  4GO1 A;  4LMY A;  3GZ5 A;  1ZG1 A;  3BJ6 A;  2PN6 A;  4WK8 F;  1J59 A;  1IXS B;  3BP8 A;  1GVJ A;  1RUN A;  5AIP A;  4GXO A;  2L4M A;  3R0A A;  4LB6 B;  4KIF A;  4HX8 A;  2P5L C;  3MZH A;  2DO7 A;  5E20 A;  1G6N A;  4E70 A;  1FBS A;  4KIG A;  2M5W A;  4RGX A;  4HZF A;  1BOA A;  3KZY A;  2LKP A;  3T8T A;  1G4D A;  2XAS A;  1BC8 C;  5CVR A;  1T6S A;  1IW7 F;  3SZP A;  1OYI A;  3F21 A;  4A5N A;  2CQK A;  2R7F A;  3LFK A;  1R5G A;  3HRU A;  4NHJ A;  1H9T A;  1UB9 A;  4XRF A;  1PP8 F;  4LGW A;  2HEO A;  1W4M A;  3CTA A;  1ZGJ A;  1EV7 A;  2L01 A;  1USS A;  1SD7 A;  3I4P A;  3DXJ F;  3R6S A;  3BRO A;  3IL2 A;  2EB7 A;  1BJA A;  1NHA A;  2J5P A;  4AVP A;  2Q0O A;  5BPI A;  4MGR A;  2V1X A;  3LA7 A;  3KP3 A;  3K2Z A;  3N97 A;  1O7L A;  5D5W B;  3WOD F;  1SD6 A;  1EH7 A;  4EGY A;  5HLH A;  1P92 A;  1DUX C;  1B6A A;  2GIV A;  2CG4 A;  2F5F A;  5HOO A;  3HSE A;  1LEA A;  1IXR C;  3B02 A;  4ZZL A;  2PBI A;  3REO A;  2VE8 A;  1T39 A;  3DQV C;  2CFX A;  4R1H A;  3RKW A;  1ZLK A;  3TKY A;  1FSH A;  2NS0 A;  1RUO A;  4AIH A;  3I71 A;  3K69 A;  3TOA A;  3TOB A;  5ICC A;  5H20 A;  3JTH A;  3O3K A;  3EUH A;  4AIJ A;  3GX4 X;  3E3V A;  5FFX A;  3D5L A;  5L3F A;  4RB2 C;  1K78 B;  3HSR A;  4G6Q A;  2HTS A;  1EH6 A;  2VT3 A;  3GO5 A;  1ZG5 A;  5K5O A;  4I01 A;  3U9G A;  2QEN A;  2YPR A;  1W5S A;  2EFQ A;  1Y0U A;  1IXC A;  3EDP A;  3ULQ B;  2O61 A;  5AIQ A;  2ZME B;  2UWM A;  2IJL A;  2PQ8 A;  3MFK A;  4G94 A;  5F6F A;  3KFW X;  2NYX A;  4KYW A;  3WTW C;  3IHU A;  3S2W A;  5HS7 A;  3GW2 A;  4M71 A;  3V7C A;  2OA4 A;  5F1R A;  2DI3 A;  4P55 A;  2OD5 A;  4EM0 B;  3KEO A;  4MQ9 F;  1R00 A;  4N9H A;  5ILS A;  3F6O A;  4KT5 C;  3HOT A;  2A07 F;  1XN7 A;  3NRV A;  1KQ0 A;  1FC3 A;  1YW8 A;  1MDM A;  3TDZ C;  2ADU A;  1ULY A;  4KIB A;  3J7A O;  5LGT A;  1IF1 A;  3W6K B;  1RI7 A;  3J81 K;  4RGS A;  4BAY A;  5D8K B;  5DYM A;  3ECO A;  3V7S A;  4BHP A;  1ZRD A;  2ZNZ A;  2EA2 A;  3GUD A;  2CSO A;  5DUK A;  3KLN A;  4IHT A;  2QM3 A;  1CGP A;  4M73 A;  1KQ9 A;  1E2X A;  3GF2 A;  2Z3Y A;  2HQN A;  4U0Y A;  2FMY A;  4OIO F;  5LBQ A;  1L0O C;  5J6X A;  3I58 A;  2VXZ A;  3KEQ A;  2EA4 A;  4XBF A;  1FPQ A;  2HR3 A;  3L09 A;  3LST A;  4D0P A;  3F6V A;  5KVR A;  2XV4 S;  2KKO A;  2XAH A;  5CYV A;  2GQQ A;  4OU0 A;  3TDU C;  4UNO A;  5JR3 A;  1H9G A;  3WTX C;  3C3W A;  5D6E A;  1EH8 A;  1REP C;  1FLI A;  1P6R A;  1KYZ A;  2XAF A;  3EYI A;  3DEU A;  3LWF A;  4I0A A;  3O6B B;  3ZPL A;  3RYR A;  3ZMU A;  3WTS C;  2MD5 A;  3F23 A;  5ILU A;  1HKS A;  1KA8 A;  4MTE A;  2QBY B;  3I64 A;  2QBY A;  1O3R A;  3F8B A;  5LHH A;  3CUQ A;  5ICF A;  1LDK B;  2A6E F;  1X3U A;  5FLX K;  2P5K A;  5LHI A;  3G73 A;  3ISP A;  1BIA A;  2BBY A;  3E6D A;  1ZRC A;  4FHT A;  2STW A;  5H6R A;  2FSW A;  1R1T A;  5DD8 A;  1XCV A;  3IRQ A;  3V8L A;  1QZZ A;  1XSD A;  2RC4 A;  4MEX F;  3KP7 A;  2KRF A;  2V6C A;  2F5E A;  3IC7 A;  3WGG A;  3ZQ7 A;  3BJA A;  1B9M A;  1F9N A;  2RV8 A;  3IRR A;  1FWZ A;  5A2Q K;  1ZAO A;  1ONV A;  2WTE A;  2Q2E A;  3Q9S A;  1ZN2 A;  3L7W A;  1B4A A;  2ZFW A;  2FF4 A;  1DDN A;  5L3E A;  2LF8 A;  2FU4 A;  4IHS A;  2YX7 A;  4P5O A;  3I53 A;  1F5T A;  2W57 A;  4S05 A;  4HLX A;  4N0B A;  3L2C A;  2F2E A;  4JBA A;  4MHG A;  2X4H A;  4OIQ F;  4GYI A;  3BOQ A;  1YW7 A;  3GWZ A;  3WGI A;  4TV7 A;  1YG2 A;  3ZMZ A;  3P9I A;  1D3Y A;  3HYI A;  2K7L A;  4G7Z F;  2FE3 A;  1BC7 C;  5HDG A;  1IN5 A;  2XKO A;  4Q4Z F;  2ZO4 A;  1WWX A;  2XIG A;  4IRG A;  4KUM A;  4A6D A;  2FOK A;  4S04 A;  2HFH A;  4M9S A;  1CF7 B;  1KU9 A;  1FBU A;  3GFM A;  4BQA A;  4Q5S F;  3DPL C;  3H3Z A;  2BGC A;  3TO9 A;  2A3S A;  4HF1 A;  1O3S A;  2B0L A;  2VE9 A;  4OMZ A;  3F8F A;  4B8X A;  5HS9 A;  1HSJ A;  5K5Q A;  3EYY A;  1UFM A;  1Z91 A;  4WXC A;  3HTS B;  1LVA A;  1FBQ A;  3WU1 B;  3MCZ A;  4XSZ F;  3I0T A;  1BI2 A;  5FD5 A;  1D5V A;  5HS8 A;  1I1S A;  2M45 A;  2CGP A;  3VB2 A;  1L3L A;  1R36 A;  3MWM A;  4AWX B;  2ZKZ A;  3WTY C;  4AD9 A;  1JHF A;  2VOO A;  1G3T A;  1I1G A;  4F7Z A;  4Q48 A;  3D0S A;  2R3S A;  3Q9V A;  3ABU A;  4GYG A;  5AON A;  3WE2 A;  3ECH A;  3QU3 A;  2O0Y A;  2IRF G;  2LF7 A;  3RYP A;  4LLL A;  4YFX F;  1R5H A;  1D8J A;  1P4A A;  4BXU A;  2EFO A;  2XAQ A;  3RJP A;  2EWN A;  4L18 B;  3MQ0 A;  3O2P E;  3FM3 A;  4HYE A;  1W7P D;  3FZV A;  5K1Y A;  1GXQ A;  3K1P A;  1UHM A;  5IT9 K;  5LEK A;  1IN8 A;  3V8K A;  3KE2 A;  2ELH A;  3HOS A;  3M7G A;  3HHG A;  3EQL F;  5TRD A;  4BH9 A;  5CJ9 A;  2FEZ A;  4QWQ A;  4A12 A;  2A5Y B;  2C6Y A;  2M30 A;  3GFI A;  1U6G A;  1ON2 A;  2K4B A;  3GXO A;  1KU2 A;  2HOE A;  3DP7 A;  3BY6 A;  1U5T A;  2Y48 A;  3F72 A;  2YR2 A;  5LGU A;  5CLS A;  4ENJ A;  2VT2 A;  3JAM K;  2QLZ A;  2L3D A;  2MLK A;  4WX9 A;  2JT1 A;  2P6S A;  2MH9 A;  3T8R A;  1Z1D A;  2G9W A;  4G8X A;  3LQQ A;  4UVB A;  2MBF A;  3M8F A;  4LFU A;  2HYF A;  2VOP A;  5ICE A;  2RKH A;  5FGM A;  4HW0 A;  4AIK A;  2AS5 F;  1I27 A;  2ESN A;  1O7F A;  2DW4 A;  4ETS A;  4Z2Y A;  3VOE A;  3WTU C;  2BEO A;  1YS7 A;  4O3M A;  2PEX A;  4A0X A;  2Z33 A;  1RZ4 A;  1BN5 A;  1U8R A;  4U0W A;  2ACJ A;  1H0M A;  4ON0 A;  3MAJ A;  1MJA A;  1HQC A;  1JE8 A;  1TBX A;  4YFK F;  4L9N A;  2FNA A;  4HBL A;  1FP1 D;  2HDC A;  1HKT A;  2FBH A;  1J5Y A;  5J8C A;  2X0L A;  2VBX A;  4ZYE A;  2RN7 A;  3CJN A;  4A2U A;  5LRS A;  3M9A A;  3P9K A;  2KIF A;  3J80 K;  5E1W A;  1DPR A;  5DD4 A;  1R7J A;  1XDU A;  1YYV A;  3FWE A;  3DPT A;  5D5U B;  4RS8 A;  2GXG A;  3WTV C;  2H6B A;  4PGG A;  4MQV A;  4U7B A;  4LK1 F;  2A68 F;  3KZZ A;  4L5I A;  3ZN0 A;  2VN2 A;  1SAX A;  3SXY A;  4I02 A;  1TNS A;  4MNU A;  4OMY A;  3QRF F;  3M8E A;  3ML6 A;  2EFW A;  4HX4 A;  3LA2 A;  3L00 A;  4Y17 A;  1HW2 A;  3NEU A;  1FNN A;  2K27 A;  2IP2 A;  3RPQ A;  4EM2 A;  4GGG A;  2O6G E;  1Q1H A;  2WC2 A;  4U0V A;  2NNY A;  1Z05 A;  1W7P A;  4MTD A;  1R58 A;  4U7D A;  4M6X A;  1D8K A;  5EEG A;  5HLI A;  1FSE A;  1FYM A;  2MA3 A;  1JGS A;  1MDM B;  2JPB A;  2FXA A;  1XMA A;  2KJB A;  3E5Q A;  1KQ8 A;  3LAJ A;  3ZMS A;  3WE3 A;  5HDK A;  4Y13 A;  4HAM A;  1BBY A;  2QQ9 A;  4I09 A;  1J7K A;  1A04 A;  5LHG A;  4Q47 A;  2L54 A;  1S7A A;  3CLO A;  3VFZ A;  2ZNY A;  1FYK A;  1KYW A;  2EV0 A;  2Z99 A;  2NAZ A;  3HSF A;  5DCM B;  1UCR A;  3C18 A;  3BPX A;  5DCM A;  4WF2 A;  4UVA A;  1XGM A;  1G3Y A;  4G7H F;  3ROU A;  1FY7 A;  1Z6R A;  4LJZ F;  4G6D A;  6PAX A;  4L9T A;  2V1U A;  4M74 A;  3R61 A;  2EJR A;  2JSC A;  2ISZ A;  2ISY A;  2DT5 A;  2DBB A;  2HWV A;  1IRF A;  2GXB A;  1S6L A;  1SFX A;  2IA0 A;  5HVQ C;  1SFE A;  2ZJ2 A;  3VOD A;  1V4R A;  3FXQ A;  4KN7 X;  1BIB A;  5L3D A;  1E17 A;  3BDD A;  1J75 A;  2W84 A;  1ZHF A;  1IN4 A;  4EV0 A;  2Y0M A;  1S7O A;  4EGZ A;  2DAO A;  2F5D A;  2O03 A;  3OV8 A;  3DKW A;  3HHH A;  3GEZ A;  1I5Z A;  1QPM A;  1P2F A;  1T0F A;  1J2X A;  1IRG A;  4DQ2 A;  4R8H A;  1S8N A;  3DFG A;  3ZN1 A;  1K7A A;  4M72 A;  1K6O A;  2E1C A;  3CUQ B;  4HF0 A;  3SHF A;  2KIU A;  4IRI A;  1KU7 A;  2DPD A;  4HX7 A;  2PMU A;  2COM A;  2V9V A;  1S29 A;  4I7H A;  4OOI A;  1YO5 C;  4PDK A;  3I59 A;  5BQT A;  4CGZ A;  2DLL A;  2OAZ A;  4ESF A;  2H27 A;  4JQF A;  2P4W A;  1ZAR A;  2QQA A;  1YFH A;  2GA1 A;  3F8N A;  4A5M A;  1J0R A;  2QWW A;  2NNN A;  4L9J A;  3BJO A;  1ZYR F;  3KLO A;  2BE5 F;  2O3F A;  3VEP A;  3E6B A;  3ZMV A;  1FX7 A;  2CW0 F;  3FMQ A;  1P4W A;  4ESJ A;  1WKM A;  3GZ6 A;  2V79 A;  2E7X A;  3QOP A;  4I2O A;  3P7N A;  2H6C A;  3E5X A;  2BV6 A;  5ICG A;  1OYY A;  4HQM A;  3RPU A;  3QP6 A;  4IJA A;  1ZLJ A;  2NRA C;  3T5X A;  1B59 A;  1TLH B;  3GYH X;  5BPD A;  2W25 A;  2ZBK A;  1MJ9 A;  3HIF A;  1LDJ A;  2VC0 A;  1C0W A;  1YTY A;  3JW4 A;  3BWG A;  3L9F A;  1DPU A;  4I0B A;  4EJT A;  1IUY A;  4U88 A;  2LNB A;  1JXS A;  3GLX A;  4ZYG A;  2K4J A;  3I54 A;  3QAH A;  4FX0 A;  5DV5 A;  1FZP B;  4BYY A;  4RGR A;  1IAW A;  3F22 A;  2LSO A;  2VBW A;  2PFB A;  2MLG A;  2FBI A;  2IVM A;  2DTR A;  2M1B A;  2ZCW A;  2JPC A;  4YG2 F;  3R0J A;  3FF5 A;  4RAZ A;  1MKM A;  1PP7 U;  2W24 A;  3BPV A;  1IN7 A;  1LQ1 A;  1HKQ A;  4CDG A;  4M9X A;  1QZY A;  1AOY A;  1K79 A;  3JSP A;  4L0Z B;  5FFZ A;  4OIP F;  4GCV A;  2RQP A;  5JVT A;  2E1N A;  2H94 A;  3B73 A;  1XGO A;  2ETH A;  1OKR A;  3HRM A;  1XD7 A;  4LG0 A;  3QPT A;  3ZMT A;  2OQR A;  5E18 F;  2K02 A;  3E5U A;  3KP6 A;  1FT9 A;  1TQM A;  4DNC A;  1TW2 A;  5JFR A;  2HKO A;  1XDS A;  4BHC A;  4ENM A;  2VON A;  2Y75 A;  1LNW A;  3CUO A;  2P7V B;  3ZP5 A;  4ENN A;  3RDI A;  4CZZ A;  2RNJ A;  4CHU A;  3IWZ A;  4L0Y B;  3GFL A;  1SFU A;  1KGS A;  1TW3 A;  3RKY A;  4EM1 A;  3RIR A;  1O3Q A;  1T38 A;  3E6C C;  1U78 A;  2GWR A;  2P7C B;  2P5V A;  2EV6 A;  2VBZ A;  2EFP A;  3JSO A;  2JZY A;  2XGX A;  2JRT A;  4NQW A;  1R1V A;  4XLN F;  4ZYH A;  5IT3 A;  3QU6 A;  3DF8 A;  1B1B A;  2D1H A;  1F4K A;  4EJW A;  1U5T B;  2DPU A;  2FML A;  1LEB A;  3Q5F A;  2XRN A;  4O6J A;  4UVC A;  3EET A;  4IPA A;  3QP5 A;  5CVI A;  1GXP A;  4IF4 A;  4N9I A;  4PCQ A;  3TO7 A;  1SMT A;  2GAU A;  5JI6 A;  1XMK A;  2BYV E;  2QYO A;  4PZJ A;  4XLP F;  2RVC A;  2QQB A;  2Q8K A;  4RB3 C;  3ERE D;  5LLQ A;  4KMF A;  1SD4 A;  2IPQ X;  3KCC A;  5D8L B;  3KET A;  2IT0 A;  3W6J B;  2J5O A;  4HDU A;  2EK5 A;  2XAG A;  4ZH4 F;  2PMH A;  1I6X A;  1GHC A;  3R60 A;  2PI0 A;  3KP2 A;  3J81 Z;  5J8F A;  4WXH A;  1KU3 A;  4IVN A;  1LB2 A;  3WTZ A;  5CVJ A;  2HKX A;  2G7H A;  2LDU A;  4UHT A;  1MJB A;  4LK0 F;  1YLF A;  5LRR A;  1R23 A;  3C1D A;  3HTU A;  4XSX F;  1DP7 P;  4KNY A;  2KIM A;  3WTT C;  3FMS A;  4G7O F;  1ODD A;  1XGN A;  3QPH A;  3H92 A;  5ERI A;  2WWY A;  1WRJ A;  4NB5 A;  1ZRE A;  4K2E A;  3FX3 A;  3WG9 A;  4EJU A;  1OR7 A;  2L02 A;  1U2W A;  5KK1 A;  2QVO A;  1TTY A;  4RB1 A;  3PFI A;  1XSX A;  4KDP A;  1TQI A;  1JHH A;  1OYW A;  2OQG A;  4ZYD A;  3CUQ C;  5D5V B;  3GFJ A;  1S3J A;  3NQO A;  1BI1 A;  1OMI A;  4QLC U;  1STZ A;  1BI3 A;  4RGU A;  3RTR A;  5FB2 A;  1ZG3 A;  5FD6 A;  2XAJ A;  4L5J A;  1K78 A;  5JHU A;  1HW1 A;  2F5C A;  1SMY F;  2EV5 A;  2W85 A;  4RB0 A;  3V4G A;  4G9Y A;  2A61 A;  1W7P B;  4H0E A;  2JTV A;  4HA8 A;  3SZT A;  4UUV A;  2ZME A;  4A0Y A;  4ZZD A;  5F64 A;  2H09 A;  4WCG A;  5E1X A;  1XGS A;  1TQP A;  5FLX Z;  1VTN C;  1G3W A;  2D45 A;  1QQI A;  4JK1 X;  3SQN A;  1FOK A;  4HQE A;  3FXU A;  1HBX G;  4KMU X;  1SD5 A;  1YW9 A;  2HTJ A;  2VOD A;  1WI9 A;  3JTG A;  4LLN A;  3I5U A;  1G3S A;  2STT A;  5DDG A;  4LD5 A;  4A6E A;  3ELK A;  2CWE A;  5EEH A;  1P4X A;  3WGH A;  4R79 A;  3TQN A;  1ON1 A;  4ESB A;  2QZ8 A;  2OZ6 A;  4HDV A;  5E1Z B;  1PDN C;  5A2Q Z;  2KJC A;  3V7R A;  2IW5 A;  2DK5 A;  5ILV A;  4YFN F;  3IKT A;  4FT8 A;  4LB5 A;  1XCB A;  2PLY A;  1Z7U A;  2Z5U A;  2E7W A;  3LQR A;  2R7D A;  1UST A;  3RI4 A;  2VBY A;  3TGN A;  2UXN A;  3MZY A;  4I98 B;  4CO8 A;  2P6T A;  4A0Z A;  1O3T A;  2RDP A;  4WXD A;  1WQ2 A;  1IN6 A;  1R1U A;  4ENK A;  2TDX A;  2DK8 A;  2D2W A;  2FQ3 A;  1R22 A;  2OU2 A;  1B9N A;  2A6H F;  3FM5 A;  1RNL A;  2DQR A;  1W5T A;  5CVV A;  5DEQ A;  1U3E M;  1QBJ A;  2OBP A;  2UXX A;  4KN4 X;  2AXL A;  3T1B A;  3K1N A;  5BS6 A;  3F8C A;  4Y15 A;  4WWC A;  4MEY F;  1FP2 A;  1O57 A;  4UV8 A;  3H3U A;  3U1D A;  4PGH A;  4EMS A;  2GA2 A;  4EQQ A;  3FXR A;  5LEJ A;  3IWF A;  2O8X A;  2L4A A; 
#chains in the Genus database with same CATH topology
 3S3O A;  5L3B A;  3I59 B;  2FBK A;  3PUF A;  3SFZ A;  5KHD A;  3F3X A;  5DUI A;  3AAF A;  3S8P A;  3IKV A;  2FRH A;  1YHQ I;  5BMZ A;  4HF2 A;  4IXA A;  2HGC A;  2HVQ A;  3AFH A;  1ZH5 A;  4PJJ A;  2CUF A;  5HNH A;  1T2K A;  5IOY A;  3LAP A;  3COA C;  2Y0S A;  2WAF A;  4M9Z A;  4XNF A;  2ZJP F;  3DTK A;  2PJP A;  1ETW A;  1PUE E;  2IS4 A;  3A01 B;  3HUG A;  2V6E A;  4KIT B;  3LA3 A;  1YI2 I;  5GAH J;  2XPU A;  1IZ1 A;  3MEX A;  2WV0 A;  4GRI A;  3RSN A;  2MC3 A;  1IRX A;  2GBY A;  3E97 A;  2FA5 A;  2HS5 A;  5H6Q A;  2YX4 A;  2XUB A;  2D1V A;  3R4K A;  2VQC A;  1WI3 A;  5D4R A;  2UZK A;  1LFB A;  1HXD A;  2A69 F;  4EJO A;  4X0G A;  4EJV A;  1ORK A;  1K61 A;  2QUF A;  4YII A;  1P7J A;  1Z6T A;  2DMP A;  1RC9 A;  2VC1 A;  4P9U A;  2CO5 A;  4O5V A;  1MZB A;  4RAY A;  1HDD C;  1YS6 A;  4X1E A;  2GOM A;  3GVA A;  3PL8 A;  4EVI A;  1BM9 A;  2ECB A;  3FMR A;  1J9I A;  4BEH A;  1HOM A;  2M8E A;  4OIR F;  2RGV A;  2DJI A;  1QO0 D;  3A0B C;  1T08 B;  3OYN A;  1U5T C;  2AQE A;  3ZMD A;  3E6M A;  4FET A;  1XSV A;  2CFO A;  2DU9 A;  4CYD A;  1YQA A;  3K1M A;  2VQH A;  3KP5 A;  5D5X B;  5E8I A;  4OWR B;  5B1B H;  2R7O A;  3N4M A;  2KRH A;  4D9J A;  1UJ8 A;  3ABT A;  3H3V K;  3BZ6 A;  3U2R A;  2DFF A;  2K86 A;  2EFN A;  1VZ0 A;  1B8I B;  3M1E A;  1BI0 A;  3PUB A;  3OOP A;  3ZCO A;  1SAN A;  3DLA A;  3FXM A;  1FOY A;  5IT9 Z;  1QNT A;  2YSR A;  5FKL A;  1GLN A;  2EZH A;  2EZI A;  3CF5 F;  1ZGA A;  2CS3 A;  1X19 A;  2CYY A;  1ZRF A;  1T98 A;  2DFI A;  3OYM A;  3DV8 A;  2DQL A;  3HRT A;  3ESW B;  1ETX A;  4HV5 A;  2OZU A;  1TNT A;  2XHK A;  3CO7 C;  1FMW A;  2M7B A;  2OUM A;  5D4S A;  2VAS A;  2M4K A;  3L2V A;  3FKJ A;  2JA8 J;  1HST A;  3K70 D;  1HW5 A;  4FAS D;  1LDD A;  5CVU A;  4KIC A;  2K9Q A;  1VQ5 I;  4DYC A;  4UXN A;  2ESH A;  5K5R A;  3E0J B;  3V8J A;  1YIJ I;  3F8M A;  5HLG A;  1F1Z A;  3K9T A;  1BR2 A;  1QGP A;  5LGN A;  3JCU C;  4IQ4 A;  1V3F A;  3FHZ A;  1ETV A;  5HDN A;  1MGT A;  2IA1 A;  5B5E C;  1Y1V J;  3PQJ A;  1FYL A;  5TJJ A;  3CJT B;  1D1B A;  5L3G A;  2G7U A;  2HYG D;  3K4M A;  5D6F A;  4KA4 A;  2M9H A;  2Z9O A;  1QA6 A;  3PO2 J;  2HQR A;  4OIN F;  3P9C A;  1GDT A;  4CIC A;  1W0U A;  1BR1 A;  2X9D A;  1TWG J;  3IUO A;  4E7K A;  3CC7 I;  3FHN A;  1OPC A;  1TT5 B;  3K4B A;  3JRD A;  2UV1 A;  1R71 A;  3JAM Z;  3EPZ A;  1RIO H;  2PG4 A;  2ZXJ A;  3FIS A;  5BOX A;  1CF7 A;  2H8R A;  1YIO A;  4M6Y A;  3KEY A;  1T56 A;  2RAE A;  1V5F A;  2G0E A;  1A5J A;  2P8T A;  2BW3 A;  4LIV A;  4YIF A;  2KDZ A;  3HRS A;  4XN0 A;  3CO6 C;  4IRH A;  4KFC A;  4A69 C;  5KCM A;  2E5N A;  4XLA A;  4V2F A;  1OR7 C;  2W4S A;  2K9M A;  2QEX I;  1Q1V A;  3K0L A;  2BHY A;  2JUC A;  2KL4 A;  4ASN A;  5KAI C;  2XRO A;  1AU7 A;  2IA2 A;  1OCZ H;  1QHH D;  3PQK A;  2LBF B;  3UNG C;  2V1D A;  1ZKG A;  2MH2 A;  3KP4 A;  4UUT A;  4LLG F;  4IX7 A;  5E17 F;  2WA0 A;  5FO5 A;  1XB4 A;  4HOB A;  3T0Y A;  2FNP A;  4HV6 A;  4P96 A;  4LG0 B;  1Y39 A;  2NVY J;  1YJW I;  2HPI A;  2KRC A;  4FX4 A;  4B09 A;  5ED4 A;  2R7V A;  4BNC A;  2GZW A;  3H0G J;  5J1U A;  4Y52 J;  1UHW A;  1WJA A;  1Z21 A;  3BG6 A;  3G3Z A;  1AWC A;  4CCN A;  2D5V A;  5L3C A;  2O8K A;  3WU0 A;  2O5R A;  4L9V A;  1Z9C A;  2KFD A;  2WB1 A;  1WSU A;  2VPR A;  1FTZ A;  2X6O A;  4A3K J;  4I76 A;  1MD0 A;  3CCU I;  3S93 A;  2XVC A;  2A05 A;  4UV9 A;  2XKP A;  5DCF A;  2EIN H;  3CDH A;  3TO6 A;  5E8G A;  4CXF A;  5C4J J;  4HLY A;  2M87 A;  2EIK H;  4CSW A;  3HM5 A;  3C7J A;  1TL8 A;  3TP0 A;  2BY2 A;  1MSE C;  3LSR A;  2HZT A;  2Y31 A;  2MC4 A;  4XIC A;  4BBS J;  4CUG A;  4P9F A;  3J80 Z;  2ZME C;  2E2J J;  1LJ9 A;  3SJM A;  4BHB A;  2YU3 A;  3RKX A;  4GO1 A;  4LMY A;  3GZ5 A;  1TWC J;  2R5Y A;  4XRS A;  1ZG1 A;  4HNT A;  3CCJ I;  3BJ6 A;  3FDY A;  2PN6 A;  5IY5 H;  4CZC A;  4N4N B;  2R0Q C;  4J19 A;  4WK8 F;  1J59 A;  1IXS B;  3BP8 A;  1GVJ A;  4XON A;  1RUN A;  4NQW B;  5AIP A;  4GXO A;  2CQ7 A;  4XLE A;  3OL4 A;  2L4M A;  3R0A A;  2M4G A;  5F0F A;  5IYD J;  1YJ9 I;  4C2T A;  4LB6 B;  1VQK I;  4PK4 A;  4KIF A;  1JGG A;  1ZTR A;  1VQP I;  4HX8 A;  2P5L C;  2V1N A;  1WJC A;  3JRC A;  5FLV A;  3KPH A;  2LMD A;  5BNG A;  2MSY A;  3MZH A;  3CMM A;  2BOL A;  4RM2 A;  1G8X A;  2DO7 A;  1MBK A;  5E20 A;  2MW8 A;  3ASO H;  3OSF A;  4XN3 A;  1G6N A;  1QRY A;  1YRN B;  4E70 A;  1FBS A;  2CQN A;  5M5W J;  3S16 J;  4BJ6 C;  1JT0 A;  4KIG A;  1UAA A;  1MMN A;  1WH5 A;  2M5W A;  4RGX A;  5DS9 A;  4HZF A;  3W2V A;  1BOA A;  3KZY A;  3VSK A;  2LKP A;  1TWH J;  3T8T A;  1G4D A;  2XAS A;  1XX5 A;  1BC8 C;  3CZ6 A;  1X2M A;  2AXT C;  2M7A A;  5CVR A;  4B43 A;  2LY9 A;  1T6S A;  3C2G A;  1IW7 F;  2M3A A;  3SZP A;  3PNY A;  1OYI A;  3F21 A;  4ZDP A;  4A3D J;  4A5N A;  3OS1 A;  2CQK A;  2VJ4 A;  3D5S C;  2CH0 A;  3HB9 A;  2R7F A;  5J40 A;  2B9S A;  3PNV A;  3LFK A;  1R5G A;  3HRU A;  1WJF A;  5EYR A;  4NHJ A;  1BJZ A;  1H9T A;  1UB9 A;  4XRF A;  1PP8 F;  2I5U A;  4LGW A;  2HEO A;  1QHG A;  1W4M A;  3CTA A;  4UUS B;  1R4N B;  1EV7 A;  1ZGJ A;  3QYF A;  2UUZ A;  2L01 A;  1USS A;  2ZJQ F;  1SD7 A;  3LSM A;  3ABL H;  3CD6 I;  5GPC A;  3I4P A;  2DOA A;  3DXJ F;  3R6S A;  3BRO A;  3IL2 A;  2EB7 A;  3DEE A;  2KZG A;  3OY9 A;  1BJA A;  1NHA A;  2J5P A;  4AVP A;  2VI6 A;  4AID A;  1V5E A;  1JKO C;  2Y69 H;  1VQ8 I;  1WJD A;  2Q0O A;  2ELK A;  2DFH A;  5BPI A;  3FXJ A;  3PSF A;  2R7Q A;  3QOE A;  4MGR A;  2V1X A;  2XC7 A;  2RQQ A;  2F48 A;  5F0C A;  1Y8Q B;  3LA7 A;  3KP3 A;  3K2Z A;  3N97 A;  1YX5 A;  1O7L A;  5D5W B;  3WOD F;  3CCQ I;  1J09 A;  1SD6 A;  3HBL A;  1EH7 A;  5HLH A;  4EGY A;  1P92 A;  4E7H A;  1DUX C;  2LTP A;  2XGC A;  1B6A A;  4D5C A;  2LD5 A;  3PJR A;  3TMO A;  1D0X A;  2Z16 A;  2GIV A;  5F27 A;  2CG4 A;  3H1C A;  2F5F A;  2JVH A;  2Y9Y A;  2L7K A;  5HOO A;  3HSE A;  5DM7 F;  2OTJ I;  1LEA A;  1IXR C;  3B02 A;  1I39 A;  3HOW J;  2LVS A;  1VI0 A;  4ZZL A;  2L5Q A;  2PBI A;  3REO A;  2VE8 A;  3TW6 A;  1T39 A;  2DA2 A;  2YUS A;  2GIZ A;  3DQV C;  2CFX A;  4R1H A;  2BY0 A;  2ZSI B;  3RKW A;  1ZLK A;  5HLT A;  1DGW Y;  3TKY A;  1FSH A;  3GTP J;  2NS0 A;  1H8A C;  4AIH A;  1RUO A;  2H1L A;  3A1Y A;  3I71 A;  4C3J J;  3K69 A;  3TOA A;  3TOB A;  5ICC A;  3HJE A;  5H20 A;  1SFK A;  3JTH A;  4NUB A;  2E1M C;  1VQ6 I;  3ZQH A;  2MGQ A;  2L4A A;  3O3K A;  1UEL B;  1ZK8 A;  2OV7 A;  3EUH A;  4AIJ A;  2JA6 J;  3GX4 X;  3E3V A;  5FFX A;  3D5L A;  5L3F A;  1PUF B;  3BT9 A;  4RB2 C;  1K78 B;  2YS9 A;  3HSR A;  3OYG A;  3AKZ A;  3ZOB A;  2QGU A;  4G6Q A;  2HTS A;  1EH6 A;  2VT3 A;  3GO5 A;  1ZG5 A;  5K5O A;  4I01 A;  3U9G A;  2QEN A;  4ZYA A;  2YPR A;  1POG A;  4IHY A;  1W5S A;  4C3I J;  2EFQ A;  4RM3 A;  4IOA F;  2CW8 A;  2WAQ A;  1Y0U A;  1IXC A;  3EDP A;  3ULQ B;  2O61 A;  4XOT A;  5AIQ A;  2CV1 A;  2FD5 A;  3A03 A;  3VSL A;  3CC4 I;  3BG9 A;  2ZME B;  4XL9 A;  4BAC A;  4IKF A;  2UWM A;  2IJL A;  1MIJ A;  2MG4 A;  2PQ8 A;  3HKZ N;  1IDZ A;  3S14 J;  3MFK A;  4G94 A;  5F6F A;  3KFW X;  1BR4 A;  2F4I A;  2NYX A;  4KYW A;  3ASN H;  3IHU A;  3WTW C;  2CV2 A;  3S2W A;  5HS7 A;  5TGT A;  3GW2 A;  4M71 A;  4P1W A;  3V7C A;  3Q0V A;  2OA4 A;  1NG6 A;  5F1R A;  2DI3 A;  4P55 A;  2K40 A;  4C3H J;  2OD5 A;  4EM0 B;  3KEO A;  4MQ9 F;  1R00 A;  1ENH A;  4N9H A;  2XSJ C;  4IHW A;  5ILS A;  3F6O A;  3OWT A;  4KT5 C;  2I8D A;  3F0C A;  3M1C A;  2B63 J;  4G6T B;  3HOT A;  2A07 F;  2LLK A;  1XN7 A;  3NRV A;  4UB8 C;  1HDP A;  1KQ0 A;  1FC3 A;  2XDV A;  1YW8 A;  4OAY A;  2EIJ H;  2RNG A;  3BCB A;  1H89 C;  1MDM A;  3TDZ C;  5F04 A;  2ADU A;  1ULY A;  4KIB A;  3BR3 A;  1OLT A;  3J7A O;  2HI3 A;  5LGT A;  1IF1 A;  3W6K B;  2W1O A;  1RI7 A;  3P5J A;  3J81 K;  4RGS A;  4EAT A;  3TW7 A;  4BAY A;  3DTE A;  1G2H A;  5D8K B;  1X4O A;  5DYM A;  3OIO A;  3JRI A;  1MNE A;  3ECO A;  1GV5 A;  2JUG A;  1ZGW A;  2P81 A;  3CCR I;  3V7S A;  4BHP A;  9ANT A;  1ZRD A;  1D0Y A;  2ZNZ A;  1WVR A;  2EA2 A;  2K3P A;  1RPW A;  2QA4 I;  3GUD A;  1VQ4 I;  2CSO A;  2LK2 A;  5DUK A;  1M1E B;  2L9S A;  3KLN A;  5GAG J;  4IHT A;  4M3F A;  2EIM H;  2QM3 A;  1CGP A;  2HVR A;  5K7F A;  4M73 A;  1KQ9 A;  3QWL A;  4Y33 A;  1E2X A;  4NC7 A;  3GF2 A;  4RA2 A;  5K7Z A;  2FUG 2;  5EG0 A;  4Z6Y A;  2Z3Y A;  2HQN A;  4PUS A;  4U0Y A;  2FMY A;  1BA5 A;  4E7J A;  4XOP A;  4OIO F;  2Q1Z B;  3CMA I;  4CYC A;  2BXY A;  5LBQ A;  1L0O C;  4B47 A;  3SZG A;  1GVD A;  5J6X A;  5E3N A;  2QSF X;  4CCO A;  3I58 A;  2VXZ A;  1IV6 A;  3KEQ A;  3LMM A;  3VPR A;  2EA4 A;  2FOW A;  1FPQ A;  4XKW A;  4XBF A;  2HR3 A;  3L09 A;  3LST A;  2E2H J;  4D0P A;  2LKX A;  1APL C;  2BVL A;  3F6V A;  2R7Z J;  5KVR A;  3WG7 H;  5K7H A;  1OJL A;  2KKO A;  2XAH A;  2XV4 S;  3ZR8 X;  3NAR A;  5CYV A;  3OYA A;  2GQQ A;  4OU0 A;  1Z3Y A;  3GTL J;  3TDU C;  4UNO A;  3DWL E;  5JR3 A;  1H9G A;  1WJ5 A;  5M3M J;  3C3W A;  3WTX C;  2KHM A;  5D6E A;  4F91 B;  2R4G A;  3I3L A;  2DA6 A;  4DIQ A;  1XS9 A;  2R5Z B;  4BQQ A;  4CH7 A;  1EH8 A;  1REP C;  1WFX A;  1QVU A;  1FLI A;  1P6R A;  1R49 A;  1LKX A;  1KYZ A;  4BQO A;  2XAF A;  1VQL I;  2KLO A;  3EYI A;  3DEU A;  2QF7 A;  3DU6 A;  2HVS A;  3LWF A;  4I0A A;  1YX3 A;  3O6B B;  3ZPL A;  3RYR A;  1P7I A;  2LG4 A;  4DZJ A;  4JX6 A;  3ZMU A;  4E7S A;  3WTS C;  2MD5 A;  3F23 A;  2BHZ A;  5ILU A;  2QSG X;  4IHV A;  2FQ4 A;  1HKS A;  1KA8 A;  1TT0 A;  4MTE A;  1VQM I;  2QBY B;  3I64 A;  2QBY A;  1O3R A;  3F8B A;  4NC8 A;  5LHH A;  1K6Y A;  3G4S I;  3CUQ A;  3MKL A;  5ICF A;  3OYD A;  2DTZ A;  1CQT A;  2I10 A;  1LDK B;  2A6E F;  4RLF A;  1X3U A;  1W36 D;  5FLX K;  2P5K A;  4LIU A;  3S1N J;  2K3F A;  3BG7 A;  2KIQ A;  5LHI A;  2NOJ B;  3HUG B;  3G73 A;  3OYF A;  3ISP A;  1BIA A;  2QKL B;  4A3C J;  1JUS A;  2HU9 A;  3HOX J;  1SC7 A;  2BBY A;  3E6D A;  1BOB A;  1ZRC A;  4FHT A;  4MFE A;  2STW A;  1DQU A;  5H6R A;  1W1W E;  2FSW A;  3BR6 A;  1R1T A;  1EF4 A;  4A3M J;  5DD8 A;  1XCV A;  3IRQ A;  3V8L A;  1QZZ A;  2DT6 A;  3GZN B;  5E3O A;  1XSD A;  2JA7 J;  2RC4 A;  1Z0X A;  4BEH B;  4UB6 C;  3HOV J;  4MEX F;  1JKP C;  2HQA A;  3KP7 A;  2KRF A;  3L2W A;  2JRM A;  2V6C A;  2F5E A;  3IC7 A;  3WGG A;  3ZQ7 A;  3JRH A;  3L2Q A;  3CCV I;  3BJA A;  1B9M A;  1F9N A;  2RV8 A;  3KZI C;  3IRR A;  1UMQ A;  1FWZ A;  4W1U A;  1MH4 A;  2LOO A;  5A2Q K;  1ZAO A;  1ONV A;  2ME0 A;  1MMD A;  2DOD A;  2EPF A;  1GUU A;  5CPR B;  2WTE A;  3L2U A;  3LSJ A;  4BGD A;  2Q2E A;  4KIS A;  3Q9S A;  4NNJ A;  1ZN2 A;  3S3M A;  3L7W A;  3FK6 A;  1B4A A;  4M6V A;  5FKK A;  2ZFW A;  2FF4 A;  5DTD A;  1DDN A;  4A3G J;  1VQO I;  1T33 A;  5L3E A;  2LF8 A;  3NAU A;  1UG2 A;  3H35 A;  2FU4 A;  4IHS A;  3BC8 A;  2YX7 A;  4P5O A;  4QIW N;  4ZTJ A;  3I53 A;  1F5T A;  2WBM A;  2W57 A;  4YEJ A;  4S05 A;  3CCS I;  4HLX A;  4N0B A;  3L2C A;  2F2E A;  4JBA A;  4MHG A;  4BBR J;  2IS2 A;  5F0H A;  2X4H A;  4OIQ F;  2LR8 A;  4GYI A;  3BOQ A;  1Y1W J;  2AO9 A;  1YW7 A;  3AG2 H;  3GWZ A;  3WGI A;  4TV7 A;  1YG2 A;  3ZMZ A;  3P9I A;  3V42 A;  1D3Y A;  3HYI A;  2K7L A;  4CCM A;  5E79 C;  2FE3 A;  4G7Z F;  1BC7 C;  5HDG A;  1IN5 A;  2XKO A;  4Q4Z F;  2ZO4 A;  1WWX A;  1Z7L A;  2XIG A;  4IRG A;  2HDW A;  3HG9 A;  1VQN I;  3PO3 J;  1D1A A;  3CP8 A;  4KUM A;  3RQ4 A;  4A6D A;  3G6E I;  2FOK A;  4FQG A;  2IBD A;  4S04 A;  1MBJ A;  4RDU A;  3JRG A;  2HFH A;  4M9S A;  1CF7 B;  1KU9 A;  3AG4 H;  3MVP A;  1FBU A;  3CCM I;  1I50 J;  2GM4 A;  3GFM A;  2BW3 B;  1U0J A;  3HDD A;  2BXZ A;  4BQA A;  4Q5S F;  3DPL C;  3H3Z A;  2BGC A;  3TO9 A;  2A3S A;  4HF1 A;  1O3S A;  2B0L A;  1VQ9 I;  2VE9 A;  4OMZ A;  3F8F A;  4B8X A;  4GDF A;  1ETK A;  5HS9 A;  1HSJ A;  5K5Q A;  3EYY A;  2DOF A;  1UFM A;  3CCL I;  2EZK A;  1MND A;  3LSI A;  3NWS A;  1Z91 A;  4WXC A;  3HTS B;  1A31 A;  2VJJ A;  1LVA A;  4D5F A;  2JQ7 A;  2LY1 A;  1FBQ A;  1NG7 A;  3WU1 B;  1ERD A;  1Y6I A;  3MCZ A;  3CJR B;  4XSZ F;  3I0T A;  2JVG A;  1BI2 A;  2XRL A;  5FD5 A;  1WH7 A;  4IO9 F;  1A35 A;  4ZJZ A;  3IH3 A;  1D5V A;  5HS8 A;  1I1S A;  2M45 A;  2CGP A;  1TP4 A;  5EEA A;  3ZQG A;  3VB2 A;  3S17 J;  3C2B A;  1L3L A;  4DBQ A;  4FTH A;  1R36 A;  2L9R A;  4AUX A;  3MWM A;  1TWF J;  4AWX B;  2ZKZ A;  1XC5 A;  1SVO A;  2KIS A;  1GT0 C;  4ZTF A;  3WTY C;  2L7F P;  4AD9 A;  2YU9 J;  3OIP A;  1X1D A;  1JHF A;  4DBR A;  3CCE I;  4AVZ A;  1LE8 A;  2VOO A;  1G3T A;  2QQ8 A;  1I1G A;  3LSG A;  4F7Z A;  2W7N A;  4Q48 A;  3D0S A;  3GBG A;  2R3S A;  3Q9V A;  4PJN A;  3ABU A;  4RAF A;  4GYG A;  5AON A;  4XRM A;  2F5V A;  2COB A;  3WE2 A;  4E7Z A;  5DM6 F;  2JWT A;  3ECH A;  2O0Y A;  3QU3 A;  1ITY A;  3K4J A;  2IRF G;  1V5G A;  2LF7 A;  3RYP A;  4LLL A;  4YFX F;  1R5H A;  2F6C A;  4QTR A;  1D8J A;  1P4A A;  4BXU A;  4Y4R A;  2EFO A;  2XAQ A;  2R5Y B;  3RJP A;  2BY3 A;  3WHC A;  5C44 J;  4RLQ A;  1HF0 A;  2EWN A;  4L18 B;  3MQ0 A;  3O2P E;  3FM3 A;  2E60 A;  1ZQ3 P;  1S9H A;  1BW6 A;  4HYE A;  2BY1 A;  1W7P D;  3BR1 A;  3FZV A;  5K1Y A;  1GXQ A;  2IEK A;  3K1P A;  1UHM A;  5IT9 K;  5LEK A;  4PJM A;  2LRE A;  1IN8 A;  3V8K A;  1Y56 A;  5J1R A;  3KE2 A;  2ELH A;  5J4Y A;  3HOS A;  3M7G A;  1DGR M;  3HHG A;  2HOT A;  1JJ8 C;  3EQL F;  1AA7 A;  3FBI B;  5TRD A;  2R7U A;  1O4X A;  4I99 C;  4BH9 A;  5HNF A;  5CJ9 A;  2FEZ A;  3BZC A;  3PIO F;  4QWQ A;  4A12 A;  4B3A A;  1AKH A;  4B1R A;  2A5Y B;  2C6Y A;  2R7X A;  2EQR A;  2M30 A;  3KYL A;  3GFI A;  1IG7 A;  1U6G A;  1ZEL A;  4BDY A;  1ON2 A;  2K4B A;  3A0H C;  3GXO A;  3LFU A;  1KU2 A;  2HOE A;  5GTI C;  2DMT A;  3DP7 A;  3BY6 A;  3VYT B;  3ZQL A;  3PNT A;  1U5T A;  3OYH A;  2M34 A;  2Y48 A;  2CW7 A;  2XF5 A;  3F72 A;  4BE1 A;  4DJA A;  2YR2 A;  2X6W A;  5LGU A;  5CLS A;  3OYE A;  4ENJ A;  4CCL A;  5JLX A;  4MFD A;  4BY7 J;  3BLY A;  1T95 A;  2VT2 A;  3JAM K;  3EUA A;  2QLZ A;  4IOC F;  2CQX A;  2DFE A;  2VKE A;  2L3D A;  2MLK A;  1A6Q A;  4WX9 A;  2JT1 A;  3GTJ J;  2P6S A;  4FE4 A;  2MH9 A;  3T8R A;  2WY7 Q;  3HKZ A;  1Y8R B;  1Z1D A;  2G9W A;  1IRZ A;  4G8X A;  3KYD B;  3LQQ A;  4RBO A;  3SYT A;  1R6R A;  1F36 A;  5M3F J;  1X1P A;  4UVB A;  3AL0 B;  2MBF A;  4BS9 A;  3M8F A;  4MIM A;  5JHF A;  3H9Q A;  1VND A;  4F3Q A;  4LFU A;  3K4L A;  2HYF A;  2VKV A;  3OL3 A;  2VOP A;  4LOC A;  1S5L C;  2VKD A;  2NVT J;  5ICE A;  2RKH A;  2H8W A;  5FGM A;  4HW0 A;  4AIK A;  2AS5 F;  1JTX A;  1HCR A;  2NVQ J;  1I27 A;  2ESN A;  4PSX A;  1X1C A;  2F4M B;  4L5E A;  4KT6 A;  1O7F A;  2VXD A;  2DW4 A;  2CMP A;  4ETS A;  4Z2Y A;  1ZR2 A;  3VOE A;  3MZ8 A;  3WTU C;  2BEO A;  1YS7 A;  1K4T A;  3DBR B;  4O3M A;  3BQZ A;  2PEX A;  4A0X A;  1XPX A;  2Z33 A;  1RZ4 A;  2VJI A;  3HPH A;  3S3N A;  4HSR A;  1BN5 A;  1U8R A;  4M3E A;  4U0W A;  2ACJ A;  1E3H A;  4ON0 A;  1H0M A;  3MAJ A;  4E7L A;  1MNM C;  3GLL A;  1MJA A;  4DYR A;  1HQC A;  1JE8 A;  1TBX A;  4YFK F;  4L9N A;  2FNA A;  2PX9 A;  4HBL A;  1A6I A;  1FP1 D;  2HDC A;  5FKO A;  3JRE A;  1HKT A;  4XKV A;  3ZQC A;  2FBH A;  1J5Y A;  2JSP A;  5J8C A;  2X0L A;  3S1R J;  2VBX A;  1PYV A;  4MLO A;  1FOW A;  4ZYE A;  1JKQ C;  1MW7 A;  3QPL A;  2OJE D;  2RN7 A;  3CJN A;  4A2U A;  5LRS A;  3M9A A;  3P9K A;  1OCT C;  2EBI A;  4XQF A;  2KIF A;  3J80 K;  5E1W A;  1DPR A;  1V55 H;  1JUP A;  4S0H B;  3OOU A;  5DD4 A;  1R7J A;  1XDU A;  1YYV A;  2L9N A;  3FWE A;  3OYB A;  3DPT A;  5D5U B;  4RS8 A;  3FXL A;  4XMY A;  3S1Q J;  3DLL F;  1N78 A;  3HL2 A;  2GXG A;  3WTV C;  2H6B A;  4IEJ A;  4PGG A;  2LRD A;  4LK1 F;  4MQV A;  4U7B A;  4A3F J;  3HOY J;  1Y0N A;  2A68 F;  3CF2 A;  3KZZ A;  2IGN A;  4L5I A;  3ZN0 A;  2M0C A;  2VN2 A;  4CCK A;  4RMN A;  1LFU P;  1SAX A;  3SXY A;  4I02 A;  2Z1D A;  2EH3 A;  1TNS A;  1ETQ A;  5TIS C;  4MNU A;  1I3Q J;  2LH9 A;  4OMY A;  3QRF F;  3M8E A;  3ML6 A;  5IYC J;  2W48 A;  2EFW A;  2VLA A;  4HX4 A;  3LA2 A;  4DW6 A;  1OIS A;  3L00 A;  4Y17 A;  1HW2 A;  3DPU A;  3NEU A;  1FNN A;  1RR7 A;  3HEF A;  4V19 K;  2VIX A;  3M07 A;  2K27 A;  2IP2 A;  3IH4 A;  3RPQ A;  4EM2 A;  3HC7 A;  3L2R A;  4GGG A;  4W97 A;  2O6G E;  1Q1H A;  3D5R C;  3A2K A;  2WC2 A;  3IP4 B;  4U0V A;  3BQY A;  5IP9 J;  3G71 I;  1DU0 A;  2K5C A;  1LPQ A;  5GP9 A;  2NNY A;  1Z05 A;  1W7P A;  4MTD A;  1R58 A;  4U7D A;  4H4K C;  4M6X A;  1D8K A;  2DCE A;  3N05 A;  5EEG A;  5GTH C;  5HLI A;  2N8G A;  1QZE A;  1FSE A;  2CJJ A;  2ZXI A;  1FYM A;  5FRN A;  2L2O A;  2MA3 A;  2DYS H;  4RAG A;  3UKG A;  3RPU D;  1JGS A;  2CUJ A;  1MDM B;  2JPB A;  3GTM J;  2FXA A;  3BR2 A;  1XMA A;  2KJB A;  3E5Q A;  2WAD A;  1KQ8 A;  2PMZ N;  3LAJ A;  3ZMS A;  3WE3 A;  2VQG A;  5HDK A;  3WU2 C;  1V54 H;  3MKZ A;  4Y13 A;  2GLO A;  4HAM A;  3LSK A;  1BBY A;  4NBQ A;  2LC2 A;  2LYC A;  1UHS A;  2QQ9 A;  2ID3 A;  4I09 A;  1J7K A;  4C30 A;  4J00 A;  2LY2 A;  1A04 A;  4JOM A;  5LHG A;  2M8G X;  4Q47 A;  1IC8 A;  3K10 A;  2L54 A;  1SVL A;  3H5A A;  1S7A A;  3CLO A;  4FIS A;  3VFZ A;  2ZNY A;  5LFA A;  1FYK A;  1A36 A;  4YRV A;  1KYW A;  2EV0 A;  2BVM A;  1MBG A;  1E3P A;  2Z99 A;  4BU2 A;  1EKE A;  3U21 A;  1NTC A;  5EJC A;  2NAZ A;  2W00 A;  3HSF A;  5DCM B;  1UCR A;  3C18 A;  2ZFU A;  1KZH A;  3TED A;  3BPX A;  5DCM A;  3IAS 2;  4WF2 A;  4PSW A;  1EJ9 A;  5IP6 A;  5EG0 B;  4XLH A;  4UVA A;  1XGM A;  1SEU A;  1G3Y A;  1RET A;  4G7H F;  3G1L A;  4A3L J;  3ROU A;  1FY7 A;  2MYS A;  4IL6 C;  4CYC B;  3CME I;  1IO2 A;  3K6G A;  1Z6R A;  4LJZ F;  4A3B J;  3CMY A;  2XGE A;  4G6D A;  6PAX A;  2A5W A;  2DMN A;  4L9T A;  3CQZ J;  2DA4 A;  3HOU J;  2V1U A;  1AHD P;  1B72 A;  4M74 A;  3SFI A;  3D1N I;  3BG5 A;  3R61 A;  2EJR A;  3J7Y J;  2JSC A;  3CC2 I;  1X2N A;  3BTC A;  2VKH A;  2ISZ A;  4YIR X;  5J47 A;  2ISY A;  3LL7 A;  2DT5 A;  2XAU A;  2QSH X;  3I4M J;  2DBB A;  2HWV A;  4Y7N J;  1HC8 A;  1IRF A;  5GAD J;  1YIT I;  2GXB A;  1OCO H;  1S6L A;  1SFX A;  2IA0 A;  2LFB A;  2Z2S B;  2VB6 A;  5FKN A;  2HZD A;  5HVQ C;  3QYE A;  1SFE A;  2ZJ2 A;  4ZDO A;  2XB0 X;  1PJR A;  3EUK L;  3G1M A;  1V4R A;  3VOD A;  3FXQ A;  4KN7 X;  2ZC2 A;  3M3Y J;  3H5R A;  1BIB A;  5L3D A;  1E17 A;  3BDD A;  3DTI A;  1J75 A;  5F1J A;  1SAU A;  1ZHF A;  2W84 A;  1IN4 A;  1FIP A;  4AU7 A;  4V2G A;  3RZD J;  3BZK A;  4EV0 A;  2PJR A;  2VL8 A;  4HNU A;  4JX5 A;  2E5Z A;  2Y0M A;  3PIP F;  2HOS A;  1S7O A;  5EGO A;  3QQA A;  1X3W B;  3SDB A;  4EGZ A;  3SEZ A;  2DAO A;  2ZXW H;  2F5D A;  2O03 A;  3OV8 A;  4M3G A;  3DKW A;  3HHH A;  2DDB A;  3GEZ A;  1I5Z A;  4IQJ A;  1QPM A;  3S2D J;  1P2F A;  1T0F A;  4E4H A;  2DMU A;  1SFO J;  4M3B A;  4BKX A;  2K85 A;  1J2X A;  2V9P A;  1IRG A;  2L0K A;  2OPT A;  2W82 A;  4DQ2 A;  4R8H A;  1S8N A;  2O9L A;  2DJN A;  3DFG A;  2X6Y A;  4EEF G;  1JUM A;  2KDO A;  3ZN1 A;  1K7A A;  4M72 A;  1K6O A;  2E1C A;  3CUQ B;  1H88 C;  4HF0 A;  2Y30 A;  3SHF A;  2KIU A;  3RQI A;  4IRI A;  1KU7 A;  2DPD A;  4M3D A;  4I6Z A;  4HX7 A;  2PMU A;  2COM A;  2V9V A;  1S29 A;  4I7H A;  4BXX J;  2HXO A;  2H1K A;  4OOI A;  3W3C A;  2X1C A;  4A3I J;  1FMV A;  1YO5 C;  4PDK A;  1S7E A;  3I59 A;  5BQT A;  4E6K G;  4CGZ A;  2DOE A;  1GV2 A;  2DLL A;  2OAZ A;  4ESF A;  2CU7 A;  2H27 A;  4JQF A;  3WHB A;  2P4W A;  1ZAR A;  1WJB A;  4AYB N;  2QQA A;  3K4C A;  1YFH A;  1U9O A;  1NK3 P;  1FIA A;  3H0D A;  2GA1 A;  3F8N A;  4A5M A;  1J0R A;  2QWW A;  3A01 A;  3FK7 A;  4LG3 A;  4BJ5 C;  1RR8 C;  2NNN A;  1IDY A;  4L9J A;  1IGN A;  3BJO A;  1ZYR F;  4A3E J;  4UY8 I;  1U9N A;  3KLO A;  3ONQ A;  4JP0 A;  4PFP A;  4CCJ A;  1VF9 A;  2BE5 F;  2O3F A;  3VEP A;  5B66 C;  3E6B A;  3FXO A;  3ZMV A;  1FX7 A;  1D0Z A;  2CW0 F;  2Q2E B;  3OR1 C;  3FMQ A;  1P4W A;  4ESJ A;  1WKM A;  5FKM A;  3GZ6 A;  1XMX A;  3W2W A;  2IGM A;  5CQG A;  2V79 A;  2E7X A;  3FIW A;  3QOP A;  4I2O A;  1FOX A;  2VJ5 A;  3I56 I;  3P7N A;  2H6C A;  3E5X A;  2BV6 A;  2IGO A;  5ICG A;  2MD0 A;  1OYY A;  4HQM A;  5F08 A;  3RPU A;  1IUF A;  3QP6 A;  4PJ0 C;  4OAZ A;  4IJA A;  1ZLJ A;  2NRA C;  4BQN A;  3ZRG A;  3T5X A;  1B59 A;  3IAM 2;  1TLH B;  3GYH X;  5BPD A;  1IJW C;  5J3L A;  3VYS B;  4XM3 A;  3OYJ A;  2W25 A;  3ZXS A;  1B8I A;  2XB5 A;  1T8I A;  2ZBK A;  3RKQ A;  4YEL A;  5EF6 A;  1MJ9 A;  3HIF A;  3KIO A;  3C2H A;  1LDJ A;  2VC0 A;  3H9J A;  5B3S H;  1C0W A;  4II3 A;  5IYB J;  1YTY A;  3JW4 A;  3K70 C;  3BWG A;  3L9F A;  3AL0 C;  1DPU A;  3CCY A;  4I0B A;  4EJT A;  1IUY A;  2R7W A;  4U88 A;  3S1M J;  2MAB A;  1MMS A;  2LNB A;  2JK3 A;  5IP7 J;  1JXS A;  5JVG F;  3GLX A;  2X1D A;  2K4J A;  4ZYG A;  3I54 A;  3QAH A;  4FX0 A;  5DV5 A;  1FZP B;  2CUZ A;  5C4X J;  4BYY A;  4II2 A;  1QPI A;  4RGR A;  3SDG A;  3GTG J;  3ZQF A;  1IAW A;  3VWB A;  2XF6 A;  2K9N A;  3F22 A;  2LSO A;  1K4S A;  2VBW A;  2PFB A;  3HGG A;  1E0E A;  3HGY A;  1ACI A;  3I9V 2;  2MLG A;  3JRF A;  2FBI A;  2IVM A;  2KMU A;  2DTR A;  2M1B A;  1WPK A;  2ZCW A;  2DA5 A;  3FXK A;  3JRA A;  3DBH B;  3H36 A;  3FKI J;  3TBI A;  2JPC A;  4XOR A;  4YG2 F;  3R0J A;  2E35 A;  3FF5 A;  4RAZ A;  2M0M A;  1MKM A;  1PP7 U;  2X6X A;  2Y0S N;  1WCM J;  2W24 A;  4DGW B;  3BPV A;  2X85 A;  1IN7 A;  2DYR H;  1LQ1 A;  2V26 A;  3AG3 H;  1HKQ A;  3G1O A;  1MBF A;  3B6C A;  4M9X A;  4CDG A;  4QSH A;  1QZY A;  3OYK A;  1AOY A;  2KZV A;  1S72 I;  1X3Z B;  2ELJ A;  1K79 A;  2JA5 J;  2AHQ A;  5EDN A;  4N4O B;  3JSP A;  4L0Z B;  5FFZ A;  1NH3 A;  4OIP F;  4GCV A;  2RQP A;  5JVT A;  2KQR A;  2HNH A;  3EUH C;  4IHX A;  1SVM A;  3J7Z I;  4IZZ A;  2XF7 A;  2E1N A;  4PJL A;  4XRS G;  4BE2 A;  2H94 A;  3B73 A;  2LBF A;  2ZSH B;  2OF7 A;  1XGO A;  2ETH A;  4HNV A;  1OFC X;  2RRE A;  4BUP A;  1HA8 A;  1QVT A;  1OKR A;  2A6T A;  2WY8 Q;  3HRM A;  3IV5 A;  1YJN I;  1LE8 B;  1XD7 A;  4LG0 A;  4ZDL A;  3GCM A;  1QU3 A;  3QPT A;  3BR5 A;  3ZMT A;  4DZP A;  2OQR A;  5E18 F;  1VFC A;  2K02 A;  2IXS A;  4ITV A;  3E5U A;  3KP6 A;  4HST A;  1FT9 A;  2IAI A;  1FJL A;  1TQM A;  1IV8 A;  3ZQQ A;  4DNC A;  1TW2 A;  5JFR A;  1R5I D;  3OMY A;  2HKO A;  1XDS A;  4BHC A;  4ENM A;  2VON A;  1FEX A;  2Y75 A;  1LNW A;  3S15 J;  3DKY A;  3K4K A;  2OC6 A;  5E3L A;  3CUO A;  1WGX A;  2P7V B;  3ZP5 A;  2E34 A;  4ENN A;  1JI8 A;  3RDI A;  4CZZ A;  2L7M P;  2RNJ A;  5JLW A;  4CHU A;  3IWZ A;  4L0Y B;  3CDL A;  3RCO A;  3GFL A;  1SFU A;  3K7A J;  3E7L A;  1KGS A;  2OCC H;  1TW3 A;  3RKY A;  4EM1 A;  2NS7 A;  3RIR A;  3F9K A;  2V4J C;  4C9Y A;  1O3Q A;  3CJQ B;  3VYU B;  1T38 A;  2ZJR F;  3E6C C;  3Q3S A;  1U78 A;  3I4N J;  1E3O C;  3HZJ A;  4F55 A;  1AKH B;  2GWR A;  2P0W A;  1WHU A;  1YOV B;  2EV6 A;  2P5V A;  2P7C B;  2CV0 A;  2VBZ A;  2EFP A;  3JSO A;  2JZY A;  1MMA A;  2XGX A;  2JRT A;  3DCF A;  3TL4 X;  4NQW A;  4D7N A;  1R1V A;  2GXA A;  4XLN F;  3ZGK A;  1Z3X A;  4ZYH A;  5IT3 A;  2DT7 B;  3HPG A;  3QU6 A;  3ABM H;  3DF8 A;  1B1B A;  2D1H A;  2GOX B;  1F4K A;  4EJW A;  2ID6 A;  3O8G A;  1U5T B;  5EZG A;  2DPU A;  2FX0 A;  2FML A;  3ERM A;  4JYK A;  2NVX J;  1LEB A;  3Q5F A;  4A93 J;  3DBL B;  2XRN A;  4O6J A;  5FJ8 J;  3QOD A;  4XR6 A;  4UVC A;  3EET A;  4IPA A;  3H9G A;  1YRN A;  3DKX A;  3QP5 A;  5CVI A;  2FJ1 A;  3X2Q H;  3OS0 A;  1RES A;  1ETO A;  2K9S A;  4DOZ A;  4IF4 A;  1X58 A;  1GXP A;  3HOZ J;  2OCE A;  2WAE A;  4N9I A;  4PCQ A;  4F93 B;  3TO7 A;  1SMT A;  4D1Q A;  2GAU A;  5JI6 A;  1XMK A;  4BL0 B;  2BYV E;  1P9Q C;  2E71 A;  1Z67 A;  2QYO A;  4PZJ A;  4XLP F;  2RVC A;  2QQB A;  2Q8K A;  4RB3 C;  3ERE D;  5LLQ A;  4B3X A;  5GPA A;  4KMF A;  1SD4 A;  2IPQ X;  2X51 A;  3KCC A;  5D8L B;  1VQ7 I;  3JR9 A;  2AQF A;  3KET A;  2DMQ A;  3W6J B;  2IT0 A;  2R7T A;  2J5O A;  4HDU A;  2EK5 A;  4BJT A;  2XAG A;  4ZH4 F;  2TCT A;  2M2E A;  2PMH A;  1I6X A;  3DEW A;  2HPM A;  1GHC A;  3R60 A;  2XPV A;  4UUS A;  2WB1 N;  2PI0 A;  3KP2 A;  4B48 A;  3DU5 A;  3FBN B;  2IGK A;  3J81 Z;  4QPO A;  5J8F A;  1UG0 A;  4HRI A;  2ZB9 A;  4WXH A;  1KU3 A;  3O8H A;  5M5Y J;  3M4O J;  5KNL A;  4IVN A;  1LB2 A;  1MMG A;  3IH2 A;  3WTZ A;  5CVJ A;  2HKX A;  2TRT A;  4ABZ A;  2G7H A;  2LDU A;  4HEA 2;  4UHT A;  1MJB A;  4LK0 F;  1YLF A;  5LRR A;  2PMZ A;  1R23 A;  3B6A A;  3C1D A;  3HTU A;  4XSX F;  1DP7 P;  4KNY A;  4U87 A;  2B7E A;  2KIM A;  2NXN B;  3WTT C;  3FMS A;  3BTJ A;  4G7O F;  4CA0 A;  1ODD A;  1XGN A;  3QPH A;  3H92 A;  3LSP A;  3TP3 A;  2R92 J;  1JTY A;  5ERI A;  2WWY A;  2IS1 A;  1WRJ A;  4C2U A;  1JJ6 C;  4NB5 A;  5FRM A;  1ZRE A;  4K2E A;  2DA1 A;  1W5C C;  3FX3 A;  3WG9 A;  1MBE A;  3OS2 A;  2DA3 A;  4EJU A;  1OR7 A;  2L02 A;  1U2W A;  5KK1 A;  1T0F C;  2QVO A;  1LUJ B;  2R93 J;  2ICW G;  3GTO J;  1I6H J;  2HXI A;  1TTY A;  4RB1 A;  2R7S A;  1KON A;  2DN0 A;  3PFI A;  1XSX A;  4KDP A;  1BL0 A;  1D1C A;  1TQI A;  4ZC3 A;  1JHH A;  2F4O B;  2X48 A;  4HG2 A;  3OSG A;  1OYW A;  2OQG A;  4ZYD A;  3CUQ C;  3CP2 A;  5D5V B;  2JA2 A;  4B44 A;  1OCC H;  3GFJ A;  3S2H J;  4NC6 A;  1BW5 A;  1S3J A;  1X1B A;  2L7Z A;  3NQO A;  3S32 A;  1BI1 A;  1OMI A;  4QLC U;  4FCY A;  1NK2 P;  3VDX A;  1D5Y A;  1STZ A;  4XK4 A;  5E3M A;  1DP3 A;  3L1P A;  1WZ2 A;  5IOZ A;  3I55 I;  2DXI A;  1BI3 A;  1EA3 A;  4J01 A;  4RGU A;  2QCO A;  3RTR A;  4F92 B;  5FB2 A;  2HYJ A;  2VPL A;  1ZG3 A;  5FD6 A;  1PVE A;  1JKR C;  1PUF A;  2XAJ A;  4L5J A;  1K78 A;  2DA7 A;  5IPA A;  2KT0 A;  1JT6 A;  5JHU A;  3QYB A;  2LP0 A;  4DYQ A;  4XID A;  3LNQ A;  3KX2 A;  1HW1 A;  2F5C A;  5EZH A;  1SMY F;  3BTI A;  2EV5 A;  4XLC A;  5CKT A;  2VQL A;  2W85 A;  1MH3 A;  4BE0 A;  2XGD A;  4RB0 A;  3V4G A;  1WJE A;  4G9Y A;  3K4N A;  5J1Y A;  2X1E A;  2A61 A;  1W7P B;  1N25 A;  3W2A A;  3MN2 A;  4H0E A;  2JTV A;  4NDL A;  3MKW B;  3BR0 A;  4HA8 A;  3SZT A;  1R9T J;  3U1K A;  4UUV A;  2NVU B;  2XPW A;  4A3J J;  2ZME A;  3ABK H;  2E2I J;  4A0Y A;  4ZZD A;  2V9K A;  5F64 A;  2NOG A;  5C3E J;  2H09 A;  4WCG A;  2CQQ A;  5E1X A;  3OIQ A;  1LFP A;  1XGS A;  1TQP A;  2E19 A;  5FLX Z;  3GTK J;  1RKW A;  3OYL A;  2Y9Z A;  3MMY B;  1VTN C;  1G3W A;  2O7O A;  1QQI A;  3LOC A;  4JK1 X;  2D45 A;  3SQN A;  1FOK A;  4XKC A;  5FRO A;  4BDZ A;  4HQE A;  2OTL I;  3FXU A;  1HBX G;  1I3A A;  4G12 A;  3BG3 A;  4KMU X;  2JJ7 A;  4AC0 A;  1YE9 A;  1SD5 A;  1MSF C;  1YW9 A;  2HTJ A;  2VOD A;  2DDA A;  1WI9 A;  2EZL A;  3JTG A;  4AM3 A;  2R7R A;  4LLN A;  3I5U A;  1G3S A;  2LKS A;  1MBH A;  4ANJ A;  2STT A;  3A02 A;  1N77 A;  1XTA A;  2ECC A;  3Q0W A;  5DDG A;  4LD5 A;  4F52 A;  3CES A;  4BXF A;  4A6E A;  5LD2 C;  3ELK A;  3PM1 A;  1TC3 C;  2CWE A;  4D7M A;  5EEH A;  2NS8 A;  1P4X A;  2JN6 A;  4LIT A;  3WGH A;  3UR3 C;  4R79 A;  3BTL A;  3TQN A;  1ON1 A;  2QZ8 A;  3BCA A;  2OZ6 A;  3HXL A;  1ETY A;  1R4M B;  4HPQ A;  5E1Z B;  4ESB A;  5GAE J;  5A2Q Z;  4HDV A;  1PDN C;  3RZO J;  3PSI A;  4AYB A;  2KJC A;  3V7R A;  4BY1 J;  2QKM B;  3G2B A;  1LVK A;  3AG1 H;  2IW5 A;  2JMW A;  4XKB A;  2XSD C;  1OQY A;  4FE7 A;  4MO7 A;  2DK5 A;  5J4V A;  5ILV A;  4YFN F;  1B72 B;  1OCR H;  3SEQ A;  3IKT A;  3OYC A;  2BZT A;  2E36 A;  5HOD A;  4FT8 A;  4LB5 A;  5CQE A;  2HOA A;  2KPM A;  1XCB A;  2PLY A;  5H2F C;  1Z7U A;  2Z5U A;  4B4C A;  1HLV A;  3CDI A;  2E7W A;  3LQR A;  2R7D A;  5KAF C;  1W0T A;  2EIL H;  1FTT A;  3W6V A;  1UST A;  1X4P A;  2VBY A;  3TGN A;  1X1A A;  3RI4 A;  3E1S A;  2UXN A;  3Q0U A;  3MZY A;  1TZL A;  4I98 B;  3NWT A;  2IS6 A;  4CO8 A;  2P6T A;  4A0Z A;  1O3T A;  2RDP A;  4WXD A;  1WQ2 A;  2Y2Z A;  2WAQ N;  1IN6 A;  1R1U A;  3MKY B;  2PJR B;  1Z77 A;  2CRG A;  2TDX A;  4ENK A;  2DK8 A;  1RKT A;  2D2W A;  2FQ3 A;  5EGO B;  1ZR4 A;  4GFB A;  2V7F A;  1R22 A;  2OU2 A;  1TWA J;  3J7A Y;  1B9N A;  3GME A;  2A6H F;  3FM5 A;  1N75 A;  1RNL A;  3OR2 C;  2DQR A;  2VUM J;  1W5T A;  1G59 A;  5CVV A;  5M5X J;  1F43 A;  3H5N A;  3QPS A;  4QPQ A;  5DEQ A;  1U3E M;  1OCP A;  2CUE A;  1QBJ A;  1DU6 A;  2HDD A;  3VYR B;  2OBP A;  2UXX A;  4KN4 X;  1K83 J;  1XG1 A;  4Y3O A;  2R5Z A;  2KP6 A;  2AXL A;  3LSH A;  4KJZ A;  4XLF A;  3T1B A;  3K1N A;  2E1O A;  5BS6 A;  4X6A J;  4PFO A;  3F8C A;  4Y15 A;  3OYI A;  3A4C A;  3ZQI A;  3M8J A;  4WWC A;  4MEY F;  2ME6 A;  1FP2 A;  2HQ5 A;  2ZXH A;  1O57 A;  1U8B A;  3CLQ A;  3K2A A;  5B1A H;  4UV8 A;  4C2M J;  2K9L A;  2L9V A;  5FLM J;  3JRB A;  3H3U A;  3KYC B;  1UZC A;  2E1M B;  4PGH A;  3U1D A;  2WV1 A;  4E7I A;  4EMS A;  1RRJ A;  2GA2 A;  4EQQ A;  3FXR A;  5LEJ A;  1W36 C;  3IWF A;  3MD2 A;  3GTQ J;  3PFY A;  2O8X A;  2MFZ A;  4JX4 A; 
#chains in the Genus database with same CATH homology
 5L3B A;  3I59 B;  2FBK A;  3SFZ A;  5DUI A;  3F3X A;  3AAF A;  3IKV A;  2FRH A;  5BMZ A;  4HF2 A;  4IXA A;  2HGC A;  1ZH5 A;  1T2K A;  3LAP A;  3COA C;  4M9Z A;  2PJP A;  1PUE E;  3HUG A;  3LA3 A;  1IZ1 A;  3MEX A;  2WV0 A;  2MC3 A;  3E97 A;  2FA5 A;  2HS5 A;  5H6Q A;  2YX4 A;  2XUB A;  2D1V A;  3R4K A;  5D4R A;  2UZK A;  1HXD A;  4EJO A;  2A69 F;  4EJV A;  2QUF A;  4YII A;  1Z6T A;  2VC1 A;  4P9U A;  2CO5 A;  4O5V A;  1MZB A;  4RAY A;  1YS6 A;  3GVA A;  4EVI A;  1BM9 A;  3FMR A;  1J9I A;  2M8E A;  4OIR F;  2RGV A;  1QO0 D;  1U5T C;  3ZMD A;  3E6M A;  1XSV A;  2DU9 A;  4CYD A;  1YQA A;  3K1M A;  3KP5 A;  5D5X B;  5E8I A;  3N4M A;  3ABT A;  3BZ6 A;  3U2R A;  2K86 A;  2EFN A;  3M1E A;  1BI0 A;  3OOP A;  5IT9 Z;  1QNT A;  2YSR A;  1ZGA A;  2CYY A;  1ZRF A;  1T98 A;  2DFI A;  3DV8 A;  2DQL A;  3HRT A;  4HV5 A;  2OZU A;  1TNT A;  2XHK A;  3CO7 C;  5D4S A;  1HST A;  1HW5 A;  1LDD A;  5CVU A;  4KIC A;  4UXN A;  2ESH A;  5K5R A;  3V8J A;  3F8M A;  5HLG A;  1F1Z A;  3K9T A;  1QGP A;  5LGN A;  1V3F A;  3FHZ A;  5HDN A;  1MGT A;  2IA1 A;  3PQJ A;  1FYL A;  5TJJ A;  5L3G A;  2G7U A;  2HYG D;  5D6F A;  4KA4 A;  2Z9O A;  2HQR A;  4OIN F;  3P9C A;  4CIC A;  1OPC A;  3JAM Z;  1RIO H;  2PG4 A;  2ZXJ A;  5BOX A;  1CF7 A;  1YIO A;  4M6Y A;  2P8T A;  4YIF A;  3HRS A;  3CO6 C;  4IRH A;  4KFC A;  3K0L A;  4ASN A;  2XRO A;  2IA2 A;  3PQK A;  2V1D A;  2MH2 A;  3KP4 A;  4LLG F;  5E17 F;  5FO5 A;  1XB4 A;  4HOB A;  3T0Y A;  2FNP A;  4HV6 A;  4P96 A;  4LG0 B;  4FX4 A;  4B09 A;  5ED4 A;  4BNC A;  2GZW A;  1UHW A;  3G3Z A;  1AWC A;  5L3C A;  3WU0 A;  4L9V A;  1Z9C A;  1WSU A;  1MD0 A;  2XVC A;  4UV9 A;  2XKP A;  5DCF A;  3CDH A;  3TO6 A;  5E8G A;  4CXF A;  4HLY A;  2M87 A;  3C7J A;  2HZT A;  3J80 Z;  4P9F A;  1LJ9 A;  4BHB A;  2YU3 A;  3RKX A;  4GO1 A;  4LMY A;  3GZ5 A;  1ZG1 A;  3BJ6 A;  2PN6 A;  4WK8 F;  1J59 A;  1IXS B;  3BP8 A;  1GVJ A;  1RUN A;  5AIP A;  4GXO A;  2L4M A;  3R0A A;  4LB6 B;  4KIF A;  4HX8 A;  2P5L C;  3MZH A;  2DO7 A;  5E20 A;  1G6N A;  4E70 A;  1FBS A;  4KIG A;  2M5W A;  4RGX A;  4HZF A;  1BOA A;  3KZY A;  2LKP A;  3T8T A;  1G4D A;  2XAS A;  1BC8 C;  5CVR A;  1T6S A;  1IW7 F;  3SZP A;  1OYI A;  3F21 A;  4A5N A;  2CQK A;  2R7F A;  3LFK A;  1R5G A;  3HRU A;  4NHJ A;  1H9T A;  1UB9 A;  4XRF A;  1PP8 F;  4LGW A;  2HEO A;  1W4M A;  3CTA A;  1ZGJ A;  1EV7 A;  2L01 A;  1USS A;  1SD7 A;  3I4P A;  3DXJ F;  3R6S A;  3BRO A;  3IL2 A;  2EB7 A;  1BJA A;  1NHA A;  2J5P A;  4AVP A;  2Q0O A;  5BPI A;  4MGR A;  2V1X A;  3LA7 A;  3KP3 A;  3K2Z A;  3N97 A;  1O7L A;  5D5W B;  3WOD F;  1SD6 A;  1EH7 A;  4EGY A;  5HLH A;  1P92 A;  1DUX C;  1B6A A;  2GIV A;  2CG4 A;  2F5F A;  5HOO A;  3HSE A;  1LEA A;  1IXR C;  3B02 A;  4ZZL A;  2PBI A;  3REO A;  2VE8 A;  1T39 A;  3DQV C;  2CFX A;  4R1H A;  3RKW A;  1ZLK A;  3TKY A;  1FSH A;  2NS0 A;  1RUO A;  4AIH A;  3I71 A;  3K69 A;  3TOA A;  3TOB A;  5ICC A;  5H20 A;  3JTH A;  3O3K A;  3EUH A;  4AIJ A;  3GX4 X;  3E3V A;  5FFX A;  3D5L A;  5L3F A;  4RB2 C;  1K78 B;  3HSR A;  4G6Q A;  2HTS A;  1EH6 A;  2VT3 A;  3GO5 A;  1ZG5 A;  5K5O A;  4I01 A;  3U9G A;  2QEN A;  2YPR A;  1W5S A;  2EFQ A;  1Y0U A;  1IXC A;  3EDP A;  3ULQ B;  2O61 A;  5AIQ A;  2ZME B;  2UWM A;  2IJL A;  2PQ8 A;  3MFK A;  4G94 A;  5F6F A;  3KFW X;  2NYX A;  4KYW A;  3WTW C;  3IHU A;  3S2W A;  5HS7 A;  3GW2 A;  4M71 A;  3V7C A;  2OA4 A;  5F1R A;  2DI3 A;  4P55 A;  2OD5 A;  4EM0 B;  3KEO A;  4MQ9 F;  1R00 A;  4N9H A;  5ILS A;  3F6O A;  4KT5 C;  3HOT A;  2A07 F;  1XN7 A;  3NRV A;  1KQ0 A;  1FC3 A;  1YW8 A;  1MDM A;  3TDZ C;  2ADU A;  1ULY A;  4KIB A;  3J7A O;  5LGT A;  1IF1 A;  3W6K B;  1RI7 A;  3J81 K;  4RGS A;  4BAY A;  5D8K B;  5DYM A;  3ECO A;  3V7S A;  4BHP A;  1ZRD A;  2ZNZ A;  2EA2 A;  3GUD A;  2CSO A;  5DUK A;  3KLN A;  4IHT A;  2QM3 A;  1CGP A;  4M73 A;  1KQ9 A;  1E2X A;  3GF2 A;  2Z3Y A;  2HQN A;  4U0Y A;  2FMY A;  4OIO F;  5LBQ A;  1L0O C;  5J6X A;  3I58 A;  2VXZ A;  3KEQ A;  2EA4 A;  4XBF A;  1FPQ A;  2HR3 A;  3L09 A;  3LST A;  4D0P A;  3F6V A;  5KVR A;  2XV4 S;  2KKO A;  2XAH A;  5CYV A;  2GQQ A;  4OU0 A;  3TDU C;  4UNO A;  5JR3 A;  1H9G A;  3WTX C;  3C3W A;  5D6E A;  1EH8 A;  1REP C;  1FLI A;  1P6R A;  1KYZ A;  2XAF A;  3EYI A;  3DEU A;  3LWF A;  4I0A A;  3O6B B;  3ZPL A;  3RYR A;  3ZMU A;  3WTS C;  2MD5 A;  3F23 A;  5ILU A;  1HKS A;  1KA8 A;  4MTE A;  2QBY B;  3I64 A;  2QBY A;  1O3R A;  3F8B A;  5LHH A;  3CUQ A;  5ICF A;  1LDK B;  2A6E F;  1X3U A;  5FLX K;  2P5K A;  5LHI A;  3G73 A;  3ISP A;  1BIA A;  2BBY A;  3E6D A;  1ZRC A;  4FHT A;  2STW A;  5H6R A;  2FSW A;  1R1T A;  5DD8 A;  1XCV A;  3IRQ A;  3V8L A;  1QZZ A;  1XSD A;  2RC4 A;  4MEX F;  3KP7 A;  2KRF A;  2V6C A;  2F5E A;  3IC7 A;  3WGG A;  3ZQ7 A;  3BJA A;  1B9M A;  1F9N A;  2RV8 A;  3IRR A;  1FWZ A;  5A2Q K;  1ZAO A;  1ONV A;  2WTE A;  2Q2E A;  3Q9S A;  1ZN2 A;  3L7W A;  1B4A A;  2ZFW A;  2FF4 A;  1DDN A;  5L3E A;  2LF8 A;  2FU4 A;  4IHS A;  2YX7 A;  4P5O A;  3I53 A;  1F5T A;  2W57 A;  4S05 A;  4HLX A;  4N0B A;  3L2C A;  2F2E A;  4JBA A;  4MHG A;  2X4H A;  4OIQ F;  4GYI A;  3BOQ A;  1YW7 A;  3GWZ A;  3WGI A;  4TV7 A;  1YG2 A;  3ZMZ A;  3P9I A;  1D3Y A;  3HYI A;  2K7L A;  4G7Z F;  2FE3 A;  1BC7 C;  5HDG A;  1IN5 A;  2XKO A;  4Q4Z F;  2ZO4 A;  1WWX A;  2XIG A;  4IRG A;  4KUM A;  4A6D A;  2FOK A;  4S04 A;  2HFH A;  4M9S A;  1CF7 B;  1KU9 A;  1FBU A;  3GFM A;  4BQA A;  4Q5S F;  3DPL C;  3H3Z A;  2BGC A;  3TO9 A;  2A3S A;  4HF1 A;  1O3S A;  2B0L A;  2VE9 A;  4OMZ A;  3F8F A;  4B8X A;  5HS9 A;  1HSJ A;  5K5Q A;  3EYY A;  1UFM A;  1Z91 A;  4WXC A;  3HTS B;  1LVA A;  1FBQ A;  3WU1 B;  3MCZ A;  4XSZ F;  3I0T A;  1BI2 A;  5FD5 A;  1D5V A;  5HS8 A;  1I1S A;  2M45 A;  2CGP A;  3VB2 A;  1L3L A;  1R36 A;  3MWM A;  4AWX B;  2ZKZ A;  3WTY C;  4AD9 A;  1JHF A;  2VOO A;  1G3T A;  1I1G A;  4F7Z A;  4Q48 A;  3D0S A;  2R3S A;  3Q9V A;  3ABU A;  4GYG A;  5AON A;  3WE2 A;  3ECH A;  3QU3 A;  2O0Y A;  2IRF G;  2LF7 A;  3RYP A;  4LLL A;  4YFX F;  1R5H A;  1D8J A;  1P4A A;  4BXU A;  2EFO A;  2XAQ A;  3RJP A;  2EWN A;  4L18 B;  3MQ0 A;  3O2P E;  3FM3 A;  4HYE A;  1W7P D;  3FZV A;  5K1Y A;  1GXQ A;  3K1P A;  1UHM A;  5IT9 K;  5LEK A;  1IN8 A;  3V8K A;  3KE2 A;  2ELH A;  3HOS A;  3M7G A;  3HHG A;  3EQL F;  5TRD A;  4BH9 A;  5CJ9 A;  2FEZ A;  4QWQ A;  4A12 A;  2A5Y B;  2C6Y A;  2M30 A;  3GFI A;  1U6G A;  1ON2 A;  2K4B A;  3GXO A;  1KU2 A;  2HOE A;  3DP7 A;  3BY6 A;  1U5T A;  2Y48 A;  3F72 A;  2YR2 A;  5LGU A;  5CLS A;  4ENJ A;  2VT2 A;  3JAM K;  2QLZ A;  2L3D A;  2MLK A;  4WX9 A;  2JT1 A;  2P6S A;  2MH9 A;  3T8R A;  1Z1D A;  2G9W A;  4G8X A;  3LQQ A;  4UVB A;  2MBF A;  3M8F A;  4LFU A;  2HYF A;  2VOP A;  5ICE A;  2RKH A;  5FGM A;  4HW0 A;  4AIK A;  2AS5 F;  1I27 A;  2ESN A;  1O7F A;  2DW4 A;  4ETS A;  4Z2Y A;  3VOE A;  3WTU C;  2BEO A;  1YS7 A;  4O3M A;  2PEX A;  4A0X A;  2Z33 A;  1RZ4 A;  1BN5 A;  1U8R A;  4U0W A;  2ACJ A;  1H0M A;  4ON0 A;  3MAJ A;  1MJA A;  1HQC A;  1JE8 A;  1TBX A;  4YFK F;  4L9N A;  2FNA A;  4HBL A;  1FP1 D;  2HDC A;  1HKT A;  2FBH A;  1J5Y A;  5J8C A;  2X0L A;  2VBX A;  4ZYE A;  2RN7 A;  3CJN A;  4A2U A;  5LRS A;  3M9A A;  3P9K A;  2KIF A;  3J80 K;  5E1W A;  1DPR A;  5DD4 A;  1R7J A;  1XDU A;  1YYV A;  3FWE A;  3DPT A;  5D5U B;  4RS8 A;  2GXG A;  3WTV C;  2H6B A;  4PGG A;  4MQV A;  4U7B A;  4LK1 F;  2A68 F;  3KZZ A;  4L5I A;  3ZN0 A;  2VN2 A;  1SAX A;  3SXY A;  4I02 A;  1TNS A;  4MNU A;  4OMY A;  3QRF F;  3M8E A;  3ML6 A;  2EFW A;  4HX4 A;  3LA2 A;  3L00 A;  4Y17 A;  1HW2 A;  3NEU A;  1FNN A;  2K27 A;  2IP2 A;  3RPQ A;  4EM2 A;  4GGG A;  2O6G E;  1Q1H A;  2WC2 A;  4U0V A;  2NNY A;  1Z05 A;  1W7P A;  4MTD A;  1R58 A;  4U7D A;  4M6X A;  1D8K A;  5EEG A;  5HLI A;  1FSE A;  1FYM A;  2MA3 A;  1JGS A;  1MDM B;  2JPB A;  2FXA A;  1XMA A;  2KJB A;  3E5Q A;  1KQ8 A;  3LAJ A;  3ZMS A;  3WE3 A;  5HDK A;  4Y13 A;  4HAM A;  1BBY A;  2QQ9 A;  4I09 A;  1J7K A;  1A04 A;  5LHG A;  4Q47 A;  2L54 A;  1S7A A;  3CLO A;  3VFZ A;  2ZNY A;  1FYK A;  1KYW A;  2EV0 A;  2Z99 A;  2NAZ A;  3HSF A;  5DCM B;  1UCR A;  3C18 A;  3BPX A;  5DCM A;  4WF2 A;  4UVA A;  1XGM A;  1G3Y A;  4G7H F;  3ROU A;  1FY7 A;  1Z6R A;  4LJZ F;  4G6D A;  6PAX A;  4L9T A;  2V1U A;  4M74 A;  3R61 A;  2EJR A;  2JSC A;  2ISZ A;  2ISY A;  2DT5 A;  2DBB A;  2HWV A;  1IRF A;  2GXB A;  1S6L A;  1SFX A;  2IA0 A;  5HVQ C;  1SFE A;  2ZJ2 A;  3VOD A;  1V4R A;  3FXQ A;  4KN7 X;  1BIB A;  5L3D A;  1E17 A;  3BDD A;  1J75 A;  2W84 A;  1ZHF A;  1IN4 A;  4EV0 A;  2Y0M A;  1S7O A;  4EGZ A;  2DAO A;  2F5D A;  2O03 A;  3OV8 A;  3DKW A;  3HHH A;  3GEZ A;  1I5Z A;  1QPM A;  1P2F A;  1T0F A;  1J2X A;  1IRG A;  4DQ2 A;  4R8H A;  1S8N A;  3DFG A;  3ZN1 A;  1K7A A;  4M72 A;  1K6O A;  2E1C A;  3CUQ B;  4HF0 A;  3SHF A;  2KIU A;  4IRI A;  1KU7 A;  2DPD A;  4HX7 A;  2PMU A;  2COM A;  2V9V A;  1S29 A;  4I7H A;  4OOI A;  1YO5 C;  4PDK A;  3I59 A;  5BQT A;  4CGZ A;  2DLL A;  2OAZ A;  4ESF A;  2H27 A;  4JQF A;  2P4W A;  1ZAR A;  2QQA A;  1YFH A;  2GA1 A;  3F8N A;  4A5M A;  1J0R A;  2QWW A;  2NNN A;  4L9J A;  3BJO A;  1ZYR F;  3KLO A;  2BE5 F;  2O3F A;  3VEP A;  3E6B A;  3ZMV A;  1FX7 A;  2CW0 F;  3FMQ A;  1P4W A;  4ESJ A;  1WKM A;  3GZ6 A;  2V79 A;  2E7X A;  3QOP A;  4I2O A;  3P7N A;  2H6C A;  3E5X A;  2BV6 A;  5ICG A;  1OYY A;  4HQM A;  3RPU A;  3QP6 A;  4IJA A;  1ZLJ A;  2NRA C;  3T5X A;  1B59 A;  1TLH B;  3GYH X;  5BPD A;  2W25 A;  2ZBK A;  1MJ9 A;  3HIF A;  1LDJ A;  2VC0 A;  1C0W A;  1YTY A;  3JW4 A;  3BWG A;  3L9F A;  1DPU A;  4I0B A;  4EJT A;  1IUY A;  4U88 A;  2LNB A;  1JXS A;  3GLX A;  4ZYG A;  2K4J A;  3I54 A;  3QAH A;  4FX0 A;  5DV5 A;  1FZP B;  4BYY A;  4RGR A;  1IAW A;  3F22 A;  2LSO A;  2VBW A;  2PFB A;  2MLG A;  2FBI A;  2IVM A;  2DTR A;  2M1B A;  2ZCW A;  2JPC A;  4YG2 F;  3R0J A;  3FF5 A;  4RAZ A;  1MKM A;  1PP7 U;  2W24 A;  3BPV A;  1IN7 A;  1LQ1 A;  1HKQ A;  4CDG A;  4M9X A;  1QZY A;  1AOY A;  1K79 A;  3JSP A;  4L0Z B;  5FFZ A;  4OIP F;  4GCV A;  2RQP A;  5JVT A;  2E1N A;  2H94 A;  3B73 A;  1XGO A;  2ETH A;  1OKR A;  3HRM A;  1XD7 A;  4LG0 A;  3QPT A;  3ZMT A;  2OQR A;  5E18 F;  2K02 A;  3E5U A;  3KP6 A;  1FT9 A;  1TQM A;  4DNC A;  1TW2 A;  5JFR A;  2HKO A;  1XDS A;  4BHC A;  4ENM A;  2VON A;  2Y75 A;  1LNW A;  3CUO A;  2P7V B;  3ZP5 A;  4ENN A;  3RDI A;  4CZZ A;  2RNJ A;  4CHU A;  3IWZ A;  4L0Y B;  3GFL A;  1SFU A;  1KGS A;  1TW3 A;  3RKY A;  4EM1 A;  3RIR A;  1O3Q A;  1T38 A;  3E6C C;  1U78 A;  2GWR A;  2P7C B;  2P5V A;  2EV6 A;  2VBZ A;  2EFP A;  3JSO A;  2JZY A;  2XGX A;  2JRT A;  4NQW A;  1R1V A;  4XLN F;  4ZYH A;  5IT3 A;  3QU6 A;  3DF8 A;  1B1B A;  2D1H A;  1F4K A;  4EJW A;  1U5T B;  2DPU A;  2FML A;  1LEB A;  3Q5F A;  2XRN A;  4O6J A;  4UVC A;  3EET A;  4IPA A;  3QP5 A;  5CVI A;  1GXP A;  4IF4 A;  4N9I A;  4PCQ A;  3TO7 A;  1SMT A;  2GAU A;  5JI6 A;  1XMK A;  2BYV E;  2QYO A;  4PZJ A;  4XLP F;  2RVC A;  2QQB A;  2Q8K A;  4RB3 C;  3ERE D;  5LLQ A;  4KMF A;  1SD4 A;  2IPQ X;  3KCC A;  5D8L B;  3KET A;  2IT0 A;  3W6J B;  2J5O A;  4HDU A;  2EK5 A;  2XAG A;  4ZH4 F;  2PMH A;  1I6X A;  1GHC A;  3R60 A;  2PI0 A;  3KP2 A;  3J81 Z;  5J8F A;  4WXH A;  1KU3 A;  4IVN A;  1LB2 A;  3WTZ A;  5CVJ A;  2HKX A;  2G7H A;  2LDU A;  4UHT A;  1MJB A;  4LK0 F;  1YLF A;  5LRR A;  1R23 A;  3C1D A;  3HTU A;  4XSX F;  1DP7 P;  4KNY A;  2KIM A;  3WTT C;  3FMS A;  4G7O F;  1ODD A;  1XGN A;  3QPH A;  3H92 A;  5ERI A;  2WWY A;  1WRJ A;  4NB5 A;  1ZRE A;  4K2E A;  3FX3 A;  3WG9 A;  4EJU A;  1OR7 A;  2L02 A;  1U2W A;  5KK1 A;  2QVO A;  1TTY A;  4RB1 A;  3PFI A;  1XSX A;  4KDP A;  1TQI A;  1JHH A;  1OYW A;  2OQG A;  4ZYD A;  3CUQ C;  5D5V B;  3GFJ A;  1S3J A;  3NQO A;  1BI1 A;  1OMI A;  4QLC U;  1STZ A;  1BI3 A;  4RGU A;  3RTR A;  5FB2 A;  1ZG3 A;  5FD6 A;  2XAJ A;  4L5J A;  1K78 A;  5JHU A;  1HW1 A;  2F5C A;  1SMY F;  2EV5 A;  2W85 A;  4RB0 A;  3V4G A;  4G9Y A;  2A61 A;  1W7P B;  4H0E A;  2JTV A;  4HA8 A;  3SZT A;  4UUV A;  2ZME A;  4A0Y A;  4ZZD A;  5F64 A;  2H09 A;  4WCG A;  5E1X A;  1XGS A;  1TQP A;  5FLX Z;  1VTN C;  1G3W A;  2D45 A;  1QQI A;  4JK1 X;  3SQN A;  1FOK A;  4HQE A;  3FXU A;  1HBX G;  4KMU X;  1SD5 A;  1YW9 A;  2HTJ A;  2VOD A;  1WI9 A;  3JTG A;  4LLN A;  3I5U A;  1G3S A;  2STT A;  5DDG A;  4LD5 A;  4A6E A;  3ELK A;  2CWE A;  5EEH A;  1P4X A;  3WGH A;  4R79 A;  3TQN A;  1ON1 A;  4ESB A;  2QZ8 A;  2OZ6 A;  4HDV A;  5E1Z B;  1PDN C;  5A2Q Z;  2KJC A;  3V7R A;  2IW5 A;  2DK5 A;  5ILV A;  4YFN F;  3IKT A;  4FT8 A;  4LB5 A;  1XCB A;  2PLY A;  1Z7U A;  2Z5U A;  2E7W A;  3LQR A;  2R7D A;  1UST A;  3RI4 A;  2VBY A;  3TGN A;  2UXN A;  3MZY A;  4I98 B;  4CO8 A;  2P6T A;  4A0Z A;  1O3T A;  2RDP A;  4WXD A;  1WQ2 A;  1IN6 A;  1R1U A;  4ENK A;  2TDX A;  2DK8 A;  2D2W A;  2FQ3 A;  1R22 A;  2OU2 A;  1B9N A;  2A6H F;  3FM5 A;  1RNL A;  2DQR A;  1W5T A;  5CVV A;  5DEQ A;  1U3E M;  1QBJ A;  2OBP A;  2UXX A;  4KN4 X;  2AXL A;  3T1B A;  3K1N A;  5BS6 A;  3F8C A;  4Y15 A;  4WWC A;  4MEY F;  1FP2 A;  1O57 A;  4UV8 A;  3H3U A;  3U1D A;  4PGH A;  4EMS A;  2GA2 A;  4EQQ A;  3FXR A;  5LEJ A;  3IWF A;  2O8X A;  2L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...