3GVCA

Crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
245
Chain Sequence
LAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAALW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Probable short-chain type dehydrogenase/reductase
total genus 89
structure length 245
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gvcA00
5AXBA 4FIZA 3BXXA 2AQ8A 3V5NA 4QFDA 2CSUA 3W8DA 1NNUA 2B35A 3V2UA 4CMCA 3IOYA 1JWBB 5EMHA 2HMUA 1HE4A 4AFNA 2FPPA 2Y05A 4KDFA 5A9SA 1LSSA 1WNTA 2NQ8A 3A14A 5L7YA 3D5TA 5DZSA 1ULSA 3OIDA 4EJ0A 5AXAA 3T4EA 3X2EA 2X9GA 5MGBA 2X0IA 3NTOA 3GDOA 1PL7A 3BAZA 4DMMA 4XRGA 3PZRA 4YA6A 4W7IA 4J9VA 4CM8A 4G2NA 2B69A 5JDIA 3EHEA 2EERA 1PSDA 3AM4A 3DO5A 2C2YA 3JTMA 1HSZA 5A5EA 4JBGA 1NASA 1I8TA 1GFSA 2WD7B 3CUKA 3GGPA 3ONEA 4J1SA 1U3TA 4LRTB 5ENVA 4Z0HO 5B4TA 4J43A 4AJ2A 3T7EA 4I08A 1HYEA 1DFGA 3U4IA 1U4OA 3ZWCA 3I6IA 4O63O 4DREA 3JQFA 3K6JA 4FJ0A 3WNVA 1XEAA 3IP1A 4N5LA 3H5NA 4OXYA 4BNKA 1JDJA 3DHEA 3I1JA 1Z74A 2FP4A 4CM3A 2QYTA 4GWKA 2GN6A 4E0BA 5L4LA 5L7TA 3IUSA 2Q46A 4CLXA 1D8AA 3RUDA 2CUKA 5T6BA 1BXGB 2Q2WA 2O4CA 3Q3CA 4YQZA 5K9ZA 1VE9A 3U62A 3GG9A 2OZPA 1NWCA 1FDTA 2B5VA 2FSSA 1KOLA 2BFAA 4CMGA 5IN4A 1IB6A 1BHSA 2DAPA 4HV4A 5LDHA 3AM3A 2W2KB 4XB2A 3DTYA 3TN7A 4WNIA 1E7QA 1ZK2A 4AICA 1P1HA 2CY0A 3NYWA 2WD8A 3NDJA 4PLGA 4J2OA 3UN1A 3O8QB 4ALLA 4LK3A 1EQUA 4E2WA 4FN4A 4YAEA 4ROSA 2YHIB 2Q99A 4FFNA 4MP8A 5JDCC 1GQYA 4BQPA 1GV0A 2D4AA 3DMTA 3GNQA 3C8MA 1JQBA 2OMEA 3ANNA 4GSLA 4XQEA 8ADHA 4MKRA 1ISHA 2HK8A 3LC2O 4FOSA 4GLOA 4YRDA 5JCJD 2O3QA 2QHXA 1NVGA 4OSOA 3WYEA 4R68A 3D64A 4HWKA 3KSZO 4KTVE 3IP3A 1F0YA 4XQGA 4E5YA 1MX3A 3DZGA 2FHSA 4QO8A 4JBIA 3S2IA 4TSKA 1HXHA 2BFOA 4DPLA 3NTRA 4TKMA 4LGVA 3EYWA 3PEFA 1DSSG 2V6FA 4OYRA 3VTZA 1BVUA 3P7MA 4NBRA 5H81A 3SEFA 4BO5A 1BVRA 2NTJA 1NTOA 5L9AA 1TB4A 1U3UA 3ZNNA 1I24A 4M55A 1UP4A 3MWDB 5JBIA 3QJ5A 5ITWA 3V1TC 2NTNA 4AL4A 5EERA 5K6AC 4B3JA 3HN2A 2XF8A 4PLHA 2OORA 2PD6A 4LVUA 2O7QA 4PG8A 1U7HA 2BLLA 4PVCA 3VKVA 4CQMA 1M6HA 4CLRA 1KERA 1W4ZA 4MVJP 3D4OA 5A04A 4Z6KA 2GN8A 1LQUA 4UEOA 3E9QA 3ROKA 3NJ4A 4CJXA 4I5DA 3RUIA 5H83A 1NHWA 1M2WA 2VWGA 4B8ZA 1LX6A 2YV1A 3WB9A 1T2FA 1K2WA 2NU6A 1V3UA 2CVOA 2IXBA 4BNNA 4EUFA 1LLDA 3EUWA 3NDRA 1R15A 2X9NA 5ITVA 3HUDA 1E7RA 1ZJYA 3D1LA 4YJHA 2B36A 4A7PA 1EDZA 3EVTA 2RAFA 1GTMA 2H1SA 1H6BA 4YRAA 1BXZA 4YAKA 3NV9A 3TFOA 4JQCA 1GYPA 3AY7A 3PTZA 4D79A 1DAPA 2X4GA 4YR9A 4CQMB 5J23A 4DA9A 3UOGA 4CL3A 4A2CA 4WOKA 1U3VA 2D3TA 3BTSA 1O9BA 2UYYA 3JQFC 3OEWA 3FRJA 1UXKA 3PPIA 5AQ1A 1Z45A 3I9NA 4GSKA 1PJ4A 2Q4BA 2EWMA 3OQ1A 1XELA 1N9GB 4WNCA 3U3XA 5DCYA 2C54A 1C3VA 1BW9A 3U4DA 1ZK3A 3WFIA 4NJMA 4YJFB 3D3WB 4JX8A 5TJHA 4M89A 1M66A 1NVTA 2RHRA 5DBIA 4BB6A 3OIFA 4BHTA 1P1IA 1F8GA 3VPXA 2BF7A 5TX7A 4FC7A 5KJFA 2GRAA 2J3JA 1C0KA 2YFQA 4L9RA 3S1LA 2ZIZA 1UUFA 3VH1A 3CPSA 4CLHA 1V6AA 1XSEA 1LBEA 3S2EA 3NT4A 1SBYA 1X13A 1ZUD1 1Q1NA 4ZVVA 2BGMA 1ZEJA 4CV0A 4HUJA 1VLLA 1ZZEA 3DBLA 4WGGA 2UAGA 3M1LA 3JYQA 3R6DA 4IDAA 4E21A 1B14A 4WEOA 1T2CA 5BSFA 3FPLA 2WD7A 1E6UA 1V0JA 4O0LA 3DXFA 1NFFA 3R3SA 4QECA 4FC6A 2D5AA 2YYYA 4OAQA 3U9LA 4ZICA 3Q11A 4DYVA 4LISA 3KHUA 3DBHA 3NGXA 2WMDA 2VHWA 4KQWA 4LVCA 4NJOA 4O59O 1LRJA 5CPFA 4CMAA 3L6DA 4B7XA 2W2LA 1LDBA 3PLNA 4UUMA 1L7DA 3ZWBA 4LCEA 4N7RA 3DZJA 1EUCA 4BGEA 3AFNA 2J5KA 5JXWA 1I3LA 1T4BA 5F1PA 2DC1A 2P4QA 4HADA 3RC1A 1GCOA 3CE6A 5ICSA 4UVIA 4J7CA 3HG7A 2Z95A 4YJDA 2DKNA 2PD3A 3I9MA 1VKNA 1X0XA 3GGOA 1IHXA 3WJ7A 4BIIA 3F3SA 4ALMA 5G0SA 2AG8A 4R1TA 3WYCA 2PGDA 3TZ6A 3ZW9A 1DIAA 2ZATA 3H9JA 1E3JA 3EC7A 4UAGA 2WYWA 4YAIA 1AXEA 2P9GA 4WOJA 4K9DA 1RYEA 2VTDA 4GVXA 3RVDA 5A05A 4R1SA 1RM4A 1QYDA 3HHPA 4DL9A 4QXMA 1HZJA 1YJ8A 1H6CA 1YO6A 3ICCA 1CQJA 3TSCA 1Y8QB 2NACA 3LC1O 9LDTA 1JAXA 1K6JA 1R37A 3IS3A 2OP1A 5U4QA 4ZQBA 1KEVA 1AE1A 1CYDA 3KSUA 3AK4A 4GGPA 1H94A 1VI2A 4A10A 5IDXA 4Y98A 2AXQA 3A4VA 4YWJA 3GZNA 5EL0A 3VKUA 1LTHR 2YDXA 4D44A 5CDGA 4QT0A 1LJ8A 3CZRA 1QXSA 1S7CA 2DTXA 2GLXA 2IE0A 4AJIA 1ISGA 2EXXA 3CXRA 5DN9A 3OJFA 4J7UA 5COBA 1ADCA 4RLSA 4B8WA 3DZKA 2F1KA 3KVOA 1GPJA 3WLFA 1HYHA 2VOEA 2UV8A 2FR0A 2WWRA 2OGUA 2FR1A 4Q3CA 1FDWA 3DBLB 2Q1SA 3JD0A 1LI4A 3BMNB 1B8PA 4IS2A 5G4KB 5BSGA 3D4PA 5TF4A 3VDRA 2AA3A 3QVTA 3V2GA 1X15A 4CM1A 1RYDA 3AI2A 4M49A 4FFPA 4YVFA 4YT8A 3JQCA 4Y9DA 2YJZA 3JQ7B 1TI7A 5JMWA 2W4QA 2V6MA 2CDAA 3PP8A 3TZHA 4JNKA 3O4RA 4BMVA 2O50A 3JQGB 3JYLA 4B7CA 5DCWA 1DFHA 1JTVA 1MP0A 5L53A 4BKOA 4BNZA 4DQUA 3GAZA 1KBZA 1H9BA 1P33A 3PYXA 4MPDA 2V65A 1DC4A 2X22A 1MXHA 1AHIA 1WXDA 4H7PA 1X0VA 5DULA 1HDXA 2QRLA 1QLJA 2ZK7A 1EVIA 3OMLA 2D59A 4F6CA 4L4RA 3WQRA 5HBRA 2VNSA 4J90A 5B4UA 1Z73A 3DONA 2JHGA 4NK4A 5L4SA 4XD2A 1O0SA 1PZGA 3BIOA 4IIUA 4PG5A 3OEYA 3DBHB 2IZZA 1W8DA 2O3RA 4CUJA 3FNGA 4CODB 3SXPA 5KJCA 5JE8A 4OQYA 1YQDA 3F5SA 3TDKA 4UULA 3UH1A 3FNHA 1KEPA 4BV8A 4U0KA 2OUIA 4DBVO 4NK5A 3E9MA 3ZV5A 1DC5A 4QEDA 1KVSA 2PGJA 4U6QA 4X54A 2NU8A 3PIIA 4YDRA 3GDGA 3MJTA 4GX5A 4XR4A 3ZU3A 5HM8A 4B4OA 1QSGA 5C7IO 5JAMA 4E32A 3WQSB 3G79A 1ISIA 3Q6IA 1NM5A 4PLFA 1I30A 4IDBA 4C4OA 4Q3DA 2X9VA 4MP6A 4NJMB 1YRLA 2R00C 3D5QA 1BW9B 3ICPA 2G82A 5HS4A 4I5FA 1MLDA 1NXQA 1LEHA 3LT0A 2DTDA 1E3LA 3C3XA 4BNFA 1Z7BA 1ZCJA 3I9JA 2FZWA 1A4IA 1HE3A 4D43A 3H9EO 3QA9A 1WVGA 4FBGA 3INRA 1SB8A 2EF1A 3DQPA 5CP8A 2FRDA 1LSUA 3GY0A 3UICA 5IN5A 4TWRA 3B6ZA 1P9LA 1T26A 3H2SA 3OH8A 1UXHA 4OH1A 1ARZA 7MDHA 1NR1A 4BNWA 4BO0A 4NU6A 3JQ6A 4R1NA 4IGFA 1Q7GA 1PJBA 4CQMD 3E9NA 3HB5X 5CEEA 3DBVO 1PGJA 4BUCA 1W6UA 2D5CA 2QG4A 2Y1EA 3FTPA 3HADA 2POQX 1IZ9A 5A4DA 4MKZA 1LC0A 2PFGA 3QVWA 4TZTA 1B26A 1HLPA 4CLOB 4Z9YA 2J3IA 3G17A 4L76A 4ALKA 4CMBA 2EG9A 1WLYA 3FTNA 2Y1DA 1QV7A 1Z82A 7ADHA 3R1IA 2G76A 3A06A 1MA0A 3AFMA 1H2HA 1FMCA 3FHLA 5DNAA 1CDOA 1Z6ZA 2ZJ0A 3WMWA 4JXKA 1R0LA 4LCJA 1KEUA 3PJGA 2Q2VA 4XYBA 3DAPA 3TNLA 2W2KA 3CMMA 3JQ9C 3IC5A 3RD5A 4O5OA 2NU7A 3FR7A 4CMHA 1FDUA 3C7AA 1UP6A 2H5LA 4ND4A 1J5PA 1HDGO 3PJDA 4OOFA 4Q3EA 2EIHA 1LSOA 5GZ3A 3K5PA 1D1SA 4E12A 4XR9A 1YH3A 2Y1OA 2AQHA 2AHRA 2O2SA 5FWNA 1GR0A 4CM4B 3UCFA 3LF1A 3FNEA 1CWUA 2JHFA 4WCDA 1HE2A 1CQIA 4Y6RA 3GEMA 3N58A 4BV9A 4RVUA 1Z75A 4XKJA 2GUGA 1Y5RA 2EEZA 2NADA 4WLFA 1UXGA 1UXIA 4EJ6A 2VYVD 1WPQA 4K28A 4WUVA 3PXXA 3E82A 3WGYA 2VRCD 4EGFA 4JJFA 3H65A 4BNUA 2I6TA 2YUTA 3I5MA 1F12A 2BMAA 1NAIA 4S3MA 1PJQA 3D3EA 5JFOA 1C0PA 4H16A 5JSFA 1QYXA 3K2EA 3RUEA 3FNFA 3OP4A 3OJ0A 3O8QA 4IQ8A 5DOZA 4CM8B 4Q3BA 2V7PA 5ENDA 2X5JO 3TJRA 4NFHA 4PG4A 3JQAA 4Z0PA 3NT5A 1C1XB 3LT1A 3IIEA 4PZDA 3HZZA 4L4XA 3BTOA 5L95A 4O6VA 1PTJA 1QORA 3H4VA 1EEHA 2Q2QA 4FOOA 1XDWA 1XG5A 5AXCA 3G1TA 3VVBA 1ENOA 2JD0A 5AYVA 2I3GA 2IZ0A 1VSUA 1LDYA 1N8KA 4RPJA 4J91A 1TT5B 1A4UA 1EVYA 1GYQA 2JCXA 2AEJA 3C7CB 2YZ7A 1J0XO 2DPGA 4IZIA 2R00A 4RQUA 4XIJA 1NFRA 2DBVO 1MFZA 2QRJA 3GN1A 3L6EA 3AUTA 4CM9A 1EDOA 3B1FA 4ITUA 4DPMA 3ANMA 1E7MA 2H6EA 3BMCA 2P9EA 6LDHA 4HFJA 4UREA 4XQCA 3RC2A 3TL2A 2EJWA 2C82A 2PZKA 4KZPA 1EFLA 3TZQA 3RSHA 1NPYA 5A1TA 4XDYA 4XB1A 2HU2A 3E03A 4DXHA 1HL3A 3ROMA 1DFIA 1DXYA 1NPDA 4GMGA 5G2OA 4ALJA 3GZNB 2GF2A 1B0AA 5CDYA 1K3TA 3ON5A 4UVGA 4Y6SA 3KTDA 4P38A 4YEDA 3L4BC 3ZV4A 4DPKA 1PJ3A 1GUZA 3OA2A 2ILTA 1YL6A 2IODA 4AJKA 2Y1GA 1E3WA 3GEDA 1IOLA 1LLUA 1DJQA 1DOHA 1PGPA 4AJPA 4R16A 1EE2A 4GX0A 1UAGA 2Z5LA 2BGLA 5T67A 3UGKA 1ULUA 2F00A 3TZKA 3PZBA 4N5NA 3CH6A 2Y0EA 4J1TA 1I2ZA 3ZWNA 4NFSA 2E4AA 4TQGA 1A7KA 3HSKA 4MOWA 3QV1A 3DFZA 1R4MA 1XU9A 1F8FA 5IAAA 1WW8A 3ZHBA 2E82A 1U2GA 4A27A 4XGIA 3ZWVA 4RF4A 1GU7A 4IS3A 2NWQA 3PQEA 4ESOA 3ZZNA 4DUPA 1Y8RB 4DQXA 2SCUA 1ZK0A 3NGLA 3GHHA 3GVCA 2FMUA 4XQ9A 5BNIA 1ZKMA 3QRWA 4OXKA 5A3JA 1MXFA 1XCBA 2RHCA 1DBVO 3RFVA 2C20A 2BFPA 3PHIA 4OMUA 1GZ3A 3FI9A 2AQKA 3BYZA 4XGKA 4TVOA 3QIVA 3DR3A 1YKFA 2B37A 3IJRA 2G0TA 2CVQA 4QSMA 5KKAA 4RCVA 4CLEA 4B7UA 1VJ0A 2HLPA 4M54A 4IGEA 4PRKA 1ZNQO 1XIVA 4QX6A 3QLJA 1UDAA 1P1KA 5A9RA 5C7LO 2RIRA 2YDYA 3AI3A 4J0EA 1OZAA 2ZCUA 1UJMA 2A94A 4II2A 4XJSA 5TQVA 5BSEA 4H15A 1GQ2A 3WLEA 1DRVA 3C1OA 3RUFA 4URFA 1RPNA 4GGOA 2VZ8A 4BNTA 2TMGA 4FFLA 2NVWA 1NFQA 2BRUA 1XA0A 2HUNA 2VYNA 2DBRA 4YT2A 4I9UA 5TRTA 1Y9AA 3A28A 5B1YA 2PLAA 5JCXA 1AXGA 4HXYA 2HCTA 3PRJA 3HQ4O 1XQ6A 2B0JA 3E8XA 2VWPA 3ETDA 4A73A 4OQZA 1L1FA 1X14A 2EGGA 2FR8A 2ZB8A 3UVEA 4AJ4A 3P2OA 3KO8A 2O3JA 4MIYA 1NX6A 1P1JA 5HS6A 5G0TA 5F21A 1N1EA 1GUYA 3OJOA 3WWZA 4U8GA 3MEQA 4D0SA 5I9NA 1W73A 3L9WA 3TL3A 3RUCA 3L77A 5EPOA 1H2BA 1ZO8A 2EKQA 1JA9A 1PZHA 4TROA 1PR9A 4XDZA 2JKVA 2C2XA 5I7EA 2GN9A 1P31A 3PJFA 5EQDA 3PGXA 4DIOA 4F3YA 5JC8A 1E77A 4E3ZA 4YACA 1W0CA 1IUKA 4HP8A 1HKUA 3JSAA 3KEQA 2WEKA 1PQUA 4XYEA 3W8FA 3ZHYA 1H5QA 2CDCA 1JKJA 1PJ2A 4N54A 4KMSA 3WIEA 3WGHA 2FPIA 2CMDA 3WGIA 4QQRA 1MGOA 3WX0A 3ZH2A 1LNQA 4YPOA 1YQXA 5CG1A 4BO3A 3PHLA 3PQDA 3B70A 2HRBA 1H6AA 3OJLA 5DP2A 1KC3A 3TPCA 1YL5A 1FDVA 3RFXA 4R69A 1R16A 3H9QA 4OOEA 1I32A 2OBNA 4CUZA 1SEPA 4E4YA 2A4KA 4KWHA 3F4BA 1ADFA 3BTUA 4R54A 1O95A 1RKXA 4FB5A 3IJPA 2DFDA 5K6AA 1ENYA 3RCBA 1U28A 1P1RA 3CKYA 3AU9A 3ZU5A 4NR0A 3RWBA 2VUUA 1VRWA 4G81A 5JO0A 1IPEA 1JLLA 4J3FA 3ZN2A 1T2DA 3NJ8A 5GZ1A 5HA5A 3KYCA 3INTA 2VT3A 1E3SA 1N7GA 4CV1A 1OI7A 2UDPA 3DMTC 5TT0A 2VRCA 1B16A 1SPXA 2X0NA 4UUPA 4ZHSA 3ITDA 3RKRA 1XR3A 3AUAA 3C1AA 2YV3A 3DHNA 1SC6A 4BKUA 3O03A 4MVJE 1PL6A 3PHHA 4JN6B 4J0FA 3WS7A 4Q3NA 4OIMA 4E31A 1E1MA 5KIAA 2VCYA 2YHIA 2Y66A 1EMDA 3QWAA 2X8LA 1S6YA 1AGNA 3F4LA 4J2HA 4K6FA 3W4IA 1FK8A 1MFPA 4NG5A 3DMYA 3MJSA 4CL8A 4CV3A 1GEGA 4YCAA 1U7TA 1E1LA 3RROA 4ZGWA 4CM6A 3I9KA 6ADHA 1M67A 2C7GA 3Q2KA 3KEOA 4FD3A 2LDXA 3DZIA 2JCYA 4DYDA 4YQYA 1U5CA 3EVNA 3EW7A 1VPDA 1FXSA 2X6TA 4B79A 1DRWA 1PGOA 1EUDA 1N92A 5TIIA 5F1OA 3EZYA 5G0WA 4RORA 4AJNA 1BXGA 2PZLA 3OQBA 2PY6A 2I5PO 1ONPA 4M8SA 1PQPA 2IRWA 4WCFA 1ORRA 1RM5A 3WGZA 3WDSA 4RVGA 3ZCXA 2C07A 4YB8A 3TZCA 4B3IA 5KCZA 1PZEA 3HFSA 4GQAA 4FQ8A 1O5IA 1UDCA 2NSDA 3UFXA 2IDZA 3PHJA 1U4SA 1HTBA 3LF2A 1VJTA 4YT5A 5MDHA 1IZ0A 1PGNA 2VNAA 4IBOA 1OOEA 3B20A 4CM5A 1R4NB 2VN8A 1LRLA 3F47A 3L4SO 4J49A 4ND3A 3WNQA 2VUTA 1QYWA 1AUPA 1FF9A 1RM3A 2D0IA 4ALNA 3L07A 3BHIA 1UXJA 1C1DA 2J5RA 3QHAA 4NFYA 4DMLA 5C5IA 3CZMA 5L45A 4B3HA 4XZ3A 2WE7A 1I10A 5CEFA 1EK5A 1YGYA 4TRNA 4KP7A 4QO7A 1Y81A 5L3ZA 4CMEA 3UAGA 3QWIA 4XWYA 2GZ1A 5JY6A 3OIGA 2I9PA 4JLWA 3EDMA 5G0VA 1TXGA 5T8KA 4NIMA 1DJNA 4DQVA 3H9GA 3KYBA 5KOIA 4L8VA 4E5NA 3BZUA 4ID9A 5A9SB 3E48A 1I3MA 2J8ZA 1YE3A 3ZW8A 4XA8A 1Y9EA 1RJWA 5ILGA 4W6ZA 3DWFA 4AG3A 4PLZA 5I8ZA 3DFUA 2FSVA 2Y0CA 3E1KA 3MJ4A 1EVJA 4BNJA 4CMJA 3DZFA 4W4TA 5HTOA 4OHUA 2NU9A 1WAMA 3QY9A 3WGTA 3VH3A 1PZFA 3K8ZA 4II3A 3WR5A 2O2YA 3D4NA 1D4FA 1PWXA 3BMQB 4EI2A 2C59A 2CVZA 2IEDA 2IXAA 2TMDA 5LCXA 4MVJH 3ONDA 2ZTUA 2QW8A 4MIEA 2JAHA 1XU7A 1D1TA 4N18A 5AVOA 1JWAB 1JW9B 3WGGA 1T24A 3GOHA 1OC2A 2Y1FA 1Q7BA 2YV2A 3I23A 3Q9NA 5F3RA 1KIFA 2HSDA 3QWBA 2IYPA 3WGOA 3GGGA 1PEDA 2G1UA 3LK7A 3M6IA 3KYDB 3K92A 4LW8A 2YFHA 4EBFA 4XYLA 3E6AA 4OKNA 3JQ9A 3NX4A 1MG0A 3WQQA 1IYZA 4FJ1A 3BMOA 4RGBA 2I66A 1NPTO 2IYOA 3ZWOA 5F1KA 2EKPA 2HK9A 4BNYA 2FOIA 3GDFA 2G5CA 3VOSA 4BNGA 1M6WA 1EVZA 3LLSA 1SEVA 4ZQFA 1X7DA 2B4RO 4PCVA 4R41A 5ER6A 1C0IA 5BR7A 2V6BA 1CETA 2HK7A 4BGUA 5I7FA 2PA3A 3GFBA 4IJWA 4DLAA 5EIOA 1BDBA 5JPIA 3JQ8B 4WASA 2J6IA 2JD2A 3H5RA 1IULA 1NR7A 1XLTA 1YJQA 4P22A 2HDHA 1LDEA 3I83A 1T2AA 3M2TA 3PDJA 4IJVA 3KB6A 5FI3A 3QE3A 1LUAA 2FY8A 3HWRA 3RUHA 5ICMA 2O7SA 2UUOA 4CMIA 3Q9UA 4C7KA 3DDNA 1Y5MA 2DUUA 4GBJA 3ZNPA 3PLRA 3ST7A 2O4UX 4PLVA 2C7VA 5IZCA 4WLVA 2BD0A 1CERA 4NBVA 1ZMTA 2BH9A 3GZ4A 4XGNA 5A9TA 3WFJA 4B4VA 3JYOA 4LN1A 2HO5A 4L73A 4RQTA 2NUAA 1KETA 2WYUA 3AW9A 1SAYA 3Q1LA 4EITA 2PR2A 3FBGA 3RI3A 2EKLA 3DAGA 2ZQZA 4WPGA 3NKLA 4NDNE 4DC0A 4CPDA 2AG5A 4RLHA 1ZIDA 4OXNA 2WJPA 4BO9A 5AOVA 1JVSA 1YS4A 3AUSA 4BB5A 4FFRA 2FWMX 4OGWA 3GFGA 4JBHA 1MB4A 3SJ7A 1JKFA 1DPGA 1OMOA 2VZ0A 2CZCA 3E18A 4RPGA 3SX2A 4DLLA 4MVJD 2JCVA 1KS9A 4IQGA 2ZTVA 4NBTA 1YL7A 4E33A 3TF5A 2XOXA 3CIFA 5KJEA 4KTTE 2Z1NA 3IKTA 4L4SA 4IJKA 4IINA 4RDIA 3GPIA 4BNVA 4IPTA 4KDEA 4BQRA 1M75A 1WZEA 2PD4A 4IDGA 5DT9A 5L7WA 2ET6A 1A71A 1GZ6A 1E92A 3DBRA 1DC3A 1YONA 4R9RA 1C1DB 1XHLA 4FJ2A 3I4FA 1GD1O 1IHYA 4R3NA 2W8ZA 5TT1A 2HMVA 4KUEA 2A9FA 1DO8A 1K5HA 1SOWA 3ONFA 1JKIA 2PKRA 1E6WA 1SB9A 2GPTA 2H63A 3LDHA 4RVDA 1E3IA 5G0UA 2BGKA 3TWOA 1ADGA 4IMRA 4BS9A 3K30A 4PLCA 4ZJUA 2P9CA 1C14A 4DIFA 3IDSA 2EJVA 2WM3A 8LDHA 3JD1A 3SC4A 4BGIA 2GZ2A 1GPDG 1U9JA 4R3WA 1LXCA 4BKPA 1T2EA 1Q7CA 3P19A 1YOVA 5CAEA 3GA0A 5AXDA 3GAFA 3VH4A 3GLQA 4J6FA 3DAFA 3AUUA 4EZBA 1QRRA 1A5ZA 3EY4A 2HAEA 1YOVB 1LQTA 4NU5A 3FD8A 4OJNA 4RZIA 4D3SA 1PL8A 5ADHA 3DOCA 1WDKA 4FGWA 1P45A 2O3TA 3ENKA 1QP8A 3HDJA 3DC2A 4YYZA 5IDWA 1LA2A 5CDTA 2HMSA 4TRRA 1ZK4A 3GPDG 1K6IA 4RF3A 1PU2A 1P77A 3K73O 3KZVA 3QWFA 2Y93A 1E7YA 1R0SA 1U5AA 4GX1A 4TKLA 3GQVA 4E13A 1BSVA 2IEBA 3DB2A 4I9NA 4OKIA 5KJ1A 1PJSA 1PQWA 4MKXA 1BXKA 4Z9XA 3TOXA 2C5EA 1CJCA 2XXJA 1E5QA 3ETEA 3PJEA 4PZCA 4BO4A 4EJMA 5IJZA 1UZLA 1HDOA 4YJGA 3HJAA 2Q1TA 3KOUA 1M76A 1HYGA 2GCGA 3OSUA 2RH8A 2WE8A 2CD9A 4WK6A 3SBOA 4ZA2A 2NVUB 2GASA 2OO5A 1DAOA 3KLMX 3PWSA 4JGBA 3W4KA 4ZRMA 3KYCB 2ZYDA 2CF5A 4XIYA 5KVCA 5B4VA 2VOJA 4FR5A 4JJIA 3IKVA 3MWEB 3OQ6A 2DVMA 4IDEA 1JN0A 5IZCC 5IZ4A 3O38A 4EUHA 4AJHA 1YB4A 3RC9A 4BKRA 3S2FA 1ENPA 3SVTA 4NBWA 1WZIA 3CSDA 4G5HA 3IUPA 4CM7A 2DU8A 3OETA 2OFPA 3L6OO 4W7HA 3HFGA 3VAZA 4IIVA 1Q2XA 4A5OA 1E5LA 1XYGA 1EE9A 2Q3EA 4RZHA 3SLGA 3WOHA 2QRKA 2Q49A 1EUZA 2LDBA 2DQ4A 4CMIB 3ITKA 3CMCO 5TLSA 2AEFA 4W9NC 4CQLA 2WYVA 2P2SA 4D3FA 4E30A 3VH2A 3VPSA 3R3JA 1E1KA 1XWFA 3G49A 3KV3O 2Q50A 3RAJA 2QYSA 3U4HA 3JQ8A 1N5DA 3W8EA 1HDRA 1D3AA 3E5MA 3ZU4A 4GAEA 4BO2A 2B4TO 3P2YA 1VC2A 3MCVA 4HBGA 3ZI0A 3EZLA 5HWSA 4BNHA 1I5RA 3E5RA 1T25A 4PN3A 4PIVA 1BMDA 1J49A 4I1IA 4J7XA 5EN4A 1GL3A 2HMTA 1K0UA 3GVPA 1JAYA 1GYRA 3WIDA 1NQOA 3LVFO 1EK6A 2VHXA 2XPCA 3HNPA 3MTGA 4PVDA 1NQTA 3PIDA 4Q39A 4Y8VA 3ZWAA 4W82A 5TC4A 2NM0A 1LDNA 3QVSA 3KYDA 4R5HA 4E5KA 4MDHA 1K6XA 1QR6A 1V3TA 3F1LA 1O89A 2W90A 1YBMA 4IDDA 3ZV6A 2ZYGA 1LC3A 2NLOA 4RPHA 4J4TA 4FPXA 4ND5A 3NDIA 2PWZA 3MZ0A 5BT9A 3UXYA 1GV1A 2I67A 3HN7A 3U0BA 2YY7A 2QQ5A 1I2BA 1B8UA 1V9LA 2VTEA 4B4UA 2J5QA 5CDSA 2E49A 2NV6A 3QW2A 1IL0A 4K6CA 1PGQA 4FDAA 1ISMA 4IDFA 2GERA 2B5WA 4BO6A 3OF2A 4FS3A 1SMKA 2X23A 4CR6A 1GADO 4EEZA 3OHSX 1DHTA 3GUYA 1HDYA 4GI2A 4J1QA 4TRJA 1NP3A 1EBFA 5DP1A 4D0RA 5L51A 3NEPX 4HFNA 3T4XA 2DBQA 1PWZA 5G4KA 3C1TA 1O94A 4LMRA 3HE3A 2H9IA 2V6GA 2VZ9A 3GF4A 3GR6A 4KQXA 4HX5A 5DDIP 3SJUA 4YXFA 1I3KA 2FN7A 1KY4A 2G17A 2GNAA 5LC1A 3GHYA 4DGSA 4KUGA 5IF3A 4HY3A 5KVQA 4CV2A 5T5QA 1ZSVA 2VWHA 1KY5A 4AVYA 4BMNA 3PVZA 5IXSA 1E1NA 4RVHA 1HWYA 5ES3A 2Y99A 5JDIC 5TGDA 2W2LD 3H5AA 3KM0A 1H6DA 2PH3A 3DTTA 3VZPA 4E6PA 2WTBA 3W1VA 3GMSA 4CLDA 2E48A 5KVVA 4A26A 2BFMA 3H3FA 4J1NA 5THKA 4HNGA 3KSDO 5JDCA 2Q45A 1Y6JA 4GWGA 4OO3A 3UF0A 4DBZA 4EEXA 1MG5A 2PH5A 1R4MB 1UDBA 3ZGYA 2HRZA 3PYMA 1ID1A 4MJLA 4XX0A 4Z9FA 2PNFA 1HDZA 5DBGA 1V8BA 4XJTA 3GH3A 1EBUA 5GZ6A 1JU9A 2ZTLA 4IM7A 4WLOA 1YB1A 5B37A 3COSA 4UVEA 3NAQA 3HDQA 3AOEC 2X5KO 4YTEA 2O48X 1E3WB 4ILKA 3GNTA 2AW5A 4Q9NA 1HDCA 5FYDA 2BKAA 4JCOA 4PLTA 1MC5A 5JYEA 5CDUA 3R0IA 3WXBA 3LYLA 3VVCA 4AJJA 3GVIA 1GUFA 2X58A 2ZB7A 1LLCA 4WCFC 3ZV3A 4P8RA 4XYGA 3JQAB 4Y67A 4YJGB 4BGVA 3RQSA 1SZJG 2EGHA 1EFKA 1ONOA 1E0DA 1GEEA 1UZMA 1XGKA 2PTGA 2XAAA 3VZSA 2NQTA 3BTVA 2CF6A 2VRBA 3JD2A 4W9NA 2Y0DA 1QG6A 2C0CA 4RV9A 3RFTA 4HFMA 5I9LA 2E6UX 5EINA 1GY8A 3H3JA 4IQ0A 4IUYA 1UR5A 4MINA 1ENZA 2GYYA 4ZQEA 3W6UA 1I0ZA 1I01A 4E5MA 1HSOA 4U7WA 1QV6A 1G1AA 2WSBA 3BHJA 1NQAO 4N5MA 1PX0A 2YQ4A 3RU7A 3O9ZA 5JAQA 4DRYA 5C3MA 3UKOA 4EDFA 4IZHA 1A27A 4JIGA 1TLTA 2DT5A 3C85A 2NTVA 3ORFA 1YXMA 3VPGA 3T7CA 1XQ1A 3AY3A 5T8KC 1TT5A 2DTEA 1VL8A 1H93A 4RPKA 1TEHA 2VT2A 3D3WA 2Y67A 1H9AA 4DC1A 3ASVA 1N9GA 1CF2O 5TJ9A 3C7DB 5I9MA 1IE3A 2D8AA 3JQBC 4XRRA 3WSVA 2R2GA 5ILOA 2OXIA 3RBXA 4PLWA 1B2LA 1TT7A 2VYVA 1Z7EA 1HEUA 1YBAA 1WP4A 4XCVA 3G3EA 3ZHXA 1VJ1A 1LDGA 9LDBA 5F5LA 2Y68A 4ONEA 3OJEA 4R1UA 5THQA 4RL6A 1UAYA 3ZWPA 5FFFA 1WDMA 1PS0A 5FI5A 4E2YA 5I8WA 4RVSA 3KLPX 4Z0TA 3LT4A 4D46A 5I7VA 4INAA 2VQ3A 1Q0HA 5JO9A 3SC6A 1ZJZA 4FCCA 1ZBQA 2YW9A 1UZNA 2BHLA 4WKGA 5G4LA 2ZYAA 5JNLA 3S2GA 3PFWO 1YQGA 1LU9A 1SCUA 3H2ZA 3ROPA 5IXYA 5KTKA 3ABIA 1DIBA 3GVXA 5TSDA 4DIBA 2P4HX 2X7HA 1KVUA 1IY8A 1WMBA 3F5QA 1ZSYA 4IDCA 4WLNA 1BG6A 4JP3A 2DPHA 4I5GA 2GSDA 3H9UA 1TVEA 4WJZA 2D2IA 2PGLA 1DIHA 4G65A 4CLRB 1HRDA 4WE3A 3TFQA 5L4NA 4YAGA 1CIVA 3JD3A 4PLPA 2QZ9A 5DBFA 3O26A 3LSYA 2ZKLA 3B1KA 2Q1WA 1ZEMA 3GMDA 1BRMA 5JY1A 2AQIA 1V35A 1QMGA 3IMFA 2PV7A 4FFMA 4J4HA 1ONNA 4AJOA 4QFCA 2GDZA 3PDUA 1YVEI 4MVJM 1U2DA 3RBVA 2VHVA 2ZTMA 1KYQA 2I76A 1PIWA 2J3HA 2ZCVA 3K9QO 3ZU2A 1PJLA 1I36A 3Q0EA 3WMXA 1PS9A 4NQZA 3X2FA 4RPLA 2X0JA 1YDEA 4P4NA 4PRLA 3DBRB 4GLLA 1RWBA 3AJRA 4LSWA 4D3DA 2PKQP 5CPBA 3ZDFA 3QP9A 4RF2A 3V2HA 4IMPA 3FSRA 4CLOA 4PG7A 1X7GA 4J16A 3UCEA 3AM5A 1HE5A 5BNTA 3NT2A 3IAHA 4JJGA 4U6SA 1VSVA 5I7SA 3D0OA 3FBTA 1DDOA 4UVDA 2HMWA 4S1VA 4TZKA 3JCZA 3I52A 3DOJA 1SO8A 3U49A 2O3SA 2VWQA 3GG2A 3PI7A 1GDHA 4ZQGA 1YDWA 4WLEA 2X1HA 2AMFA 4L0QA 1VM6A 3IQDB 4BO1A 4R9SA 1Q0LA 2DFVA 1NQ5A 2O3UA 1ZW1A 2DLDA 2EV9A 2JD1A 2IZ1A 3FWNA 3PK0A 1ZXBA 2EW2A 2VUSA 2Y1CA 4KUHA 1VL0A 3AOGA 2A35A 3DZBA 3OFSA 1KVTA 1R66A 2EHDA 5JYDA 4UUNA 1A9YA 3JV7A 1Y7TA 1GZ4A 4J4BA 3I9OA 3QVXA 1GQQA 2Z1MA 1D7OA 4RDHA 1F06A 1N7HA 1ZSNA 3B1JA 5K0ZA 4R01A 4DVJA 1FJHA 2X86A 1DLIA 3NUGA 4PFJA 3H7AA 4XYMA 1NYTA 2XXBA 5KWEA 2OL4A 1RM0A 2GGSA 4W99A 3GRPA 1E3EA 3WJAA 2AE2A 2A92A 3BMNA 4GVLA 5JAZA 3K2BA 3DL2A 4E2XA 1YB5A 2QX7A 1B3RA 3Q2IA 4JK3A 4U0JA 4WECA 3DHYA 4IXTA 1QLHA 5IDQA 1EZ4A 1ZMOA 2PK3A 5KKCA 1GCUA 4I5EA 4K1LA 4IJUA 4Q3AA 2R6JA 1NAHA 4L75A 3FWZA 1OFGA 2OHXA 4UEKA 1I33A 3MOGA 4GMFA 4NBUA 2HJRA 5CG2A 4YBZA 4XEHA 4NPCA 4UUOA 3WTCA 3ZWYA 2NNLD 4E5PA 1E7SA 3RJ9A 2JL1A 3ULKA 1A7AA 1WMAA 1TA4A 1P1FA 3DOOA 3BMOB 4YAJA 4ZQHA 2O23A 3GRKA 1KEWA 3I4CA 2VHYA 3MJEA 3IL2A 3ZNOA 3TOZA 5T57A 4CM9D 4BKQA 4D42A 1G0NA 1NHGA 3U09A 3BMCB 1BTOA 3S8MA 1P44A 1CRWG 4PLYA 5B12A 1DEHA 1DC6A 5T64A 1I2CA 3DZHA 2C5AA 3JQGA 3FCOA 1P3DA 1LRKA 3NRCA 5ER9A 3GT0A 1CEQA 1O6ZA 2GZ3A 3V8BA 4GKVA 1FDSA 3PQFA 2VHZA 3UCXA 2BI7A 5DCUA 4CMEC 1I3NA 1B3BA 4WCFB 5A3VA 2I65A 2FZEA 2OP0A 3CINA 4MIOA 4L74A 5HRUA 3PYLA 4M86A 3EK2A 4M1QA 3VPFA 1HZZA 4P4LA 1X1TA 2NVBA 2BELA 4B4WA 3ANLA 4BMSA 2P68A 2ZB3A 4MVJF 3OBBA 3WG9A 4KWIA 2JFGA 1DB3A 3TRIA 4K26A 1HT0A 1YWGO 4H3VA 1F14A 2QIOA 1C0LA 1WDLA 1ZXLA 4ZRNA 4OSPA 3F46A 4CQLB 3AWDA 4MO2A 3ETGA 2RBEA 1R6DA 5GY7A 4DWVA 1V3VA 1DLJA 3VPHA 1HETA 3GUCA 3GVHA 3RIHA 1E7WA 3INGA 3WICA 4NI5A 1AHHA 2PKQO 3RJ5A 1U8FO 1QKIA 1A72A 1R4NA 3K96A 1VL6A 4I9HA 3GEGA 4R5MA 1F17A 3LQFA 3N7UA 5COAA 3AOEA 3UW3A 5TNXA 3RASA 4EYEA 4ZU3A 4NHEA 1ISFA 3C24A 3PHGA 1LLQA 3ZWXA 3UHAA 2GO1A 3RUAA 3ASUA 2D1YA 3JYNA 3TQHA 4BNXA 4BO8A 1LSJA 3EAGA 2W98A 4TRMA 5JMPA 2AE1A 3ENNA 4DLBA 2RH4A 2P5UA 4CM4A 3NTQA 2EP5A 3K31A 1SNYA 1KVRA 2BI8A 1U8XX 2HKIA 3RKUA 4QUKA 1B15A 3VC7A 2Q1UA 2B83A 2J3KA 3LT2A 1NWHA 3KUXA 4PG6A 5DF1A 4CR8A 2WDZA 2NVUA 4PGFA 1DIRA 5C37A 3A9WA 3M2PA 4M87A 3FN4A 1C1XA 1DIGA 2RCYA 4LSMA 4BO7A 3WYBA 5IDYA 4GX2A 1HLDA 5CHEA 3CEAA 1PR3A 5JAIA 4CR7A 3L9XA 4ND1A 4BL5A 2I3AA 3W6ZA 4JROA 2EW8A 4FSHA 3D7LA 3EGOA 5LDGA 3RBZA 2JFHA 1N1GA 1T1SA 1UH5A 2OOSA 3JYPA 4YJHB 1L7EA 1BDMA 1R0KA 2GN4A 1X7HA 3ZWMA 4EW6A 1ISJA 4MVJI 3LC7O 2I99A 5BQFA 4PZEA 4Y6PA 4OM8A 3A1NA 3U4CA 1ML3A 3FPCA 1H0KA 3HDHA 1YBVA 4ALIA 3PWZA 2ZJ1A 3P5SA 3VHRA 4D45A 1T1RA 3EMKA 4RF5A 5JW6A 1G6KA 1B8VA 4R51A 4DTIA 3HB4X 4OL9A 4J9UE 1Y1PA 5CEJA 1B7GO 1KC1A 3F1KA 4Z3KA 1OBFO 3OM9A 1JVBA 5FF9A 3GNSA 4AJ1A 3KETA 4HFRA 4FGSA 4YJFA 2DBZA 4NH4A 3CTMA 4TVBA 4RJTA 1PJCA 1J6UA 3U5TA 5L40A 1QYCA 1GAEO 2HJSA 3KRTA 3N74A 5KNLA 3F6YA 3KBOA 3QWHA 3WBBA 4MP3A 4HKTA 4BOYA 3GK3A 2E37A 1BWSA 4C7JA 3L0DA 4ZN6A 1EQ2A 3WGQA 5COQA 3V1YA 5C7OO 5IG2A 3GC6A 4LRSB 4F45A 2CNBA 1R12A 3QVOA 5FEUA 1A9ZA 5A06A 2DM6A 3MJVA 3ROQA 1G0OA 3OA0A 5JC1A 3OECA 4NMHA 1J4AA 1AN9A 2X5OA 4BNLA 3FF4A 3SLKA 4BNIA 3JQDA 4U5QA 1K89A 3JQBA 4RVFA 4CMKA 4O1MA 1P0CA 2FPGA 2AEMA 4IXWA 4KOAA 3ADPA 4D41A 1SOVA 2B4QA 4A03A 4ND2A 5CFZA 3BHMA 3RC7A 1PS8A 1UP7A 3G1UA 3VZRA 4A0SA 1Q0QA 2ZQYA 2JFFA 3PFFA 3JQAD 3WWYA 4NZ9A 1LDMA 1X1EA 4FFOA 2DUWA 3V1UA 4Z3DA 4E2ZA 5JCJA 3GN2A 5EQFA 4GPD1 4RO0A 5BSHA 2PZMA 3VTFA 5KJ6A 3S55A 5JLAA 2HQ1A 1P74A 1U1IA 2JAPA 4LMPA 5GMOA 1IPFA 4YRBA 1U3WA 3VDQA 2VYND 4HNHA 3QQPA 2OBYA 2CDBA 4UEJA 5A5FA 5A03A 4CUKA 5U1PA 1NVMB 3RU9A 2CFCA 3WTBA 3ADOA 1HF3A 2UUPA 2JJYA 3JQ7A 4R4JA 4ZD6A 5U9CA 3KXDA 3AU8A 3PGJA 1NBOA 1DRUA 3HDYA 4F46A 3DEYX 1PJTA 4WLUA 2GD1O 3AY6A 3H6KA 5EJ2A 3I6QA 1KVQA 2PZJA 4NNJA 4I8XA 2EP7A 3MOIA 5BNFA 3JD4A 3G0OA 3ZNQA 4P4GA 5IFLA 1OAAA 5TS3A 3STHA 1OC4A 1ZH8A 3PWKA 2YQ5A 4D7AA 3MTJA 4JP2A 4BNMA 4BVAA 3FR8A 3WBFA 4F6LA 2Q4EA 3F9IA 4AJLA 5KVSA 5A02A 2UVDA 3JQEA 1ADBA 4YT4A 5DOVA 3WSWA 2P5YA 3QSGA 1ZFNA 4AJEA 3LZ6A 1E6EA 1MC4A 4MVJA 1BGVA 1P0FA 1O8CA 1XKQA 4MVJG 3L4BA 5EESA 4IY1A 3W4JA 3LLVA 3M1AA 4GH5A 3I9LA 3LU1A 1Y8RA 4TMFA 1Y8QA 2P91A 1DHRA 2GR9A 3H8VA 3MJCA 4WEQA 1MUUA 1ZK1A 5F5NA 4GKBA 3ZWWA 5JS6A 3ZHZA 2C29D 3OICA 1ZVMA 4EUEA 5H82A 3AI1A 2X0RA 3I3OA 2YHUA 1T4DA 3UUWA 4QTZA 2ZB4A 4GL4A 3VZQA 1WWKA 1MV8A 3BMQA 4UVHA 3BA1A 4FW8A 1N2SA 1VKOA 2QZZA 1QYVA
chains in the Genus database with same CATH superfamily
2XA1A 3DZDA 3FYSA 2QMHA 4RS4A 5AXBA 4FIZA 4JC5A 1C9NA 3V5NA 3WV4A 3P27A 1S89A 6PFKA 1GRVA 4OLBA 3ZK7A 3JQRA 3W8DA 4ZOQI 2B35A 2OCYC 3EGCA 5LXTF 3L43A 4LA4A 2OEPA 5FBLB 4CMCA 3IOYA 1JWBB 4RD6A 3THYA 4FIDA 4M1MA 4UXIA 4AFNA 1JMVA 2Y05A 2BDEA 2QW1A 3DSRA 1OROA 1VPLA 2XMSA 1G9TA 3LSTA 3O0TA 1VKZA 3I32A 3DBIA 2X0IA 2YJNA 2ZR8A 3GDOA 1TM2A 2WHYA 4PXYA 2YICA 3IVMA 3CUSA 4P2BA 3AGQA 1JQKA 2OHGA 3K9WA 4C76A 2OY0A 1W2HA 5IFKA 5CHYA 1YB2A 4MX8A 2X3YA 1MH1A 1YZHA 3TAHA 3TTVA 2BHRA 5CB0A 3U26A 3DHWC 4KQMA 2EERA 1CTQA 4KGXA 1KPGA 1JI3A 4ZDKA 1EAMA 2VF8A 4FYWA 5A5EA 3BXHA 2NX2A 3GGPA 1GFSA 4XH9B 5LIRA 3RV4A 1U3TA 3KV1A 1G2OA 3T7EA 4I08A 3TCXB 4JYAB 1N2HA 2EZ9A 4JFAA 4AN4A 4DREA 1OB2A 3ROGA 4ME6A 4UMEA 1SWWA 4FTWA 3UHFA 3K6JA 4JUFA 4PQFA 3K7EA 3A4TA 3QVLA 5JH7F 3QYPA 3WNVA 4P7BA 1HMPA 3OPYA 4HH4A 2NSJA 3L7LA 3EWSA 4BNKA 3DHEA 3I1JA 4UE6A 5CCDA 2FP4A 2LD4A 4BFLA 4CM3A 1VE7A 3M4JA 2QYTA 3OC6A 5CBPA 1MOZA 2Q1YA 3A6JA 3AERA 1ZOPA 3TIXB 4KVAA 5C1BA 3IUSA 1D1PA 1DZ3A 2AZMA 3RK4A 2HT1A 3CCCA 2VF5X 1T15A 3LKBA 3EQ9A 4CLXA 3ZK8A 1D8AA 4ER5A 2F8MA 1T0PA 4KBYA 4CQNA 4IKPA 2Y1XA 3I04A 1NDHA 4TN5A 4AG6A 4BMOB 5K9ZA 3M89A 1VE9A 1ZRMA 4Z1MA 5C31A 3E61A 2QUKA 2FEPA 4D8TA 1RMYA 5LOVA 3VR6D 3PGMA 2BFAA 4EKDA 1NVAA 1RKQA 1SOMA 1IB6A 4B45A 2IITA 1Z2DA 5LZ9A 5FQOA 1G5RA 5HK9A 2GJ8A 2OKGA 3DTYA 2CT8A 1E7QA 3UGQA 1P1HA 3VC2A 3AEKA 2R6GA 2Q3JA 3L7OA 2WD8A 4BIMA 5C5DA 1ONBA 3H1PA 4J2OA 4PLGA 2UXDB 2A9QA 2DFTA 1EQUA 1EK1A 1UPUA 2Q8PA 2VPWA 2WF5A 3B6JA 4FN4A 4LK3A 4M7RA 4XE5A 3AEQA 2HIMA 4RSGA 1GKKA 3DEAA 4ROSA 2XDQB 4Z1MD 4A36A 4C14A 2P79A 2Q99A 4C7MA 5HCUA 2C5GA 2VP4A 4WOPA 3ZHUA 3NBZC 4LXHA 3OHMA 1JQBA 3LXXA 5IDXA 3NDPA 3DUFB 4PC3A 3WJ2A 4J2TA 2XOKA 1WDWB 1ZIXA 4RGYA 4FOSA 2QHXA 4G5QA 3AVWA 3WP1B 3MCAA 2PSEA 1IBRA 3D64A 1L7XA 2DRIA 2BM0A 3HWSA 1TIBA 1X39A 5CR9A 2GD2A 5EJMA 4BLPA 1O95D 4CKBB 1GL9B 1SBZA 4XQGA 1Q0RA 5DYWA 2ECPA 1VI5A 2G88A 1MX3A 4PSAA 3SCZA 3CX7A 3TKYA 4E5YA 3HVHA 3HJUA 4JBWA 1T8SA 1CR2A 1VB3A 1E1CB 1X42A 4DQKA 1U7OA 1O57A 2RGCA 3O8DA 5I5GA 1XDUA 4FYJA 4NYJR 5LQSA 1C3JA 4FSDA 3H75A 1NF3A 1SKBA 2P4EA 4P4TA 5GJCA 5H81A 1BVRA 5AW5A 1BE8A 2O2HA 4WQMA 3ZNNA 1ORVA 3FM9A 3DPSA 5JYCA 4B6EA 2WFMA 3QJ5A 4IVNA 1OXTA 3V1TC 2NTNA 3M4XA 3H9BA 3HN2A 3HCAA 3C8UA 3MQFA 3SSOA 5BYAA 3WYFA 2ERXA 4HWOA 4YCSA 1J24A 4KR2A 4CN8A 1ZR4A 2BLLA 3BFJA 1XWWA 1UK7A 3ANTA 2IYFA 3PEUA 3VKVA 3YASA 4B32A 2BKVA 4AMZA 1TVKB 4CU5A 2XCRB 3B3GA 2NYUA 3IT1A 3PXCX 4G25A 4Z6KA 2GN8A 1A5TA 1DKRA 1BX0A 1LQUA 1VIMA 2YQZA 3BH0A 3L93A 4XCQA 3GFPA 4I50F 5FD8A 4CJXA 1OXSC 3PFIA 2RHLA 2I22A 4KQKA 3RUIA 2QT9A 4WT7A 1M2WA 2YRWA 3TXYA 5K3EA 4AKGA 1QAMA 3BE4A 5E1BA 5A0FA 1TYDE 1V3UA 3H2HA 3R7WB 5HIIA 2IXBA 5BR4A 1R27A 3NDRA 3ZTWA 1NTRA 2X9NA 2EJBA 5ITVA 1JIVA 1XAJA 3QA3E 5FWAA 1ZJYA 2JJ1D 1NY5A 3IOCA 2AFHE 1SBQA 1QPGA 3RYFA 4A7PA 4ZMRA 1ZNXA 4PZAA 1F2TA 1M0SA 1VHQA 1GTMA 4INOA 5KOYA 3D2LA 1EE1A 2E21A 1IMJA 4MRNA 3NV9A 4UKDA 3KD2A 3PTZA 3EX7C 2X4GA 1VPVA 4TUYA 4YR9A 1M2FA 4CQMB 5J23A 2NTYC 3KQPA 1QBKC 2JLWA 1F2UB 1FMJA 1K3UB 4QEKA 5A7HA 5P21A 1XQYA 1ZH0A 4W63A 3L4JA 5A4AA 2PCLA 2RIPA 1D09A 5AI6A 3JQFC 1A9TA 3FRJA 4G5FA 5BN4B 3ZVNA 1N75A 2G7MC 5AQ1A 3GRVA 1T8YA 2ZOSA 3O2JA 3L8EA 5I01A 2Q4BA 2EWMA 5HM6A 4ARBA 4EW3A 4P32A 1N9GB 3FFBA 4IR7A 4WNCA 2W6CX 2HRCA 2FLWA 2J7PD 1D4OA 3SM3A 3EPHA 3WFIA 4NJMA 4YJFB 3BDIA 3D3WB 4BB6A 1M1XB 4M89A 4BHTA 3OIFA 3GLUA 3R2JA 3ZGNA 2QK4A 4RUKA 2BF7A 1KO1A 1W4AA 5DHPA 5TX7A 5JJKA 1NLMA 1PLLA 2GRAA 3C45A 4PZ9A 5DXAA 4QVIA 2C4WA 1UUFA 3P97A 3CPSA 5ARDA 3U44A 1YI1A 4TT3A 1UMBA 1ZD8A 1ZUD1 1U8CB 4LY9A 1S0UA 4CIVA 1ZEJA 5AHXA 4HUJA 1VLLA 5B55A 4IP0A 4JJ7A 1GXSB 2G1PA 3SXUA 2G40A 4IDAA 2QZ4A 4O2BA 3LI2A 4D8XA 1E6UA 2CL0X 2WZCA 4LFCB 1WEKA 4OFBA 5IYZB 1NFFA 2XMZA 2ZR9A 3OLZA 4LJAA 4QECA 1N6PA 3U9LA 4ZICA 3T8YA 2VTBA 1X7XA 3NHZA 3D9QX 4MQ6A 5TQ2B 2PX2A 2WMDA 4WW0A 3BH6A 4DABA 1W4BA 4AO6A 1A9QA 4OM7A 1FMTA 2IF2A 2W2LA 1LDBA 1L7DA 2AB0A 4N7RA 4LOKA 3F3MA 4BX0A 1Z39A 2F9FA 3AHCA 4PWYA 1LTQA 1FFXB 3RT7A 1BDIA 1K5GA 1I3LA 2FF7A 2DOKA 5F1PA 1FP2A 2VAXA 4RIFA 4EF4A 2DC1A 3ACBA 2EZ4A 5LKRA 1T0UA 4HADA 3TVYA 4AO7A 3RC1A 4CTJA 1JFFB 1GCOA 2C0PA 3WHPA 4UVIA 2ZAYA 5DN6D 2WUWE 5IEJA 3DVRX 4ZDJA 1WB4A 1KGSA 2GEBA 3AINA 2DKNA 2PD3A 3AFOA 4XXHA 3TR5A 3WJ7A 3ZW7A 1IHXA 5FTLA 1PZMA 3F3SA 5FTJA 3VUFA 4ALMA 5LU8A 2M32A 3NGMA 4N47A 2WQ7A 4FT2A 2AG8A 3WC4A 3X0DA 2HF9A 4P5EA 3SQWA 1WNFA 3RVJA 3KZCA 4Y1RB 4BNDB 3K6RA 2GEKA 5MN6A 2ZTHA 5BN1A 2RJNA 3NUZA 1E3JA 3EF0A 4LGMA 4MUGA 4ANFA 3VPCA 2XCUA 4Y6QA 5LUAA 4K9RA 1AXEA 1V6SA 4YAIA 1W44A 2RI1A 5ECGC 4FFVA 2C31A 2VTDA 4ZVSA 2C5SA 1F5SA 2BP7B 3VC1A 1NI3A 1A98A 1JILA 1F1JA 2Q3LA 1RM4A 2ORIA 4P4SA 4PPGA 1QYDA 4YRTA 1U94A 4BTEA 3T7TA 1YO6A 1P80A 3QYFA 3VJMA 1U3FA 2ADMA 3S1AB 3RRYA 3I2FA 4AY2A 1JAXA 2BN4A 1MOQA 3EXEB 3PGLA 2VP6A 3QKSB 5K3DA 1CQXA 1XX6A 4AZWA 1BEEA 3K9CA 2QBYA 2QNIA 3RS5A 1Z06A 3B2EA 3I6YA 3AK4A 4ND8B 1PEYA 2EFDB 4H3KB 3SG0A 1SXPA 4MDEA 2MSDB 3A4VA 3CT6A 3JYHA 2DGDA 3SYRA 4DV7B 5EL0A 3KPUA 3QGMA 3BAFA 1RAEA 5FV7A 5MGNA 5KO2A 1OPXA 3NHAA 2I2FA 5FOTA 4BLWA 1AURA 1MOSA 1QXSA 1GZSA 4X60A 5LBIA 2EXXA 3HTXA 1OXVA 4MHSA 3OJFA 3BXFA 3ZGLA 1J06A 4N7JA 1SVUA 2F1KA 2I2DA 3V8PA 3IBGA 4RZ3A 2NN3C 1KFJB 3CH7A 2Q0HA 2AZXA 1G66A 2UV8A 4ENPA 3A1DA 2J4CA 1XJWA 4HEQA 1K4KA 5C8ZA 1WY7A 1EDEA 1TW3A 3NTUA 3OIWA 3D4LA 1VP3A 1XZGA 3PQ4A 4YYEA 1B8PA 5JNSA 1PR1A 1ZL2A 2HZ7A 1WCV1 3ZD9A 5EIXA 3X44A 1ID8A 3FA2A 2AA3A 4E11A 3GLIB 3V2GA 1EGVB 3AI2A 2GJKA 4M49A 4FFPA 5FO1A 2YUIA 3JQ7B 5AMXA 1L7AA 2W4QA 4QWMA 1FDOA 3A8TA 1QIMA 1CUVA 2CDAA 2UVQA 3PP8A 4I55A 3TZHA 5IDVA 2H7YA 3JQGB 3R4CA 1XV5A 4BMVA 3DMPA 1U0SY 5HUQA 1ECJA 1KKMA 3A1SA 3GMIA 3S70A 3V7NA 1XXHB 2GPSA 2PA0A 3E7XA 4BVKA 5HYVA 5CVJA 2DJIA 3ZDQA 4DQUA 3PYXA 1KO4A 1SXHA 4ZEWA 1G4HA 3PQ3A 1JTFA 1MXHA 1AHIA 4GP6A 1ECCA 1Q91A 2WK1A 3FLAA 1G21E 2GHIA 2P2LA 4FI3C 1UQRA 1WSDA 1N5KA 1VJRA 4YRNA 1D0IA 2C5BA 1F5NA 3LHFA 5B4UA 2A0YA 5C4MA 4XD2A 1E79D 4IIUA 4PG5A 1LH0A 1ODSA 2BUAA 3KXLA 2ID8A 5BWMA 3OPMA 1IRIA 1KH1A 1WCXA 4IIJB 4OTZA 4RVNA 4CUJA 2E0IA 3L0ZA 3SXPA 5JE8A 3Q0IA 4FUTA 4OQYA 4X20B 4MQBA 3RRMA 1YQDA 2XIQA 2MTBA 1EWRA 2X8WA 3F5SA 1S1CA 3LUDA 2H48A 1EP9A 3Q3JB 1XYVA 2A9JA 4UULA 3UH1A 4ZEMA 3U9SA 5J4HA 3UJNA 3GLGE 4F3KA 4U2GA 2OUIA 4MA4A 4DBVO 3DEJA 2WWYA 1AD2A 5HE9A 3G1WA 4E14A 3ABQB 4GX5A 4XR4A 2QMOA 1S3GA 4OLJA 3NOXA 3ZU3A 4CCWA 1MBZA 1QSGA 2Q9CA 2RGEA 2AOUA 1WIWA 5JAMA 2XMGA 4JI8B 3R44A 2IU6A 5BURA 3G79A 4OLAA 5FNVF 1FXUA 5JRJA 1T6YA 2WAYA 3KS9A 1AUXA 1JZSA 1VPEA 2FW8A 1I30A 2QQFA 3LL4A 1TCVA 1K66A 3NEYA 3OE4A 4MB6A 5ALQA 4MP6A 2BMFA 4L95C 2BM9A 1YRLA 2R00C 2A14A 3OZIA 5LP6F 3EQ2A 2G82A 3ICPA 5KPJA 4I5FA 3H16A 4FGZA 1NXQA 4GPEA 3VR6H 3IPRA 4DAEA 2IU3A 4FS8A 4OP3A 2B99A 2O54A 2HQOA 4DRZA 4OEHA 2UKDA 1RQLA 2FZWA 3A3KA 1A4IA 1YZKA 3H5OA 1HE3A 3LBIA 1Z34A 2P2CA 2VDKB 2VXCA 3DUWA 2DQKA 1WVGA 4LQ4A 4REOA 3ZX4A 1SKQA 5G3YA 3K9BA 5K5EA 1SB8A 2EF1A 3DQPA 1WD7A 5KQPA 1LPMA 4C7VA 3UICA 5IN5A 2AN1A 5CFNA 3RPEA 3BB1A 2I4OA 1GCGA 4OH1A 4UUAA 1UXHA 3DMRA 3RS7A 3IA2A 4BNWA 5CMLA 1R88A 5AJVB 2FUG1 3ZWQA 1G8GA 1PLKA 1KOJA 4IGFA 1DAMA 2KI5A 3BF7A 4O4JF 1X7WA 4G0MA 4WESA 5CEEA 2QG9A 4OXXA 3OZVA 1Z37A 2D5CA 3B7PA 1WKBA 5DHUA 3ZJ5A 2V6JA 2POQX 2VS1A 3E0XA 3TCNA 3TRFA 4V39A 2P75A 4UXJA 2QTWB 4TZTA 1XPRA 4Z9YA 2J3IA 4IYRA 1VBFA 4A23A 5JMOA 2QAIA 1MIHA 1SCUB 3A4LA 3KKLA 4L50A 2EG9A 2DCMA 3AEUA 2E4UA 2GAIA 2J4DA 1GVNB 4HX9A 5EZYF 4D9HA 5D5QA 1X7WB 2VVTA 4NS4A 4WESB 4WX2B 5B1EA 2XB8A 3HCOA 4DV2B 5LMCA 1SG9A 1Z0ZA 3WL3A 4O1IA 3C87A 2C61A 1OTXA 2OB1A 1FMCA 4WI1A 4EL5A 4N9WA 3WLLA 5EE1A 2DLNA 4EUSA 4CCYA 1XTZA 5B3KA 3DAPA 5LQDA 4YQEA 4QVKA 3G6WA 1TZ2A 2PVCA 3JQ9C 2GQ0A 3O4IA 5ESXA 5ALKA 3HKEB 5TPZD 1QYIA 4H31A 4CMHA 1FDUA 1Z5VA 1K2VN 1I7LA 2WM2A 3L3BA 4MW4A 5DGTA 3VKHA 3ZE0B 2EWWA 2HZBA 4Q3EA 1EPUA 4G0XA 1E9CA 1HKHA 2JASA 2V5VA 1BX3A 1M2GA 2Y2UA 2EIHA 1LSOA 1AHPA 1HQYE 5AP9A 2PL5A 1A9SA 1D1SA 2HJHA 2QTVB 3B9QA 3CUEF 4XR9A 5ALPA 3UM9A 2WJHA 4E12A 1QQBA 5GJBA 3OOEA 2C9YA 2O2SA 2YXEA 4S0ZA 5CGQB 4EJ0A 3HRIA 1KJJA 4D5GA 1QIHA 1GR0A 3OFVA 1YJBA 4CM4B 2B1RA 3VC3A 3JPYA 3FNEA 2AOXA 3DTVB 1XMIA 3EZXA 4WCDA 1DO2A 2MR6A 1N2XA 3MMXA 1CQIA 2C1EA 4X3PA 5D7BA 2G0NA 2IEZA 3CURA 3K0FB 1Z47A 4RVUA 5EY5B 2X0DA 1DRJA 1PZNA 2EEZA 2C4NA 1RWPA 2LE0A 1N2GA 1FSFA 3EXG2 2VAVA 1CUBA 1UXGA 4WK2B 4N3AA 4X91A 1B2RA 1OZFA 4K28A 4WUVA 3WFZA 4UBKA 2HOQA 4FDUA 4M36A 4WKPA 1DEXA 3D8UA 4H18A 2VUIB 2YWRA 1DKMA 3H65A 3MT8A 5C0OE 3JSXA 4C06A 4BNUA 2I6TA 1T2NA 3FPBA 5SZJA 3O83A 5IAGA 2W2QA 1NAIA 3GT7A 4OKSA 1PJQA 4L27A 3CRZA 4Q7JB 1I6LA 4QEZA 4NICA 1U7DA 2FPUA 4OLFA 1MAAA 4IQ8A 4YRGA 1F6BA 2PZGA 4J07A 1N5RA 2ZUTA 1YZNA 4HPWA 1AZTA 3A27A 4COOA 2V7PA 1UCFA 4QHYA 1D5WA 1QC5A 4PC6A 4RCZA 1Y6GA 4Z0PA 1JHYA 4QBFA 4CG3A 4NOMA 2BT4A 2HDWA 3FX2A 3FCSB 2X15A 4ZYLA 3Q3HA 5DHFA 2EL7A 3BTOA 5L95A 1QORA 2ZE8A 3C3YA 4AI6A 2Q2QA 4F1WA 4ZYUA 5BOVA 1UOOA 1ZS9A 4YGXB 5L3QA 2FWPA 6AT1A 1CQWA 4UHBA 4FHZA 3G1TA 1ZRSA 3MJRA 4CIXA 4OX9Y 1ENOA 3HBLA 4ISCA 4US0R 3ZS8A 2TMKA 1GHTA 3N0VA 4JBYA 5D5HA 1PO7A 2PMDA 1VSUA 2YNMC 3DOFA 3SZRA 3T4PA 5FAKA 1E2BA 1FB5A 3HVUA 4JT9A 2PNJA 1P6QA 2WWXA 3ISVA 3ZDCA 3AF1A 3GRAA 1CJMA 2PU7A 3ANXA 5FJJA 2DPGA 3GCXA 4F85A 2JFQA 2R00A 1SK9A 1L7BA 3KQLA 2ZSHA 2G67A 1YS7A 2DBVO 1OE0A 3EIQA 3TW8B 3E53A 1HR0B 4E94A 3AUTA 4HGNA 3B1FA 4GZ3A 1QFYA 1P8JA 2FSVC 4ITUA 2Z83A 4FMBB 3K1YA 5F77A 2B4AA 3M5CA 1HNWB 4YFVA 4J3NA 3LA6A 2R25B 3OD1A 4HFJA 2XMQA 4WOBA 2EJWA 2C82A 3TL2A 2PZKA 4KZPA 1K5DA 3AFGA 1EFLA 1WDTA 2ODTX 3TZQA 3DLTA 2P67A 2ZQ5A 4X3CA 5HXAA 3PR2B 1IM5A 4IEEA 2O1EA 1V4BA 3D5EA 5CGZA 3C7TA 5CK4A 1G8HA 1DFIA 1DXYA 3K6SA 4ALJA 2PUDA 1U8AA 4IJMA 2WYIA 1KJZA 2E3JA 3IX7A 1Z12A 5HJEA 4O25A 3IKMB 2QEQA 4UVGA 1QR2A 4BVGA 3KTDA 2XTAA 4LE2A 1FFWA 2ADOA 3LUHA 4O2LA 3GYBA 3M34A 3WMGA 3ZV4A 4IZ6A 3EXEA 4LQCA 3RG2A 1GUZA 4EH1A 1F2VA 3HGQA 1VRCA 1GG8A 2EC5A 3OKCA 1Z8DA 1JQDA 2ZDGA 2XGJA 3IFSA 3SBDA 5ENZA 1E3WA 4AMYA 4L3WA 3J7TA 2BKXA 2WBLC 1LLUA 1RCFA 1DJQA 2ZITA 3UZUA 3KT6A 2GK6A 3WZMA 3UMFA 2Z5LA 3HJFA 5B57C 1QHIA 3BFVA 4ZMSA 4NYJQ 3TZKA 1EFTA 3PZBA 5D85A 4YMGA 3OZAA 3CH6A 4KFCA 1W36C 1EB8A 2OA0A 3B5IA 3HO1A 2E4AA 2QAGA 2E85A 2I4NA 5GONB 3LXUX 3HI6A 3DFFA 3DFZA 4MOWA 1XK7A 1V6CA 4ARCA 3CNBA 2E82A 2AT1A 1G6Q1 4MKIA 5H9VA 1BHJA 1FUEA 4M9ZA 2OGZA 1EGQA 4DQXA 1KBQA 1RZUA 1ZK0A 2ZJZA 2DZDA 3GVCA 3NGLA 5F52A 2FMUA 4DT1A 3NVDA 4AQDA 1XZBA 5FRDA 3BRSA 3AO0B 2QNBA 1NRJB 4OXKA 4YUYA 2CL6X 1CY2A 2ODAA 3O1IC 1IDN1 1LLFA 4INJA 1NBMA 4IQFA 4M8IA 1H4TA 4R1PA 2OC4A 5EIEA 2R0QC 4QG3A 4OHBA 3BYZA 4XGKA 1SD1A 3HPRA 5DYNA 1FFGA 2ZPUA 1Z6QA 2HX1A 1G2IA 1KYZA 2IPNA 5LD2C 2AUMA 5EEHA 3VZDA 1KTIA 1YR9A 2HA3A 2CVQA 1KAEA 3FJ1A 3KDSE 4HB0A 4KK3A 2NZXA 4RCVA 2X0KA 4OHOA 1Z8HA 3U3ZA 3W3AH 3WLNA 1JG7A 3ESYA 3ICOA 4FZRA 1VJ0A 1SVNA 2HLPA 4O2BB 1R0BA 4OP1A 4PRKA 4TMYA 3B36A 4YXWA 4A15A 1JBEA 3O74A 1GXSA 3O21A 4UW9A 4Q9IA 4XVUA 3B53X 5I9SA 2RIRA 2H4FA 2YDYA 3QV2A 4V1CA 2A94A 4XJSA 4MH0R 4P2GA 3WZ2A 4H15A 1GQ2A 3CRRA 2P4SA 4E5VA 3G68A 1G5TA 3WLRA 4PHFA 3Q85A 4JDPA 2TMGA 4NENA 3CW9A 4XPZA 4DMRA 4OI1A 2FNAA 1XA0A 2VYNA 2BMJA 2VHQA 5BOSA 5TRTA 3A28A 5EHGA 3WNBA 5B1YA 4AROA 2YVUA 5JCXA 4R2WA 1AXGA 1YULA 3B3JA 3JZAA 5K51A 1XQ6A 4AIIA 3ZCRA 3E8XA 4YP9A 2P5TB 1MTZA 3ETDA 1TTHA 4OQZA 5FX2A 4KACA 1X14A 2EGGA 2FR8A 5IXJA 1Q0TA 1FW8A 2F3RA 2QX9A 5GOZA 1PJZA 4AXXA 2XD9A 3PNKA 2K7FA 2RHGB 4IDPA 2NO5A 5HS6A 3RLIA 4CHTA 1GUYA 3OJOA 3VNBA 5ALFA 4RTKA 5I9NA 3I01M 1FP4A 3OTOB 3PUXA 1IUOA 3DPUA 3QXXA 4IF4A 1P1BA 3PSHA 3TR0A 3VOAA 4YRMA 2CWWA 5EPOA 1HL7A 2O8EA 5IYZF 1JA9A 3DLPX 3ECSA 3LY7A 2DH6A 2GN0A 4AZSA 5I7EA 1A2OA 4MCIA 3ASZA 2H9YA 3K09C 3PJFA 3G9ZA 5JAHA 1K8XB 3UENA 5B30A 4AF8A 5JC8A 4DR5B 4PINA 4DB4A 5DHQA 1GNRA 4KFSA 5WRFA 4V24A 5JD3A 3W79A 3JSAA 3CPJB 3H1EA 5DNYB 2IV2X 2Q3FA 4OQFA 4BCBA 2OCAA 1PJ2A 1KI6B 1NBWB 1I1HA 4D0GA 4M88A 2I33A 2FPIA 4DA0A 2CMDA 3ORSA 4DE5A 2JHCA 3KP1A 4V03A 9MHTA 1MGOA 1I1OA 3WX0A 1WKCA 3LRPA 1B42A 2EKZA 3ZXSA 4YPOA 2NYVA 2EGUA 1SHKA 4OJMX 1Z0UA 4J0KA 3OZUA 4L5CA 2V54A 2D1FA 1YZUA 4LDQA 5FOUA 1QO9A 5A4IS 2FRDC 3A3YA 4O4LF 4U2FA 4R6XA 2CNWA 5E2IA 5E7QA 3RFXA 1Y6RA 3V42A 8GPBA 3PD0A 2ORED 3JY6A 2D2VA 4R69A 1RHUA 2D3WA 2RKWA 3H9QA 1L5SA 2OBNA 1SEPA 2Z8ZA 3AR8A 4OOEA 2UVPA 1JH8A 3FOCA 3PXEA 5CLQA 2I6QA 3VJKA 3F4BA 4BP3A 2HO4A 4AN0A 4FB5A 1IZZA 3H87A 2FK7A 1ORIA 5EUQB 1YTLA 1N1DA 3VYSB 2JIOA 3RCBA 4E22A 1U28A 2IJGX 3CKYA 3A9CA 3L0PA 3OEEA 1S2NA 3EPLA 4H4DA 4JC4A 3RWBA 1VRWA 3TKAA 3A9SA 3DULA 3ONWA 4HMPA 4CI9A 5BXYA 2GA8A 3LGXA 5IKEA 3VFDA 1CBUA 3TPZA 1T2DA 4B0OA 4F8JA 3KYCA 1U8EA 2IOFA 3HHEA 3RS0A 1N7GA 4QLBA 1QFJA 5KX5A 5CT4A 5KMGB 2JH9A 1Q3HA 2B1IA 3K05A 4P0TA 4WXMA 2UZ0A 3ITDA 4AURA 3GJ8A 2WNIA 3PIRA 3R6TA 5CK5A 3RWMB 1NG9A 2N47A 2QN6A 2XB6A 4MVJE 3L7AA 4JN6B 1I7NA 4J0FA 1S4QA 3I8XA 2ZDHA 4OIMA 4E31A 5LJIA 2DPXA 4Y3UA 2GBCA 5CVUA 1VZ3A 2Y66A 4WSOA 3OMXA 2EARA 2BTEA 3AUXA 3ICEA 5HOEA 4J2HA 4HGOA 3VKWA 2QJRA 1EKXA 4LXXA 5AI8A 1C1YA 2DUJA 3DMYA 1L7OA 3MJSA 4HRAA 4B33A 3NXSA 4CV3A 1ULBA 4WNAB 2B6NA 3HYCA 4L6CA 1JKMA 2M9MA 5D6OA 4MZDA 2V59A 1YUNA 1BU5A 2REQA 4P3OA 2VH5R 5I7RA 5IKPA 1MQSA 2H2WA 2R5WA 5LOVB 1XNHA 3OCCA 3QOXA 1WP9A 4DYDA 3L01A 5KHOC 1U5CA 2YWCA 3S44A 2GKOA 1NKSA 1PGOA 4UDOA 1N92A 3MSXA 4ZJYA 2G3YA 3B60A 3FYTA 2LCFA 3RGGA 3MCUA 2CVFA 2NQ2C 1A88A 2GCIA 4DA8A 4F38A 2HHCA 3BXOA 3HVIA 1S7GA 1G8YA 1SKUA 1LK0A 2IRWA 3K0CC 4KK4A 1EYZA 4ZEVA 1ORRA 3KSAC 1HX7A 2FTKE 2O2DA 3WDSA 5CDFE 4RVGA 2AC2A 4PPFA 5EC8A 4B3IA 3O8RA 5KCZA 2OV2A 1W0JA 5BRAA 1PZEA 3PDIB 4BC0A 1W5FA 4FQ8A 1OLXA 3SC2B 4BVJA 1BIFA 2H2HA 2ZETA 4AS2A 2Z2JA 2A0KA 3CUUA 4O4IA 2FI1A 3V1KA 2IDZA 1I13A 3N2IA 4U8HA 2GXAA 1HTBA 3LF2A 3LIPA 4HQRA 4YT5A 1YCGA 2REOA 3K1AB 2O57A 2IZ7A 2QVXX 3GARA 1OOEA 1NBME 1PFYA 4F56A 2XBMA 1H2FA 2VN8A 4EYGA 1JDPA 3WL7A 2VUTA 1RM3A 3P52A 5FOSA 4PONA 2AMVA 2HHAA 4MW2A 3KKEA 3L07A 4MROA 3U7QA 3KQSA 5C5IA 1P17A 1JEEA 1QNLA 2JIZD 1SA0B 4CE6A 1ZM4A 4B3HA 4DMLA 5L45A 2Y1WA 4P3XA 3ELWA 5AW7A 1KYXA 2Q3CA 2QA5A 3AZOA 4K87A 3WVNA 5AM4A 4KP7A 4CF4A 5L3ZA 4CMEA 2O2IA 2XNSA 1VKRA 3PV0A 1I6WA 4O4JB 1IY9A 1BJKA 2V03A 2WWTA 5JY6A 1PT6A 4MQMA 1SUSA 4HN9A 1XLWA 2Q2OA 1T3SA 4NIMA 5T8KA 1DJNA 5AI4A 3ORQA 5SZHB 3ZXUB 1TCBA 1UBEA 3C3BA 2JFOA 5AM1A 3BZUA 4NEQA 4BFWA 3VRHA 3EMVA 4F7WA 1SQ0A 5LZ5A 1TA9A 4AKEA 2J8ZA 5IHXA 2A0UA 4CCSA 5ILGA 3HJRA 3EF1A 1N8SA 5IBPA 4O4LB 3DFUA 2Y0CA 3E1KA 3S7TA 3URKA 1XHFA 2VR1A 3HYNA 3DZFA 3P9YA 4KGZA 3TCKA 4BFXA 4W4TA 4CMJA 4Z7QB 3DOEA 1EP1B 4BFTA 4AKHA 1WAMA 5FDFA 1UBOS 4PZUA 3VH3A 2E89A 1XP5A 2HXSA 3F96A 2M6KA 1JALA 1PWXA 2IS1A 2VJAA 3BMQB 4RJKA 1AN0A 5SZKB 2I0FA 3SKVA 3QUCA 4CFSA 5HQ3A 2TMDA 4W5JA 2ZBRA 4FN5A 3OJWA 2BJHA 5L3RA 3IAS1 4BCCA 4MIEA 4Q1CA 2CJYA 2ZBPA 1D1TA 3RW9A 1QHNA 3T1OA 2R47A 2IYRA 1OC2A 2YV2A 5DM1A 3G7UA 2ZUDA 2ZE7A 5DXJA 4CETA 1PEDA 1Y3HA 2G1UA 1K8RA 2XE6A 2Z3ZA 2ZYTX 1SBTA 3M6IA 3P9IA 3KYDB 3K92A 1KI7A 2YFHA 2HJGA 3S7ZA 4TUYF 2A5DA 3NX4A 1XCOA 2DHRA 3PDWA 3O73A 3KOOA 3M6VA 4H3HB 4RGBA 4HAZA 2JBAA 4F4DA 5K4HA 4P84A 1WMEA 3RSCA 1JHVA 2HK9A 2L19A 4NEGA 5TMBA 4BNGA 2G5CA 4GQIA 4FD2A 5I48A 1ADJA 2VDRB 2VHUA 3FDXA 4ZAFA 1CY8A 8ATCA 5JQGA 1SEVA 1XZQA 4IHJB 3H8JA 2V6BA 3JARA 3KQQA 1OYWA 5ER6A 1W2GA 3E15A 3TTYA 2NUPB 4BGUA 1RQRA 3GFBA 2DWQA 1U90A 3CZAA 1PNTA 2NUPA 1BDBA 2QI9F 5DYGA 1H1DA 3OZGA 2JD2A 3H5RA 1IULA 1YJQA 2YHAA 1NVBA 1RRFA 3ESXA 3GL9A 4P22A 1LDEA 2A3NA 5JC1A 4U4AA 3M2TA 3JWHA 1U2GC 1O96A 1KAMA 1F60A 3KB6A 2FETA 5AESA 3DE2X 3G88A 3UWPA 2QN8A 4HLUC 2O7SA 2UUOA 5ICMA 4DVGA 4C7KA 2V97A 5EXTA 5DTRA 1Y5MA 3D6MA 1ZU5A 2XGMA 3PLRA 1GRQA 4MS1B 1A8PA 2BBTA 2QR5A 3HDTA 3FOZA 2JAOA 2C7VA 1NT4A 4IHAA 2O2JA 4ISBA 1RS0A 3KKOA 1HE8B 2I8LA 4GZ6A 1J7KA 1SR8A 3MERA 2UYQA 4OFZA 3RO7A 3KAPA 2WAAA 4RMIA 4B4VA 3LWBA 5C34B 4MULA 4Q37A 2HO5A 2GAOA 2Q0XA 1CUIA 3BSWA 4RQTA 4DOMA 2JLQA 1SAYA 3Q1LA 5B53A 4EITA 1BYIA 1KU0A 2ZQZA 3NKLA 4X1YB 5EHXA 3WGMA 3A26A 2JFWA 4KZKA 4G89A 4CPDA 4DC0A 5F35A 4ZI7A 2FHPA 1NXPA 1ECPA 1UJBA 3KR9A 4MR7A 3OQNA 2AK2A 2FFRA 4TKVA 2UZAA 1YS4A 2E4XA 3KBBA 3VO9A 2FZ4A 3RVQA 3AUSA 1GGNA 3G23A 3MIZA 2P3OA 3KL4A 1GTZA 2IDKA 4FFRA 2FWMX 4LXIA 2HH9A 3GFGA 1GL7A 1U1CA 1AKEA 1JKFA 1DPGA 2QN3A 2OVFA 3LQYA 4RYDA 4P81A 2CZCA 3KAQA 5KNBH 5KSPA 4PQGA 4GWLA 2EG5A 1NQXA 2CBZA 3IP5A 5T41A 3GYGA 2DB3A 1E9BA 2JCVA 1LJLA 3EIEA 2VAMA 3HGMA 2OCDA 2ZTVA 3FCXA 4PAQA 5CJ2A 5EGSA 4KO3S 4IRUB 5C1IA 4HAYA 3UMBA 2XUHA 3N2ZB 2O8DA 2MSCB 1OWPA 4IVPA 3SY8A 1Y33E 3NR2A 4IJKA 1L4LA 3DOUA 3EBPA 3GPIA 4IINA 4L28A 4RDIA 4TGLA 1JR3D 3GFFA 4Q4HB 1NMYA 3L7CA 4IDGA 4QTTB 3K1TA 1JSRA 2P11A 2E9SA 5D1HA 5M34A 3HB1A 2ASVA 4Y30A 4DJFC 4GXTA 4RDXA 1U8ZA 3OQJA 2F3SA 4IEFB 1Z0FA 4B83A 4IVRA 4JLDA 5L6LB 1G8FA 5TT1A 1PRYA 2HMVA 4KUEA 4KPGA 1QE3A 2CNNA 4N82A 3TNDA 2ONZA 4MKGA 4R9VA 5CNJA 4EA9A 1JKIA 1KH3A 2FRVA 1AUOA 2PKRA 3EJ6A 1SB9A 2GPTA 3R09A 2IYYA 1IEXA 4RVDA 5G0UA 5IJAA 3TWOA 3OOJA 1M2KA 4PAGA 1VLMA 4DM3A 1VLQA 2Q29A 4PZYA 2DY1A 1YRHA 4TPKA 4PLCA 4TLEA 3T9BA 4DIFA 4O4IB 2RH5A 3BRQA 4KH0A 4UCQA 1DI0A 1Z4JA 2AVDA 4BGIA 2Z3WA 2A5LA 2J9ZB 5JPCA 2OESA 3GJQA 3P9KA 1H8ED 2PWPA 1FLNA 3CT4A 2NNWB 4PSUA 4BKPA 1T2EA 3P19A 2ISQA 2WVHA 3IJ5A 4FE3A 1BMFA 5H70A 2G8LA 3TBKA 4CKWB 1WEHA 5K2OA 5A2GA 3KTFA 1ORTA 3DAFA 1A76A 3AUUA 3HA2A 4AUMA 5AOAA 1XXLA 3R9XB 1M5RA 2O8FA 3PNQA 3EY4A 1GTJ1 1N2IA 1Z4IA 2GBLA 1FUKA 4OJNA 4NU5A 3UA4A 1UJCA 2VBIA 4D3SA 4HX2A 5EP2A 3DOCA 3H7IA 3EQZA 1C9MA 1WSAA 2GYUA 5I3CA 4DTCA 1JJIA 1WDKA 2BRUC 5PGMA 2GCEA 5B7NA 4K6KA 2C96A 3MW8A 2DUNA 3QK7A 3THXA 4YYZA 5TEVA 2HN9A 4HGYA 1FU4A 2EYUA 4OJKA 5IBCA 3L8HA 5MFZA 2B7CA 2XUKA 5ELLA 4BEBA 4D9JA 2B9VA 3LQ2A 4H1HA 3GFSA 4YN3A 3GZTB 3K73O 2HHJA 2JH8A 5IPFA 4ZGBA 5KYUB 1UKYA 1U5AA 4DJDC 3GW8A 1QHHA 4E13A 1BSVA 4B48A 2W6JA 4MAFA 4DJTA 3DEIA 2R6DA 1FPQA 2XYQA 4MKXA 2ZJAA 1BXKA 2WSLA 1G17A 1F3LA 1WXGA 3I9V1 1CJCA 2O14A 3N8KA 1XAGA 3L6CA 3PJEA 4ZT7A 2W2OA 2CXNA 1GPBA 1UZLA 1HDOA 3M3HA 4YJGA 3RTDA 4BLOA 1A3CA 1XTTA 2I2AA 2PVPA 5ALXA 3S28A 2Q1TA 3OTGA 3KOUA 4ZXPA 5C52B 4O2BF 3D1VA 1BYUA 2WE8A 1QCZA 2CD9A 4WK6A 3I01A 3MHPA 2W2PA 5IM4A 1D9XA 5IUKC 4GKKB 1IK4A 1LZLA 1KF0A 3MYYA 3KLMX 3DMGA 1VBNA 3KYCB 4QYIA 4ZRMA 2B82A 3DVSX 5ALTA 4A5SA 3LM8A 3ZY6A 5EJ6A 4XIYA 3VI4B 1QRSA 4FDTA 1VYVA 4UM7A 3T5CA 4D6XA 4DDVA 5BP7A 1ZGZA 1LPPA 4RM2A 2XNDA 5KU1A 1V1MA 3SHQA 2O8BA 2XB2A 4ZOLA 1E63A 1AOXA 2J08A 4EUHA 3RC9A 2QZSA 3HBJA 2SECE 4V3CA 4YJ2B 3S2FA 4X6XA 1Q74A 4Q82A 4HTFA 5BR1A 1ENPA 2NXEA 3LY5A 2JFYA 4RY9A 1OWMA 3BE5A 4ADSG 1WZIA 2JATA 2R87A 4FYIA 4N3CA 1NG1A 2H65A 1X87A 3KKQA 3WBKA 1DKLA 1KQ3A 3IUPA 4OPMA 2AXEA 3EUAA 4ZT5A 3L6BA 4W7HA 3IT2A 3R5JA 4KFTA 4LJ8A 3VAZA 4N5DA 4A5OA 3ZDZB 1U1DA 1E5LA 1MTOA 3IAM6 3PRKE 1EE9A 4K9SA 4KYVA 5E6RA 3TINA 2HLDA 3ZY3A 1I2MA 3RH0A 1R0YA 2HU7A 2QP3A 1EUZA 1PVVA 2APJA 2WJVA 1YS1X 1SY7A 3BCSA 2UUBB 2AEFA 1CRLA 4D3FA 2WYVA 2Z3VA 3M5DA 3KHSA 1ATIA 3R3JA 3EPJA 3A9UA 4YAOA 4U3JB 2G1AA 5AHOA 3RAJA 3MGBA 3UB4A 4XQ0A 1W2WB 4N76A 4MS4B 2QDKA 3Q5EA 3JWJA 1OX4B 4I1PA 3F6CA 2UXCB 4Q19A 3T7KA 4BFCA 4WZAA 4JLMA 2QTGA 1Y9JA 1FTSA 4F2WA 2YWEA 1AU9A 4GAEA 4BO2A 3P2YA 1H69A 1RAFA 4HBGA 4MI6A 3X3HA 3CF6R 2I6SA 2QVGA 5HWSA 1TCCA 1CRPA 1YDMA 3NBQA 3RS3A 2XUGA 1OLSB 4PN3A 1XN1A 4P80A 1BWRA 4PIVA 4FGJA 1Z83A 5FPPA 1K0UA 5JTTA 1ZICA 2W22A 2ZT5A 3E23A 2FMIA 2W8BA 1NXTA