3GVCA

Crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
245
Chain Sequence
LAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAALW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Probable short-chain type dehydrogenase/reductase
total genus 89
structure length 245
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gvcA00
1IPEA 3P2OA 3WSVA 4EEZA 5H83A 4CMIA 2Y0DA 4Y9DA 4XRRA 3DBLB 3P19A 2HLPA 1R66A 1BG6A 4KP7A 3K73O 4DL9A 4GH5A 4MKXA 5DBIA 3Q3CA 3OQ6A 1V3UA 1CYDA 1I10A 5A9RA 2FP4A 3FCOA 3JD2A 3DZBA 1ZKMA 2AEFA 1YWGO 4D42A 2Z5LA 1P9LA 1XA0A 2IRWA 2VUSA 2HAEA 5G2OA 4BKOA 4C7JA 1SPXA 1B8PA 3M6IA 3GZ4A 3GF4A 5I7SA 4DUPA 1GQQA 4M54A 3G3EA 4IPTA 1SNYA 2X9VA 4ZQHA 4Q3NA 2H6EA 2BLLA 2WSBA 4NQZA 4IIVA 4DQVA 2RIRA 3PVZA 4GX0A 4TROA 2VYVA 2FOIA 3LVFO 5F1KA 3TFQA 3TZ6A 5A9SA 3GEGA 1X1TA 1BXKA 2X5OA 2HRZA 4ND3A 3U49A 4JQCA 3M1LA 4YJHA 1RKXA 1LBEA 1UXIA 1XGKA 1JTVA 2DPHA 2VZ8A 2UVDA 3ZCXA 5CPFA 4BIIA 4RF3A 5AXDA 4YRBA 3WNVA 1DXYA 4PIVA 1R4NA 3GGGA 4RZHA 1VL0A 1AXEA 1DHTA 1JWBB 1YKFA 4E2YA 1RYEA 1J5PA 3VOSA 1BMDA 2PFGA 2YDYA 3DZKA 4ALKA 4B3JA 4GX2A 4R16A 4G81A 4BKRA 1ADGA 4CLOB 4B8ZA 1GD1O 1PU2A 1DB3A 4DA9A 1GYPA 3U5TA 2E49A 1E92A 1UR5A 2D0IA 3ROQA 1AGNA 1XYGA 5MGBA 2B4RO 4GLOA 1YQGA 3PEFA 2EJVA 1H2HA 2DC1A 3ROKA 4PVCA 5ICMA 3G17A 3JD0A 2OFPA 5IFLA 1JLLA 4N54A 1B8UA 5JDCC 4BGUA 5KJFA 5TJ9A 2FPIA 3LT4A 4D0RA 4LCJA 4ZQFA 4E5PA 3S55A 4DGSA 4HKTA 2AW5A 1IHXA 5KKCA 5G4LA 1R0SA 4RLSA 4KQWA 1OC4A 1DRUA 2IYPA 3LLSA 4EZBA 2Y68A 3KYCA 5IAAA 2Q2WA 1V3VA 1EUZA 3PFFA 3AUTA 3QVSA 4IDCA 4HUJA 1T2AA 1M76A 1DIBA 3RUDA 4D46A 2HRBA 2IZZA 1AUPA 1PL7A 2ZQZA 1LTHR 4QECA 2NLOA 1TB4A 4TRJA 1U5CA 2C07A 2ZYGA 5ICSA 5CHEA 5F21A 4L8VA 2PA3A 2BGLA 4RCVA 1X1EA 1DDOA 3RC7A 4FFMA 1GCOA 4FC7A 3VVCA 4AJKA 1H2BA 4HFJA 1UP6A 2EW2A 4CMBA 2PV7A 1ORRA 2JHFA 2RCYA 3R3SA 5JSFA 4DPKA 4GSLA 3E8XA 2GERA 3HB5X 1DAOA 4EJMA 3D4PA 1U2DA 3H2ZA 5JAZA 3TFOA 4RQUA 2NTJA 1IY8A 2D59A 4AICA 5K0ZA 1F06A 1ZJYA 2JFFA 3BHMA 4L73A 4FB5A 3BA1A 4TSKA 3RUCA 3DDNA 3D5QA 1GEGA 2CZCA 2R2GA 3EVNA 3OECA 4D3DA 4U0KA 2I99A 4C7KA 1KVSA 4AJOA 2I5PO 1KVQA 5C7LO 3NTQA 1PQPA 2NVBA 3BTUA 3ONEA 3ZV4A 5I8WA 2Y1EA 2HMVA 1K6JA 1NXQA 1P1KA 1J4AA 2JAPA 3V1YA 3BXXA 3RUHA 1NQTA 1QYVA 1T2DA 3SXPA 1PGOA 4XYGA 1DSSG 2DBVO 2NV6A 4CODB 4E32A 2IXBA 4PLTA 3B1FA 1IULA 3PWKA 1Z74A 3EAGA 5TC4A 2NVUA 4GWKA 4E5MA 1Z75A 1I3MA 3H3FA 4L4XA 2Y93A 1NFRA 1ID1A 3ITDA 4M55A 4IQ8A 4RVUA 2DTDA 5H81A 3W6UA 4BNIA 4DXHA 4ONEA 3BAZA 2WYVA 5JAQA 1DIRA 4WJZA 4BNTA 1DO8A 4J16A 1ZK4A 2PK3A 3CXRA 3JYQA 4BO6A 4IDGA 1A9ZA 4MKRA 2VT2A 1M2WA 5COQA 3L77A 4Y98A 1D1SA 2NU9A 4CQMD 5U4QA 2B83A 3QSGA 2FR0A 4MVJH 4R01A 1LX6A 2CVQA 3IUPA 5EPOA 1LA2A 3RC9A 7MDHA 4XQGA 2YV2A 4XIYA 3WBFA 1MX3A 3MJCA 2VNAA 1ZMOA 3KM0A 2WYWA 5CAEA 3RSHA 3H9JA 4OL9A 5T8KA 3DZHA 3LF1A 3UKOA 1NPTO 2GRAA 1MC4A 3OIDA 2NTNA 3PJDA 2P4QA 3OFSA 4IQGA 4P4GA 3K96A 4B8WA 3GAZA 1Y8RA 1EK5A 2HKIA 2R00A 3VKUA 4EYEA 1EDOA 3O38A 5IG2A 1MXFA 1PJCA 3I83A 3H5AA 3I5MA 1PSDA 1K6IA 3R3JA 3T4XA 1X0XA 4FGWA 8ADHA 1W73A 2YV1A 2E37A 4IDEA 3DQPA 1YBVA 3GZNB 5FYDA 1VKOA 2Y1GA 1TEHA 3HE3A 4LCEA 2X0JA 3GDOA 2C29D 1P45A 2J5KA 2VRCD 4OO3A 1QV7A 2EERA 4G2NA 4MKZA 3OM9A 3RU9A 1GL3A 2I65A 3JD4A 3H2SA 2W2LD 3MJTA 2YQ5A 4BO3A 2D3TA 3CKYA 2X23A 1E3SA 2JFHA 3GMDA 4LMPA 3W8FA 4J7XA 3TSCA 2YDXA 1IYZA 5HRUA 3RD5A 4WLVA 1OI7A 3EC7A 1DOHA 3M2PA 4PG5A 4JK3A 1YS4A 1H6CA 2GSDA 3V2HA 4HP8A 5A03A 3GGOA 1T2EA 1H94A 3TRIA 4OSPA 1PEDA 4KMSA 4N5LA 3AOEC 3B1JA 1ADCA 3L0DA 1YB5A 4WGGA 2NVUB 2G1UA 3DHYA 1HE2A 3DB2A 2OZPA 4LGVA 3SX2A 2P91A 1GPJA 3FTPA 4BS9A 1ENZA 3IS3A 4CUZA 2FMUA 3KV3O 3ZWNA 3RFXA 4L74A 5A9TA 1Z82A 1N8KA 1ULSA 4CV3A 3D1LA 3X2FA 4TMFA 5F1PA 3AM4A 1BSVA 1WMBA 4NJOA 5KJEA 4F46A 1HLPA 4WKGA 3PPIA 4CM9D 4OXYA 4IY1A 4B4UA 4BQRA 3FI9A 2HMWA 2B0JA 4W99A 4RV9A 4DIBA 1SO8A 5L9AA 3FPLA 5KJ6A 2JCXA 1XQ6A 3DBHB 2X5KO 3WMWA 1TA4A 2VYNA 4UUPA 1NHWA 1ZSVA 2NM0A 3VKVA 5C5IA 2DT5A 1CIVA 4XEHA 1WPQA 3VH2A 3WQQA 2Y99A 4KZPA 3SC6A 4AVYA 3KYCB 1E1MA 2X0IA 4IJWA 3CTMA 1EE9A 2VHXA 4E2WA 1T25A 5IXYA 1IZ0A 3GK3A 4MJLA 1H93A 1X14A 3FTNA 2EGHA 1SEPA 2GR9A 2J5RA 4CPDA 3DTYA 4YQYA 1Q7CA 3K2EA 4A7PA 3HQ4O 3SBOA 1IHYA 1MP0A 2O2SA 4BNHA 3E82A 1E0DA 4RVSA 4AL4A 3RVDA 3PHJA 4DC0A 3GNSA 4BO2A 2P9GA 4GX5A 2RBEA 3RFVA 3BIOA 1ZO8A 1U5AA 2WTBA 3DAGA 4R1SA 4S3MA 5G0WA 1IB6A 3ZW8A 1HZJA 4RVDA 3KYDB 5EIOA 1Y9EA 3PJGA 3AUSA 3NYWA 1HYEA 5F5LA 1QYXA 3F1KA 3GQVA 4YJGB 1H0KA 2BFMA 2IDZA 3NX4A 1UXKA 2VYND 3ZWBA 1ZK3A 3HDQA 1P44A 4BL5A 3DXFA 4J1QA 2YQ4A 1C1XA 2CSUA 3H3JA 4F6LA 4I9NA 1TT5A 1Y8RB 5CG2A 3JQBA 3IKTA 1I30A 5JAIA 5JYEA 4XQ9A 1YO6A 3VZPA 4CM9A 3L6OO 3GVIA 1PZHA 1YOVB 1ZZEA 5A05A 3DHEA 2ZCVA 4R9RA 4UULA 4OAQA 5DZSA 1H6BA 3ZGYA 1FDSA 2G76A 4WUVA 4OH1A 3B70A 5DBFA 2IEDA 3JD1A 3OIGA 3IIEA 3UF0A 5T64A 1Y81A 2ZYDA 2O2YA 3QJ5A 1ZEJA 3MTJA 4FJ2A 4QFCA 3AUAA 5GZ6A 5AQ1A 5CEEA 1PS9A 1J6UA 1TI7A 1VJTA 3HFSA 2AEJA 1MUUA 1I8TA 2PH3A 3GEMA 3WTCA 5JBIA 5KTKA 5JXWA 3CE6A 3I52A 4NR0A 3UAGA 1DC4A 2PLAA 2IYOA 2PTGA 3OSUA 2H63A 3DMTA 4UVHA 4CLOA 1E7YA 2C7GA 1UZMA 5TSDA 4A2CA 1U2GA 3FNGA 2NACA 1C0LA 4IDFA 3DFZA 1E7QA 4BO1A 4XGNA 2W2LA 4CMAA 2UYYA 1C14A 4B7CA 2TMDA 1U9JA 4YAIA 1XDWA 3IL2A 4ZA2A 2VRCA 3C7DB 2ZQYA 1PGQA 2QYSA 4XYBA 1B7GO 3EDMA 3WGQA 5L51A 2DFVA 1FDTA 3Q9UA 3ASVA 2OBYA 4LSWA 2Y0CA 1GCUA 3KSZO 1DBVO 1WVGA 3PLNA 1HSOA 2VOEA 4FBGA 4OSOA 3RJ9A 1V3TA 1X15A 3LQFA 4E2XA 4W7IA 2WD8A 1LSOA 1TXGA 4WNCA 3RROA 4K1LA 2AG8A 5DCWA 5A06A 5KCZA 1U3TA 3DFUA 1OOEA 4GI2A 4YAKA 3ZNQA 2V6MA 3C1AA 1QRRA 3GR6A 4W9NA 3GUYA 1P1JA 2Y0EA 4GWGA 1BRMA 1G1AA 4RPHA 3V1TC 5THKA 4HFRA 5JLAA 5KJ1A 2O48X 4CQMB 1ULUA 1T2FA 2VTEA 4EW6A 3F5QA 5AOVA 2DBZA 3LF2A 4WCFA 1MG0A 1Z7BA 1YDWA 3NAQA 3OIFA 1PJSA 2HQ1A 3C24A 3U9LA 5B12A 2W98A 2YW9A 3NKLA 4R41A 3PI7A 3FR8A 1AHIA 3QWHA 4AJLA 4YAJA 3WGGA 4WPGA 5FEUA 2VWPA 3WJ7A 3ENKA 1VJ0A 5DN9A 3I9LA 1LEHA 1PJBA 3NDRA 2PGLA 4M1QA 4PG7A 4TKLA 3T7EA 4CMEC 4ZGWA 1B15A 1NR7A 1I36A 5DP1A 5BQFA 3JQ7A 1GTMA 3H7AA 3KYDA 1NVMB 4BO7A 3IP1A 3JQEA 3CIFA 3PTZA 4J4HA 3BMNB 3B20A 4NHEA 1GV1A 5G0TA 3N58A 4KTVE 3WFIA 5A5FA 5TRTA 1O89A 2CF6A 3UXYA 1GYQA 2BRUA 4J1SA 5IDWA 2B5WA 3U0BA 1L7DA 4AJ1A 3D3EA 2UAGA 2I6TA 3C85A 2J6IA 1PL8A 4FD3A 4ZD6A 3OF2A 2EGGA 2I67A 4RJTA 3IC5A 2O3RA 2NU8A 2P9EA 3CZRA 2DVMA 1ZK0A 2C0CA 3DOOA 1EFKA 1ZIDA 2BF7A 1NNUA 4EGFA 5HS4A 2B69A 3L4BC 5KNLA 2I76A 4ALLA 5EJ2A 3WWYA 3HUDA 1C1XB 3FF4A 4NFHA 4DLAA 5IF3A 1FF9A 4R1TA 1VSVA 1KY5A 1LDEA 4B4WA 4GX1A 4FCCA 1GAEO 4NK4A 3AY7A 3UICA 2DBQA 2XXBA 2DPGA 1QORA 1ZJZA 3JQGA 3WTBA 1ISMA 1KIFA 1NAHA 1B3RA 4KDFA 2YHUA 1JW9B 3KUXA 2LDXA 4E0BA 1HYGA 2ZJ0A 2Q1WA 1QYWA 1M67A 1D4FA 3ICPA 4R1UA 1D7OA 2DM6A 1DC5A 4CLEA 4YT8A 4IGEA 2GZ2A 3L9XA 2CDCA 4PCVA 1A9YA 4I9HA 5L7YA 1FDWA 1YVEI 1BXGB 1DIAA 3L4BA 1SMKA 1XKQA 3QWIA 5DNAA 4YWJA 3AY3A 2GN6A 3R6DA 3TZCA 3TZHA 4ZN6A 1PGPA 4UREA 2RH4A 1VSUA 3T7CA 4CM5A 1KEWA 5BNFA 3T4EA 1Y9AA 3L6EA 1M66A 2FWMX 2OOSA 3O8QB 3UUWA 5KOIA 3BMNA 2F1KA 2UDPA 4OKIA 4U6QA 4JBHA 3FWNA 1P33A 4RDHA 1BVRA 1LU9A 3Q1LA 4PFJA 2HUNA 1YB1A 1ISIA 2ZTUA 1LDGA 1EBUA 1WWKA 1Q7BA 3UCEA 3ZWPA 4Z9XA 1GYRA 3TF5A 4CMEA 1XLTA 2GZ3A 1J0XO 1DJQA 3PWZA 5KKAA 4I1IA 2FSSA 1XHLA 3PK0A 4RF5A 3HB4X 4KUHA 4YAEA 3RBVA 5U9CA 1N7HA 3HSKA 5ER9A 4OOFA 2HSDA 1Y6JA 2G5CA 4MIYA 4WECA 2Q99A 1KC1A 2NTVA 4XA8A 2R6JA 1BGVA 3O9ZA 1QYCA 2OUIA 1EMDA 4HBGA 3PJFA 4Z9FA 5JMPA 1GV0A 4Q3CA 4IINA 4RL6A 5A4DA 4II2A 1GY8A 2VT3A 5ADHA 4IJUA 4OXKA 4U8GA 1VL6A 1F12A 4KQXA 1C1DA 5HTOA 1NAIA 2B37A 2X9NA 2DBRA 3PXXA 4LW8A 1YQXA 4Q3DA 2DU8A 2HK7A 1A71A 2PGDA 3PYXA 3AI2A 1PZFA 3KB6A 1S7CA 3ADOA 1E7RA 1LLQA 4EBFA 4U6SA 5ES3A 4E21A 1VC2A 5K6AA 2OL4A 4XZ3A 2P5YA 3H9QA 3I9NA 1MG5A 3AU9A 1P3DA 3OICA 1OFGA 3DZIA 4M8SA 4IBOA 2BD0A 3L9WA 2X22A 2AE1A 5TGDA 3G1UA 3OMLA 1VI2A 5JMWA 2JD2A 3ZWAA 1A7AA 2AA3A 4PLVA 1MB4A 3GHYA 1N7GA 4DPLA 3U4DA 1ZFNA 3HDHA 3OEWA 5EQDA 4CQLA 3A1NA 1YB4A 5IDQA 2C59A 4R4JA 1R15A 4M87A 3PJEA 4AJHA 3UW3A 3H9UA 3EZYA 1EQ2A 3GA0A 3QE3A 1C0PA 4R51A 4DIOA 2HJSA 4XR9A 2DTEA 1DIGA 4TRRA 2YV3A 1R6DA 2QYTA 1X7DA 1ENPA 3VH3A 1EFLA 2QRLA 1E7SA 2RHCA 4XJTA 1UP7A 3RC2A 4YR9A 1DC6A 2Q3EA 5DF1A 4BNGA 1OMOA 3VVBA 1HDGO 3ZNOA 1T1SA 4L0QA 3JQ8A 4IJVA 1C0KA 4IMPA 4BGEA 1JWAB 3FN4A 4PLHA 3UOGA 1QMGA 3FBTA 3PHHA 3NT5A 4PRLA 5JS6A 5BSEA 1K6XA 1ONNA 4L4SA 2DUWA 4X54A 5DOVA 4QT0A 3V2UA 4DYVA 2FY8A 4ZVVA 4MINA 2Q4BA 1W6UA 3U09A 4AJEA 1WDMA 3SLKA 1P1HA 4LK3A 1U3WA 4Z9YA 1F0YA 4YJGA 3WYCA 2PZJA 3ETGA 3QW2A 4PLCA 3VPGA 3A06A 1F17A 1L7EA 3KEOA 4P38A 5CDTA 4CLRA 1C3VA 1E77A 1CERA 1ZMTA 3V1UA 4A5OA 4NBUA 2GLXA 1DFIA 4J4TA 4IDBA 2WM3A 3R0IA 3GUCA 2EIHA 4PLZA 1JDJA 1VLLA 1PS8A 3RQSA 1NFFA 1NWHA 3E9QA 4DWVA 2Q2VA 3KVOA 2AE2A 1QP8A 1I3NA 5A5EA 4Q3AA 3MJVA 1H9AA 3RBXA 1MFZA 2H5LA 3N74A 4DMMA 5GZ1A 4AFNA 4YVFA 2X7HA 2UV8A 3QWFA 5AXAA 4BNKA 1A72A 5BR7A 5IZCC 5L4NA 4BMNA 4O0LA 5CDUA 1P1FA 2UUOA 3GZNA 4HNHA 1SAYA 4FW8A 4WLUA 3WDSA 1I0ZA 2I3AA 2X8LA 4ALJA 1GFSA 5F1OA 1HETA 1PJ4A 1HF3A 1OC2A 1KY4A 1NHGA 1X13A 3A28A 5DP2A 4BNFA 3ZW9A 4OKNA 4MIEA 2F00A 2CDAA 2D4AA 1EVYA 1UUFA 1LLDA 2VRBA 3AI3A 2YJZA 1CETA 4J91A 4RPLA 1JN0A 5GMOA 5L4LA 4O59O 1I3KA 3LT1A 3BTOA 4NDNE 4RPGA 3IAHA 1C1DB 3ULKA 3C8MA 5JW6A 1U4SA 2D5CA 3RUAA 3TL2A 2O3JA 1QYDA 4OM8A 1BVUA 3QVTA 4NBVA 1E6WA 4I9UA 4HNGA 1BXZA 1KOLA 3F46A 3I9OA 1ISHA 4TWRA 5I9MA 2D8AA 4TRNA 4ALIA 3TOXA 4P22A 2QHXA 4L9RA 3RASA 5C7IO 4XDZA 3GNQA 1VL8A 2ZTVA 4F3YA 2CMDA 2NNLD 4D79A 3A4VA 4MVJD 1HRDA 3AOEA 4CV2A 1MLDA 4NU6A 3GG2A 3OJLA 4JCOA 3EHEA 3KSUA 1FXSA 1UAGA 1VKNA 3MWDB 3P2YA 4WLEA 3DBRA 3EY4A 2Y1FA 3OJOA 4RDIA 4MVJP 5F5NA 5LCXA 1F14A 4E30A 5HWSA 1E7WA 2Y66A 3QQPA 3DO5A 3NGLA 3ZU3A 4E5NA 5B4UA 9LDTA 2I66A 2LDBA 1KS9A 1OBFO 1HDOA 1D8AA 2A4KA 4YQZA 2O3QA 4YJHB 3S2FA 1DAPA 1DLIA 3QA9A 1JAYA 4MVJE 4URFA 2AQKA 3KXDA 4WLFA 3V8BA 3EUWA 1XIVA 1YE3A 4N5MA 5HM8A 2XF8A 1I3LA 2XPCA 4F6CA 5C7OO 2YFHA 1I32A 4D0SA 1SB8A 1B14A 3U3XA 4YA6A 1U8FO 1LSJA 2X58A 4RO0A 4OHUA 1XELA 1NM5A 1RJWA 4EJ6A 3ZWOA 2E6UX 4HV4A 4GKBA 4MVJM 3OBBA 4YJDA 3WB9A 3I4FA 4DRYA 1CF2O 1JU9A 3C1TA 1YL7A 3WG9A 3PHIA 2GUGA 2Z1NA 4GMFA 4DQXA 4D3FA 1RWBA 4D41A 4J4BA 2UUPA 4UVGA 3UGKA 4NBWA 3ZI0A 3BYZA 1ML3A 3V5NA 1SBYA 4GGPA 5B37A 3W4IA 2W4QA 1QG6A 5IZ4A 1YQDA 5L7TA 3E9NA 2DAPA 3RUFA 3NRCA 4I08A 2CVOA 4JLWA 2VOJA 4BNXA 1HZZA 1LI4A 2Y1OA 1KVTA 2OP1A 3IP3A 4KUEA 4OJNA 5L40A 1JQBA 3WOHA 5EERA 4J2OA 4CM4A 3AY6A 4U0JA 1CEQA 1P1RA 1PJ3A 3Q2IA 1WDLA 3RKRA 4RGBA 4OQZA 3TJRA 1IOLA 3I1JA 2AEMA 1Q0LA 2PKQO 2Y1CA 2EKLA 3BMCA 5ILOA 4WLNA 3ZHZA 1H9BA 4J2HA 2VHYA 1HYHA 2VHVA 1F8GA 2O23A 3E6AA 3GRKA 3MEQA 4CQLB 1ADBA 4PLPA 3LZ6A 5G0UA 1ZSNA 3I6IA 2QX7A 2VHZA 3ONDA 2HMUA 3FHLA 2GASA 3ABIA 2FZEA 1PR3A 5U1PA 2I9PA 1CDOA 1LDBA 1UP4A 4BNUA 3KEQA 4BUCA 5BT9A 1UXJA 4PG4A 2EP7A 4CM3A 4CL8A 1E3EA 4D44A 5FF9A 4B3HA 4BB5A 3PRJA 2A94A 4A26A 4EEXA 1KETA 4RLHA 4H16A 1IUKA 4S1VA 1AE1A 4CR6A 4BOYA 4IZIA 3GN1A 2BGMA 1FK8A 1R16A 4MVJI 2FPGA 2O3SA 1HDZA 1KC3A 4R54A 3K9QO 7ADHA 4P4LA 1VRWA 5CFZA 3E1KA 2Q50A 5JFOA 4Z0PA 1CQIA 3QIVA 5DULA 4TQGA 1EE2A 1ISFA 2JD1A 4OYRA 1EQUA 4PZEA 4CLDA 4I5GA 3LT0A 2C20A 2P4HX 1Q7GA 4ROSA 4MVJF 3JYNA 4NZ9A 3WQRA 5GZ3A 5GY7A 5IN5A 2NQTA 3KLMX 1D1TA 5EN4A 4ND4A 3JYOA 3RU7A 1GPDG 1A4IA 3D3WB 4A27A 2VTDA 3TL3A 4UUNA 1I2BA 2Q49A 4FQ8A 3IDSA 5JO9A 3SEFA 4NIMA 2B35A 5EMHA 2ZB7A 4L75A 4A10A 1GUFA 2C54A 4BKUA 3QVWA 2PZLA 1T4BA 2POQX 3AW9A 1XR3A 5LDHA 4XQEA 1P77A 3LYLA 1FDUA 1EBFA 4E31A 4UEKA 1HWYA 1Y5RA 4MVJA 4MP3A 2QZ9A 3JQDA 1IL0A 5ITWA 1Q0QA 3IJRA 5A1TA 3STHA 3H8VA 4FJ0A 5AYVA 4YPOA 2H1SA 3BTVA 3VH1A 4DQUA 4L76A 1YXMA 4BNVA 2HK8A 2ZB3A 2FR8A 3WMXA 3DBLA 4G65A 3W8DA 2JHGA 3HJAA 1YONA 3AFMA 5A3VA 3WSWA 2J8ZA 3GDGA 4YTEA 3H6KA 1MA0A 2ZKLA 1GQ2A 4B7UA 2EWMA 1KEVA 2PD3A 1PGNA 1W8DA 4UEOA 1BXGA 1U8XX 1YBAA 2O3TA 1YL6A 2EW8A 4Z3DA 3O03A 1YRLA 4CM8B 3ZWCA 2YFQA 4Z0TA 4DTIA 1BHSA 5G0VA 2DLDA 2G17A 3ST7A 4XGIA 5BSHA 4MO2A 1HLDA 3ON5A 4E13A 1PL6A 3UHAA 4WE3A 3JQGB 2BH9A 4JNKA 3GNTA 5ENVA 4RF4A 2VUUA 4XWYA 5HA5A 2QW8A 5FI5A 4PLGA 2OHXA 5AVOA 3NDJA 4Q39A 3OJEA 1XWFA 1DHRA 2C2XA 2OMEA 1WDKA 2Q45A 3H5NA 3K8ZA 1V0JA 1PR9A 4J0EA 3RUEA 1ZH8A 4FR5A 3LC1O 4OIMA 4CJXA 3L6DA 4ZRNA 3TQHA 3PYMA 1NBOA 4IXTA 3EMKA 4Z0HO 3QY9A 5G0SA 2NUAA 1BWSA 2PGJA 3H65A 5TQVA 4XIJA 4J9UE 3TZKA 1Z6ZA 1GEEA 4DLLA 4BKPA 4R68A 4XRGA 4Q9NA 3QRWA 5JAMA 1C0IA 5I7FA 1LQUA 1ZNQO 3E5MA 2QRKA 1R4MA 1M6HA 1VE9A 1UDBA 2EP5A 4J3FA 3ZDFA 1TT7A 2DFDA 3VTZA 4LSMA 4CLXA 4YT4A 4ALNA 5B4TA 4YJFB 5MDHA 1E1NA 2Q1UA 2ZYAA 4GL4A 4XB2A 5JCXA 3AU8A 3HHPA 3I4CA 3OQBA 3ZWYA 4CM8A 1UZLA 2A92A 2P9CA 3F47A 5K6AC 1O94A 3JQCA 1A27A 3HADA 4UVIA 3JQ9C 2AQHA 3NUGA 4R1NA 4TZTA 3VTFA 3O8QA 3AK4A 4W82A 3WICA 3BZUA 1QXSA 4DC1A 3VC7A 1Z45A 3KZVA 3L4SO 2BI8A 1M75A 1LRJA 1F8FA 1HDCA 5KVVA 4HWKA 2O4UX 4CMKA 3WFJA 3MZ0A 4R69A 2EHDA 2EKPA 3K31A 3LC2O 4YACA 9LDBA 1BDMA 2ZK7A 3GFGA 1XSEA 1GR0A 4IGFA 3VH4A 4JJGA 4XDYA 4B3IA 4ITUA 1E3WA 4ZRMA 1Y1PA 1P0CA 1PZGA 1Q0HA 1WLYA 2AHRA 2AXQA 2NVWA 1AXGA 3FD8A 1LLUA 3OETA 1HDRA 1XCBA 4DBZA 3PQDA 3AFNA 3PDUA 2J5QA 1N92A 4JBIA 4CUKA 1GUYA 1U28A 1WMAA 2GD1O 4Z3KA 2HCTA 2J3HA 1TVEA 1R37A 3I9KA 4ESOA 1HDXA 1PJ2A 1ZEMA 2W8ZA 3E9MA 3U4CA 3JQ6A 4QX6A 1WXDA 1N9GA 1Q2XA 4WK6A 1LC0A 1LRKA 4XD2A 3WGHA 2YYYA 4NJMA 2PH5A 4BGVA 2EEZA 4RVHA 2JL1A 3E18A 1B8VA 4TVBA 2GN4A 2BKAA 3NDIA 2WYUA 3DMTC 3ZZNA 3DAFA 5JPIA 5IZCA 1N9GB 3F4LA 1DFGA 3GDFA 4ZJUA 3ENNA 1BW9B 2C7VA 1B0AA 2P68A 5TS3A 4I8XA 2JJYA 4BMSA 5CG1A 1FDVA 4W9NC 4HADA 4AJ2A 3FR7A 3H9EO 3GVPA 4PLWA 3EK2A 2HJRA 3JCZA 4TVOA 4ND1A 4HFNA 3CZMA 4H3VA 4EDFA 5C3MA 3LK7A 4CUJA 3PLRA 4IS3A 2D2IA 5BNTA 1EVJA 4IDDA 4AJNA 3DZGA 3D5TA 5K9ZA 4BO4A 1KBZA 5COBA 1QKIA 3DOCA 4BV8A 4QEDA 5A3JA 5IJZA 3NTRA 4FOOA 3JQ8B 1QSGA 1RM5A 3ZNPA 5AXBA 1WP4A 4GGOA 3N7UA 3MJEA 3KETA 3RBZA 1O9BA 3O4RA 2DKNA 2X0NA 2O4CA 1NVGA 3NTOA 1AN9A 3Q6IA 4RZIA 1R0KA 1DPGA 2RH8A 4FFRA 3DBRB 1Y5MA 3ORFA 4K6CA 4J7UA 3OA0A 3WYEA 3ZHYA 3GVCA 5T67A 3TZQA 1PTJA 4NFSA 5ILGA 5DCUA 3TOZA 5IN4A 4OMUA 1ISGA 2Z1MA 3TDKA 3NJ4A 1B26A 1PQWA 3TN7A 1Y8QB 1HE5A 1LXCA 3ANMA 3I3OA 1PGJA 1MC5A 5G4KB 3WIDA 3FPCA 3CUKA 5FFFA 3GN2A 4Y6SA 4BVAA 4LMRA 3EYWA 3KRTA 2FHSA 2FR1A 4PGFA 4UUOA 1O6ZA 4XJSA 5I8ZA 4ID9A 2W90A 4JN6B 4QXMA 3JQAA 3MJSA 1W0CA 5B4VA 1DRVA 5JCJD 3S2IA 4B4OA 3UCFA 1J49A 3NJ8A 3BHIA 3VHRA 4D7AA 1WZEA 4PVDA 3PWSA 1HTBA 3PDJA 2CUKA 3D3WA 3GT0A 4WCFC 4CM7A 3KO8A 4G5HA 1L1FA 3WBBA 3WGTA 1R4NB 1PWZA 3KLPX 1FMCA 3ZN2A 4CV1A 5TF4A 2WD7B 4I5DA 2ZIZA 3L07A 1Y7TA 1LNQA 3KBOA 3KHUA 2YY7A 2GZ1A 4J7CA 3QWBA 4GBJA 1M6WA 2V65A 1CQJA 2BMAA 1UZNA 4W4TA 3QWAA 1E3WB 4E5YA 5KIAA 1YDEA 1Q1NA 4FIZA 4WASA 3QVXA 4ILKA 2VQ3A 1T2CA 4KWIA 2DTXA 4PZDA 4YXFA 4RORA 1V6AA 2EXXA 5DBGA 3JQAB 4PZCA 3HN7A 4RF2A 1ZBQA 4CM1A 1LSSA 3ZWWA 4LRSB 5EESA 3WGIA 3MOGA 1HSZA 2Z95A 3UVEA 4NPCA 3HZZA 3AUUA 3WLEA 1NQ5A 3GOHA 4Z6KA 2YHIA 1DJNA 2PKQP 2A35A 4J90A 2FSVA 4K9DA 4NK5A 3B1KA 5CEFA 3ZU2A 1N5DA 5IDYA 2E48A 5TIIA 4BNWA 3OEYA 1W4ZA 4YT2A 1GZ6A 2C5AA 3LLVA 2P5UA 3VPFA 4J49A 1VM6A 2NU7A 1U4OA 2VZ0A 4BB6A 4UEJA 4NFYA 2VWHA 4C4OA 4TRMA 3GY0A 3I9MA 4LN1A 4HY3A 1LLCA 3D64A 1ONOA 4BNYA 2Q4EA 2NQ8A 4DVJA 1PZEA 2YZ7A 1T24A 4PRKA 1I2CA 2ILTA 4NNJA 5T5QA 4CR8A 3EVTA 2AQIA 3FWZA 3MCVA 3S1LA 3S8MA 3OA2A 2BHLA 2GN8A 4QTZA 4PG8A 8LDHA 5I9LA 3B6ZA 1H6DA 4J9VA 3KYBA 4JJFA 3GPDG 3H4VA 1X0VA 1P74A 2O50A 2VN8A 3F4BA 3F3SA 2GDZA 3UH1A 3JSAA 3DOJA 3F9IA 3JQ9A 1IE3A 2PR2A 2Q46A 4B7XA 4CMCA 3ROMA 4A0SA 1E3IA 4WOJA 5JY6A 5JNLA 1NP3A 3GG9A 4A03A 1K5HA 3PHGA 3ZV6A 2B5VA 1LDYA 4IMRA 2C2YA 5TJHA 4IM7A 4PLYA 3D0OA 4YBZA 3I23A 4PG6A 1NASA 5KJCA 3WLFA 2CFCA 4FN4A 3C3XA 1TLTA 5JCJA 1JKIA 4OQYA 5A9SB 2IE0A 1HKUA 1NPYA 3JQAD 5JDIA 5L4SA 1QR6A 1D3AA 4B79A 2HU2A 1X7HA 4MOWA 4NJMB 1UDAA 2D5AA 3WQSB 2TMGA 4E6PA 4YYZA 4BNNA 3PHLA 3UN1A 4Y6PA 2WJPA 4U5QA 4GVXA 4XR4A 4B4VA 4XQCA 1MGOA 3U4IA 4HFMA 4JGBA 1DFHA 4DYDA 3ZWVA 1JKJA 4BO9A 2GO1A 2WMDA 2JD0A 4GPD1 4CMHA 3AWDA 4AJPA 2VNSA 4N7RA 4I5EA 1I24A 3W8EA 2CVZA 3AM3A 2HMSA 4PN3A 1RM4A 3HFGA 1KYQA 1LSUA 4NU5A 4QO8A 1V8BA 3IKVA 5KVQA 1ENOA 4HXYA 3CINA 3K5PA 4E2ZA 4RPKA 4CL3A 6ADHA 1E3JA 4CV0A 1GU7A 1NR1A 5IDXA 4QO7A 1K89A 2O3UA 4H15A 3IOYA 3HG7A 2D1YA 2ZB4A 2BFOA 4JIGA 1X7GA 2BI7A 4UVDA 1ZVMA 5A02A 4Y67A 2W2KB 1G0OA 3BTSA 2WD7A 1E5QA 3DR3A 3DONA 2GGSA 1MFPA 4QFDA 4XYLA 3WR5A 3W6ZA 3X2EA 1XEAA 1G0NA 3K92A 3QLJA 4EUEA 5CDSA 2PZMA 1SCUA 1LC3A 3WGYA 1E6UA 2V6FA 4GVLA 1H6AA 1SEVA 4IQ0A 4YT5A 2OXIA 2J3JA 3ZV5A 3ADPA 1NVTA 5L7WA 2IEBA 2PD4A 3AM5A 3GEDA 3PIDA 4DMLA 3RIHA 2GNAA 4RQTA 4NH4A 4GKVA 4WLOA 3INRA 2FPPA 2A9FA 5J23A 4J43A 4INAA 4FPXA 3CMCO 2ZJ1A 5TT1A 4IDAA 3FNEA 3ICCA 3CEAA 1YGYA 4JX8A 1SB9A 2YHIB 1NYTA 2V6BA 3MJ4A 3VPHA 4E3ZA 1VJ1A 4FSHA 4L4RA 1PJTA 1YH3A 3CH6A 1YBMA 2CY0A 4R9SA 1GUZA 4KDEA 3H9GA 2Y1DA 4YRAA 1IPFA 2PD6A 4CMJA 1JKFA 1NQOA 1UXHA 1WAMA 4NI5A 2EJWA 1SC6A 4O6VA 2GPTA 3IMFA 4E4YA 2VWQA 5JDCA 5THQA 1ADFA 3DAPA 4M49A 5LDGA 2E4AA 1MV8A 4YDRA 3BMQB 4KOAA 3QP9A 3W1VA 3PQFA 1ZW1A 1K0UA 1N1EA 3MOIA 2CD9A 2YUTA 3QHAA 4ND2A 4R5HA 1E6EA 3G79A 3ANNA 1OZAA 3JQ7B 1KVUA 4LRTB 1JVSA 3SLGA 2X0RA 3FRJA 5JO0A 4DIFA 4NBTA 3DZJA 1QLHA 3GVHA 4BMVA 3PP8A 1DRWA 4IZHA 2ZTMA 2FZWA 3JQBC 3KOUA 3ZWXA 3SJ7A 3WIEA 2C5EA 5ENDA 2PZKA 1U3UA 2JCVA 1LDNA 1PWXA 1ZK1A 3GH3A 3DL2A 1I2ZA 3K2BA 4XCVA 1JVBA 1UJMA 5IXSA 1SOWA 1K2WA 1SOVA 3VPSA 3FSRA 2HMTA 3LC7O 3HWRA 2E82A 2JAHA 1N1GA 1PX0A 3ETDA 2VHWA 2OORA 3JTMA 1ZCJA 3NT2A 4HX5A 4J1TA 1U1IA 1B2LA 1A5ZA 1A7KA 3ITKA 4JXKA 3RFTA 4H7PA 4K28A 2B36A 2HO5A 3E5RA 2IZ0A 4GAEA 1FJHA 3PZRA 3GMSA 4KTTE 4BNJA 5DDIP 1NQAO 2HK9A 4YCAA 2B4TO 4IIUA 2OP0A 3Q0EA 1ZXBA 3GPIA 4MP8A 5L95A 2ZCUA 4MPDA 1HEUA 4JROA 2EG9A 1NX6A 1KEUA 3DEYX 2V7PA 3W4JA 1EUCA 1HL3A 3AI1A 3NT4A 2IXAA 2XAAA 2WDZA 3RWBA 4ZQEA 4JP2A 2Q1TA 1GDHA 4FFPA 2PKRA 3ONFA 4K6FA 4BHTA 1GZ4A 3JV7A 3EW7A 4UVEA 2GN9A 4CQMA 2DQ4A 4BV9A 4FFOA 3VZQA 2QRJA 2JCYA 2XOXA 5A04A 1DC3A 1SZJG 4W6ZA 2CNBA 3V2GA 3OP4A 3GAFA 3OQ1A 2WWRA 4W7HA 3WJAA 1T1RA 2NADA 3AJRA 4MIOA 4R3WA 5L3ZA 2PNFA 4UAGA 1P31A 1ARZA 2SCUA 4MVJG 3RUIA 1KERA 3GVXA 3RAJA 3I6QA 5G4KA 2J3IA 4AJ4A 5B1YA 4AG3A 3EZLA 3WYBA 4XX0A 5JE8A 2FN7A 4BO0A 4BO8A 1LJ8A 1YL5A 1ZSYA 4IXWA 4Q3EA 3SJUA 3Q2KA 3VAZA 3NGXA 2AMFA 3Q11A 5LC1A 3ANLA 4OOEA 3DC2A 2X86A 5JYDA 4LVUA 3PFWO 1UXGA 2J3KA 4XYEA 1H5QA 1JA9A 4WEOA 4WCFB 3RC1A 3D7LA 5JY1A 2P2SA 3BMOB 1QV6A 1PS0A 3WGZA 5JDIC 3TPCA 1TT5B 1EVZA 5BNIA 2CDBA 3ASUA 1ZXLA 3JQFC 3DTTA 4J6FA 3G0OA 3TNLA 5FWNA 5JC8A 5TLSA 2WEKA 2NSDA 3NEPX 1LDMA 1XU9A 1EVIA 2OO5A 3ZH2A 5CEJA 1WNTA 1Z73A 4AJIA 1E7MA 4BNZA 1Z7EA 3LDHA 2X9GA 1HE4A 4D3SA 5I7VA 3BHJA 2BELA 2ZTLA 1A4UA 2Q1SA 3IJPA 1ISJA 3RCBA 2AQ8A 1Y8QA 1EZ4A 1P0FA 1E1KA 2B4QA 3FNHA 4R3NA 5AXCA 4KUGA 1R4MB 2EKQA 3D4OA 5T6BA 3PYLA 4FC6A 5BSGA 3ZU5A 1N2SA 4DPMA 2ZB8A 1E5LA 2X6TA 3RJ5A 2VZ9A 2GCGA 3MWEB 3PGXA 1CWUA 3HDJA 2BFPA 5KVSA 1IZ9A 4QUKA 4WCDA 2X4GA 3JQFA 1CJCA 2R00C 3CSDA 3DZFA 3RKUA 1GZ3A 5DOZA 1RM0A 1HXHA 4EITA 4QSMA 2GYYA 4GSKA 4OGWA 2W2KA 4LISA 5TT0A 2QIOA 1T4DA 5T8KC 2XXJA 4O5OA 4A73A 1RPNA 3HDYA 4DBVO 2EF1A 3WWZA 3PGJA 1ONPA 3BMOA 3INTA 4BNLA 3OJ0A 2O7SA 1T26A 5CDYA 3E48A 2NU6A 1U3VA 5C37A 1DEHA 2OGUA 4OXNA 4MDHA 4O1MA 2VUTA 1LRLA 2FRDA 3LSYA 1LQTA 1R12A 3U62A 1ENYA 3BMQA 3DWFA 4P8RA 5DCYA 1B3BA 1GADO 1PIWA 1O8CA 3PIIA 2NWQA 4RVGA 4ZQBA 5JC1A 1YJQA 3A14A 5DT9A 3ZNNA 3FNFA 4II3A 4M86A 5ITVA 1OAAA 3JD3A 1E3LA 4Y6RA 3VDRA 1WZIA 2HDHA 4R5MA 4P4NA 2VWGA 5CPBA 4YRDA 1O0SA 4LVCA 4ZQGA 3CPSA 4FGSA 1O5IA 2ET6A 1DIHA 4U7WA 1UAYA 3OH8A 2V6GA 3WXBA 4TKMA 5L53A 4ALMA 3IQDB 1DLJA 1K3TA 1PJLA 3D4NA 3GFBA 5TNXA 3VZRA 1BDBA 4BO5A 4EUHA 3PZBA 2JKVA 5CDGA 2X1HA 2Q2QA 2O7QA 2WE7A 4N18A 4WNIA 3JYLA 5FI3A 3DBVO 4FFLA 3GGPA 3ETEA 3VZSA 4CLHA 2CF5A 3HNPA 3UFXA 4YAGA 1NFQA 4PLFA 4DLBA 1HDYA 4IS2A 5T57A 3ZU4A 1UDCA 4E12A 3I9JA 5L45A 4GQAA 3WGOA 3LU1A 3DMYA 3WNQA 2H9IA 3F6YA 1LUAA 3Q9NA 5BSFA 5I9NA 1YJ8A 3NV9A 3INGA 4BGIA 1PJQA 1U7TA 1B16A 3H5RA 3KSDO 3WS7A 1XG5A 2VYVD 3IUSA 5EL0A 3R1IA 5F3RA 3P7MA 4MP6A 4BKQA 4AJJA 3G49A 1P1IA 3U4HA 1NTOA 3HN2A 3K6JA 1JAXA 1NPDA 3BMCB 4YEDA 3QVOA 1E1LA 4F45A 4IUYA 4FS3A 3E03A 4XGKA 4GMGA 3A9WA 3M1AA 3UCXA 2ZATA 3C7CB 1V9LA 4YB8A 4YJFA 3KTDA 3QV1A 4TZKA 4FJ1A 5EQFA 4J0FA 3F5SA 4O63O 3VDQA 1CRWG 4CMGA 3GLQA 3C1OA 1YOVA 4KWHA 3G1TA 4WOKA 1AHHA 3AOGA 1RM3A 2X5JO 3ROPA 2G82A 2QG4A 2BFAA 3CMMA 3LT2A 3COSA 3K30A 4QQRA 4RPJA 4D43A 4Q3BA 3JYPA 4N5NA 4CMIB 4XB1A 5KVCA 2GF2A 1RYDA 1U7HA 5I7EA 4GLLA 4CM6A 5COAA 4WEQA 1EEHA 4E5KA 2QQ5A 2PY6A 4Y8VA 3F1LA 2RAFA 3SC4A 3MTGA 1G6KA 3W4KA 5TX7A 4ZHSA 1PQUA 3OHSX 4FOSA 1EK6A 4FDAA 3DHNA 2JFGA 1XQ1A 4BQPA 2Y05A 4ND5A 1BW9A 3ZV3A 2PWZA 1KVRA 5KWEA 2RHRA 1XU7A 1WW8A 3M2TA 2C82A 3RI3A 3ZHBA 3FBGA 3VPXA 1I33A 2OBNA 1I5RA 4NG5A 1UH5A 4UUMA 3PQEA 4E33A 4M89A 3P5SA 3SVTA 3S2EA 2BGKA 1V35A 1ZUD1 3C7AA 1VPDA 5EINA 3OJFA 4ZICA 4DREA 5HS6A 2QZZA 4RVFA 3GC6A 1HE3A 5CP8A 1MXHA 2WE8A 4BNMA 3S2GA 3EGOA 1I01A 3DBHA 4FFNA 4CLRB 1QLJA 3GHHA 1KEPA 1EDZA 1S6YA 1GQYA 4JP3A 4CM4B 3GRPA 4NMHA 5ER6A 3ZHXA 4CR7A 1BTOA 1EUDA 1NWCA 4I5FA 4JJIA 4JBGA 4XYMA 2AG5A 4ZU3A 3TWOA 4NBRA 2IZ1A 4J1NA 4IJKA 6LDHA 3ZWMA 2DUUA 3WX0A 1O95A 2I3GA 4XKJA 4D45A 2EV9A 5HBRA 1ZK2A 2IODA 4K26A 4EJ0A 4EUFA 2G0TA 2VCYA 2Y67A 5H82A 1HT0A 4EI2A 3O26A 1R0LA
chains in the Genus database with same CATH superfamily
4MUGA 3P2OA 2QXTA 4EEZA 4DB4A 3BL5A 2H92A 1ODIA 3IAM6 2Y0DA 5F33A 3W6PA 1WKVA 4Y9DA 4RA9A 2HJGA 3NONA 2O7VA 1R66A 4DLXA 3LYAA 2C2GA 3MQFA 5DBIA 3VO9A 2ZR7A 2BUBA 4K7JA 1KXZA 5HE9A 1TKCA 2X77A 1P3Y1 4O4HB 3MUFA 3M4ZA 3BQ9A 3OMWA 3K9FC 4I7EA 4XM0A 4D42A 1YA6A 3DMPA 2IBSA 4X90A 1G9SA 4XLZA 1TL7C 3PGVA 1VP3A 3NEAA 5DTIA 5G2OA 2FUG1 4C7JA 2PAAA 2OM6A 2H7XA 2VHQA 4YFVA 1SPXA 4CIBA 3IV9A 3NC4A 4ZDKA 4RDXA 2Z2XA 4B7ZA 4QUEA 3PNLA 3GZ4A 4J0GA 4DVJA 1S89A 3ROEA 3UW1A 5I7SA 4QVIA 1GQQA 4EENA 2X9VA 3R5KA 1CS4C 4Q3NA 5LBUA 4KDRA 3VZDA 1AX9A 1A1SA 5BQ3A 4IIVA 4DG5A 3PVZA 5CVVA 3HU1A 5FAKA 4U2EA 4I55F 1HO3A 3KSAC 3AVTA 2XUAA 3T9CA 1L4BA 3AQ4A 1UPAA 3BK1A 4HYEA 4MB2A 2P4UA 1XL0A 3NIGB 1PWEA 4JQCA 1SHJA 4YJHA 3UT6A 4DV0B 4ARCA 1LBEA 1UXIA 2VF2A 2WUWE 4OBBA 4XQ0A 3MW8A 1L7BA 1QH9A 4FYKA 5BRNA 5KYUB 5AXDA 1E2NA 1M2VB 5CD9A 3I2YX 1OXBB 1YRHA 3CJTA 4H7EA 4IGAA 4RZHA 1P9RA 5DMXA 2RGAA 1ND5A 3CRQA 4HN9A 5B57C 2YNMC 1UQRA 2CLSA 3VSAA 2HRRA 4QXAA 1XOIA 3OE7A 4B8ZA 1GD1O 4IUCS 1W4LA 3F0TA 1E92A 1PNQA 1X8XA 2FRVA 2J67A 5AM0A 4NPHA 2FPXA 3MLBA 3AEXA 3UMJA 2IEAA 1USGA 3EBOA 4PBSA 3LXXA 4N4AA 4TLEA 1XEWY 3SD7A 3OCCA 3F6PA 4FDTA 4X9XA 2NSJA 3KQVA 4GLOA 2E4YA 4TM8A 2DC1A 5F9HA 4LHYA 3OTGA 3ELUA 3N0TA 2ACVA 3AFIA 4QOIA 2HZ7A 3V7UA 2PLWA 4GOJA 4N54A 4BFSA 1FFEA 2FPIA 4C76A 3LT4A 1ZLXA 3LNTA 3ZCPA 3JATA 4PZAA 3S55A 4UUAA 4HKTA 4DGSA 4E5PA 5AVTA 1GAXA 3M70A 2I6FA 1J2TA 1PAUA 4CCYA 4URVR 2ISSD 4Y6RA 2QRVA 2VF7A 1D2GA 1Y3HA 1C4KA 4OI0A 4FGLA 3M9WA 2RHHA 2FB9A 4MR9B 2H11A 4F5WA 4Z7NB 2H57A 3AWIA 4P0PB 3WP1B 2YRFA 5IAAA 1JPVA 1C41A 3AUTA 1TZCA 4NAUA 3RYHA 3ZOZA 1QH1A 2MYUA 4MGYR 1V4BA 1L5YA 1QO7A 2L19A 3FHOA 3STVA 1DIBA 3EXFA 2EF0A 3SSNA 1OJLA 2ECPA 3O2SB 2IC5A 1G4AE 2B7CA 2OT3B 2YHAA 4A0QA 5JCZA 1PL7A 2PT5A 2QX8A 4O8CA 3OF3A 4OH7A 4RSGA 4QKQA 3IH5A 1X9HA 3CSSA 5F98A 2BMFA 2GPJA 2QPTA 4PNHA 5HXAA 2ZYGA 3OE5A 5CHEA 3NH6A 1OTYA 2H4FA 3E23A 1Q21A 4EG0A 1PVDA 5FUXA 4RCVA 1OU4A 1VKRA 3IBGA 4ACAA 4I4IA 4KV7A 4FFMA 2X0KA 1ZJ4A 4P7FA 3LBHA 4YP6A 3VVCA 3SYNA 1P4HA 2VNJA 1WMEA 2W71A 4L2IB 3I52A 4P58A 5H16A 3SHVA 4DXAA 4ANFA 2O8EB 4URXR 4ZHQB 3R3SA 5CFOA 3A7EA 3F8WA 4Y2TA 5CA1A 4RTSA 2OO5C 3E8XA 3KD3A 1DUVG 5GM1A 1FNDA 1E4OA 5JT1A 1Q7RA 3PTLA 4B80A 1AZSC 5KB3A 5B7QA 1M2JA 3ENQA 4NZMA 1XA4A 5HTKA 5JAZA 3CZCA 5K4HA 4BXOB 4AICA 1GRVA 3SSAA 1QU3A 4P7BA 4C3UA 1F06A 2JFFA 3E9ZA 4ZTZB 3LCUA 4L73A 5CLIA 4FB5A 5JS2A 2I6XA 4TSKA 1GTSA 5JQGA 2IS2A 3B7GA 4CEHB 2PVPA 4ABYA 3AR8A 3H2KA 4NZOA 4CHTA 4E2FA 1SULA 3AL3A 1P80A 4NNPA 2I99A 2M32A 1KVSA 5HQ3B 2I5PO 1KVQA 5AWFC 3UGQA 5C7LO 3RS2A 2QS9A 2ZU6A 4ZTBA 4EUSA 5I8WA 2C2OA 2Y1EA 2HMVA 4RHYA 1RS0A 2XA9A 1N32B 3C14C 1H1TA 1ZN9A 1AMOA 1G55A 5T3UA 4AY2A 2JAPA 1RRPA 2PX4A 4ZMBA 4YDSA 3BXXA 1E9RA 1YUBA 3AZOA 2GPAA 3PQ7A 2CJXA 1NYLA 4C5BA 1CRPA 3BEOA 1JT9A 2GZHA 2OPHA 1KPIA 5IMBA 1U0FA 2ID4A 3ESAA 3WZLA 4BBZA 3ETLA 4FZ3A 4M76B 2AFHA 2V74B 3MGBA 3DDWA 5TC4A 4ZOAA 1CUJA 2GM9A 1W96A 2NVUA 3E9DA 4HLNA 3ZE0B 1XLWA 2AFRA 2HWYA 1WCXA 1ID1A 1XZHA 3HB0A 4RVUA 5J5CA 4A2QA 1GNSA 3ZKAA 3JAWB 5HCUA 1K5DA 1TQ2A 2D74A 3BAZA 1RHKA 3SM9A 2FEKA 1ZH2A 1DIRA 3ZE8A 3EVAA 4YDQA 1HBJA 1HMPA 1HZZC 1ZK4A 4CWAA 3W3ZB 4IZ6A 3BGSA 4H2DA 4IV0A 4DNQA 1ILEA 3RVBA 1JHXA 3OCWA 4MKRA 4MWSA 2VT2A 3OVMA 2W6JA 1X38A 2QKYA 3FNRA 4BV2A 3QENA 2BDUA 4Y98A 1YFZA 2QB5A 1DXOA 4KPYA 2NU9A 5FFMA 2Q0QA 5U4QA 5DXJA 2ZLBA 3HJTA 2CVQA 1LA2A 4MUNA 3RC9A 4CEHA 5BSKA 3TCNA 5F4ZA 1G20B 1S5PA 4M36A 3F6CA 2PT9A 2VNAA 4N6NA 4C04A 1X19A 2WYWA 3OX2A 3RSHA 2D0DA 5T8KA 5AOCA 1T36B 2GRAA 2QVZX 1MC4A 2K2WA 3MRSA 3PJDA 3EOBI 4XVUA 5HF8A 4C2UA 4P4GA 2XTNA 5CX1A 4OA5A 5TEWA 3AYXB 3SY8A 4NHOA 4EYEA 1EDOA 1V5IA 2QPOA 3LA8A 5TDHA 1C7IA 2PWBA 1MXFA 3AINA 3EGCA 3AR3A 1TE2A 3H5AA 2D5BA 3OD5A 4XDGA 3MBOA 3U6BA 1ZAYA 5EMKA 1PSDA 1UJ6A 1Z18A 1VZ3A 1X0XA 3QUAA 2QWXA 2ZIAA 2YV1A 4FGWA 4M8LA 4TLAA 5HCIA 3ZGXA 4UTPA 3IVMA 1OFUX 3DQPA 1YBVA 2OCYC 4EW3A 3ANSA 1J7KA 5DHAA 1VIVA 3T9DA 4DTCA 4ADSG 3D8NA 3P9IA 4QGFA 2DKFA 1KZGB 2HJVA 3HCAA 3LJKA 4RABA 1SXJA 3O2QB 3TR5A 5FUMA 1HNWB 4QE3A 1WUHS 2VRCD 2ZULA 2EERA 3K16A 4G2NA 1EYZA 3L1HA 4IV5A 1OYWA 3L4EA 4J1TC 2ECFA 3JD4A 2FRDC 2OVFA 3T7DA 3D8TA 2YQ5A 3F78A 4UM5A 3EXFB 1L8OA 2AI3A 1JJ7A 1QH8B 3L06A 5AM2A 4AZVA 1F8XA 3CKMA 4YGXB 1NBWB 1XEFA 5HRUA 1J7JA 1RWKA 1UEXC 5KNCD 1QX3A 3BJIC 1A50B 4DC9A 3O8RA 4ZKEA 2AK2A 3M3PA 2GSDA 5JBNA 2WIKA 2L17A 1HLGA 1JNXX 4Q12A 4DQLA 1FQOA 3HM2A 4IOMA 3ZHCA 1YZNA 2HDOA 4FSDA 3SYRA 3TRIA 5JUWA 2VAXA 4PNEA 2OHJA 3C8HA 1VA5A 5ALFA 2XB4A 3G8CA 4FX2A 4OSPA 4RNCA 2LNDA 1KI9A 4F4HA 5KI6A 1Y82A 5B3KA 4KMSA 4N0PA 1ADCA 2CV2A 2R85A 2VBIA 2R8XA 3TPFA 3AR2A 4WGGA 2G1UA 3C8ZA 3OX1A 4M98A 4G2TA 1N5KA 1T6NA 2FVYA 2OZPA 5FPSA 4L95C 2P91A 1NMXA 1GPJA 3SX2A 5MFZA 4MV3A 1YTUA 1PP4A 3O95A 2VDPB 3ZVRA 2E55A 3B3FA 4X1IA 4RFLA 3UOWA 1ZI8A 2P9TA 2ZWAA 1CY7A 4TMFA 2X8JB 4KH1A 3P9SA 1QTQA 2HA5A 2WF8A 1WMBA 2JFNA 4NJOA 1BWQA 4F46A 2C2MA 2DCUA 4OJYA 3WC4A 3LD9A 4CG1A 4P3XA 5AKXA 4DQ0A 5G1OA 2XNKA 1SBHA 3U7JA 1U3FA 5KMGB 2DLCX 4GYWA 1GCAA 3SFZA 2HMWA 1KBOA 4WQMA 1DG3A 4RV9A 3EFOB 3FPLA 1TZJA 1UBMS 1JHZA 2X5KO 4MPRA 5P21A 3UKDA 5JSHA 4UUPA 1NHWA 3S44A 2CE2X 1H42A 3C16C 3I4LA 2LRHA 3JXEA 5IULC 2FSVC 1XP5A 2XVYA 4J76A 1N7IA 1WPQA 2GF0A 3VH2A 2IYXA 2I1VB 2Q3BA 4MJXA 1WL8A 4MPJA 3SC6A 1IBKB 4IVNA 3A6LA 1E1MA 2AFIE 2UVQA 4II7A 4L8YA 4IJWA 2QX6A 3EEIA 2VSXA 3OLWA 4ISCA 2GXSA 2XYGA 2FEMA 3AHCA 3KZKA 1K8QA 4U7HA 3GK3A 4MJLA 1E4EA 4MEJA 1X14A 4TTPA 4YRRA 4DW8A 4W5JA 2EU8A 1CVIA 4MCIA 1PYOA 4RVCA 4TV8F 4CPDA 4HYQA 1XZGA 2WJ3A 4A7PA 4M1ZA 5KTSA 1GAJA 2HOQA 3E82A 4F8EA 1QGED 3G2IA 1LVHA 4DHWA 4P4UA 3NLLA 5CB4A 2EJCA 1W48A 4G0XA 3TTXA 1CZKA 3GNSA 3N5CA 1DWPA 2CKMA 3JZIA 1A9XA 1BXRA 3ILYA 1WV1A 4BAZA 3UJ8A 1RRKA 4MRVA 3TAHA 3I01M 3UPTA 5CFNA 4Q9HA 1RRMA 4DMGA 1OSNA 4IR7A 5IAOA 1IB6A 4UMVA 5HKBA 4YPFA 2NO9A 2W22A 4RVDA 3SZUA 4BCBA 2BR4A 3AUFA 5EIOA 3NYWA 1QYXA 3F1KA 3GQVA 4YJGB 3PCRB 3SS8A 2IDZA 2DQKA 2XOKA 1KKMA 1RWXA 4PYNA 2CD7A 2ODTX 1NE2A 2CXHA 2XB6A 2CSUA 4J1QA 3HU2A 3BF8A 1WQ4A 1NXPA 3OEHA 2A0WA 4JLJA 4WZBA 4F6LA 2I7VA 1TT5A 2KJQA 1MJGM 2NAFA 2BM0A 4UE3S 5CVCA 1CY4A 1I30A 1MPTA 3H0EA 1YZLA 3VZPA 4G8BA 4CM9A 3AP2A 3FETA 3QEKA 5A4JA 5JRJA 2XRZA 3T15A 1EGHA 3DVSX 3EFHA 3SU8A 1HM5A 3DHEA 3WE7A 1PDVA 4OAQA 2R0QC 4DF3A 3V34A 4XVCA 2PZAA 1H6BA 1SVLA 2FLWA 2JFUA 1AQLA 3DM5A 2I4IA 4P83A 4FGUA 2JLSA 2KLHA 4C7OB 2GPNA 4TMWA 4LRXA 3JD1A 4EOGA 4CFSA 2G5TA 4DM3A 1YU9A 1I3OA 3UF0A 1A9RA 4KCGA 3QJ5A 2OXTA 1IK6A 2WTNA 3MTJA 4FJ2A 4QFCA 5DI3A 2VLBA 5AUNB 5FOXA 4CE6A 1J6UA 4GOKA 2I8LA 4MAFA 5HPYB 3HFSA 5JATA 4Y0VA 4WZAA 3TZEA 1PKEA 5KYYA 5KTKA 4YBRA 4QU8A 4ZMRA 3D4IA 1RLIA 4XCQA 3AFGA 1IU9A 4DVGA 3FOCA 3DMTA 4S0XA 4UVHA 2GVZC 1E7YA 2OSBA 5TSDA 3EIEA 2J9FA 2NACA 4BQOA 5BN3A 1FRFS 2V7GA 1XWIA 2ZBFA 4I2NA 4WZAE 3ZVLA 2F1HA 4XGNA 4BO1A 5BWLA 4ZT4A 4DKXA 2QD2A 5EPUA 3RVMA 1JHYA 4NDZA 5H80A 5TPZD 1X80A 4G0WA 4Q4AB 1XDWA 1UJ5A 1Z3CA 2DUMA 1Z62A 4C4ZA 4UMFA 2G9UA 2ZQYA 3TH5A 4C06A 4YAWA 4KN8A 4C2BA 2F90A 4XYBA 1ZC3A 2ANCA 2WPDA 1O9HA 2XTJA 3BZBA 1AG9A 2G06A 3OOSA 3PX3A 4HB3A 5AM4A 3ZK7A 1AF7A 1ONBA 2R1ZA 3SGLA 1XZBA 1WCIA 3PGA1 3IE2A 2VEOA 1Y8AA 4UNSA 1JHMA 1UFVA 2APJA 4MYTA 4QL3A 4LXHA 3LQFA 4U2DA 3W5DA 1YMVA 4P3PA 1LSOA 1TXGA 4TLLB 5GM2A 5TGZA 3UYLA 5K0NA 1QNLA 2FQQA 3RS7A 3GCGA 1DEOA 2VAWA 2VVTA 2FPUA 4GI2A 5AHWA 3WNBA 4YAKA 2E0IA 2V6MA 2Q5OA 5FOWA 5K4GA 2XXAB 4BIMA 2XW6A 3HRHA 4ME6A 1HGXA 4PYOA 4C6TB 3FLEA 5FJIA 1P1JA 3TBFA 3QLUA 2DPMA 2AV6A 2FW0A 2WK1A 4C7XA 2RONA 5I7OA 1BRMA 1XCOA 1G1AA 2ZR0A 3V1TC 4LZPA 4HFRA 4KXNA 1PQYA 4GOOD 4PQYA 4CQMB 4UHBA 2BEVB 2QAGB 3FPAA 5J2TA 2CBZA 3F5QA 1VE5A 1F20A 3OPYB 4GU5A 4H3SA 4MVYA 3JAMA 5K2OA 4DMRA 4RHEA 3L7LA 4X6LA 1MG0A 1DS6A 2E4ZA 2H9AA 3IBFA 3TUIC 4EFLA 1MEJA 1PJSA 4H0NA 5B12A 3IPRA 1NA5A 3B9RA 4GOLD 2YW9A 5BSVA 2QM0A 3FCYA 1AHIA 2AOTB 3LYHA 3MELA 2X8AA 3N2LA 1M2GA 3NATA 4G0PA 4YAJA 5BSMA 3W90A 4AJLA 3QBTA 3UANA 3O8LA 4BMZA 1TLLA 2OFXA 3OUZA 1VJ0A 2WUGA 1KJ8A 5DN9A 4FE3A 4QDZA 5FPHA 4TKLA 1PJBA 4M1QA 4PG7A 1R9JA 5KX5B 2DUJA 1I36A 1VXRA 4Y6LA 1JIJA 4RIFA 4TWZA 5DP1A 3ZKWA 4BLPA 3EFBA 3HCNA 3QKTA 2YZ2A 2Z57A 3JQEA 4EKGA 1IN7A 1QHHA 1L4FA 2PRZA 3BREA 1QP7A 1SVMA 1H3FA 3N58A 3EWIA 4KTVE 4YDHB 2VL7A 4ZT5A 1T0JB 1O89A 2CF6A 2ZI5A 3C3AA 2BRUA 4I9FA 5HKOA 4J1SA 3W06A 2W2NA 4G5GA 1IWBB 1UKEA 2J48A 2EIXA 1KI1A 1PLKA 2I6TA 4OB6A 4FD3A 1PL8A 5LQSA 5LXTF 3BIWA 3OF2A 3OZFA 2EGGA 4PWZA 2IV7A 1ZM9A 5K0SA 5CT4A 3LFTA 3ZJUA 2G36A 2RG7A 1RLMA 3QFCA 3RKSA 4WJKB 1KA9H 1OAKA 4DLNA 5L3QA 1EFKA 2WMOB 1IB0A 2P9BA 2QLLA 3LZCA 5E3JA 4UCFA 1U11A 5HS4A 2B69A 2Q5IA 2IL1A 4CT4B 3T5BA 4QM7A 4OHPA 4QOSA 2I6UA 5EJ2A 4P4TA 4NFHA 1C1XB 4V2UA 3ZUPA 1S2MA 1E60A 5H0IA 4R0MA 2YXNA 4HEA1 1NJGA 4B4WA 1PNVA 5K8TA 4P08A 2WFAA 4L6CA 1AMNA 4KYIB 4RXTA 4L22A 3EXEA 1ISMA 4U9IS 1KIFA 4U6NA 1B3RA 1DQPA 2YHUA 1CR6A 3KCNA 1JW9B 4FDUA 4FYHA 2LDXA 1MENA 3HYTA 3GRYA 3GCWA 5LMUB 3KXIA 4MV7A 4XWGA 2BGGA 2ZJ0A 2Q1WA 1QYWA 1ZUNA 3H87A 1D4FA 4CLEA 1Y1KE 4OJQA 2R11A 4IGEA 3SAJA 5KWIA 2EL7A 2CXXA 2GZ2A 2P6NA 3D8RA 3CLVA 3IO5A 4DMFA 4I9HA 1XCJA 5JISA 2NV0A 3DVLA 4LTMA 3L4BA 4GQBA 1Q0UA 1A5AB 1SMKA 1RQ7A 4NC9A 4BQEA 2A3RA 4G36A 4ND6A 2B34A 3CY6A 3NMUF 1VJ5A 3HJGA 1OYVA 2Y1KA 3MS7A 3HI4A 1C9KA 3R6DA 1DINA 3TRKA 4E7OA 5ADWA 3FB1A 4H0CA 4HGRA 3U4AA 4CNBA 1XZAA 1SZDA 3T7CA 3NC0C 1GP2A 2R65A 1Z2AA 4C1NA 3L6EA 1J8YF 2FWMX 4HMQA 1GRQA 1U98A 2CYCA 2IGTA 2OOSA 1B0ZA 1PZXA 4XM1A 1JP7A 4HNAB 4DQKA 3HY4A 4OKIA 5I7RA 3SQWA 1ECLA 1YZYA 4RV4A 4JBHA 3VUFA 2GVDC 3RRJA 4RDHA 3X3HA 1LU9A 4YIHA 2HIGA 1Y80A 4Z0NA 4I50A 1ISIA 1NLYA 2DE0X 3ECCA 4ARUA 3OKPA 5BT8A 1EBUA 3FG9A 1WWKA 3PG5A 2WOOA 5D85A 4EY8A 3ZWPA 4QXRA 5JJ5A 3MS4A 4XIFA 1IRXA 1VHLA 1Z7GA 5SYAA 3H0CA 1WR8A 1XDBA 1ZVJA 1DI0A 3W7VA 3QE0A 4KUHA 5K05A 3NHSA 4IZOA 3AHEA 3HSKA 3T4PA 3IMGA 3KTOA 3EUFA 1Y6JA 1B43A 1XMIA 2B25A 4PHHA 5A4MS 5KQLA 1KC1A 4JQOA 3NIDB 2WP8J 2EQ5A 4V24A 4KGXA 4DMCA 4QG3A 1IAVA 4GGMX 3ZV7A 3RV3A 3L01A 5JMPA 2BE7A 4II2A 4Y3UA 3TOSA 3HJHA 4C6TA 4QZVA 2BTQA 2JS7A 3N2GB 4FGJA 4S2UA 4BFXA 1SY7A 5KOJB 2BGIA 3RSSA 1LNZA 4IIBA 5ALZA 4FQ7A 5M04A 4HTAA 4TV8A 3TD6A 2DBRA 1M5TA 1XQ9A 1J21A 1YQXA 1CF9A 2AFHB 2DU8A 2HK7A 3A4IA 4JJAA 4KXUA 4Y2JA 3TVYA 4C6SA 4M46A 1I6LA 3UJNA 3ZG6A 1HX7A 4EF5A 1E7RA 2NZVG 3AHIA 3RSLA 4WA8A 3E05A 1GTG1 5ES3A 4EA7A 2J5XA 3F2VA 4NAVA 4YASA 5K6AA 5HYVA 1RJ9A 1ZD1A 1RXWA 1XZFA 3OQIB 2P5YA 3H9QA 2NZYA 4KLNA 1MG5A 4QYIB 4YLYA 1E3MA 1VBKA 1KMHB 1PLLA 1OIXA 2JFPA 3OICA 2Q4DA 1Q91A 4E4RA 4KAFA 4A6XA 3N8NA 4IBOA 1RIIA 3C5HA 4JOCA 4I46A 5HQ3A 2VSNA 1CZHA 3L9WA 2X22A 4F60A 1IHUA 2A9OA 3G1UA 3OMLA 1Q92A 1UC9A 2JD2A 1GNRA 1I80A 2H1VA 3UMYA 4X20A 2COEA 4K87A 4PLVA 2YC4C 2AJDA 3GHYA 4DPLA 3HDHA 4BV3A 2HGSA 3OEWA 3I6YA 4CQLA 5UKDA 3I9V1 4PPYA 3Q88A 5IDQA 4OYHA 4M87A 3BB3A 4AJHA 3UW3A 2YXEA 2GEKA 1PJAA 3LQQA 1MAWA 4HDCA 2R1UA 1EQ2A 1OJ7A 2Q9UA 3GA0A 3QE3A 4GECA 4M2LA 3WRYC 4HNRA 1R6TA 3B13B 4XR9A 4JC5A 1DIGA 4Q1CA 4N48A 1X8LA 1XHEA 1X7DA 4KMRA 3VH3A 3WNCA 2QRLA 5ADUS 1UP7A 3B7PA 1KMMA 1HEIA 1P2UA 1XQWA 5CH5A 1GKUB 3OT1A 3VVBA 1XKLA 3DLBA 3QFTA 5T4FA 1AQ6A 4G26A 3OPXA 1ZMRA 1PFWA 3EDOA 3ETJA 2CLEB 4IJVA 3SF8A 4LJSA 2JBAA 1UC8A 5TVGA 4IMPA 1L3IA 4N6OA 4K9KA 3EEYA 3HVJA 3R09A 1JWAB 3RRZA 2IKSA 3LPDA 4KE7A 3HA7A 4FYVA 3FBTA 4PLHA 5EYPB 3UOGA 2P6MA 5CFLA 5B6JA 5HJEA 1NBAA 2WUFA 1V1JA 1EJ0A 4HRAA 4ZAZA 4ZI7B 4JV5B 1JR6A 2C2HA 4C20A 3NHFA 3V2UA 5JNWA 4EATA 1UK9A 3T0FA 4E22A 4LK3A 1U5BB 2FK8A 2Y0PA 1NBEA 4P3NA 4BU1A 2DBYA 4OMDA 2R8YA 4YJGA 2NTYC 2NYVA 2JARA 4F7DA 5F9FA 2X1VA 3QW2A 3A06A 2CHEA 2D1FA 1H9CA 1H0RA 4P38A 3MCTA 3N8DA 1Q95A 5ARCA 1HPLA 1CZRA 1E77A 1NXVA 3EGWA 1Z38A 4JXJA 4NBUA 2GLXA 1INLA 1CS0A 1UANA 1RQXA 4EYGA 2GH1A 3COJA 4UARA 5CT5A 2C9DA 3VSBA 1PS8A 1XVIA 2RHJA 1E1RA 2WHPB 1DADA 4JJ4A 4DWVA 3MTEA 4K6GA 2Y9MB 2PJZA 1JLHA 1MFZA 3TFWA 4ZDJA 1NXXA 1Q77A 4G0VA 4Z3OA 1N5OX 1M2EA 1U2TA 3RPEA 4AFNA 5KQSA 3HXMA 1TM5E 2X7HA 3LDUA 3MTBA 3PUZA 2F59A 4M6WB 3WL3A 3RWMB 5I9IA 1LX7A 2I3DA 3LL7A 4LDQA 2UUOA 2MR6A 4C1BA 3OCZA 1NVVR 1QRUA 4TZ0A 3LAWA 3BVPA 1W19A 3SHOA 1SUCA 4CDNA 2KI5A 2YWGA 4K2AA 1GFSA 1SG6A 2FXVA 3GGCA 3OX3A 1T3ZA 3TG8A 1HF3A 1VG0B 3M6VA 4ZO8A 2ISQA 4K40A 5F3DA 5FXMA 2GCOB 2RMKA 3H84A 2QGNA 4CEJB 4CN9A 3AGPA 3MXTA 4OKNA 4OHMA 1SD5A 1UWKA 5AJXA 2CDAA 2D4AA 1EVYA 2VRBA 2YJZA 1QF6A 4RPLA 3K72B 3V3TA 3UC9A 3IPCA 5ERGB 5HIIA 1U2DC 3WI7A 4ETWA 3GLFB 2PLFA 4NDNE 3FGOA 3IQFA 5CAEB 1OIWA 3IAHA 1RR6A 3IP9A 3K9CA 3ULKA 3AB7A 2GK6A 2QUBA 2O8VA 1AQUA 1U9YA 5C46F 3TJMA 1A8PA 3TL2A 2NT4A 1BVUA 3ZDRA 5KNCH 3QVTA 3HM9A 3FKSA 3K0SA 4GI7A 2YASA 3D7KA 3F46A 1ISHA 2IHBA 3JALA 3MAJA 5MN4A 5I9MA 1CZUA 2Y6UA 3NI2A 4AX8A 1K8RA 2HRDA 1FFDA 4JSTA 5C8YF 2P0EA 3TS1A 4TRNA 3EN0A 4GWLA 4RIEA 3TOXA 4MWBA 4NCXA 2QHXA 4P22A 4OHYA 3DO8A 4XDZA 4LZNA 1AQYA 1G3IA 3OAAD 1VL8A 5GQSA 4D9GA 2UZ3A 4HYYA 2CMDA 3GLRA 3ZQ4A 4D79A 5H7XA 4R2XA 1S3SA 3B60A 5DGIA 4HNTA 1HRDA 3ISTA 4O3FA 4JCOA 3EHEA 4NOKA 4WLEA 1A4XA 2WSLA 2ONYA 3SEQA 1L0BA 1EINA 2QG6A 2RJOA 5FLEX 3EY4A 3EMBA 1LBSA 4ZYYA 2YV4A 1XK6A 2QSJA 3HEAA 5FWAA 3T1VA 5D5QA 4EMBA 4OHKA 1IVNA 1P5JA 1EXWA 2CYBA 4Q9DA 1MTOA 3PNYA 2JC3A 4URYR 5AK5A 3ZU3A 1Q0TA 1EX9A 9LDTA 5T4HA 2CLCX 1MO3A 2Q1YA 4FD2A 4R40A 1OBFO 4DQDA 2R8OA 4L7QA 4UD6A 1N25A 3BILA 3TNYA 4YQZA 2CJWB 3D4BA 4UHJA 2FW6A 1XTPA 2EFCB 3S2FA 4MTLA 1RAIA 4L5JA 5BV2P 1H2AS 1DLIA 1JAYA 1EM8B 1P81A 2W6IA 3EODA 4HXFB 4MVJE 4PICA 4BVJA 4RTOA 4KH0A 3FAKA 3ZCVA 1RJGA 5K3SA 3D6TB 3L1KA 4CRWB 4N5MA 4UD2A 3T61A 2IX3A 1VA4A 4WADA 3B3GA 3R24A 1I32A 1SVIA 2F8LA 4B09A 3Q3GE 4A8TA 2DFLA 2QE7A 4YA6A 5CNKA 4A91A 3L8FA 2C00A 2OAEA 1JVNA 2P1RA 1KI6B 1WBDA 2EJTA 2XVZA 3MINA 1SH7A 5JCOA 3KAQA 3ZDAA 2SICE 2BFCA 4PBRA 3A9UA 3SZ3A 2OZVA 4MA5A 3U4QA 2G67A 4GKBA 1ZA1A 3OBBA 4GR4A 1T5DX 3U9TA 3MOSA 3M6MD 1EPUA 5JQGB 2IPNA 4AW9A 4MI3A 3O91A 2ZRGA 1YL7A 3NVAA 5KX5F 1U0BB 4FGZA 2WF6A 4UBIA 2P6PA 2WWWA 3EGXA 3LX8A 2V8BA 1FQWA 4DQXA 1IHDA 4EPWA 1LBTA 3D5EA 4X3OA 4D41A 3LY5A 4N9QA 3RODA 1CUAA 2QT9A 5AP9A 2FI1A 1KU6A 3EF3A 5HHTA 3ZI0A 3BYZA 3KQKA 5ALQA 5IABA 2E85A 5E1OA 1VCNA 2FDXA 2ZSKA 4GGPA 3BDAA 3KEFA 3EIUA 3TSAA 3W4IA 4P36A 1E2DA 1YQDA 3RYCA 3PQCA 2E1RA 1ZIXA 2O06A 1G21E 3E9NA 3OLCX 2DAPA 4KQ9A 4ECEA 5A2QA 2X0EA 5EP4A 1YGPA 1Q1AA 3NGMA 2OV1A 3OF5A 4Y2RA 5D2CA 3PPVA 1YDGA 5BW8A 5I4CA 2Y1OA 2V7BA 4TT8A 3FWKA 2ZJFA 2HW8A 2Q3DA 4NRDA 2OP1A 5DGCA 4OJNA 3A1UA 1V16A 1N3BA 1P7WA 3VMFA 4IUBS 1WDLA 3ICWA 1O03A 1TCUA 3OJWA 1Q0LA 4UBJA 4UDYX 3DCYA 3E4CA 4AS3A 4BMOB 1L7PA 3B12A 3B8EA 4AB1A 1E6MA 2YC2C 4GR5A 4LJ4A 3Q7EA 3UG6A 4V0OA 4DLZA 4MA4A 4X5OA 1CIPA 1TAGA 3GFVA 5I7HA 3QKSA 2VHVA 1F8GA 2H65A 2O23A 1BROA 2VSQA 4F2DA 5JU6A 1XBTA 2GN0A 2IYSA 4PLPA 1MRNA 4YMIA 3ONDA 4H6PA 1GM5A 1GL7A 2C4HA 3NXSA 2SCUB 3PC8A 1CRLA 4RD4A 4YREA 3V4SA 4DBLC 1Y5NA 3TMYA 3PDWA 2I9PA 1CDOA 2FHPA 3LCJA 1RRCA 5J2TB 5JNRA 2ZWMA 1TU4A 1TUBB 2D0OB 4PG4A 4D4GA 5ALNA 5F2KA 5CYOA 3W78A 2ZYVX 4QJBA 1E3EA 1LPOA 4JMPA 1D9ZA 4O2LA 1GZHB 1JLMA 1SUAA 3MQ2A 2FLVA 1PLJA 2RBKA 4PHGA 4R9VA 4B35A 4A26A 1KMIY 2CE7A 2XNSA 4BFTA 2R6HA 1CRQA 2IYAA 3RNLA 1EQAA 1UAAA 3OWXA 4EF4A 2QN7A 4OHBA 2D7CA 1Z0SA 3IFSA 5FI1B 4LY0A 4NFLA 4MVJI 1TO1E 3E2IA 2QG9A 1HDZA 4R54A 2Y2VA 4JBXA 5FQOA 4FONA 5CBPA 2Q6TA 1VRWA 2ODBA 2VHEA 2Q50A 2ZRQA 3E1KA 3E8MA 4GEGA 3KJZA 2HPAA 3R3VA 3DE5X 4UKDA 1IHOA 3EARA 2BAGA 5DULA 3QELB 2JD1A 5KSWB 1XTUA 4PSAA 4OYLA 3P2JA 3PB3A 1W88A 4RD3A 2P4HX 4KQ2A 4Q66C 3SOPA 5FLYA 5JJIA 4YI3A 4CKXA 4ROSA 2JIOA 3LUDA 3EF1A 4WN9A 1VQ1A 2YMQA 2NQTA 1Z2CA 2QAGC 1O0BA 4DB2A 5EN4A 2P2LA 1WHTB 4YJ3B 3RU7A 4JYAB 1A4IA 1MO4A 1XTVA 2AN3A 4QJIA 2H7YA 3KALA 4DM7A 3K0AB 1DTWB 2BEWA 4HDKA 4YI5A 4WDRA 3O47A 1H1LA 3DP7A 1XMPA 5IBRA 1VJDA 1NY5A 2D1QA 1XJ5A 5FWXB 2A5LA 2NIPA 5IMSA 2C54A 5E7MA 4BKUA 3THWA 2PMDA 2CNLA 4DIDA 1AUOA 1M74A 1S8NA 1T4BA 4O2AA 2POQX 5BSTA 3K5IA 1WZNA 5LDHA 1ZWLA 4XQEA 4QAQA 4XSGA 3WV4A 1WSDA 3ICOA 4PX2A 3RRXA 2ZT7A 1UWLA 4NEGA 3C3WA 1JG6A 1WB4A 3IR6A 3HVHA 1Y5RA 1GTVA 4NCJA 4P32A 1RZRA 1IL0A 1Y63A 4R98A 2VBFA 2QV0A 3AGQA 3QF7A 3H8VA 1TVKA 3UHFA 2H1SA 4H1VA 3VH1A 4DQUA 3IP5A 2OTCA 1LW7A 3I9V6 2HK8A 4C43A 1IEVA 4KI7A 2HUPA 3FYHA 2X0FA 3CLSC 2JHGA 3DDOA 3HJAA 3SS9X 3WSWA 5AM3A 1FLVA 3GFRA 1JQEA 3H6KA 3D1JA 1TQHA 4MGHA 4B7UA 4LXTA 2YBDA 3KZXA 1K3FA 3K4QA 1KEVA 1E2FA 4POOA 4C0BA 4M1OA 3KQHA 1UBJS 1DUIA 1XRSB 4QYWA 2UUAB 2QLBA 2OESA 2QW0X 3TKYA 5TQ2B 2EW8A 3L7KA 2C0QA 4PZYA 1UJNA 1L4GA 4UHFA 3R9WA 4FHCA 2WTEA 4M0FA 1GAWA 3KAJA 2VJNA 1I4OA 1TUGA 1YT5A 3UFXB 3GBSA 3O8OA 4X60A 2IYWA 3EOAI 4MO2A 5ULLA 1HLDA 3ON5A 4MR8A 3H9BA 4JQYA 3T9FA 1ODLA 2R86A 3R7WA 1RQ2A 2WF7A 4WE3A 1YDMA 5EHIA 1Y1LA 3V8EA 5BNWA 2QLFA 3JQGB 3LFUA 4N82A 1KARA 1ZKDA 5GJCA 1XLUA 1I6MA 2MHCA 2VUUA 2QW8A 1DBIA 2G88A 4PLGA 2OHXA 3Q7TA 2JH9A 3L02A 4UEOA 4ZJZA 2A1TS 3H5NA 1WDKA 4HGPA 1VCIA 4IOKA 2E89A 2IW1A 3LC1O 4DEVA 1W9HA 3L6DA 4ZRNA 4B1FA 2HN9A 3ZCQA 1KKUA 1XFAA 2AMLA 4TS9A 4Z0HO 1NUAA 1U94A 3R6WA 4FCTA 5G0SA 1XDUA 3W1EA 2PVSA 2NUAA 4BRUA 1BWSA 5C1BA 2PGJA 1SKAA 5TQVA 4XIJA 2B7BA 3TZKA 1J0EA 2HJHA 2H2GA 4JDPA 4R68A 3EW9A 3UJCA 4FTWA 3HPRA 4Q9NA 1RACA 1W52X 5I7FA 3ZCSA 1XRLA 4IHQA 3W04A 1EE1A 1U0LA 4TUYF 2L69A 5HNKA 1A4RA 4O25A 1VHJA 2BGUA 1R4MA 3FCUB 1YS6A 1CEXA 1DKUA 2EP5A 4ZZIA 4GR9A 1U8UA 1JGTA 1KYWA 2B5OA 4WBNB 5MDHA 4RKRA 4I66A 4LMAA 4Z53A 4GL4A 1TX4B 3S28A 5CXQA 2RFLA 1G2IA 1P7CA 1UZUA 2PO5A 2ANBA 3JW8A 3WOVA 4C7OA 1JEYB 5JH7A 4LOAA 2R8RA 1AKRA 4MWZA 1UZLA 3KUCA 1MAVA 3V97A 1VFNA 2IYLD 1CY1A 3SC2A 5ALEA 3U5ZB 2K2QB 2OV6A 1TU0A 5A5VA 1WCYA 3N70A 1FX0B 1UINA 2DY1A 3AK4A 3DJFA 4K3VA 1HLFA 4CDMA 3R0JA 3BZUA 5BURA 3RS9A 2BP7A 3ZQ6A 5EJ6A 2IHVA 2DGDA 4DC1A 3G0HA 4KWCA 5BW6B 2YINC 1NVAA 1JDUA 4A3SA 5FV7A 1M75A 3U44B 1HDCA 1W88B 5JZMA 2O4UX 2AG1A 3MZ0A 4A92A 2OV3A 1V8DA 4R69A 4EPYA 3DWGA 2WAXA 3GFGA 1NQUA 2QVCA 4RK1A 4MRSA 4QJ5A 1JPUA 4C07A 3H5OA 5JH7B 4EW2A 3H1FA 1XVTA 3K6KA 1MBZA 4JJGA 1P4AA 4GMXA 5BXQC 5IXJA 2CXNA 3ABZA 3HMQA 5ESRA 2KQUA 1AURA 1PFUA 1FFXB 5BOSB 1TTTA 5IT5A 3O4VA 1I2MA 5CFRA 2C58A 2C9ZA 2J5BA 2P11A 1AXGA 3E7FA 2FQ1A 3FD8A 3QYAA 1XCBA 3ZGOA 4DBZA 3PQDA 2J9RA 2HU5A 3PDUA 2J5QA 4O4JF 4Q93A 4MV0A 3WL7A 1F7VA 3UV7A 1ZL2A 1QO9A 1R6UA 1QFSA 2AFIB 2ZJOA 3AF1A 5HGXA 1FYXA 4Z3KA 1SKYE 4GXQA 4UBNA 3I9KA 5C53B 1NF3A 4DCMA 3S2ZA 1ZEMA 3FYCA 3FOBA 1S2OA 1VP9A 1YAJA 1SRQA 2VYQA 3PQ8A 2FMHA 3T7JA 4HGNA 5ALSA 4Z4FA 2IITA 4NENB 4XD2A 4NJMA 3L4KA 3I2JA 3DULA 3D2AA 4YLEA 2RDMA 4L8GA 4KYTA 1B8VA 3ZE7A 3N8HA 4TVBA 1FP6A 1XZJA 2BKAA 1R8YA 3NDIA 1QIFA 4V0ME 4RULA 1OE0A 4PNPA 1TFRA 2WYUA 1NZFA 5DLEA 3ZZNA 1OX4A 3DAFA 2FFAA 2JFQA 1T34A 4IIDA 5IZCA 3MGCA 1CUIA 3F7TA 1U3CA 3RS4A 1DFGA 3ORRA 3PDCA 2VK8A 4RZXA 5KQPA 2WV9A 1E5TA 3NTXA 5BYKA 4BMSA 2DWOA 5CG1A 4RKEA 3V8MA 1FLDA 3K0CA 5DYGA 3FR7A 2IU3A 4JLOA 2HA4A 2HJRA 3SMQA 1O08A 3IQEA 2C3MA 5ECYA 4DJAA 1MIOA 3MTIA 2E1PA 3IO3A 4OHCA 2FMTA 1LBHA 1ZA2A 1VMKA 4IDDA 2QJRA 4MWCA 1C3OB 3E3OA 5COBA 3DOCA 1Z4PX 4GM1A 4QBIA 3BWBA 4EHKA 3QI7A 5IJZA 4JA0A 3ICQB 5IBQA 3PNKA 4FDMA 2GD6A 1SC4A 2O54A 2ZXUA 1MAAA 1WP4A 3N1UA 3CR7A 5DYTA 1WQ3A 1R6BX 1ZMBA 2ZAIA 5C81A 2VCEA 1NVGA 3GQBB 4XLLA 1O6GA 2W6MA 4M9XA 1TJ5A 4DCPA 4RZIA 5JD6A 1R0KA 2QI9F 5EZ6B 1K8ZB 2BEVA 2FG5A 3CB4A 4NV3A 4FFRA 1GGKA 1E20A 3K1AA 1UM9B 4K6CA 1YUMA 5ICCA 3BJRA 2B9EA 2ZYSA 3O1IC 4JEMA 3WYEA 4UE2A