3GVCA

Crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
245
Chain Sequence
LAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAALW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable short-chain type dehydrogenase/reductase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 89
structure length 245
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gvcA00
5GZ1A 3G1TA 1LDGA 1QYCA 4CMHA 4PG5A 1Y7TA 2EF1A 3K73O 1QR6A 3I4CA 1WAMA 1H0KA 2Q49A 1TLTA 2WEKA 1YVEI 4HUJA 2BGMA 4PGFA 3U0BA 3VDQA 3QWBA 2ZQYA 3K2BA 1TVEA 4CLEA 3PJEA 4O63O 4TRRA 3WGYA 4UVHA 3VPHA 4J2OA 1A72A 1V35A 5JPIA 2ET6A 2ZIZA 5IFLA 4FCCA 3UXYA 4IINA 1I32A 4R9RA 3NX4A 3INRA 3PWKA 3C1TA 2JHFA 1V3VA 1PGOA 1SOVA 2ZB7A 4XA8A 2ZJ1A 2EHDA 3ETEA 5C7IO 5C3MA 2CDAA 1I3LA 5G4KA 4PG8A 4XD2A 3F9IA 1X1EA 3DQPA 5G0VA 4A73A 4BO8A 4DTIA 5LDHA 2HDHA 3JD2A 2ZYAA 3A06A 4ROSA 4P8RA 3KYDB 1YDEA 2YDXA 4K28A 2I76A 4GQAA 3KETA 4DXHA 5DF1A 1RPNA 3RKUA 1HRDA 4W82A 2OGUA 2D5AA 1UXIA 1T1SA 4OH1A 3CINA 3KSUA 4GVXA 3EMKA 3G79A 5BR7A 3TJRA 1XWFA 1RKXA 3GMDA 1WZEA 3ZV3A 1OFGA 1ZH8A 1YBAA 2PFGA 1PZHA 3F5SA 4XR9A 2XAAA 1U9JA 3EVNA 1DHTA 2V6BA 4MO2A 1GQQA 4D3DA 5JFOA 5U1PA 1HDGO 1TT7A 3PHIA 4CV2A 1JTVA 2NLOA 2CZCA 1H6AA 2VYVD 1T2EA 3WWYA 3OFSA 1OI7A 3I9NA 5CPBA 1P44A 1DDOA 3WJAA 3WJ7A 1DAOA 1SC6A 5A3VA 1QG6A 8LDHA 3EVTA 2NQ8A 3DWFA 3PHLA 1PSDA 5JDIA 3GZ4A 1E7QA 2X22A 4XGNA 1YJ8A 3C1AA 1P1FA 1IYZA 1R12A 1U2DA 3O26A 4ND5A 3OICA 3NGXA 3TL3A 5IZCC 3ZGYA 3WS7A 3GHYA 4TZTA 1Y8QB 3LVFO 1DO8A 4GX0A 4BNHA 1QYWA 1CQIA 1O94A 2JD2A 2Q1SA 3UOGA 5EJ2A 1AHIA 2BH9A 4OXKA 5JBIA 4L9RA 4WCFB 5A5FA 3Q9UA 2B69A 4E2WA 5KNLA 1U3UA 1PL7A 5TLSA 1CQJA 2HKIA 4AJNA 1UXHA 1NQAO 4E5KA 1J4AA 3HFGA 4MVJI 5JCXA 4E33A 1A7AA 1GZ4A 3OIDA 5DCUA 4CR7A 4HFMA 2I67A 3IC5A 2P5UA 2HMVA 1R4MB 4LCEA 4OXYA 3MOGA 4IDGA 5EPOA 2O3RA 3Q0EA 4D79A 2C2XA 1U7TA 1PGJA 1LSJA 3Q1LA 3SEFA 1VKNA 3L6EA 2VWGA 2DUWA 2JL1A 1X7HA 2PY6A 1P0FA 1ZEMA 2P5YA 5GZ3A 3OBBA 3UH1A 4N7RA 2Y1OA 1XLTA 1RM4A 2CVQA 1P0CA 2HUNA 2ZK7A 4M89A 5AQ1A 1JWBB 2CDBA 4EITA 1P1RA 1ZK0A 3I9OA 5CDGA 1ISMA 3R6DA 1C3VA 4PLVA 1PZGA 1XU7A 1ISJA 3WICA 1DPGA 4XR4A 5COAA 3ZHBA 3BA1A 2A4KA 1GV0A 2JFHA 3AW9A 1DIHA 4IDAA 1X15A 4XX0A 2EGHA 3F1KA 4PZCA 4CMJA 2VYND 3PI7A 4WLEA 5DBIA 1MXHA 2Y68A 3S2IA 3Q3CA 1A4IA 3FR7A 3L6DA 5JDIC 1SMKA 1XEAA 1GV1A 2BKAA 1ZVMA 2BF7A 4J7XA 4L75A 1CETA 4I9UA 2BGLA 5JC1A 1PZFA 2AE2A 1C14A 2CY0A 2V6MA 1VE9A 4QSMA 1I5RA 2H9IA 2FPPA 4U0JA 4IY1A 2EG9A 3FNFA 5IXSA 5KJ6A 3H4VA 2PKRA 4U5QA 2GZ1A 5A9RA 2QHXA 2PD6A 3G17A 1MG5A 2O23A 3RAJA 3GVHA 4IJKA 1VL8A 2RBEA 1NPTO 2E4AA 1RWBA 4K1LA 3GGPA 4ZQEA 5JNLA 4L76A 4KUHA 3ZHYA 1FDWA 5IAAA 1VJTA 2VZ8A 3WYCA 4ALNA 4EJ0A 3VPSA 4RPLA 5L9AA 1KVQA 3VH1A 2EJVA 3BYZA 4TRNA 5C37A 3QVWA 1P45A 2B83A 3I9KA 4W9NA 4BV9A 2NU6A 2GZ3A 4FD3A 1HDRA 1KIFA 2X8LA 3AM3A 4CM7A 4WOKA 1Y6JA 4UEJA 1KOLA 3Q2KA 5TJHA 4TZKA 3RUFA 3LT0A 1XELA 4RPKA 1MP0A 2B4QA 3QSGA 4IQGA 3OJ0A 5DOZA 1H6CA 2OFPA 2YV1A 3I6QA 7MDHA 4FPXA 4IQ0A 1XQ6A 3PPIA 5DP2A 1I2ZA 1HSOA 3DHEA 3GNQA 1LC0A 1IB6A 3PWZA 4HNGA 2C20A 4G2NA 4XQGA 4CM3A 1EMDA 1K5HA 1O0SA 4CMIA 2P2SA 1R6DA 3W6ZA 1Z7EA 2B0JA 1E3EA 2PR2A 3GDOA 1F14A 1GCOA 3GA0A 4S1VA 3DMYA 1WDLA 1T1RA 2DPGA 1E7RA 2Y1CA 4M1QA 4NR0A 4TQGA 1LA2A 4BNFA 2O7QA 4HBGA 2RH4A 2DVMA 2J5KA 3RBZA 1R4MA 2HLPA 4D0SA 2Z1NA 1MG0A 3DZFA 3DOCA 5G4LA 3I5MA 3NDJA 3F1LA 1AN9A 4AG3A 1GCUA 1ONNA 1YL5A 3RQSA 3ZZNA 1IE3A 1TI7A 3EAGA 5TT1A 4TWRA 1FF9A 4FDAA 3RC1A 3WTCA 2WMDA 3M2PA 3Q2IA 1D8AA 3P2YA 4BNUA 4GLOA 4YJFB 3ZWXA 1DEHA 2XOXA 3H8VA 3HDHA 4ZJUA 2XXJA 1L7DA 1M75A 1UZLA 4LRSB 1WDKA 2W2LA 3WQSB 1CYDA 1JLLA 4R68A 4W9NC 1H9AA 1VSUA 4BNIA 1A4UA 3TZCA 3GG2A 1WVGA 5L4NA 5C5IA 4IQ8A 3SLKA 1LI4A 2C82A 2QYTA 1UXJA 1PTJA 2NVBA 2ZATA 5DZSA 3NT2A 4UREA 1XSEA 2AG8A 1Q2XA 2HCTA 1PL8A 3ZWCA 2H63A 4DYDA 1EE9A 1BW9A 2Y99A 4BO1A 3U4DA 1KBZA 3BHJA 4MPDA 1HF3A 2WYVA 3CZMA 3T7CA 1GPDG 1YKFA 4AVYA 2OUIA 4UVEA 4N54A 2BMAA 3ROKA 3ZNNA 3ASUA 2O2SA 5JXWA 3MJVA 4BNJA 3E82A 4ZN6A 1VJ0A 1ZCJA 3OEYA 2B35A 3KM0A 4LMPA 4NJOA 2YQ5A 3RJ9A 4B3IA 1A9YA 2UUOA 3DC2A 3I4FA 1IOLA 4ONEA 3MJTA 3IKVA 2CFCA 4D7AA 3RCBA 4N18A 3K5PA 1WPQA 3MOIA 1JQBA 3OA0A 1LNQA 4WLOA 1Z6ZA 1X0XA 5KVVA 4CM4B 4CMCA 3IMFA 4RPHA 4AJOA 4RQUA 1HZZA 3C3XA 3WDSA 4L4XA 1B7GO 3QWIA 1HWYA 4F3YA 4YAIA 1ZZEA 4DIBA 1X13A 2RHRA 3LDHA 1O8CA 1IZ9A 1P33A 4RGBA 3WLFA 3DBLA 1X0VA 1ENOA 3GF4A 3EC7A 1QP8A 2QRJA 4GH5A 1J6UA 1GDHA 5GY7A 1T2DA 5CDUA 1F0YA 2YFHA 5U4QA 5T5QA 4QT0A 1NNUA 3PEFA 4PLCA 4FW8A 3KXDA 3EUWA 3W8FA 3BMCB 3DO5A 2C7VA 4YBZA 5KVQA 4BO3A 4Z3KA 4J4TA 3MJEA 1Q7CA 1W4ZA 3GEMA 5CHEA 3ZI0A 1PWZA 4B8ZA 3KVOA 4XQ9A 3ITDA 3X2EA 4XDYA 4AJ1A 1DIRA 5JAZA 3RIHA 5CP8A 3I9JA 3ONEA 1Q0HA 3GEDA 3VC7A 4NMHA 1D1SA 4BL5A 5GZ6A 4H15A 1DAPA 5F1OA 3K30A 4QFDA 3DAFA 4M49A 3OJEA 1BDBA 5JAMA 1SNYA 5THQA 3WGHA 3LZ6A 2VQ3A 1T2FA 2VNAA 3V1UA 4OIMA 3F46A 4WKGA 3CMCO 4AL4A 5CAEA 3I1JA 5JMPA 3ZV5A 4BO6A 4K6CA 5HS4A 1U3TA 2VHXA 3D3WB 4YB8A 5JAIA 2JKVA 3KRTA 4CV1A 3T4EA 3NDIA 3OJFA 2FSSA 2Q1WA 5AXCA 2PKQP 3DHNA 1C0PA 2NTNA 1H2BA 1MC4A 3WLEA 1E3WA 1DJQA 3AM4A 4IS2A 1HDXA 4IMPA 1YE3A 2JCYA 4L8VA 4B4OA 1GD1O 3IDSA 3DXFA 1VM6A 2AQ8A 1P9LA 4BGUA 2EEZA 2AQHA 5IDXA 3M6IA 4D43A 3WGTA 2W4QA 3KLPX 3KZVA 1SAYA 5FWNA 3DBVO 2GN6A 3F6YA 5L45A 2X9GA 1M6WA 1YQGA 3K2EA 3HHPA 3OQ1A 3GQVA 3BTSA 3PVZA 4I5DA 3E9NA 1ADFA 1ONPA 3F5QA 9LDBA 5T6BA 2O3JA 1WNTA 2WM3A 3ZH2A 3JQDA 1MX3A 4MVJD 1PS8A 4RVDA 1XIVA 5DT9A 3HSKA 4IGFA 4RZIA 1A5ZA 2F1KA 3TQHA 2IYOA 1NHWA 2JD1A 4ALKA 4JJGA 4FFMA 3D64A 3RBXA 3C24A 4Q3NA 3N7UA 1VC2A 5HS6A 1R4NB 4FN4A 4CQLA 2Q2WA 3JQAD 1JVSA 3FNHA 3AOGA 4A10A 1U8FO 2J5QA 2DKNA 1HETA 1QRRA 1EFKA 4E13A 3PIIA 2W90A 4YPOA 4JLWA 2DPHA 3M1LA 2D2IA 4OL9A 3ADPA 2C5AA 1BXGA 4KDEA 3W6UA 3RVDA 2V7PA 4CM4A 1B8UA 4GSLA 4J9UE 2W2KA 1K6XA 4P4NA 2HJRA 3ANNA 2O3SA 1EVYA 2DFDA 5KTKA 2OP1A 5K6AC 1HDYA 1XQ1A 3ANMA 4RV9A 5L40A 1ID1A 1MC5A 5I9NA 1EBUA 3PLRA 1ZKMA 4EBFA 3NT4A 5LC1A 2I6TA 1K0UA 1U7HA 4ZRNA 3BMCA 4EW6A 2VHYA 4BO7A 4N5LA 4WLUA 3DZBA 3E18A 4I5GA 5IG2A 1SZJG 4U6SA 5C7OO 2FPGA 1TT5A 3CEAA 3O03A 3PTZA 2WSBA 4P4GA 2GUGA 4QO7A 1JVBA 1G6KA 1SPXA 2C59A 1IL0A 2TMDA 1H6DA 1M67A 4JBGA 4OKNA 4CLRA 3HG7A 3HQ4O 3JYPA 4LVUA 4DUPA 1H2HA 4B8WA 1F8GA 2PH5A 2HK9A 2X5OA 3I9MA 1Y8RA 2C29D 1UXKA 5CDSA 3VTFA 5TQVA 1X1TA 1X7DA 4XB2A 4CLDA 3K8ZA 4CM5A 3NTOA 1I3KA 4KQWA 5BT9A 1PWXA 1XU9A 3D3WA 1LU9A 3LT1A 3RI3A 2D8AA 3DAPA 4JNKA 3CMMA 1E7YA 2E48A 1EUCA 4FGSA 1XYGA 4DQUA 2IXBA 4PIVA 3FTNA 2JFGA 1ZXBA 1DB3A 4DPMA 4UUNA 2ZTVA 5TF4A 4EGFA 1U5AA 5L51A 5COBA 4B4UA 4LK3A 3NYWA 4E30A 3LLSA 2WE7A 3HZZA 4O1MA 4YJHA 3SLGA 5ITVA 1HDOA 5L53A 2DBQA 3CUKA 4CM8A 1YH3A 4YJDA 5CEFA 1EQ2A 1QXSA 3GGGA 1TXGA 3ZNOA 4A26A 4J16A 4CQMD 1LUAA 3BXXA 3OEWA 1A27A 1ULUA 1DXYA 1E77A 2WWRA 5TIIA 1V6AA 5B4TA 2X0RA 1LDNA 1ZIDA 1RM5A 3DBRB 3L77A 1PJSA 4N5NA 4WE3A 1R15A 3T7EA 4YQYA 1NR1A 3BMOA 1VI2A 3BHMA 3LC2O 1C1XB 3IL2A 1J0XO 3NTQA 1SO8A 2GASA 2XF8A 3ZWYA 2J3KA 4Z0TA 4WGGA 3GHHA 4BNXA 1ULSA 3B70A 4U8GA 4ZGWA 3SVTA 4PG6A 4ND4A 3AUTA 1R4NA 4WLVA 4E32A 1PJQA 4P38A 1ZK3A 3GAFA 2W98A 3PHGA 4J3FA 4RO0A 4ZHSA 1N9GB 2SCUA 2NVWA 4R5HA 4YJGA 3U4CA 5JCJA 5IDQA 4QFCA 5JO0A 3WGQA 2GO1A 3QRWA 1MFZA 2YZ7A 3NGLA 1UP7A 4HFNA 1QKIA 3JQ9A 1KYQA 1NQ5A 3GVCA 1DFIA 1M66A 3TWOA 4YT5A 2OP0A 3PQDA 4P22A 2BFAA 1NQOA 5HBRA 3DZKA 3OHSX 2JCVA 2WTBA 3ZU2A 2Y1EA 2I3GA 2GYYA 3V2GA 3D1LA 4PRLA 3FRJA 4RVFA 1MXFA 1NFRA 1ZMOA 2Z95A 1HE4A 3OJLA 1E7SA 5JY6A 1UXGA 3ZV6A 2WYUA 2BI7A 3JQFA 3BAZA 1EVIA 1PJCA 4WCDA 3PDUA 3H65A 3GNTA 3H9GA 4QTZA 3GEGA 5IXYA 2RIRA 4PLFA 5AXDA 3FR8A 3K6JA 3JYLA 4ZRMA 2QYSA 4MOWA 2GSDA 3DFZA 4NFYA 1WMBA 4BMNA 4XGKA 3GR6A 1BXZA 1H6BA 3PXXA 1PJ2A 4UUPA 4G5HA 1B0AA 1PS9A 3OMLA 1DFGA 5F1KA 3JQ8B 5KJEA 1E3SA 4FOSA 4NI5A 2HJSA 4AJJA 1U2GA 5FYDA 1NWHA 3OSUA 4RORA 3C8MA 1HLPA 2AHRA 1ENPA 3EHEA 4DA9A 1DC4A 5EIOA 1XA0A 1GQYA 1YBVA 2WJPA 4DRYA 4JBIA 2FPIA 5JE8A 5JDCA 5THKA 4L74A 4DVJA 1U8XX 1BWSA 1C0LA 2PK3A 3HFSA 4B4WA 5HM8A 1V0JA 3IJRA 3TDKA 4XRGA 4F6CA 4HV4A 5T8KA 4YT2A 4YTEA 1OMOA 4JN6B 4BKOA 2VT2A 4XYMA 3RSHA 2HQ1A 1FMCA 3L4BC 4QEDA 1SB8A 1TA4A 3SBOA 1IHXA 1WMAA 4IMRA 1IZ0A 3VZSA 1DIBA 2AQIA 4FBGA 3U4IA 4O5OA 4ILKA 4YACA 5I8WA 4XYLA 3CSDA 4PN3A 3O9ZA 1ZMTA 3B20A 4DREA 3E6AA 1HYGA 1ZUD1 1TB4A 4E6PA 4UVDA 4Z0HO 4A7PA 3DBRA 1SBYA 3JQ6A 2J5RA 4XQEA 3GZNA 4WLNA 5CEJA 1C1XA 4ALLA 2VHVA 3DAGA 3HWRA 2X0NA 4INAA 1FDVA 3LT4A 2IODA 3KSDO 2QRKA 1S6YA 2QZ9A 3EY4A 1GEGA 2X58A 4YVFA 3BHIA 2R00A 4DPLA 3KYCB 1GU7A 1N9GA 2BLLA 1JAYA 4RZHA 4I9NA 2O4CA 2CDCA 1DRVA 3KOUA 4H3VA 4OQZA 3PDJA 4EEXA 3FBTA 4K6FA 2IEDA 1YJQA 3LC1O 4H7PA 2AEMA 1FK8A 2C07A 3P5SA 5ER9A 4G81A 4URFA 5BSEA 1JU9A 4IM7A 1V3TA 4HNHA 2R6JA 2IEBA 3QWHA 2PNFA 2O3UA 3MEQA 4RF2A 1M76A 1PJ4A 3IQDB 3ONDA 4DGSA 4YAGA 5DNAA 4RVGA 5KKAA 1XHLA 3AFMA 3JQ7B 2VWHA 4UEOA 2DC1A 5CEEA 5JDCC 4M86A 3WSVA 4BGVA 4B4VA 4E2ZA 4EUFA 3ENNA 1HKUA 3MTJA 3RU7A 4CLOB 2Q3EA 4YRBA 4PZEA 2J8ZA 4L4SA 3JQBA 2VRCA 4YR9A 3EW7A 4QECA 4LVCA 5G0TA 4IDFA 3R3JA 1EBFA 1J49A 2BGKA 1M6HA 3TN7A 2FN7A 4FSHA 3ZWWA 4PLZA 5J23A 3I52A 1UJMA 2GDZA 4KQXA 1WWKA 1FDSA 4BGEA 5L4LA 2JCXA 3GNSA 3WIDA 5F5NA 2I99A 2AA3A 5T64A 2DBVO 3G1UA 5ES3A 3MCVA 3JQ8A 4UUMA 4XJTA 4Z0PA 1IULA 3PJFA 2X4GA 2AEFA 1I30A 3KYDA 3CIFA 5KOIA 1E5LA 1LLUA 1EVZA 2AE1A 3DTYA 4W7HA 4ALJA 1OC2A 2CVOA 1LLDA 2V6GA 3O8QB 4LCJA 2VZ0A 3M1AA 2HAEA 3GVIA 2UUPA 1E1LA 2I5PO 3RFTA 3INTA 4BKQA 3KSZO 1Z75A 5I9MA 3SXPA 2VWQA 1NR7A 2G5CA 4CV0A 3IAHA 4XIJA 2Q99A 3GPDG 2PWZA 3VHRA 2VOJA 3JSAA 4JP3A 3ZDFA 3U9LA 1E7WA 4B79A 4WECA 4YAJA 4BKUA 2Q4BA 3ROPA 1GAEO 1MB4A 3DHYA 2Y1FA 4ZU3A 4A0SA 4MKZA 4EI2A 3U09A 1T4DA 2Y0EA 3DFUA 4ZQBA 4Y8VA 6ADHA 2WD8A 3ZN2A 2O50A 2YW9A 1O9BA 4O0LA 3EZLA 5EESA 2VNSA 2WD7B 1LRLA 3CXRA 5T67A 3S2EA 2D0IA 3ZHZA 1R0KA 4QUKA 5DBFA 4NK5A 1B14A 2E49A 1KVTA 1DSSG 2HK7A 1QLHA 1Y8QA 2WDZA 4E5NA 1DHRA 3OH8A 1N2SA 1S7CA 4RPGA 4BNMA 1NPYA 1PR9A 2EP5A 3IUPA 3QVXA 4D0RA 3IP3A 3AY6A 5TJ9A 1KVUA 1RM0A 3GMSA 5KCZA 3NJ4A 4WCFA 4D45A 1W8DA 2EGGA 1QYVA 3ZU3A 3CZRA 1E6EA 3P19A 3PIDA 4ESOA 4BNNA 1FXSA 4OQYA 2A92A 3HB5X 3D0OA 2BD0A 4YEDA 1HE2A 2P4QA 3DBHB 1HXHA 4RF5A 4R16A 1DJNA 2OL4A 4PLTA 4JBHA 2FHSA 1QSGA 3ZV4A 5A03A 3W4IA 4DWVA 2HK8A 3AUUA 1NAHA 4R69A 1NTOA 4DQVA 4JIGA 4RF4A 2BFOA 1L1FA 3VH4A 3ORFA 5HWSA 5L95A 2NQTA 4HXYA 2NU9A 2VT3A 3R1IA 3RASA 3H5NA 4FC6A 2PD4A 3QP9A 3GC6A 4HADA 5T57A 1LRKA 5AXBA 3JD0A 1K3TA 2EIHA 3ZWNA 3JYNA 4DYVA 3PHHA 4YXFA 3IS3A 3TFOA 1HYEA 3ZU4A 2X86A 3LF2A 3OJOA 4MVJG 1HYHA 3DZJA 2ZCVA 4Q3EA 1QLJA 1XDWA 2JAPA 3NAQA 2O3TA 2EW2A 3IOYA 7ADHA 5HRUA 2FY8A 1UUFA 3NV9A 4LSMA 1YOVB 2IZ0A 1Z7BA 2QZZA 1BSVA 1MV8A 3MJCA 4BNLA 1LDEA 3AUSA 3VH3A 3KHUA 4AJPA 3U49A 3K96A 4CUZA 3JQAB 1ZO8A 4W4TA 4XZ3A 5G2OA 3PGXA 3VZQA 2PZLA 4GAEA 2GD1O 4J91A 2H5LA 2VCYA 4W6ZA 2A35A 3V1YA 4R1NA 5EMHA 2Q50A 2POQX 4AJEA 3ZWVA 1LQUA 1WLYA 3COSA 4J2HA 3TOXA 4WCFC 2OBNA 4ZD6A 1GYRA 3ITKA 4DBZA 4XYBA 2RHCA 5DOVA 1ARZA 2I3AA 2HRZA 1YB5A 1PR3A 1I01A 4RDHA 3WOHA 2PD3A 2W2LD 1AXGA 4FFNA 3WBFA 1GY8A 3LSYA 2DTXA 2P9CA 3BTOA 3ONFA 2X5JO 5DBGA 1DBVO 2H1SA 5G0SA 2R2GA 4DMLA 1RJWA 4XQCA 1O5IA 5TGDA 3TL2A 2ZKLA 2HSDA 3EYWA 5I7FA 1A9ZA 1YL7A 2HMUA 3AOEA 4WPGA 3B1FA 1R16A 4YAEA 4EEZA 1VSVA 2VUSA 4YRDA 1E3LA 3HDJA 4XEHA 1E0DA 2UDPA 2J3HA 2LDBA 2Y0DA 3ROQA 4W99A 4YDRA 3AI1A 3L07A 4J4BA 1CWUA 1OAAA 3AY7A 3GH3A 3EDMA 4OAQA 4FS3A 3H3JA 1LSSA 3PJGA 3DMTA 1E1NA 3F47A 3VVBA 3GDGA 3F4LA 1PJLA 1YRLA 3KB6A 2C54A 4BS9A 4OO3A 2F00A 4J6FA 3GVPA 4OGWA 2Z1MA 4L4RA 1DFHA 1Y9AA 4BNYA 2FP4A 4LMRA 4NBTA 4GI2A 3ZNQA 5EN4A 2VHWA 2DLDA 3FF4A 4MJLA 1H5QA 2DFVA 2ZYDA 4Y9DA 3VKUA 3RC2A 1A71A 3GN2A 3TFQA 5BQFA 1VKOA 3GRKA 3HUDA 2ZJ0A 4XB1A 5F21A 5FI3A 3FNEA 5COQA 5JYDA 1HDCA 4B3JA 5G0UA 1KVRA 4ZA2A 4MVJH 4J1TA 4RLSA 4YJFA 4Z3DA 3S2GA 5B37A 5MGBA 3OETA 1NQTA 1JW9B 4XRRA 5BNTA 1CERA 4HWKA 4BNKA 3V2HA 1XKQA 3JD1A 1KEPA 3GG9A 3TOZA 3WIEA 2QRLA 4RF3A 5DN9A 2VUUA 3IP1A 1SOWA 4FJ0A 1E1KA 2Q1TA 3NTRA 4Y6RA 2OZPA 1BVUA 5I8ZA 2AQKA 3U62A 2EV9A 3AOEC 3C7DB 4AJKA 3GK3A 4M55A 5CG2A 1YGYA 2PZJA 3QJ5A 4EDFA 1D3AA 4DBVO 4MVJM 4CV3A 5A3JA 3D5TA 4U7WA 3S55A 2DTDA 2VZ9A 3DONA 3RUDA 4CMEA 2HRBA 3BTVA 1LBEA 4FFOA 4GL4A 4OOFA 4CUKA 4J7CA 1T4BA 3PJDA 1C0IA 3RUEA 4NQZA 3B1JA 1AGNA 4NIMA 1Q1NA 5LCXA 3ETDA 4OOEA 1PJ3A 1UZMA 2B36A 3O38A 3QHAA 3JTMA 2RAFA 5L7WA 1LXCA 1VL6A 1HZJA 2ZTUA 4AFNA 4IJWA 3PZBA 1R66A 4Q9NA 4NNJA 4RPJA 2GR9A 2FOIA 1N1EA 3L4SO 4NBWA 3UCFA 3IKTA 1Q7BA 3W8DA 3VOSA 1ISGA 5JO9A 3WX0A 2G1UA 3WTBA 3NEPX 5HTOA 3RFXA 3E9MA 1BVRA 1LSUA 1OZAA 3WFJA 3TZ6A 2FRDA 4PLPA 3RUHA 1ISIA 1G0NA 2ILTA 3M2TA 1O95A 3V5NA 2W8ZA 3KUXA 4J1NA 2WYWA 5AXAA 4AICA 4IZIA 1W73A 5JMWA 3FPCA 3ICCA 4Y98A 2VUTA 1WP4A 4CODB 4II2A 1BDMA 2X0IA 1HTBA 2P91A 5KVCA 3RROA 4IXWA 3E9QA 1Y1PA 4NJMB 4XGIA 4E2YA 4RDIA 1LLQA 1I0ZA 1ONOA 3H6KA 3RWBA 1PJBA 2OOSA 2XXBA 5ENDA 5A1TA 3QVOA 4K26A 3UICA 4GGPA 4FJ2A 2Q1UA 4PVDA 5JY1A 3SC6A 4CM9A 4Z9XA 3WYEA 1D7OA 4GX5A 3KBOA 5L7YA 1A7KA 3GN1A 4IDDA 4BGIA 2Q45A 2E37A 1VPDA 3FPLA 2EWMA 5L3ZA 2O3QA 4E2XA 2YDYA 2QQ5A 5B12A 3NJ8A 1DIGA 1Y9EA 2VTDA 2UYYA 4RVUA 4CMEC 3QVTA 5TNXA 3TRIA 4BOYA 1K6IA 1UAYA 1MLDA 3DL2A 1E7MA 4QX6A 3ANLA 3TPCA 4J0EA 3ZHXA 5FF9A 4GVLA 2X0JA 4BNGA 1YQXA 4GSKA 1L7EA 3WWZA 1KY4A 1F17A 3PK0A 5G4KB 4Q3CA 3GOHA 1F8FA 4OSPA 3WQQA 2D3TA 2BRUA 2HMWA 3H9JA 1BTOA 4CJXA 4E5MA 4C4OA 4OXNA 1PS0A 2UV8A 1E3IA 1GUFA 1H94A 1UR5A 4GWGA 4Z9FA 2QX7A 2G0TA 5KKCA 3FD8A 3DOJA 5LDGA 2DU8A 2PGLA 2VN8A 3BIOA 3DB2A 4FC7A 2PZKA 3E5RA 3H2SA 2PA3A 4BQRA 1SEPA 3GDFA 5DULA 3TNLA 3EK2A 3MWEB 6LDHA 3GVXA 1E3JA 1G0OA 2CF6A 1GZ6A 4R1TA 2B5WA 1NVMB 2HMTA 3H9EO 1B15A 2X5KO 3ASVA 4MIOA 4MINA 2GCGA 2X9NA 1NVGA 2J6IA 4R4JA 1KETA 4ND1A 3H7AA 2FMUA 4NZ9A 1GADO 3UAGA 1T24A 4WLFA 3GLQA 4EJMA 1PQUA 3AM5A 5I7SA 4HFRA 1HE3A 3FWZA 1I33A 4PZDA 3W1VA 2NU7A 5EQFA 4C7KA 1ZNQO 5I9LA 3QVSA 1U3WA 1GTMA 3C7CB 3HJAA 1B3BA 2DBRA 3MWDB 3WFIA 2VHZA 2C2YA 3WBBA 1H93A 1E92A 1ZK2A 3TZHA 3KEQA 3D4NA 3KYBA 1N7HA 4EUEA 1LJ8A 1LC3A 3V8BA 2DBZA 1UDAA 3GAZA 4IDEA 4PLGA 2NNLD 5FFFA 1EDOA 5AVOA 1KS9A 1U4OA 3AUAA 1JKJA 4YT4A 1WZIA 4NFHA 2YJZA 1YWGO 5ILOA 5ER6A 3H9UA 1ZJYA 3OECA 1Z74A 5KVSA 3GRPA 2AMFA 4GBJA 3VZPA 2IRWA 1DLIA 1WDMA 4Q3DA 3BMQB 4UVIA 1UDBA 2CUKA 1I2CA 1C1DB 1EZ4A 1I10A 4CM6A 1EK6A 2HO5A 1P1JA 3VPFA 4BMSA 4WEOA 2Q2VA 5I7VA 1PZEA 4GGOA 1IUKA 5JAQA 4J90A 1GYQA 1HE5A 4QQRA 2A94A 1MFPA 1Y81A 2X1HA 1PGPA 3PHJA 4RCVA 3DZGA 3FBGA 5IZCA 4A27A 5JCJD 1Z82A 2JD0A 2CVZA 2TMGA 3R3SA 4NHEA 1BHSA 4TRJA 4WOJA 1HLDA 1SCUA 4KWHA 2HU2A 2E82A 4R1SA 3QV1A 5A9SB 4IDCA 3KO8A 5A5EA 4IIVA 4M87A 1DC5A 1O6ZA 3STHA 1VRWA 4WNCA 1ZJZA 1LX6A 3D4PA 3KTDA 3OM9A 1VL0A 3ROMA 4PLYA 4ZQFA 2VYVA 3W4JA 3JQCA 4CM1A 1XR3A 2NM0A 2P9GA 4YRAA 5JYEA 3FWNA 5DP1A 5CPFA 1N5DA 3OQ6A 3GY0A 4Z6KA 1SB9A 4JX8A 3RD5A 2VWPA 5B4UA 2YUTA 3CKYA 3E48A 3F4BA 4CPDA 1LSOA 1JN0A 1P1HA 3G3EA 5IJZA 3ZWPA 3ICPA 1B2LA 1YXMA 2C7GA 4J1SA 4TKLA 2O2YA 3LK7A 4TRMA 5H83A 3H2ZA 2PKQO 2WE8A 1KC1A 1QMGA 4IJVA 4MVJP 3V2UA 1EFLA 3PGJA 1Z45A 4CUJA 3JQ9C 4TSKA 4R3WA 3N58A 3OF2A 3QWFA 1NP3A 4RL6A 2PH3A 1KC3A 1ADBA 3LU1A 2EJWA 2PZMA 1UP6A 3OQBA 1ISHA 1U1IA 2OORA 4DQXA 1N1GA 1B8VA 3B1KA 3UHAA 3JQFC 1NASA 4YCAA 5CFZA 3WYBA 4UEKA 3C1OA 4IUYA 2X23A 4KP7A 4GMFA 3PLNA 3O4RA 4LRTB 4E3ZA 1ADCA 5BNIA 1PU2A 4AJHA 2PTGA 3ULKA 4UULA 1GUYA 2AG5A 3NDRA 3U3XA 4NU5A 3SJ7A 2GLXA 4YT8A 3Q6IA 4MVJE 4BKPA 1LDYA 3EZYA 1ZSNA 4BO5A 1HDZA 3HDYA 2YFQA 1LTHR 3HN7A 4OYRA 1V3UA 3L6OO 5HA5A 4BO9A 1I24A 1NFQA 4XYGA 3PZRA 1AUPA 3TZQA 3WGOA 3K92A 3P7MA 3LC7O 3UKOA 3B6ZA 3JCZA 4Z9YA 5H82A 4B7XA 1PX0A 4FB5A 4JROA 1ZSVA 4IGEA 3HADA 3PYMA 4CMIB 4UUOA 4E0BA 5ICSA 2RH8A 4RVHA 4BNWA 2VYNA 3OIFA 1QYXA 5MDHA 1YQDA 5ILGA 1UP4A 3TZKA 4MIYA 1IPFA 3S2FA 3FN4A 1FDUA 5T8KC 5IF3A 4D3FA 1D4FA 2EKLA 3RC9A 3BMQA 2IDZA 1C1DA 1P3DA 3QIVA 2Z5LA 2VRBA 2O48X 4Q3BA 4YQZA 1YL6A 3RC7A 4FGWA 4YYZA 4MKXA 4FFPA 1T2CA 5A9TA 3T4XA 5K0ZA 4D3SA 4Y6SA 5BNFA 1QYDA 3H5AA 1HSZA 1B3RA 1B16A 4BKRA 1DOHA 1AE1A 1LQTA 3HDQA 1OC4A 1U5CA 2YV3A 4II3A 4R1UA 4I1IA 3FHLA 4BIIA 2Y1DA 3GFGA 3DOOA 2QIOA 5A9SA 4DMMA 2B4TO 3GT0A 1BRMA 3HNPA 3L9WA 4B7UA 2P9EA 5L4SA 1DRWA 1PGQA 3SX2A 2OBYA 3GGOA 4R9SA 4C7JA 2ZCUA 4U0KA 3ENKA 4F6LA 3Q9NA 4N5MA 1P77A 2ZTMA 3GUYA 1NYTA 2P4HX 3L9XA 5JS6A 5TSDA 3WGIA 1LDBA 2B37A 2DAPA 2R00C 4JQCA 4IXTA 4W7IA 2VRCD 1XGKA 3MZ0A 3PWSA 4R3NA 4J49A 3RKRA 3AY3A 4CMGA 1JKFA 1OOEA 4KUEA 1PQPA 4FR5A 2I9PA 3F3SA 1BW9B 1NWCA 4BO4A 4R01A 1R0LA 3AJRA 4G65A 3N74A 1J5PA 3U4HA 1NPDA 2IZ1A 4BNZA 3VKVA 3ZWAA 5KWEA 4BUCA 2VOEA 4OM8A 1LEHA 4E31A 2OMEA 4HFJA 1IPEA 3UF0A 3R0IA 1I3NA 3EGOA 1M2WA 4NPCA 4XKJA 4XYEA 1PIWA 1GPJA 4NU6A 1YO6A 4BB5A 3P2OA 2D4AA 1CEQA 4BMVA 4PRKA 4LW8A 3JQBC 4ND3A 2GZ2A 3CTMA 1HT0A 2CF5A 3IIEA 2PGJA 3E1KA 3JD4A 3VH2A 5IDYA 3LT2A 5G0WA 3W4KA 3S8MA 1N8KA 1ZXLA 1ZEJA 4CL8A 4MP8A 4K9DA 4BO0A 1Q7GA 1Y5MA 2LDXA 2Y05A 4J9VA 4TROA 3KYCA 3HE3A 3A1NA 4KOAA 5BSFA 1RYEA 4I9HA 3QY9A 3DBLB 3CH6A 3GUCA 2Q2QA 1V8BA 1QV6A 4U6QA 4WUVA 3Q11A 4QO8A 1D1TA 4OMUA 3MTGA 1P1IA 3WXBA 2G82A 4CR8A 2IXAA 4GLLA 3I9LA 1ZBQA 4RVSA 4HKTA 3W8EA 4E5YA 4TVBA 4E21A 1GR0A 5BSGA 2JJYA 2FZEA 3G0OA 2Q46A 3JQ7A 4FQ8A 4OHUA 2X6TA 3INGA 5TC4A 3AU8A 4RQTA 3WB9A 1EK5A 3BTUA 1GYPA 4CLOA 2P68A 4CMKA 4I08A 3H5RA 1ZSYA 3L0DA 2X7HA 4HX5A 4IPTA 2CSUA 3K31A 1N7GA 3UN1A 2C5EA 3PYLA 4I5FA 5EERA 3QW2A 4GKBA 4GX2A 1JDJA 3VZRA 1X7GA 4NBVA 2AEJA 1EQUA 1NX6A 4CMAA 5L7TA 4E4YA 3AI3A 4FOOA 3VPGA 3GFBA 1BG6A 2GF2A 5KJCA 1K2WA 1CIVA 4D42A 2G17A 3ABIA 1T25A 2AW5A 4IJUA 1KEVA 4KTVE 2OHXA 1NM5A 1T2AA 3PP8A 2Y66A 1ML3A 4R41A 3FTPA 1U3VA 4B7CA 5IN5A 1IHYA 1E3WB 4ID9A 2NVUB 3A9WA 4R54A 3QQPA 2GERA 1YB1A 2FWMX 4EZBA 4M8SA 3O8QA 4MDHA 5A02A 4BV8A 1E6WA 2I65A 2YHIB 1YONA 4NFSA 1YBMA 3AU9A 3A14A 1NBOA 2NTJA 4MIEA 1B26A 1ZFNA 2JFFA 5TS3A 4BHTA 5JLAA 3IUSA 3JQGB 4GKVA 1RM3A 1X14A 1AXEA 4LISA 4Q3AA 4TVOA 3RJ5A 4MVJF 1ISFA 2Y1GA 4KMSA 1I8TA 3JD3A 3PRJA 2ZTLA 4XCVA 4IIUA 2GN4A 1PQWA 3JV7A 2Q4EA 3D5QA 4ALIA 5IZ4A 5BSHA 3I3OA 5U9CA 5CDTA 3E8XA 1U28A 2GPTA 3PFFA 1EUZA 1VJ1A 3WR5A 4CQLB 2WD7A 4KWIA 3WNVA 4UVGA 2GN8A 4ALMA 4ZICA 2IZZA 4BQPA 5IDWA 4IS3A 4NDNE 4I8XA 4DLAA 1BXGB 4M54A 3I83A 2ZB8A 3WQRA 3WGGA 2HMSA 1Y5RA 3LF1A 3VVCA 1ZW1A 1OBFO 3MJ4A 2ZB4A 4EJ6A 2W2KB 2RCYA 1MUUA 4GMGA 3ZWBA 4LSWA 3FCOA 4UAGA 5I7EA 4EYEA 1GQ2A 4YWJA 1QV7A 2DT5A 3UGKA 1CF2O 1Z73A 2GN9A 1XCBA 5DDIP 1CDOA 3PFWO 3U5TA 5ADHA 4EUHA 3VTZA 1FJHA 1NHGA 1T26A 1UH5A 3I23A 3DBHA 3JYOA 4RLHA 4BNVA 2EKQA 4GWKA 3RUAA 5F1PA 3KLMX 3TSCA 2DM6A 1ZK4A 2ZB3A 4R51A 5AOVA 4CMBA 4JP2A 4XDZA 4AJLA 3ADOA 4S3MA 1GFSA 3LQFA 4D46A 4PG4A 5AYVA 2H6EA 3DEYX 4PLHA 4IZHA 4BB6A 2ZQZA 1TT5B 2J3JA 4H16A 4WEQA 3DDNA 5ICMA 1EUDA 4CQMB 1N92A 4DPKA 4TMFA 3KV3O 4D44A 4CLRB 1B8PA 2PLAA 2UVDA 3JYQA 2DTEA 4O6VA 4WASA 4JJFA 2OXIA 3NUGA 3D4OA 2CD9A 4IDBA 2ZYGA 3A28A 1DIAA 4J7UA 4JJIA 5KJ1A 3D7LA 5DCYA 4MP6A 1Y8RB 4YAKA 2QG4A 4BO2A 5KJFA 3RBVA 4MVJA 1KVSA 1YOVA 4J1QA 5EQDA 2I66A 5K6AA 4LGVA 1R0SA 2EW8A 2G76A 5TX7A 3RU9A 4RJTA 2J3IA 1VLLA 1GZ3A 2DUUA 2YV2A 3JQAA 2EERA 3AK4A 5A4DA 1JAXA 1UZNA 2BFMA 3QWAA 4D41A 5H81A 2NVUA 4NG5A 5JC8A 1NFFA 2O4UX 1TEHA 1I3MA 4L73A 4YJHB 3WGZA 3H9QA 5A04A 3AFNA 4E5PA 5GMOA 1C0KA 4GX1A 3H3FA 1F06A 4L0QA 4CM8B 2YHIA 3UVEA 1U4SA 3RFVA 4Y67A 4F46A 1ENZA 3DMTC 4KZPA 2IE0A 2EXXA 3HN2A 3K9QO 5FI5A 3JQGA 2NUAA 2IYPA 1MA0A 2NACA 3UW3A 3DZIA 3ON5A 1F12A 1ORRA 2D1YA 3V1TC 5CDYA 1EDZA 1NVTA 4PVCA 1YS4A 2Y67A 3A4VA 3ZWMA 5EL0A 4LN1A 5B1YA 3UCXA 3BMOB 1MGOA 1LDMA 2D59A 2JAHA 4OJNA 1Q0LA 3RUCA 4WJZA 3WSWA 3UCEA 1EVJA 4R5MA 4A2CA 5FEUA 3JQEA 3OIGA 3OP4A 4P4LA 4CR6A 4B3HA 1DLJA 1SEVA 3C85A 3FI9A 1FDTA 3ZU5A 5TT0A 4WNIA 5F5LA 3VDRA 3QA9A 2CMDA 3ZW9A 4F45A 1ENYA 1GL3A 2PV7A 5EINA 1PGNA 4YJGB 1G1AA 3TF5A 4YA6A 4CLHA 8ADHA 3G49A 3CE6A 2EKPA 5IN4A 4DLLA 4KDFA 2YYYA 3BZUA 2JHGA 3MJSA 4TKMA 3ST7A 5K9ZA 3ZCXA 2NWQA 2UAGA 2DQ4A 5TRTA 4AJ2A 3BMNB 4JCOA 4NBRA 3X2FA 2AXQA 3SC4A 4FFRA 4O59O 4IBOA 4AJ4A 2FR1A 3RUIA 3QE3A 3SJUA 5CG1A 4BVAA 1YDWA 1E1MA 2Y0CA 9LDTA 3PQFA 4JGBA 4DC0A 1W0CA 1CRWG 3E03A 1HEUA 2D5CA 2V6FA 5C7LO 1KEWA 2X9VA 3AI2A 4J4HA 1UDCA 3KEOA 1K89A 2YQ4A 4KUGA 3ZWOA 3QLJA 4PCVA 1EE2A 1I36A 2B5VA 2XPCA 5ITWA 4JK3A 2BHLA 4JXKA 4DIOA 1GEEA 1P31A 3VAZA 4CQMA 2QW8A 1CJCA 4J43A 1LRJA 4CL3A 3S1LA 4Y6PA 1I2BA 1PL6A 1PJTA 1UAGA 1BGVA 1W6UA 2NV6A 2OO5A 3NKLA 3AWDA 1DC6A 2A9FA 3PYXA 3FNGA 1ZK1A 2V65A 4DC1A 2CNBA 3UUWA 1WW8A 1QORA 1BXKA 4XJSA 1KERA 2O7SA 3DR3A 4X54A 2E6UX 4ZQHA 5ENVA 2EP7A 3E5MA 4CM9D 3NT5A 1PEDA 3D3EA 1Q0QA 4AJIA 3PQEA 1DC3A 3DTTA 2PGDA 3ZNPA 1DRUA 3ZW8A 1IY8A 1WXDA 3GPIA 2VTEA 1BMDA 1R37A 4HY3A 4E12A 2B4RO 1YB4A 2FZWA 3C7AA 4BNTA 3VPXA 3ETGA 3NRCA 2FR8A 4PG7A 1GUZA 4OSOA 1LLCA 1EEHA 5KIAA 4KTTE 4ZVVA 1NXQA 3I6IA 1HL3A 2BI8A 1AHHA 3WG9A 1JWAB 1ADGA 2GRAA 1JA9A 2C0CA 4QXMA 4XIYA 4FIZA 4WK6A 3CPSA 4OKIA 2YHUA 4PFJA 1H9BA 1KY5A 4NK4A 3GZNB 3FSRA 5A06A 1O89A 1JKIA 5JW6A 3DZHA 3UFXA 2FR0A 4Q39A 4PLWA 5F3RA 3OA2A 5A05A 4MP3A 1NAIA 4GPD1 3WMWA 1P1KA 1P74A 3WMXA 2NADA 4A03A 4ITUA 1RYDA 2GNAA 4XWYA 4ND2A 4MKRA 2FSVA 3LYLA 3HB4X 3WNQA 4FFLA 2BFPA 2NU8A 3IJPA 5B4VA 1K6JA 1E5QA 2YY7A 4I5EA 4A5OA 4HP8A 1XG5A 4DLBA 2NSDA 4FJ1A 3L4BA 5DCWA 4J0FA 5JSFA 4NJMA 2GGSA 1V9LA 4NBUA 1E6UA 2NTVA 4ZQGA 4CLXA 4DIFA 3BMNA 2Y93A 1KEUA 4DL9A 2BELA 4NH4A 3LLVA
chains in the Genus database with same CATH superfamily
2PSJA 3FNRA 1QYCA 1CR4A 1MJFA 3ZIUA 5FBKA 2QTCA 4ARVA 4CMHA 2DERA 4MI3A 3RFCA 3QEJA 2IYQA 2DPYA 3K73O 2NZYA 4JUDX 2KLBA 1AQLA 4F84A 1QPZA 5I9IA 5TQ0B 1H0KA 1TLTA 1AKWA 2ZS8A 3ASZA 2BGMA 4PGFA 2FSIA 4P84A 5BR4A 2ZQYA 3K2BA 4AK9A 4CLEA 3GJYA 3G59A 4Y2PA 1DJOA 2ZSJA 3WGYA 3N59A 1KK0A 4UVHA 5DYIA 4NCNA 4ZJPA 4J2OA 8ABPA 2YY6A 4A4DA 1LW6E 3EZNA 3C8UA 2WHYA 1RC1A 3I8SA 4NP6A 2YXPX 4P9NA 4QARA 1NQXA 3UATA 5HZKA 4UQPA 1V26A 3PWKA 4BZXA 1KKLA 1L4EA 1OX4B 1PGOA 1P7CA 2G5GX 2ZB7A 4HCJA 4URWR 5D87A 3UENA 4ETNA 4XA8A 5HQJA 1UQTA 3FTDA 1P7VA 4NCIA 5B58C 3I5YA 1DV1A 3PNYA 2H1CA 1FEZA 2YJ5A 2C2WA 3DE6X 3PL1A 2C4TA 5CH8A 4XD2A 3K2IA 2BVNA 4MUJA 4DTIA 3JD2A 3BD8A 3K1ZA 5IYZB 2OY0A 2PFSA 5LMCA 2LD4A 2HW8A 2BISA 1KKMA 2PWAA 3KETA 3VNBA 2FPPB 3IO5A 3ZCVA 4UU7A 2PH7A 1GSIA 3UMRA 4O2LA 3OZVA 1HRDA 3KJEA 2OGUA 3KWFA 4MW5A 4W82A 1FS6A 5DX8A 3RKUA 4OH1A 2VHUA 2WUWE 3WV4A 1BCSB 4HYQA 4H18A 1J1ZA 2XTNA 3EMKA 3TJRA 1U9CA 1RKXA 1XWFA 5BR7A 1SUAA 2GZHA 3M5CA 4I1UA 3I6ZA 3ZV3A 2LNDA 3MQFA 1RJ9B 4JUCA 1CRZA 2PFGA 4CTNA 2B4YA 4XR9A 2XAAA 1CVLA 3MWEA 4P7JA 1X1AA 4HMPA 3T52A 2V6BA 1O6FA 2P6UA 4D3DA 4U02A 3TTWA 3VU1A 1NDUA 1TT7A 3TCXB 1SPBS 1FXWF 3GARA 1XZHA 4OA8A 2NLOA 3BX1A 2WTEA 3G68A 1T2EA 3MPOA 1L8XA 1OI7A 3TLYA 3E05A 4M3NA 3WJAA 1KNXA 7YASA 3WJ7A 1FL9A 3KAPA 2P9HA 3M49A 2H3HA 3C3PA 5A3VA 4KR3A 3DE4X 3TCNA 5IT5A 3DW3X 4FI3C 2J87A 1PSDA 1W47A 2C61A 3GZ4A 1M6EX 2X22A 1IEWA 3TTSA 2IW3A 1YJ8A 4XGNA 5EGNA 5F3DA 3MWDA 1P1FA 2HT1A 1R12A 1BGXT 4ND5A 4QELA 3AY0A 4BFLA 4DJTA 3IQIX 1MPXA 3WS7A 2H4XA 3GHYA 4LECA 1FJGB 3TTYA 5C8XA 4LC9A 3LVFO 3A1WA 4YO8A 1QYWA 3G23A 3KELA 1ZC3A 2JD2A 5LQUA 1QOPB 1SH7A 5A3RA 3ET5A 1FLVA 3DPIA 2VC2B 1XU4A 1AHIA 4G0XA 5EJ2A 3UOGA 4D4IA 2JK1A 2YXLA 3OOEA 4QOIA 4X00A 4KRYA 5A5FA 3CF4A 2PCJA 2B69A 3V8QA 1U3UA 4ER3A 1OXSC 2HKIA 3FF1A 1A77A 2H2WA 5FAKA 1NQAO 1P2VA 3U4QB 1J4AA 3BQMB 2ZCJA 5G1PA 1N0IA 1WPGA 3AKYA 4HFMA 3GGJA 1QKJA 2R8RA 2I67A 1TJNA 2OCKA 2P5UA 5LN1A 5HQ3A 4FS8A 5EPOA 1Z5PA 3Q0EA 3R7SA 1XZGA 1CUGA 2C2XA 3K71B 2JLBA 3LECA 2I6QA 1LSJA 3P9SA 4IW3B 2FU5C 4NC9A 4FBLA 2O20A 4R83A 4HDKA 2JS7A 1JQLB 2J9FA 3C3AA 5TV2A 1YZGA 4N7RA 2Y1OA 2WHPB 1XLTA 3VMFA 2IYEA 2X8JA 3EGVA 4QKQA 4UPEA 2HUNA 3D7NA 5CR9A 2ZK7A 3NP9A 1NX9A 4BP1A 1JWBB 3BXFA 1ZMRA 5EE5B 3I9OA 5CDGA 1ISMA 4OREX 4QXRA 1R9NA 3M5WA 3A1SA 4OUKX 4PLVA 3W9SA 1H8HD 3NU1A 1G9TA 4IIJF 1EIZA 3GA5A 2A57A 1W93A 1ESZA 1JLLB 2A4KA 1J33A 3O8BA 2Z0MA 4Y1FA 4E22A 1N3BA 4IDAA 2DUJA 3BEOA 4CMJA 2VYND 1HNNA 3PI7A 5BQ3A 3HMQA 4FKZA 5EWJB 5JSYA 5JHGB 1MXHA 3P0EA 3S2IA 3Q3CA 1A4IA 4EA9A 5GIPE 2QJWA 4Q3OA 5J9FA 1MX5A 2VQSA 3NKFA 2V97A 5TMEA 1XEAA 4P86A 1Z25A 3SS9X 1ZVMA 4OVKA 3MSXA 1CETA 4I9UA 3ZD7A 5JC1A 2ZBUA 4E70A 2FFRA 3OEED 2H9IA 3IP8A 2X41A 3HNRA 4DCOA 4HLUC 1M7GA 5TE9A 5B64A 4E51A 4YCNA 2HDNB 5DNCA 1H0RA 2IBMA 3I8OA 3OESA 1QB7A 2QHXA 4WN3A 3RRYA 4L95C 1TAQA 2PN1A 5JQGA 1RI5A 2ZWOA 3A3PA 1PEAA 1W34A 2RK3A 3AF3A 3CRW1 4K1LA 3GGPA 2O0JA 2H11A 4D56A 4DWWA 4IIGA 5JNLA 4KUHA 3ZHYA 1FDWA 2CNNA 1VJTA 3CZQA 4ALNA 1UINA 4LA4A 4RPLA 4A6EA 1SA0B 1WF6A 3PDHA 2EJVA 3RSSA 3A32A 3C4JA 1YA4A 4XWWA 1YDHA 5C37A 3R9IA 3BWDD 1PZXA 4EA6A 5LXTB 2JFNA 2F55A 2B83A 4LVNA 1YTLA 4TTSA 5SY4A 2J09A 1ABFA 2H59A 3A7EA 3LM8A 3F96A 1RE1A 2JJ1A 4FILA 4H35A 3GUVA 1KL7A 2CLIB 2GZ3A 4JT4A 1HDRA 1VMIA 3G0CA 3AM3A 4RJKA 3WBKA 2XMPA 3HUFA 1AXRA 4K9SA 4OQXA 4WOKA 1Y6JA 3HB0A 4KPYA 2XXAA 5JU6A 1WVMA 3GJ5A 2IS2A 4W1RA 5TPWB 1ZVVA 2JCGA 4BIMA 4B3GA 3CRRA 4JI4B 4Q3LA 4NYIR 3L84A 3M1IA 2JANA 2OHOA 3OJ0A 1E32A 1VCNA 2OFPA 1XLTC 2QDKA 2ZBQA 3I6QA 3IRVA 4HTFB 5EKDA 5ALTA 4CT0A 3EPHA 3HJBA 4P32A 5HJ2A 2RONA 4FKMA 3CH4B 4FPXA 5ESRA 2WKQA 3OQIB 1LC0A 1IB6A 2OGTA 3ZLBA 4GFDA 3RSLA 4AO6A 4RTJA 2CXRA 4AZVA 1EXVA 4XQGA 2OD7A 1YZKA 3E7PA 4CM3A 1KYZA 2L2QA 4I66A 5HF5A 1EK2A 5JS8A 1ATIA 1U1GA 2JJ2A 4IZ6A 4G4SO 3ELWA 1U0BB 1L8AA 5J40A 3V7FA 2CVHA 2VJPA 1ELOA 2I03A 3DMNA 5ARDA 1VMKA 5A3SA 2O8DA 1C9JA 1F14A 1GCOA 1M0WA 4S1VA 4JX9A 4YRZA 4N03A 1WDLA 2JARA 4ECEA 2VNKA 3MT7A 1DWQA 5AESA 2P0EA 3HY4A 1NVVQ 4BNFA 1LA2A 2FK7A 2CCGA 2E0IA 4HBGA 3F9CA 3RBZA 2Z1NA 1GPYA 1KK1A 2C9DA 4EW1A 5G4LA 2N47A 1JEJA 4DOMA 3KQSA 1EZZA 1OIVA 1QG2A 4RD0A 2RAPA 3OFJA 4OU4A 1WBBA 4DJAA 4N0EA 1G59A 1YL5A 4QLAA 1LLFA 4GXTA 1PNTA 5FADA 3KJFA 4GM4A 2HHLA 3WZMA 3ZZTA 4A5SA 1FF9A 1U7PA 1EP3B 5BWMA 3Q2IA 4M0EA 3P2YA 3OZUA 3ZWXA 1SBIA 2IYYA 4UM5A 5MHTA 1L7DA 1DG9A 3UMJA 2RGNC 4LRSB 3X44A 5AVZA 5ES4B 1KQOA 1CYDA 3PX2A 4HRVA 1J25A 1QIGA 4BFVA 4BNIA 3TZCA 4RIIA 3H19A 1KHTA 2FZGA 3OTWA 1KZHA 4RKYA 5C5IA 1NJGA 1Z33A 2FW6A 1C4WA 2CXTA 2NSHA 4P0TA 2QYTA 1U0EA 1I3CA 2AJTA 3RGWS 1UXJA 3F6EX 1PTJA 5TPZD 5BN4B 3OPQA 4U00A 4HH1A 1WSDA 3OZCA 4A1FA 4BJ6A 2AX3A 3V4FA 4KXWA 1L7XA 1SBQA 2NZXA 1OXUA 2HCTA 3HEMA 3JW8A 1AQJA 1JDNA 2OPHA 5ABPA 2VBIA 3DZ8A 2BKLA 1S5PA 1TM4E 2H63A 3D2CA 3KJXA 5KX5F 1EE9A 2YBDA 2HO4A 4XWOA 5HIMA 1ST2A 3BWVA 1W1IA 2WYVA 3CZMA 1DJLA 3A9VA 3DLBA 3T7CA 2IXDA 2R4QA 1YKFA 2OUIA 2XAUA 1DELA 4AS2A 1V3QE 1EZ1A 2YJTD 4Y1EA 1XRRA 3IJEB 1NBMA 3QFTA 2ZM5A 3N0RA 4G8DA 3VO1A 3AR6A 2RGDA 4PHCA 1TYCA 4NJOA 5JECA 1GWNA 1A9YA 3I4FA 2FWJA 2V98A 4BV9A 3VXKA 2EW1A 1I4DD 3KKLA 4OJQA 4U7HA 3QVLA 4N18A 5D86A 5D7BA 3T95A 2O07A 2A5DA 4ZVSA 2AWNA 3NAZA 5F2EA 3DMRA 2XNCA 3HB1A 1SKMA 3QE9Y 4WLOA 5FA6A 1HRKA 5KVVA 2QZSA 4WESB 4BP3A 4CMCA 4US2R 1FZTA 4IWYA 1AQUA 3S2UA 1SHLA 1U9IA 3R0JA 3WDSA 4KI0A 4NARA 4PN7A 1NVBA 2O0HA 3LQYA 5DASA 5HOQA 1Y1SA 1KFKB 4MQ5A 3VKWA 4S1OA 5JZBA 1OH5A 3CZCA 3SC2B 3BE8A 1PYOA 3EVEA 4RD1A 1CCWA 4PSCA 2OHFA 3LDHA 1IZ9A 2Z1DA 1OREA 3DBLA 3KOWA 3S1AA 1KYXA 3OPNA 3M5PA 2HNAA 4EHIA 3LHKA 4E09A 4KR6A 1G2QA 1XZFA 4YUYA 3W1WA 1R8SA 2YFHA 5H3HA 1P39A 2B21A 3CQ9A 1W7AA 1YIAA 3OPMA 1NUTA 4BFSA 3PEFA 4QUGA 3EEYA 1P6UA 1O7JA 4WL0A 3DO5A 4Z3KA 2C7VA 5FTNA 4ARUA 4F9FA 1C7RA 5AW9A 3MJEA 4DSUA 1Q7CA 3MK31 5CHEA 1DKQA 4ZCLA 4UCQA 4RANA 3ITDA 4DKJA 2POCA 3DVLA 4BLPA 1DIRA 2NYVA 1PTJC 4P2GA 1I6LA 3I9JA 2CHFA 4HWSA 4O4HF 3TPZA 1IMOA 1IN7A 1LPMA 1BNCA 2V7QA 4MA5A 1BHJA 1PUIA 3QPDA 4PW0A 2P27A 1D1SA 1ECJA 3C3JA 4HN4B 2XMZA 1Z6TA 1UEXC 3DVQX 4LE1A 1UMDB 3PRKE 5F1OA 4Y1GA 1A50B 4Q9LA 4QFDA 3R7FA 3W04A 2DR2A 5FOUA 3OJEA 3ZLUA 3UUFA 1B2RA 1H69A 5JAMA 1IN1A 5THQA 3LZ6A 3ZVMA 1V47A 1N6KA 3V1UA 1FYEA 2FH5B 3I64A 1DP4A 2QX8A 2V5VA 1U90A 3D81A 1FFAA 3D5EA 2V6JA 3F46A 4LY9A 2C3PA 2B82A 3EGIA 3RH0A 5CAEA 3ZV5A 3WGMA 2YWJA 1DC8A 3O1LA 4G0VA 3OJFA 1K5PA 3MTIA 1O9HA 1EUCB 2WHEA 3IYLW 3S4YA 3DHNA 3TMAA 2PUCA 4BEJA 1H2BA 1XTUA 4K9OA 1E3WA 1DJQA 2ZDHA 2J4DA 1HDXA 4WZBB 1Y7HA 3K7EA 3FSGA 2JCYA 3KEFA 2FX2A 4L8VA 3Q9LA 4DV0B 2NUPB 5IC5A 3EGXB 3S7TA 5AW1A 3T4UA 4TM7A 4LHXA 3OPYI 3IUNA 3V55A 3BWYA 2BZ1A 3HYSA 3EXG2 3KLPX 1C3XA 3PUJA 2EVWX 1Q7TA 3CCFA 4JOSA 1U3FA 4LY6A 3KUDA 4BLWA 2EF0A 4QXQA 1SAYA 5AVYA 1U9IC 4DV5B 1FRFS 2ZJAA 2QZ4A 3GYGA 3L8MA 4Q05A 1Z5OA 4CBVA 1JRLA 1M6WA 5EJ8A 3DDUA 1YQGA 1G8FA 2ALJA 4L78A 4B76A 2BMVA 4ER5A 2AOTA 2E7ZA 3TKLA 1OF1A 2J45A 2JAUA 3FYCA 3PVZA 3M3HA 4NBSA 5J5VA 3E9NA 3O93A 3RU3A 1UT8A 5LOVB 1ZCAA 1ONPA 1FDRA 1YHZA 4AUNA 2PUBA 9LDBA 3O4GA 4XWGA 5T6BA 3HJUA 1FE8A 3ZH2A 3JQDA 3GFTA 3OOWA 2FWRA 1Q17A 2PRIA 4MVJD 2ZU6A 2PUHA 2VJQA 1P8AA 5FLEX 2F1KA 3A26A 4PYJA 1RJFA 1NHWA 2IYOA 3W5SA 4JJGA 4ALKA 3D64A 2ZW9A 5HSGA 5I4KA 1ZOOA 3OPVA 3OLWA 3PUZA 4HRYA 2WJ3A 3N0WA 2P7HA 3OAAA 1TKRA 1L4BA 1WUHS 1DWOA 4PX3A 2CWWA 2FEWB 1AO0A 2J5QA 1T3TA 4FYJA 5JS1A 3ZDXB 2Y2UA 2WFLA 1RJDA 2HN9A 3HUEA 2A7XA 1YIDA 2W90A 4JLWA 4ZU6X 3HBMA 2OKCA 2V6IA 1RYHA 4OL9A 1QH1B 2JIZD 2A84A 2C5AA 2IK8A 5AWFC 3HYCA 5HZHA 3WRWA 1Z6YA 2NV2B 3H13A 2JFVA 2ZYSA 3RVDA 2G63A 2AKEA 5AUOB 2V7PA 3OJWA 3FFAA 1YQ9A 4J9UE 2O5CA 2A7QA 4GI1A 3UZUA 1OV6A 4QPCA 3TEJA 4JC8A 1L8OA 3S1SA 2O3SA 4PONA 4G9EA 1P91A 1OU0A 1DE0A 5FWDA 4DMUB 1HDYA 1GFIA 4YV0A 2XGGA 4QNMA 4XWTA 3CRNA 1O0CA 4OQ4A 4Q4HB 4RV9A 3ZE9A 4MYCA 1EBUA 3PLRA 1BE0A 1SKUA 5SZIA 1ZKMA 2CD7A 1N6HA 1X6VA 3K0EA 4L0MA 3NT4A 5FA5A 1M1YA 4OYYA 3NETA 1WVIA 3EPKA 3M81A 1K7CA 2G08A 1JQAA 1OROA 4NMWA 4ZRNA 2WUVA 3WC4A 4EW6A 4TTQA 4N5LA 1E9BA 2A30A 3DZBA 3IEIA 4P5EA 3RR2A 4BAUA 3L46A 3Q41A 2AJDA 1FX0B 3E15A 2FPSA 2FPGA 4RMGA 1MEEA 3L1HA 1UBMS 4G36A 5JQWA 2ZR0A 1U0HC 3KQYA 4QO7A 1G6KA 4C20A 1M67A 3M6UA 1V45E 3TLZA 2OAGA 3USCS 2BGGA 2ZRMA 3JYPA 4LVUA 4TXLA 5JSHA 4ABTA 1SCUB 2AB0A 1MB0A 3HA3A 2R2AA 3GFQA 2HF9A 5JVDA 2HJHA 1VYTA 1M74A 3GA7A 3MF4A 4JS0A 5HG0A 1JDVA 3K32A 4CF5A 1JYSA 4K1XA 1FU8A 1NSYA 4QHYA 5T4HA 4AC9A 1UXKA 3PCXA 5E3HA 5TQVA 4B32A 4D9CA 3IMCA 3IALA 1J7KA 4YP9A 3K6RA 1SXQA 4GI5A 4EGSA 3R2JA 4HF7A 5KYYB 2CLEB 1GITA 2Q0QA 3LT1A 4ND7A 3V8NA 2R5WA 4ZTZB 4JNKA 1PQ4A 3CMMA 1E7YA 4QDZA 1R74A 2C9CA 2IXBA 5CVVA 1V4NA 1GTL1 2ZT7A 1ZXBA 2Q3BA 2ZRHA 3HC7A 2ZTVA 3TW0A 3B1VA 5H68A 1XRLA 5L51A 4RHXA 5I01A 5COBA 3NYWA 2QYOA 3FCYA 1CY2A 3LLSA 3VYSB 2DCMA 1S96A 1NE7A 5LMUB 3QUCA 2VI5A 1RMQA 1REQA 4PSDA 4YJDA 4QLBA 5CEFA 3RK0A 1W36D 3GGGA 4GLFA 1TXGA 4KAXA 4U39A 1X9HA 3MCUA 3W3AH 3BXXA 4QU5A 3WLLA 1YVUA 1E77A 2WTMA 3PEEA 3C70A 3W79A 4RQAA 3K0AB 3RYHA 1A1SA 3N6RA 4MUKA 2VS1A 2X0RA 1G2OA 5B4TA 3DBRB 3L77A 1RM5A 1W5TA 3OCWA 4WFIA 2XUGA 4WE3A 3T7EA 3CUSA 5BSGA 1LB1B 3I2IA 1JR4A 2CUZA 3CUVA 2OYSA 1NG9A 3LC2O 2D1QA 3IL2A 4IH1A 4EFNA 5M04A 1N8NA 1SO8A 1TRKA 2GTPA 2VVTA 1FBTA 3QZUA 3RVPA 3L3BA 2BEWA 1D0VA 5K8JB 2WFAA 2YFYA 2H1HA 2G9VA 2IHZA 1U7WA 1ISRA 1VDMA 2C8VA 3ILXA 4ND4A 4PG6A 1APBA 3T1HB 2LPMA 4B4KA 1G16A 1R4NA 2R8YA 2EJUA 1H3FA 2FGKA 4E32A 1W36C 1KGSA 2DQSA 1KZ9A 1MTZA 2EATA 3HV2A 2W98A 4JYMA 4OQNA 3R76A 5HM6A 2N9UA 3LHIA 1TKAA 4M21A 3PFKA 3BMXA 5D3ZA 4YIHA 2I2CA 3AVOA 3AUYA 2OO5C 4PPFA 3U4CA 3AYZB 2GO1A 3UAXA 4G01B 4X90A 3FVVA 5BUSA 4RTOA 3B1YA 3NGLA 1B6SA 1TADA 4MCHA 3H86A 3MT8A 1QKIA 3VSEA 4D4MA 1WU7A 2WAXA 1M66A 2D2FA 2PEYA 3CS3A 3I2KA 2OP0A 3MUOA 5LA6B 2BFAA 1NQOA 2ZJ4A 5HBRA 3CWZA 3EWAA 5CBKA 2NIPA 2BZ0A 1QFMA 2Y1EA 1Z0ZA 4R9VA 2GYYA 4P80A 1Y1RA 2COEA 3D1LA 2BDEA 1Y33E 3G2PA 4MTLA 1Y6FA 1E61A 1NBWB 4KE7A 3FRJA 4RVFA 1MXFA 1ZMOA 3OJLA 3CLRD 5HCUA 2FZCA 2C4WA 3ZV6A 3SFTA 3HR7A 2HA7A 4TXHA 3C5CA 1PK8A 1V7CA 1EVIA 3MWJA 4HQ6A 4BCDA 3DWIA 3ZGZA 3RS3A 4X60A 2UXCB 5BSTA 1P4AA 1QRDA 4QTZA 4RNDB 1T2NA 1N6LA 3HYRA 5EEHA 1U11A 2QM7A 3E7WA 4R7GA 1UBSB 2RGGA 3KLOA 2RIRA 3AJ9A 5AXDA 3FR8A 2UYHA 3GJ7A 4KXUA 3H1FA 3JYLA 3TR5A 5JISA 2D1RA 2QYSA 3FTQA 3MG9A 2GSDA 3DFZA 4NFYA 5E2AA 3P0FA 3LW8A 1SN7A 2FCRA 4BMNA 4OUDA 5E4JA 4DZZA 3DPUA 2O8BB 3A36A 4FGKA 1XMQB 4KN9S 1W5AA 5IBRA 3WQHA 1BXZA 3E9EA 2OV1A 1TZKA 3FYSA 4JLDA 4LY3A 3PXXA 4OHMA 2GPYA 3VM6A 3W9YA 3CLRC 3JQ8B 1BE1A 5H0IA 1DTSA 2WMOB 3DCJA 3L2OB 3ZOKA 3TD9A 5C34B 4NI5A 4ESVA 1JG7A 2HJSA 4C43A 3VJMA 1MJGA 4G0YA 3TQFA 4K9RA 2QSJA 2Y6UA 4PANA 1FYDA 1DTWA 3OVMA 3EQ9A 4NTZA 4YDSA 2C31A 5FJJA 3Q7TA 1CF4A 1O8BA 3P2EA 3IT3A 2YMLA 4BVFA 4KQIA 1A69A 1XA0A 2SKDA 1JPJA 5JE8A 2FPIA 3D1JA 3G7NA 1IN4A 5THKA 3G8DA 1SOAA 4UMVA 4DVJA 2JLVA 1MZPA 3IDAA 1T4CB 1C0LA 2CXOA 1QANA 2PX4A 3EXG1 3U31A 1QRAA 4JI2B 1UC4B 2PWPA 1XPOA 5T8KA 2XH8A 2AXNA 3P27A 4KQ6A 4YRLA 3QJYA 2DECA 5JNVA 4EFDA 3UOAB 2YNMD 5DK6A 1MEJA 1V25A 1WQ1R 3ED5A 3L4BC 4PZAA 4QEDA 1SB8A 3NRBA 3SBOA 4FYWA 4UHDA 6Q21A 4JLMA 4K6GA 3CKLA 4NZMA 4ZOLA 5IK2D 3BFJA 3PRYA 2PX8A 3HVHA 4EI8A 4G0WA 1BA3A 3P9KA 4EABA 2A0WA 1YZNA 3O9ZA 1ZMTA 1P29A 2AJLI 3L7KA 3B20A 3OKPA 4U2GA 3JASA 2CV2A 1UKCA 2PZGA 1AZLA 4IOMA 1Q3HA 4NS1A 2CFOA 4EGQA 4R31A 3FX2A 4A7PA 4G24A 2H8KA 1HUQA 3GZNA 4WLNA 4WOPA 4XQEA 3X1YA 3Q3HA 2JEZA 4C4XA 3CUYA 4JJ7A 1ZDMA 4ALLA 4MVWA 3D2LA 3HABA 3TIXB 4D97A 2X0NA 1FNCA 4INAA 4L4ZA 4WT7A 1FDVA 3JARA 1J8MF 1CP2A 2QD4A 3KSDO 1OFUX 4YASA 2QRKA 3VDXA 1QC5A 3EUEA 4BVEA 4C4YA 4E1AA 3QYFA 1L5HA 2BY4A 3EY4A 4I1SA 1GEGA 4EYQA 1NLYA 2GBIA 1W4CA 3BHIA 1BS9A 3CB4A 3SSNA 4NYJQ 4ESEA 2DF8A 1N9GA 2XQGA 2ZSEA 3O8NA 3LTNC 2BLLA 3D6UA 1JAYA 1HL7A 3N87A 4RZHA 2GILA 4X8MA 2O4CA 3V8RA 4F4JA 2AMVA 2GAAA 3HXTA 4NBNA 4OQZA 2Z2YA 4RJ2A 2MR6A 2VP6A 1NUSA 1B6GA 1CXZA 1NVVR 3M6MD 5CVDA 3FTEA 3MPUA 3P5SA 4P81A 3WQBA 1DZ3A 2OFWA 1UJ5A 1XCGB 1FBNA 2HZ7A 4UBMA 2WWVD 2BKUA 2RHBA 3TKAA 2ZE7A 2PNFA 3X1ZA 1GG5A 4YAGA 2WSMA 1PJ4A 1DZIA 3KVRA 2AUMA 4TYNA 1VE1A 5KKAA 1XHLA 3AFMA 3JQ7B 1GU1A 4UEOA 4NENA 4MLZA 4IHJA 3ZUPA 1U7DA 3D31A 3NHZA 2NU9B 4L6AA 2YIDA 1N5RA 1XTRA 4M86A 2PRKA 4PXSA 3RVBA 4BGVA 3NOVA 4XXHA 2X7XA 4G63A 3MRTA 1GRNA 2J0UB 1HKUA 2QRVA 2AF4C 2PYIA 1B0PA 4YRBA 4QU8A 4JL8A 4RIEA 4TKVB 3K35A 5J2TA 1JHZA 1LBIA 4L4SA 3RLIA 3JQBA 5CM2Z 1YBHA 1CQZA 1Z47A 3EW7A 4LVCA 5G0TA 1O94D 3R3JA 2BGKA 1J49A 1XX6A 1M6HA 2A2ZA 4MQ6A 4Y18A 3AKCA 3ZWWA 2IWHA 4QULA 1T0JB 3RJTA 3HH8A 2VDOB 5IAEA 1GO2A 2B1RA 4MS4A 1FDSA 2QUIA 5JJCA 3HJGA 4IQ4A 4K0RA 4OXXA 3LO5A 2IHNA 1GKIA 2OCPA 1ZD5A 2I99A 3ORQA 4H6PA 1POXA 4R7TA 5IVDA 1DAIA 1LS6A 4W5WA 3G1UA 2PTHA 4DV7B 1ZYUA 2GHTA 5ES3A 1DUVG 4P33A 1UJNA 4DM7A 4LOJA 4B33A 1IULA 2AFIB 1Z38A 3CY6A 3DLCA 2AEFA 1TEZA 1FLDA 3KYDA 2MOKA 3CIFA 3WNDA 2Q5LA 1E5LA 1JHOA 1EVZA 1LLUA 2AE1A 4C06A 2IH2A 4I6EA 5DE3A 1XKTA 2CVOA 4IIDA 1QE3A 1W0KD 3EVAA 4DTCA 1HQDA 2JGRA 2L19A 3M1AA 4PSAA 1O94C 5DHAA 2NUBA 2M1ZA 2UUPA 4WD3A 3ZYCA 1Z2EA 2BCGY 5ALZA 3K5HA 1WZ2A 2G5CA 2B78A 2R6R1 2Q99A 1NW5A 1T3LA 3I01M 1Q11A 4YC7A 2UZ0A 1PK7A 2FF5A 2SBTA 3VHRA 4HEHA 1UANA 5AKZA 4JBYA 4AYTA 4BN0A 1DBIA 2ZAOA 3ECSA 4DDVA 2IPNA 3I5AA 4WECA 2JDIA 4D8TA 4Y2TA 1K3UB 2Q4BA 4LHSA 3ROPA 4EO7A 1A5AB 3DHYA 4MCIA 2XUZA 2BTQB 2QL6A 2VDMB 3THXA 1E66A 1OFUA 4NECA 1IOWA 3VR4H 4EI2A 4GZ3A 1T4DA 4GZ6A 3VU9B 2J3DA 4ZQBA 1JDBC 1VGQA 1XYYA 1GGVA 1WB9A 4DV4B 4V39A 2JNWA 2TRSB 2HHHB 3AEXA 5ICEA 2OBBA 5EESA 2VNSA 1CDEA 1E4YA 4HAVA 2WD7B 4EGAA 1JI0A 3CXRA 4Z4FA 4ZHQA 3WGKA 2ZRQA 5AKJA 3CZ4A 1CEYA 3O3MB 3VR2A 1B14A 1D07A 3GELA 3TL6A 2WDZA 4RK5A 4MO9A 1AQYA 2V9PA 5J2UA 1N2SA 1S7CA 4RPGA 4WZBE 1NPYA 2DHDA 3RS9A 2OFOA 3QVXA 3RE1A 1SVLA 3AY6A 2QKYA 1G20B 2WWHA 1W76A 3SXUB 3NJ4A 3OURA 4WCFA 2V8OA 1FFXB 3KXIA 5HZGA 3PV0A 2H8GA 1M2OA 1QYVA 1QPGA 5HW0A 1XOIA 1TQ4A 2GHRA 4L5YA 4FFBA 2FW0A 4H1WA 2BD0A 4KYVA 1YFKA 3DBHB 1JILA 3DV0B 4TLEA 3OWOA 1UZAA 4GMKA 3TI7A 3VZDA 2I91A 4MV0A 4YIKA 1NT4A 1SKAA 4NZOA 1OX5A 4PLTA 1NXWA 1UBNA 2FHSA 1GNPA 2QXTA 5F9MA 4YDQA 5A03A 3BK7A 1DMSA 3FMOB 3Q3EA 1GZDA 1NAHA 3A3YA 1NTOA 3GEPA 4RF4A 2RK6A 2WOJA 1MVLA 1E9DA 2A9JA 2XYHA 2NQTA 3MERA 3ERCA 3EF1A 4PO9A 4LMAA 4DLKA 4QOSA 3R1IA 3N8DA 1P73A 5A5VA 1XZBA 5EOVA 1FP7A 1II8A 4FC6A 1C8VB 1KP3A 2MINB 2O2EA 3BCHA 3KKPA 3GC6A 2FZ4A 3MNFA 2SKCA 3ENVA 4FYPA 5GM2A 2KQUA 2CBXA 3AT1A 2IQIA 4UAUA 5DXAA 5AXBA 1VL1A 5K2MA 3RSZA 3ZWNA 1GKYA 2OXCA 2A67A 1QZUA 3JYNA 4DYVA 3HJTA 1UBUS 3K1AA 3SP1A 4YXFA 4F4CA 1DDGA 2HT6A 3FWPA 2X86A 3RSGA 5HOEA 4NATA 1XN4A 2GPSA 3FLBA 3DZJA 3F3KA 4IOJA 3I34X 3UJ6A 1QLJA 1RQ2A 2F64A 2PKCA 2XECA 3NAQA 1JF8A 5HRUA 3OQHA 1WW2A 3NV9A 3TLCA 1KI6B 2W6JD 4L85A 1YOVB 1TAUA 3ND9A 1Z7BA 2QZZA 1BSVA 1MV8A 5KX5B 2WBLC 2DWCA 2JCBA 1JJBA 2A0YA 4X66B 4URVR 1QYRA 3AUSA 4MV9A 2DBYA 4OK6A 3D6NB 2ZU0C 4IZOA 3LO8A 2M1XA 1FTYA 5H80A 1CT9A 5IF9A 4L5IA 5D1NA 4F5WA 4PPQA 4JKIA 4KCGA 5I3ZA 3DLHA 4C4TA 4W4TA 4XZ3A 1DO0A 3SD7A 1R3UA 4JUIA 1TJ4A 4MARA 2YWXA 3MRSA 3UJ9A 2J4CA 5EHGA 3QFRA 4WXEA 1KRHA 2QDXA 2YL2A 5FPSA 2AZ4A 2H5LA 3OT5A 1RLUA 1K97A 2VCYA 3K8YA 3VR6D 1JIQA 2WICA 3V1YA 1UC5B 4KE6A 4KLCA 1MX1A 1OU4A 3MTDA 3P32A 1Z34A 2JGJA 5SZKB 2XSZA 3L8HA 3CO0S 4LZWA 3OKFA 4AJEA 4L4UA 2JA1A 3FCCA 4WCFC 2OBNA 1SULA 3H7IA 3N2EA 4LKOA 2NO5A 4ZD6A 2QY9A 3A70A 3UA4A 1Q1ZA 1QRUA 1WJGA 1BYIA 2BUCA 5DOVA 5A7GA 5F9HA 1VG8A 1AGYA 3OU2A 2R85A 3IHTA 1U2RA 4GGMX 1I01A 3CNOA 3ZLJA 3AF2A 3WOHA 1ECLA 3UTDA 1D9ZA 2PD3A 3A0UA 4YS6A 3SHFA 4LJLA 2IYZA 5FPPA 2P75A 3WBFA 2WJGA 4B35A 4X8OA 1ZRMA 2DTXA 3BTOA 4QBGB 4IFEA 4AN4A 2GETA 1GARA 3A58B 5ECWA 2H1SA 5TEVA 3TMKA 2R2GA 2C7BA 4LS3A 1Z17A 4A0QA 1ZZGA 1M9NA 4KGVA 5B3KA 2WWIA 2XT0A 4QHSA 2RIPA 2FNAA 3CISA 5I7FA 1A9ZA 1CF9A 2HMUA 2WHQA 5KNBA 1W5BA 1R16A 3HJCA 4YAEA 1VSVA 2OQ2A 3DBIA 3LG2A 3UMFA 1G66A 2OOKA 1E3LA 3EGDB 4YONB 4XEHA 1E0DA 1PG0A 2UDPA 4O02B 3QELB 4JY7A 2Y0DA 1NI5A 1TM5E 2RHHA 3O4IA 4H2DA 1Y4SA 4GYYA 1RLMA 4ZVKA 3H9CA 3VJKA 5K51A 3IBSA 4DEXA 2ZYHA 2G07A 3AY7A 4RKQA 4Y2QA 2ZKIA 1L5VA 1Z35A 1NVAA 2RGAA 1LSSA 3T8YA 3DMTA 2NO6A 3F47A 1GZ7A 2QTNA 3P9IA 5AK6A 4AURA 1YQUA 2Q9AA 1KE2A 1N2BA 3VVBA 4HDSB 1ONBA 3SCZA 4JFRA 5JNSA 4NV0A 2J48A 2VDPB 2O8FA 421PA 2PQ0A 3SZUA 1OJ7A 3KB2A 1U2ZA 2C54A 5DEOA 4WBNA 4BS9A 4LX0A 4DWJA 3RABA 5JNWA 4EY6A 1YR3A 3B8EA 2ATCA 3SZRA 2Z1MA 1ZGZA 1AB5A 1DFHA 3R5HA 2GAIA 3MGCA 1WMSA 2BF4A 4L4RA 4X20B 2MMGA 2IYRA 1MTOA 2IDMA 4EO9A 4I3HA 4G4IA 1J22A 1JMKC 2FP4A 3R0XA 4DUYB 3K53A 1JFRA 5KDDA 4NBTA 1G38A 3L02A 4EPWA 2VHWA 2LIVA 2P5TB 2ZJ5A 3IFSA 4GWLA 1H5QA 2B25A 3FZGA 4OHCA 3HVIA 3VRHA 5DIZA 1JH8A 2H08A 1JAHA 2ZAYA 3GN2A 4GUDA 3SMVA 3GRKA 3HUDA 2C04A 4XB1A 1XHEA 3FNEA 521PA 3V46A 5COQA 3E22A 1T8YA 2YZKA 4B3JA 5JYDA 1TFRA 4QLOA 3VYWA 3RARA 1XJ5A 4F56A 3WWPA 4Y0VA 1LI7A 4MVJH 2PL1A 2P7IA 1YDFA 1VBNA 1NY5A 5CDFE 1P2GA 4Z3DA 2JLXA 2ZGVA 1JE0A 2I1QA 5B37A 3OETA 3QX3A 1SD2A 1CR0A 1J2RA 1JW9B 1QFYA 1EFTA 1U0NA 1RTKA 1VOTA 2ON6A 3OM1A 5FBHA 5IABA 1M5RA 2QBYA 1S8AA 4DCMA 4F85A 4KFCA 2Z9CA 2F9LA 1XRPA 3GG9A 1N5MA 4PWZA 4XFDA 2YHSA 2VUUA 3IP1A 4RHYA 4V0OA 3VZBA 4ZEMA 5CM8B 4Y6RA 2ES4A 4L5BA 4P4UA 5IJ0A 5BWOA 5E9AA 3TO5A 3VSCA 2AQKA 1V1MB 3OY7A 5JVDF 2XNDD 4M1WA 4GO1A 4Q0MA 1QX4A 2YH2A 4M55A 3RVJA 3ZZ0A 4B83A 3NGMA 4KV7A 2WLTA 1D3AA 4INPA 4DBVO 3EWIA 1U0TA 2FWIA 1Z0SA 2BL4A 4KB5A 2DTDA 4G5YA 1PLLA 5DBOA 2IPXA 4ZAFA 4KAAA 2R1ZA 2JJ8A 5DYYA 5C5CA 4NNOA 1C7EA 5J5AA 2PUDA 1X7ZB 5AK4A 3B1JA 2RE8A 2AZXA 5BOSA 4NIMA 5AUNB 4N82A 5LLTA 3DVRX 3ELDA 3M9LA 4OOEA 4P98A 4ZEOA 2EGUA 2MYPA 1ISSA 4P3YA 1X8XA 2RAFA 1LXCA 4P3OA 5L7WA 3BF7A 4AP5A 2ZTUA 3BIWA 2AG6A 3H2HA 4I46A 3I04A 4UUQA 4AFNA 4DNPA 4RPJA 3UCFA 4HYYA 1TQ6A 4WK0B 3EASA 4GOLD 1WD5A 4X92A 4BEVA 3SX0A 2WWFA 3NPMA 5JO9A 2HV9A 3WX0A 5JCPA 3NEPX 3ADCA 3KKOA 3RFXA 3E9MA 5TMBA 2FK8A 4D5EA 2PNJA 1LSUA 2V7XA 4PNPA 1MF7A 3WFJA 3IP9A 3TZ6A 1XQYA 2BZSA 4NCKA 4PLPA 1AKUA 1ISIA 1G0NA 1JGTA 2ILTA 4RC9A 3O5AA 2OA0A 4LFBB 3AJEA 2JFQA 1YOBA 4ME6A 4FQ7A 2BGJA 4LXIA 1ZP6A 4J1NA 1V1RA 2W2NA 3I42A 1V4BA 4G25A 1MO4A 1JSZA 4QOJA 1E8NA 4U2CA 5F77A 4AICA 1W73A 1ZD8A 1UIRA 1L7PA 3MGKA 2HA4A 3ABQB 3ICCA 5LYJA 4OA5A 4JT9A 3EEIA 1LK7A 2X0IA 8ATCA 4JJEA 4K88A 4FHCA 2C1XA 3RROA 2CMHA 5M2QA 1Y1PA 4XGIA 2VK4A 3QFFA 2HA3A 1KO1A 1UKVY 1LLQA 1GU0A 3OX4A 1G21A 3N8NA 4GE0A 3BXPA 1MBZA 2RGYA 3I0ZA 2OOSA 2R97A 4UHBA 1YI0A 3BXHA 5ENDA 4BYGA 4CN9A 2Q8NA 4HMOA 5KB3A 2IHYA 2Q1UA 4FJ2A 4GD3Q 4PVDA 2RGBA 4CM9A 2GEVA 1VJ5A 5CIYA 3SJZA 2J9XB 4WV3A 4TV8A 1Z5VA 3UGQA 2CVFA 1WCIA 1YUBA 3L43A 2OAQ1 5AVUA 4Q7LA 3GI1A 2X0EA 4D02A 4N01A 3BWMA 4KXFB 1G2IA 4ZMBA 2E37A 1VPDA 2VRNA 2QX4A 2IELA 3DNMA 3G9TA 2HM7A 4J2TA 3WDMA 4CTJA 2W2XA 3DOEA 1U02A 2O3QA 2PKEA 2NYRA 3BXOA 4PZZA 5BW4A 2G4LA 1JZSA 1M7HA 1P5FA 1S2IA 4PHFA 4RCZA 1L5MA 1KR5A 2ATIA 4Q19A 4BOYA 2H2FA 3EBLA 4BEBA 4EHBA 5BXYA 4RFSA 2GCPA 5CB0A 3DL2A 5CD9A 4L4YA 5IRCD 1E7MA 2DX7A 3ZHOA 1W30A 5ECYA 2J7PD 5FXMA 4L27A 3ZHXA 3NWPA 3VPCA 4GVLA 1S2OA 3NWOA 2BGRA 4JI6B 1RAEA 4EPRA 3GUHA 1OFHA 1KY4A 1S2DA 2GEBA 1JZQA 2NSJA 2R3SA 4O29A 1K5GA 4Q3CA 4XQ0A 4O2AA 3PGKA 4AY4A 1XJ0A 2XWSA 3WQQA 1E2FA 2BRUA 5AKXA 4URXR 4DDWA 4CJXA 3R6GA 3I30X 4A8JC 4C4OA 1PS0A 2Z4TA 2I4NA 1IVYA 2XDYA 2LBPA 4UE2A 4D9MA 1H94A 2PJUA 1NJ1A 3R75A 3UJNA 4QBHA 2YVKA 1K4YA