3GVMA

Structure of the homodimeric wxg-100 family protein from streptococcus agalactiae
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
96
structure length
96
Chain Sequence
GAMSQIKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein SAG1039
publication title WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
pubmed doi rcsb
source organism Streptococcus agalactiae serogroup v
molecule tags Viral protein
total genus 41
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3gvmA00
4I0XA 3G80A 3FD9A 3ZBHA 2DE0X 4I0XB 3O9OA 2AZ2A 4LWSA 4GZRB 3Q4HA 4LWSB 3GVMA 3HR0A 3OGIB 2VRZA 3TXQA 3Q4HB 2B9ZA 2AZ0A 1WA8A 3FAVA 3TXSA 2KG7A 1WA8B 2VS0A 3FAVB 2KG7B 4ABMA 3GWKC
chains in the Genus database with same CATH superfamily
3JSNA 1YTFD 3ABMB 1BGYH 2HFEC 3UO3A 3S3WA 2F23A 4DV2B 1KD1W 4PA4A 2P7TC 2ZQMA 2F95B 2Q7GA 3RYHA 4MTGA 1RPRA 1XNQO 4KP4A 1H2MA 5DECA 3OTOB 1UJWB 1SA0A 3T1HB 1ZWIC 5LGNA 1F7YA 4U3JA 4F6RA 2F4VO 4MS2A 5EK0A 3SYPA 4X62O 1YITV 4JTDB 3QG5A 4UB6Z 1EZJA 4K3AA 4PJ0Z 3P32A 1WA8B 3CE2A 1W59A 5K1PA 3UO2A 1GTOA 3EXAA 4AQYO 3JD0A 1U96A 3HKCA 3THOA 1D2DA 1Q90D 2GSMB 3S3XA 5EC1C 1XQ8A 3H01A 3H9VA 1SQPH 2UUCB 1Q5OA 4H13B 2X6BA 4I9WA 4I7ZB 2ZINA 2CE4A 1B06A 2X0LA 2Y48A 3K06A 5B3SC 4RUEA 1VP7A 1B6QA 4PDMA 2Y4TA 2AGAA 3OMNB 4CH3A 4GX2A 2FKXA 1K73W 2DOSA 1F4MA 2ZT9B 2DYRC 3P3NA 3TETA 1FYJA 4LP8A 3IFXA 2E3CA 2WLIB 3D36C 5EIBC 1WPBA 1VQOV 1ZSPA 1H8HG 4R50A 1XILA 4N21A 1VQNV 2R72A 4DV2O 5CBGA 1VF5B 1QLEB 4PA3A 1M56C 2Q8VA 4P9PA 1WP7A 3VQXA 1GN2A 3TJTA 5LOVA 3ABKB 5HFLA 2IU0A 5CBFA 3T1CA 3B8NA 4FLYA 1IBMO 1VQ6V 2GUZA 3PN1A 4TUYA 2MW2B 1K92A 3CPWU 4LH6A 3ZHVA 5JH7A 1MSDA 3W7UA 3UT5B 4DR5B 1N4CA 1NTMH 3AK2A 4CH6A 2CGOA 2QR4A 1XOUA 5IJ0A 4LNUB 1N33B 2WLHA 2ZR3A 1GN4A 2VS0A 2UXCO 3HPLC 1YJNV 2WA3A 2K9PA 3JD2A 4JGSA 4O2BB 2A06H 4GT1A 3EVKA 4NXMO 3JD1A 1M57C 1ENVA 1MMMA 1QBZA 3TGUH 1PPJH 5B1AC 2UUCO 2UUBB 1OHHG 2RQ6A 3B77A 1OCOB 3CRAA 3AG7A 2GDSA 2O57A 4IIJB 1VQ4V 3ZX6A 2HLDG 5L3BA 1YCIA 3E83A 3HKDA 1GH6A 1PP9H 4C7UA 4I0XA 2HP8A 1XNRB 1BQZA 2PF4E 1QHTA 2JEXA 4LR3A 1TGOA 3RYIA 4X1YA 5J2UB 1S0VA 2KKWA 3FFQA 3E8HA 1QLNA 3SGIA 3HKBA 2R9AA 4ZKIA 1Y76A 1KKCA 1IXBA 4QE9A 3SJCC 4HYOA 4F6EA 1AB3A 3RYCA 3OR6C 1Y6XA 3RYFA 4BW5A 5B1NA 5LHHA 1ORQC 1DGSA 1TUEB 1J95A 4JI7O 2PGGA 2GTAA 1JPXA 1NI8A 3FAVB 5KX5A 4YJ3A 5LP6B 3K04A 3ZJZA 2ZM6B 3CC4V 1Z2GA 4P9OA 3T2MA 4DRXA 1EZVH 1O9HA 4MVRA 5BMVA 1Y74B 3JAWB 2WLKA 1N33O 2PTMA 2FMLA 2ZKOA 2HKOA 2GV9A 2H94A 2A79B 3JCUZ 4FLZA 5L3CA 2ZDIA 2QTSA 3FB5C 4X1KA 1WB7A 4LCUC 3A2FA 1NBMG 5B1BC 2MK3A 4GUNA 2UUBO 4I9QA 1VARA 4JZGA 4LF4B 4TV9B 4DR7B 2P06A 4J7KA 2OCCC 4PI0A 2UU9B 4TWKA 5EC2C 3E35A 3ETQA 1NQTA 1AI5A 4DV5B 4BWAA 3CEIA 4MSWC 1XNRO 4B3TB 4JAAA 2LGQA 3G6BA 3T1YB 5LBQA 4LF8B 5IWAB 4JI6B 4AILC 1F23A 4CZZA 4G28B 1VMGA 3ASNB 3G67A 4DK0A 5IDJA 1L0NH 2LFSA 3DC6A 1K3EA 1SKVA 4FIPC 4O2AA 2XNDG 3L73H 1K8AW 2HJDA 1OCZC 3M7MX 3BPZA 2WLMA 1N36B 3T4ZA 2NNUA 3OT7A 4X1IB 1RM1B 3RFRA 4MTFA 1Q86W 4PELA 1E1RG 2EZOA 4P2ZA 1FXKC 2Q0AA 3SR2C 2RJZA 3JD3A 3GWOA 4W4LA 3RGBA 1E79G 2ZM6O 5JJEB 1QCEA 5FNVB 1ZUQA 1M4UA 4NXNO 4NR1A 4CS3A 5KHIA 5EZYA 1S76D 5JCOA 5JWPA 2ZE5A 4CS4A 3JAMN 2HG5C 1JOYA 1G4YB 1KKDA 2P5OA 5FL7G 2QA4V 1SQBH 1IZ3A 3DGEA 1R3KC 3FYIB 4X9QA 1LUWA 2OWOA 4PA9A 4O4JB 4JI8B 2EJRA 5H6QA 5L3DA 3FB8C 2DN9A 4LWSA 1NR1A 3WB0A 3KZIZ 2YEVB 2QWRB 5L3EA 1CP9A 2Y4UA 1AR1B 4LF4O 2R9IA 1M93A 2VQFB 2C2AA 4GYCB 3ABTA 4DR7O 4I55B 4J42A 4O4HB 5CA0A 2UU9O 3TXSA 3CD6V 3SJQC 4DW0A 3UM7A 4TV8A 4UB8Z 3BCCH 3FKSG 4LFBB 4B3TO 4L8JA 2YXLA 3K5NA 3T1YO 1FFXA 3A0HZ 4UCVA 4LF8O 1HR0O 2X6CA 2QWPB 4IYIA 3OFNG 3LNNA 2BOCC 3MAQA 3W7XA 3E89A 1FPOA 3CS5A 2OT5A 4I5SA 3X2QC 3T4DA 2IJKA 4O4LB 3BY6A 3CRQA 3DC5A 1D5NA 4NYKA 3M99B 2EILC 1YVWA 3EFFK 3CX5F 2DYRB 1N36O 1Y4MA 3F7YC 3OGIB 1NU1H 1Q3EA 5GTIZ 1AR4A 1SESA 1S5LZ 2ZDIC 2WLJA 2PZSA 1H2SB 4LF9B 1RSOA 2N05A 3B40A 3ZMVA 1DF5A 4J7JA 1AJNA 2IJIA 3HKEB 4X20A 4X65B 2XTAA 3UQ8A 1XMQB 2V7QG 1QNMA 2K1EA 3ZHRA 1Q6UA 4P30A 3ETEA 4BR6A 1AI4A 1D5AA 4I50B 2OTLV 3JALB 5L3FA 4X66B 4JV5B 1KU9A 4ZOLA 4LFCB 1R6KA 4BW9A 5B5EZ 3A0BZ 1W0JG 2YIAA 4DUYO 1IBLO 4G2KA 3H1LH 1PNKA 1IX9A 3RVYA 4H44B 4K8XA 1LUVA 2YDEA 2ZIOA 2X7RB 4DV3B 2RN9A 4JI4B 4UCSA 5LYJA 4CBCA 4U3FH 1YDXA 2VQEB 1R6TA 5GONB 4JF3A 3Q4HB 1U97A 2G38A 3JAKB 2VQFO 2A3QA 1PNMA 5F2VO 2JGUA 2P90A 3AG1C 1PL4A 2HHHB 5CB4A 4K35A 4ABMA 3CYOA 3DXRB 4LFBO 1K5SA 3IC9A 1QVGU 5LMNB 3C3TA 2CDYA 2BSKA 4KHPO 4H33A 1JFFB 4CH4A 5CN0A 4ICGA 4CS2A 4Q6GA 3K57A 4XDKA 4CH5A 4DR6B 4D7SA 2WSSG 1GN6A 1DF4A 4UXNA 3N2GA 4B7EA 1I5YA 2GBOA 1LR1A 4BIUA 3R66A 2XOKG 5KUMA 3LNMB 2DYSC 3KCYA 3M8AA 1TUBA 3AG3C 4F6RB 2QM7A 5EYPB 3ABLC 2A0LA 2GHYA 2H3OA 4K8ZA 5LL6Y 4LF9O 4JI1B 3APQA 1N34B 1XI1A 2JEUA 4X65O 1MSWD 3JCZA 1BCCH 2Q67A 5LA6B 3H1KH 1OCRB 2XUMA 3O9OA 3VQYA 4EEQA 4IHJA 3HKCB 5H6RA 2IH3C 3G4SV 4JV5O 3L72H 4LFCO 2UUAB 1ZLZA 4DR2B 5KAIZ 3WB2A 1HNZO 5IYDO 2ZXWB 1KP3A 1WB8A 2UXXA 1VF7A 3K5LA 1IBKB 4JI4O 5D5PA 4ZHQB 1V54C 2VQEO 1YXBA 3U11A 3H1IH 1GM8A 3CCVV 2N74A 4YHHO 3D3IA 3E2EA 2RNBA 3K79A 2QWOB 2HHHO 1DLBA 5IY5B 3IAYA 4HNAA 3K08A 3K0DA 2E5LO 5A2QN 3OMIB 5LMNO 1EN5A 4DV4O 1AI6A 2IJJA 2Q4PA 3OM3B 1I7FA 3LDEA 4NVPA 5E79Z 5KLVH 4RAIA 1SETA 4DR6O 5LOVB 2RCVA 1ZTEA 2BTQA 3AEIA 4TOIA 2JJ2G 2GUZB 1ZX3A 4TUYB 2W0FC 1TAEA 5JH7B 1AP5A 2F66C 3CXCU 2D2CB 5IJ0B 4JI1O 1NVPD 1N34O 4X64O 4NTXA 1CPYA 3CJHA 1I5XA 3PJSK 4KUMA 2W6JG 5KUKA 1PM9A 2Y69C 3ZBHA 4FJCC 2OCHA 3I55V 4OPAA 5K1XA 2ADQB 3RT3C 5CBHA 2EX3A 1VQPV 2UUAO 4DR2O 1B3QA 4JYBA 3OD4A 3N2KA 4UV8A 1SQFA 2H8PC 4B7KA 3SYCA 3JATA 3TK1A 4WBNA 3C90A 3LSUA 3OTOO 2IW5A 4I0XB 3WG7C 3RN4A 3T1HO 1K34A 2CTRA 4R8CA 4LF7B 3CRRA 4AHCA 2OYQA 2YIBD 5DM6V 5A9GA 4X1YB 1R6NA 1CXZB 4ZI7A 1US6A 4MW8A 3ZCCA 3E8FA 4B3MB 4FLWA 3HKBB 3F7VC 5BXZA 3CCMV 1Y76B 3H1HH 2M6YA 1YEWA 1M90W 1FJGB 1HW7A 3C3SA 4J11A 3STZC 1FXKA 3R65A 3SPJA 4KL1A 1K4CC 1BE3H 4MVZA 3HB3B 4TQDA 2VWJA 4NKGB 4JI2B 4YY3B 1P7GA 2EZPA 3CXHF 1V9PA 4YJ3B 2IH1C 4JAUA 2Z5UA 1H2NA 4GZRB 3AG2C 2DW4A 2HEPA 1S3JA 3QNEA 1ZAUA 2R9RB 1BS3A 3BAAA 3ZRVA 2EIMC 3VOUA 4ZBMA 4FMTA 2ZIMA 3BABA 4H0LB 5BMVB 4LFAB 3FB7C 4LC1A 1LNQA 2OIGA 3ML0A 2ITDC 2P4VA 4NTYA 2A7WA 4X1KB 3J80N 4UVAA 3SJAC 2E76B 4LNUA 2NR5A 4FLUA 1KP2A 2EIJB 1K5QA 2V1DA 2Q0OC 2PY5A 2YICA 1GK9A 2YS8A 2ZR2A 1Y66A 2ZNIA 4JPRA 2QKCA 1SERA 4DR5O 4LF7O 1V55B 1M9NA 1ZL8A 3G6EV 2W0XA 3ABMC 2YXYA 2QWNB 2ZE6A 2ZE8A 1FFTB 5KMGB 2NN4A 3E22A 1FKAO 4B3MO 5CA1A 3L70H 2WA4A 4O4IA 1G6UA 3G80A 4XDJA 3SYAA 2P4KA 4YJ2A 2EIKB 5EBMC 4QIWF 4KXRA 2WWWA 4I4TB 4MVOA 1JMKC 4FLTA 4WFHA 1P49A 1EBOA 2JS3A 3AG4B 1R3IC 4DV1B 3K3WA 2F93B 4LH7A 1SQQH 1BMFG 2QE7G 3VBBA 4G27B 2VRZA 5EZYB 3CB2A 1BSMA 2XAGA 1GN3A 3A8TA 5E1AC 5FLXN 4MVMA 2QKSA 5LHIA 2B1GA 2JDIG 1MZEA 2CH7A 2EINB 3FAVA 1PV0A 4LFAO 5LP6A 1Y67A 4QJFB 3CRMA 2YI8A 1OCCB 1K9MW 1SQGA 4WFFA 4PD4F 5LXTA 2UXDB 1NS1A 4JI3B 1GRJA 5JQGA 2Q7HA 1WJZA 3BFRA 4LWSB 4YIOA 3B8MA 1H2KA 2RDCA 3JAWA 1FXVA 1XHZA 3NR7A 1JA8A 1NTKH 3O65A 1XL6A 4YIPA 3ZMZA 1VQLV 3LSSA 5IYZB 5CA0B 5CMUA 5H2FZ 2PYLA 5EBWC 1VF6A 3APOA 4GX1A 1MOFA 2OTJV 1DK1A 4TV8B 5KHJA 2Q7EA 4DR3B 4FK5C 3CCSV 2UXBB 1Q8IA 1XDCA 1FFXB 4JI0B 4R6ZA 4TV9A 1H2GA 4FVMA 5B1OA 3CSXA 4JZ2A 5LMUB 2JVDA 4W4KA 2XAQA 1QLEC 3MHSC 4FZ1A 1IDSA 1MABG 4JYAB 3JARA 5JVDB 3CHXA 4UVBA 3K03A 3ABKC 5C93A 1MA1A 4Z2WA 2Q68A 3W7WA 1HNXB 4FZ0A 1QR8A 3ETGA 4IT5A 2QDOA 4OXSA 3CCRV 3BA8A 2XAHA 2YI9A 1PNLA 1RSOB 1XREA 1HDJA 3JASA 4WFAV 1YIJV 4GKKB 4D7TA 4DV5O 1SC5B 4BIZA 1N32B 3IGAC 2QWQB 5IWAO 4JI6O 1F4NA 2WLLA 1VIBA 2L35A 3U10A 4GKJB 5B3SB 1N0NA 2KG7A 4JI5B 2KQXA 1VEWA 2DJVA 3LUTB 1OCOC 1NKDA 4HAMA 4J41A 4JYCA 1BHAA 2Q73A 2L6LA 4JI3O 5LYJB 2ETNA 3OR7C 2KB1A 3K0GA 4FFBA 4DW1A 1H38A 2QSAA 5IJ9A 1NTZH 3ZRXA 4F4LA 5ITZA 2YIBA 3GWKC 1UFIA 2A9HA 3D3QA 2YEVA 3L9DA 1M56B 4DR3O 2HJFC 4PA7A 4JI0O 1SZXA 2RMKB 3GVMA 3A0RA 4O4HA 2BSKB 3SPCA 4D6TH 3WG7B 1BHBA 2JRIA 4WF9V 1Q6HA 2EULA 2QJ1A 3AK3A 4JYAO 3FD9A 4JAVA 1JR9A 4JI8O 3N2GB 1K4DC 3OUSA 2Z3YA 5LP6C 1IXMA 3DSQA 1TUBB 3TXQA 2QKAA 4Q20A 2AZ0A 3WFVA 3ZRWA 1K33A 5C8YA 1XNQB 3UCSC 4GKKO 2ZCEA 2CTQA 1VQMV 1M57B 1AI7A 3SPIA 5H9CA 4UCTA 1PD3A 4JYYA 5B1AB 1TVKA 5DEDA 2F4VB 3WB1A 1WN7A 1S72V 3D8CA 1VF6C 4IHJB 4UCOA 1KQSU 5J2TA 4FLXA 1SRYA 4FFKA 4GKJO 4JI5O 3H1JH 1SS3A 1J5EB 3RYHB 3MD0A 3OUFA 3FX7A 4I50A 4DUZB 2EIMB 4MTOA 2E75B 2P67A 1W2BU 1SA0B 1FXHA 4U3JB 2BE3A 4WCEV 1HWYA 2AW9A 4U7OA 4HZ3A 4X8AA 1M5IA 5AG2A 4B08A 1JVMA 1AILA 1NZ6A 1KC8W 2NLJC 2LP7A 2LFRA 1XMQO 4HNAB 3ETDA 3ASNC 3JSLA 3CWBH 3CRCA 1XMOB 4JTAB 2F1MA 2CAZC 1TA8A 1EN4A 3HR0A 4X66O 3AK1A 5IE9A 5LGUA 2QTOA 3ZEDA 5FPRA 1VQ9V 1AP6A 5L3GA 4PA6A 4XBFA 4IGGA 3I56V 1T5EA 3K5OA 3DXRA 3QF7A 1RM1C 2BTQB 5TISZ 4DV3O 2DMXA 2AHZA 1JX9A 2CTPA 2DE0X 2YXHA 1AR5A 3B09A 1L1FA 1XUQA 1JFFA 3VQVA 4JTCB 2N04A 4NTWA 4J7ZA 4QPJA 1MNGA 3W7SA 1JJOA 1WP8A 1GAXA 2ZNJA 1YSCA 1IBMB 3CJHB 4MTXA 1YF2A 1AROP 5B1BB 1GMGA 1R3LC 4PV1B 4GX5A 4DR4B 5EYPA 2OCCB 1KYOF 4EB6A 2QGNA 3ASOC 2XAFA 3RVZA 2Y0PA 3IC7A 2JGDA 2Y0IA 2Z0AA 5B66Z 3P30A 4PDLA 2UXCB 3N2KB 3CCLV 1J5EO 2X6AA 5LA6A 1BL8A 5LHGA 4DUZO 1K7DA 3I5DA 4WBNB 3JATB 3NXSA 2CUGA 2QM4A 3G71V 4NXMB 3RW0A 4EFEA 1KECA 1YJWV 3CCEV 4GCZA 3JD4A 5D5QA 3RBZA 3K59A 3ZN0A 3KKYA 3CCJV 2IBZH 4ZI7B 1NH2B 2HVJC 1OCZB 4TQFA 4DXWA 4Z1MG 1THZA 3VQWA 4ZHQA 4IYHA 1H2LA 4UVCA 3J81N 1XMOO 1G8MA 1URFA 4LBEC 1K97A 1AJQA 1FXKB 4X89A 3CC7V 3TCUA 2JJ1G 1WA8A 3ZS8C 4MVQA 1YHQV 3ZMUA 2Q9LA 1EN6A 1FS0G 4LF5B 3HKDB 1IBKO 2YUAA 1R3JC 1XL4A 2QEXV 2VWKA 2JK5C 2FB5A 4RQEA 2GTSA 3MDSA 4K0KB 4FLVA 1ROPA 3RYIB 1MG1A 4JI7B 1COWG 1NR7A 4PDVA 2P6JA 4J9ZB 3LDDA 1QU7A 2ZD9A 4LF6B 1PKXA 4DR4O 3KCXA 1FAFA 4AI8A 3QVNA 1VQ5V 4J9YB 1Q81W 2AXTZ 3RYCB 3RYFB 3BHPA 2FTKA 1M1KW 4QNHB 5KHGA 2WLIA 2ZE7A 1KMIZ 3BEHA 4N23A 4BIOA 2E74B 3OGCC 2HR3A 1HNWB 4NB5A 5KX5B 3OW2U 2HVKC 2PYJA 1XEQA 5KAFZ 5HFMA 1OZ0A 4MVUA 3ZN1A 1R73A 4UCRA 1ZL8B 4DRXB 1F51A 1FD9A 4TSFG 3X2QB 4UV9A 3OEEG 2LW7A 1X59A 4PDRA 2EILB 4J10A 1KUQA 3E22B 3L71H 5FPOA 5EIBD 5CA1B 1BQ0A 3UT5A 4YXWG 4O4IB 1SQXH 4RQFA 4DV0B 4YJ2B 4DR1B 1IVSA 2DWEC 3CCUV 2Q5ZA 2B1IA 2WAMA 1VQKV 4O2BA 3CP1A 3L75H 5KA5A 4LF5O 1Z5WA 4FM2A 1S5HC 1MZFA 3ZIAG 2KSDA 1JJ2U 2PI4A 2BCCH 1Q7YW 4QE7A 4K0KO 1OCRC 2ITCC 2FYUH 4IIJA 1YTFB 1O9GA 4J80A 2XT9A 1VQ7V 1P7BA 2CH7B 4GX0A 1I08A 5BY1A 3QTCA 1E1QG 3SJBC 1Q82W 2OIEA 3F5TA 4LF6O 4DYLA 4O2AB 1FJGO 2ZXWC 5DN6G 4IL6Z 4NXNB 1EM1A 5LXTB 4MW3A 3AG1B 5J2UA 5JQGB 1JCHA 4RWUA 2BTOA 4JI2O 4KFMA 3ZHTA 4YY3O 4FM1A 1HNWO 1I0HA 1RFYA 3SDLA 1QVFU 3LSQA 4MT8A 3ZHSA 4UCUA 1A32A 4A5UB 1WLEA 5IY5C 3B2EE 5CA3A 1WPXA 3BA9A 2EJ7A 1G1XB 4DO2A 2R70A 3QO5A 4E4EA 5LGTA 3SYOA 2DYSB 3AG3B 2Q69A 3ABLB 2YC0A 3JARB 3E8BA 4B3RB 4DV0O 2IJHA 4DR1O 1HR0B 4E2LA 4B3SB 1Y74A 4DV7B 1UPGA 4XDLA 2Q6AA 2B9ZA 3E8GA 1AJPA 4L87A 5KMGA 4CC6A 5BR8B 3SPGA 4Z1VA 3JASB 1EFRG 1WNSA 4RUFA 3OTFA 3K9AA 5KHKA 1NVPB 1GM7A 4OX9B 4I4TA 1CEZA 4PHZA 2LJ2A 3JYCA 3MHHC 3U0ZA 1N0JA 4R7CA 2JS5A 2ODMA 2WLLB 5EBLC 1QQCA 1V54B 2KG7B 1L0LH 2DQ3A 1RP3B 3K9SA 4FPPA 3CCQV 1NT2B 5IYCO 1R1BA 1QR9A 2WLNA 3KG2A 4WFBV 2PUSA 3FYEB 1I94B 2XASA 1NJIW 2V4DA 4FFBB 3SYQA 4DUYB 4EFBA 4HBNA 3F5WC 1IBLB 3OE7G 4OPHA 1Q6IA 5IJ9B 2ARHA 4OGQB 4DV1O 5ITZB 2YIDA 4X20B 3IJ4A 5GTHZ 3ASOB 5GW7A 1KB9F 3CMEV 4X1IA 2D3OW 2IM9A 5KHHA 1SF9A 5IYZA 1N8RW 3ICXA 4ZOLB 3LDCA 4TT3G 1VQ8V 2BOBC 3N27A 2ATKC 3L74H 1BT8A 1W0KG 5FNVA 4CC5A 3J7AU 1NH2D 4B3RO 1L8DA 2UXDO 4DV6B 5J9PC 4KHPB 4B3SO 4DV7O 1IURA 2IU3A 2JIZG 2ILMA 2LW1A 5BR8O 2Y69B 2CTWA 3ZRWB 3STLC 5C8YB 3QO8A 5JVDA 5CB4B 4O4JA 3W7TA 1YI2V 1B04A 2UXBO 2YSUB 4OX9O 1TVKB 3ZMTA 2AHYA 2UXNA 1PL0A 2LQTA 2P22C 4I55A 2LO1A 4BAYA 2ADPA 1SZTA 2WPDG 5J2TB 5LMUO 5BZBA 4QGPA 4FM0A 1HP8A 5KA6A 2CK3G 2EIJC 3K5MA 1WAZA 4EKWA 3BVOA 2PI5A 2AZ2A 1S77D 1HNXO 2CGNA 1I94O 4JASA 2DWDC 4H37A 3UKMA 3EHBB 4UFZA 3ZHQA 1Z5VA 1S5JA 1V55C 4QPKA 1HNZB 1JQ0A 3OMAB 3B4SA 4O4LA 5H5NA 3GB7C 4GLXA 3DTUB 2FL4A 5IYBO 5JJNB 4YHHB 1N32O 4ZIBA 4U7NA 1AVMA 3D36A 1SQVH 3FB6C 4X62B 4RO2A 1RPOA 2EIKC 3RWRD 2EBOA 4WFGA 3HKEA 3P3PA 4DK1A 2W6IG 3AG2B 2E5LB 1P84F 3OEHG 3CC2V 4DV4B 5JJJB 4AQYB 4ASUG 3AG4C 2DQ0A 4WFEA 3QO7A 3JALA 4DV6O 1YJ9V 1GKFA 1BZKA 4MVSA 1P4RA 4X88A 1X4TA 3SPHA 3ZHUA 1OJHA 4PI2A 3ABUA 5JCOC 3CMAV 2XHBA 2EINC 1Q43A 2XAJA 3WU2Z 3ZRSA 1XHXA 5GONA 2QM8A 3Q4HA 1KBHA 4UUJC 3JAKA 2B5UA 1OCCC 3BRCA 4EB6B 1DTOA 5IT9N 1YZBA 1OV9A 1XBLA 4X64B 1GO3F 3K58A 2JGDB 3E86A 3ZMSA 2LGWA 2M7WA 3OAAG 1GM9A 1H8EG 2F43G
chains in the Genus database with same CATH topology
4I0XA 3G80A 3FD9A 3ZBHA 2DE0X 4I0XB 3O9OA 2AZ2A 4LWSA 4GZRB 3Q4HA 4LWSB 3GVMA 3HR0A 3OGIB 2VRZA 3TXQA 3Q4HB 2B9ZA 2AZ0A 1WA8A 3FAVA 3TXSA 2KG7A 1WA8B 2VS0A 3FAVB 2KG7B 4ABMA 3GWKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0X A;  3G80 A;  3FD9 A;  3ZBH A;  2DE0 X;  4I0X B;  3O9O A;  2AZ2 A;  4LWS A;  4GZR B;  3Q4H A;  4LWS B;  3GVM A;  3HR0 A;  3OGI B;  2VRZ A;  3TXQ A;  3Q4H B;  2B9Z A;  2AZ0 A;  1WA8 A;  3FAV A;  3TXS A;  2KG7 A;  1WA8 B;  2VS0 A;  3FAV B;  2KG7 B;  4ABM A;  3GWK C; 
#chains in the Genus database with same CATH topology
 3JSN A;  1YTF D;  3ABM B;  1BGY H;  2HFE C;  3UO3 A;  3S3W A;  2F23 A;  4DV2 B;  1KD1 W;  4PA4 A;  2P7T C;  2ZQM A;  2F95 B;  2Q7G A;  3RYH A;  4MTG A;  1RPR A;  1XNQ O;  4KP4 A;  1H2M A;  5DEC A;  3OTO B;  1UJW B;  1SA0 A;  3T1H B;  1ZWI C;  5LGN A;  1F7Y A;  4U3J A;  4F6R A;  2F4V O;  4MS2 A;  5EK0 A;  3SYP A;  4X62 O;  1YIT V;  4JTD B;  3QG5 A;  4UB6 Z;  1EZJ A;  4K3A A;  4PJ0 Z;  3P32 A;  1WA8 B;  3CE2 A;  1W59 A;  5K1P A;  3UO2 A;  1GTO A;  3EXA A;  4AQY O;  3JD0 A;  1U96 A;  3HKC A;  3THO A;  1D2D A;  1Q90 D;  2GSM B;  3S3X A;  5EC1 C;  1XQ8 A;  3H01 A;  3H9V A;  1SQP H;  2UUC B;  1Q5O A;  4H13 B;  2X6B A;  4I9W A;  4I7Z B;  2ZIN A;  2CE4 A;  1B06 A;  2X0L A;  2Y48 A;  3K06 A;  5B3S C;  4RUE A;  1VP7 A;  1B6Q A;  4PDM A;  2Y4T A;  2AGA A;  3OMN B;  4CH3 A;  4GX2 A;  2FKX A;  1K73 W;  2DOS A;  1F4M A;  2ZT9 B;  2DYR C;  3P3N A;  3TET A;  1FYJ A;  4LP8 A;  3IFX A;  2E3C A;  2WLI B;  3D36 C;  5EIB C;  1WPB A;  1VQO V;  1ZSP A;  1H8H G;  4R50 A;  1XIL A;  4N21 A;  1VQN V;  2R72 A;  4DV2 O;  5CBG A;  1VF5 B;  1QLE B;  4PA3 A;  1M56 C;  2Q8V A;  4P9P A;  1WP7 A;  3VQX A;  1GN2 A;  3TJT A;  5LOV A;  3ABK B;  5HFL A;  2IU0 A;  5CBF A;  3T1C A;  3B8N A;  4FLY A;  1IBM O;  1VQ6 V;  2GUZ A;  3PN1 A;  4TUY A;  2MW2 B;  1K92 A;  3CPW U;  4LH6 A;  3ZHV A;  5JH7 A;  1MSD A;  3W7U A;  3UT5 B;  4DR5 B;  1N4C A;  1NTM H;  3AK2 A;  4CH6 A;  2CGO A;  2QR4 A;  1XOU A;  5IJ0 A;  4LNU B;  1N33 B;  2WLH A;  2ZR3 A;  1GN4 A;  2VS0 A;  2UXC O;  3HPL C;  1YJN V;  2WA3 A;  2K9P A;  3JD2 A;  4JGS A;  4O2B B;  2A06 H;  4GT1 A;  3EVK A;  4NXM O;  3JD1 A;  1M57 C;  1ENV A;  1MMM A;  1QBZ A;  3TGU H;  1PPJ H;  5B1A C;  2UUC O;  2UUB B;  1OHH G;  2RQ6 A;  3B77 A;  1OCO B;  3CRA A;  3AG7 A;  2GDS A;  2O57 A;  4IIJ B;  1VQ4 V;  3ZX6 A;  2HLD G;  5L3B A;  1YCI A;  3E83 A;  3HKD A;  1GH6 A;  1PP9 H;  4C7U A;  4I0X A;  2HP8 A;  1XNR B;  1BQZ A;  2PF4 E;  1QHT A;  2JEX A;  4LR3 A;  1TGO A;  3RYI A;  4X1Y A;  5J2U B;  1S0V A;  2KKW A;  3FFQ A;  3E8H A;  1QLN A;  3SGI A;  3HKB A;  2R9A A;  4ZKI A;  1Y76 A;  1KKC A;  1IXB A;  4QE9 A;  3SJC C;  4HYO A;  4F6E A;  1AB3 A;  3RYC A;  3OR6 C;  1Y6X A;  3RYF A;  4BW5 A;  5B1N A;  5LHH A;  1ORQ C;  1DGS A;  1TUE B;  1J95 A;  4JI7 O;  2PGG A;  2GTA A;  1JPX A;  1NI8 A;  3FAV B;  5KX5 A;  4YJ3 A;  5LP6 B;  3K04 A;  3ZJZ A;  2ZM6 B;  3CC4 V;  1Z2G A;  4P9O A;  3T2M A;  4DRX A;  1EZV H;  1O9H A;  4MVR A;  5BMV A;  1Y74 B;  3JAW B;  2WLK A;  1N33 O;  2PTM A;  2FML A;  2ZKO A;  2HKO A;  2GV9 A;  2H94 A;  2A79 B;  3JCU Z;  4FLZ A;  5L3C A;  2ZDI A;  2QTS A;  3FB5 C;  4X1K A;  1WB7 A;  4LCU C;  3A2F A;  1NBM G;  5B1B C;  2MK3 A;  4GUN A;  2UUB O;  4I9Q A;  1VAR A;  4JZG A;  4LF4 B;  4TV9 B;  4DR7 B;  2P06 A;  4J7K A;  2OCC C;  4PI0 A;  2UU9 B;  4TWK A;  5EC2 C;  3E35 A;  3ETQ A;  1NQT A;  1AI5 A;  4DV5 B;  4BWA A;  3CEI A;  4MSW C;  1XNR O;  4B3T B;  4JAA A;  2LGQ A;  3G6B A;  3T1Y B;  5LBQ A;  4LF8 B;  5IWA B;  4JI6 B;  4AIL C;  1F23 A;  4CZZ A;  4G28 B;  1VMG A;  3ASN B;  3G67 A;  4DK0 A;  5IDJ A;  1L0N H;  2LFS A;  3DC6 A;  1K3E A;  1SKV A;  4FIP C;  4O2A A;  2XND G;  3L73 H;  1K8A W;  2HJD A;  1OCZ C;  3M7M X;  3BPZ A;  2WLM A;  1N36 B;  3T4Z A;  2NNU A;  3OT7 A;  4X1I B;  1RM1 B;  3RFR A;  4MTF A;  1Q86 W;  4PEL A;  1E1R G;  2EZO A;  4P2Z A;  1FXK C;  2Q0A A;  3SR2 C;  2RJZ A;  3JD3 A;  3GWO A;  4W4L A;  3RGB A;  1E79 G;  2ZM6 O;  5JJE B;  1QCE A;  5FNV B;  1ZUQ A;  1M4U A;  4NXN O;  4NR1 A;  4CS3 A;  5KHI A;  5EZY A;  1S76 D;  5JCO A;  5JWP A;  2ZE5 A;  4CS4 A;  3JAM N;  2HG5 C;  1JOY A;  1G4Y B;  1KKD A;  2P5O A;  5FL7 G;  2QA4 V;  1SQB H;  1IZ3 A;  3DGE A;  1R3K C;  3FYI B;  4X9Q A;  1LUW A;  2OWO A;  4PA9 A;  4O4J B;  4JI8 B;  2EJR A;  5H6Q A;  5L3D A;  3FB8 C;  2DN9 A;  4LWS A;  1NR1 A;  3WB0 A;  3KZI Z;  2YEV B;  2QWR B;  5L3E A;  1CP9 A;  2Y4U A;  1AR1 B;  4LF4 O;  2R9I A;  1M93 A;  2VQF B;  2C2A A;  4GYC B;  3ABT A;  4DR7 O;  4I55 B;  4J42 A;  4O4H B;  5CA0 A;  2UU9 O;  3TXS A;  3CD6 V;  3SJQ C;  4DW0 A;  3UM7 A;  4TV8 A;  4UB8 Z;  3BCC H;  3FKS G;  4LFB B;  4B3T O;  4L8J A;  2YXL A;  3K5N A;  3T1Y O;  1FFX A;  3A0H Z;  4UCV A;  4LF8 O;  1HR0 O;  2X6C A;  2QWP B;  4IYI A;  3OFN G;  3LNN A;  2BOC C;  3MAQ A;  3W7X A;  3E89 A;  1FPO A;  3CS5 A;  2OT5 A;  4I5S A;  3X2Q C;  3T4D A;  2IJK A;  4O4L B;  3BY6 A;  3CRQ A;  3DC5 A;  1D5N A;  4NYK A;  3M99 B;  2EIL C;  1YVW A;  3EFF K;  3CX5 F;  2DYR B;  1N36 O;  1Y4M A;  3F7Y C;  3OGI B;  1NU1 H;  1Q3E A;  5GTI Z;  1AR4 A;  1SES A;  1S5L Z;  2ZDI C;  2WLJ A;  2PZS A;  1H2S B;  4LF9 B;  1RSO A;  2N05 A;  3B40 A;  3ZMV A;  1DF5 A;  4J7J A;  1AJN A;  2IJI A;  3HKE B;  4X20 A;  4X65 B;  2XTA A;  3UQ8 A;  1XMQ B;  2V7Q G;  1QNM A;  2K1E A;  3ZHR A;  1Q6U A;  4P30 A;  3ETE A;  4BR6 A;  1AI4 A;  1D5A A;  4I50 B;  2OTL V;  3JAL B;  5L3F A;  4X66 B;  4JV5 B;  1KU9 A;  4ZOL A;  4LFC B;  1R6K A;  4BW9 A;  5B5E Z;  3A0B Z;  1W0J G;  2YIA A;  4DUY O;  1IBL O;  4G2K A;  3H1L H;  1PNK A;  1IX9 A;  3RVY A;  4H44 B;  4K8X A;  1LUV A;  2YDE A;  2ZIO A;  2X7R B;  4DV3 B;  2RN9 A;  4JI4 B;  4UCS A;  5LYJ A;  4CBC A;  4U3F H;  1YDX A;  2VQE B;  1R6T A;  5GON B;  4JF3 A;  3Q4H B;  1U97 A;  2G38 A;  3JAK B;  2VQF O;  2A3Q A;  1PNM A;  5F2V O;  2JGU A;  2P90 A;  3AG1 C;  1PL4 A;  2HHH B;  5CB4 A;  4K35 A;  4ABM A;  3CYO A;  3DXR B;  4LFB O;  1K5S A;  3IC9 A;  1QVG U;  5LMN B;  3C3T A;  2CDY A;  2BSK A;  4KHP O;  4H33 A;  1JFF B;  4CH4 A;  5CN0 A;  4ICG A;  4CS2 A;  4Q6G A;  3K57 A;  4XDK A;  4CH5 A;  4DR6 B;  4D7S A;  2WSS G;  1GN6 A;  1DF4 A;  4UXN A;  3N2G A;  4B7E A;  1I5Y A;  2GBO A;  1LR1 A;  4BIU A;  3R66 A;  2XOK G;  5KUM A;  3LNM B;  2DYS C;  3KCY A;  3M8A A;  1TUB A;  3AG3 C;  4F6R B;  2QM7 A;  5EYP B;  3ABL C;  2A0L A;  2GHY A;  2H3O A;  4K8Z A;  5LL6 Y;  4LF9 O;  4JI1 B;  3APQ A;  1N34 B;  1XI1 A;  2JEU A;  4X65 O;  1MSW D;  3JCZ A;  1BCC H;  2Q67 A;  5LA6 B;  3H1K H;  1OCR B;  2XUM A;  3O9O A;  3VQY A;  4EEQ A;  4IHJ A;  3HKC B;  5H6R A;  2IH3 C;  3G4S V;  4JV5 O;  3L72 H;  4LFC O;  2UUA B;  1ZLZ A;  4DR2 B;  5KAI Z;  3WB2 A;  1HNZ O;  5IYD O;  2ZXW B;  1KP3 A;  1WB8 A;  2UXX A;  1VF7 A;  3K5L A;  1IBK B;  4JI4 O;  5D5P A;  4ZHQ B;  1V54 C;  2VQE O;  1YXB A;  3U11 A;  3H1I H;  1GM8 A;  3CCV V;  2N74 A;  4YHH O;  3D3I A;  3E2E A;  2RNB A;  3K79 A;  2QWO B;  2HHH O;  1DLB A;  5IY5 B;  3IAY A;  4HNA A;  3K08 A;  3K0D A;  2E5L O;  5A2Q N;  3OMI B;  5LMN O;  1EN5 A;  4DV4 O;  1AI6 A;  2IJJ A;  2Q4P A;  3OM3 B;  1I7F A;  3LDE A;  4NVP A;  5E79 Z;  5KLV H;  4RAI A;  1SET A;  4DR6 O;  5LOV B;  2RCV A;  1ZTE A;  2BTQ A;  3AEI A;  4TOI A;  2JJ2 G;  2GUZ B;  1ZX3 A;  4TUY B;  2W0F C;  1TAE A;  5JH7 B;  1AP5 A;  2F66 C;  3CXC U;  2D2C B;  5IJ0 B;  4JI1 O;  1NVP D;  1N34 O;  4X64 O;  4NTX A;  1CPY A;  3CJH A;  1I5X A;  3PJS K;  4KUM A;  2W6J G;  5KUK A;  1PM9 A;  2Y69 C;  3ZBH A;  4FJC C;  2OCH A;  3I55 V;  4OPA A;  5K1X A;  2ADQ B;  3RT3 C;  5CBH A;  2EX3 A;  1VQP V;  2UUA O;  4DR2 O;  1B3Q A;  4JYB A;  3OD4 A;  3N2K A;  4UV8 A;  1SQF A;  2H8P C;  4B7K A;  3SYC A;  3JAT A;  3TK1 A;  4WBN A;  3C90 A;  3LSU A;  3OTO O;  2IW5 A;  4I0X B;  3WG7 C;  3RN4 A;  3T1H O;  1K34 A;  2CTR A;  4R8C A;  4LF7 B;  3CRR A;  4AHC A;  2OYQ A;  2YIB D;  5DM6 V;  5A9G A;  4X1Y B;  1R6N A;  1CXZ B;  4ZI7 A;  1US6 A;  4MW8 A;  3ZCC A;  3E8F A;  4B3M B;  4FLW A;  3HKB B;  3F7V C;  5BXZ A;  3CCM V;  1Y76 B;  3H1H H;  2M6Y A;  1YEW A;  1M90 W;  1FJG B;  1HW7 A;  3C3S A;  4J11 A;  3STZ C;  1FXK A;  3R65 A;  3SPJ A;  4KL1 A;  1K4C C;  1BE3 H;  4MVZ A;  3HB3 B;  4TQD A;  2VWJ A;  4NKG B;  4JI2 B;  4YY3 B;  1P7G A;  2EZP A;  3CXH F;  1V9P A;  4YJ3 B;  2IH1 C;  4JAU A;  2Z5U A;  1H2N A;  4GZR B;  3AG2 C;  2DW4 A;  2HEP A;  1S3J A;  3QNE A;  1ZAU A;  2R9R B;  1BS3 A;  3BAA A;  3ZRV A;  2EIM C;  3VOU A;  4ZBM A;  4FMT A;  2ZIM A;  3BAB A;  4H0L B;  5BMV B;  4LFA B;  3FB7 C;  4LC1 A;  1LNQ A;  2OIG A;  3ML0 A;  2ITD C;  2P4V A;  4NTY A;  2A7W A;  4X1K B;  3J80 N;  4UVA A;  3SJA C;  2E76 B;  4LNU A;  2NR5 A;  4FLU A;  1KP2 A;  2EIJ B;  1K5Q A;  2V1D A;  2Q0O C;  2PY5 A;  2YIC A;  1GK9 A;  2YS8 A;  2ZR2 A;  1Y66 A;  2ZNI A;  4JPR A;  2QKC A;  1SER A;  4DR5 O;  4LF7 O;  1V55 B;  1M9N A;  1ZL8 A;  3G6E V;  2W0X A;  3ABM C;  2YXY A;  2QWN B;  2ZE6 A;  2ZE8 A;  1FFT B;  5KMG B;  2NN4 A;  3E22 A;  1FKA O;  4B3M O;  5CA1 A;  3L70 H;  2WA4 A;  4O4I A;  1G6U A;  3G80 A;  4XDJ A;  3SYA A;  2P4K A;  4YJ2 A;  2EIK B;  5EBM C;  4QIW F;  4KXR A;  2WWW A;  4I4T B;  4MVO A;  1JMK C;  4FLT A;  4WFH A;  1P49 A;  1EBO A;  2JS3 A;  3AG4 B;  1R3I C;  4DV1 B;  3K3W A;  2F93 B;  4LH7 A;  1SQQ H;  1BMF G;  2QE7 G;  3VBB A;  4G27 B;  2VRZ A;  5EZY B;  3CB2 A;  1BSM A;  2XAG A;  1GN3 A;  3A8T A;  5E1A C;  5FLX N;  4MVM A;  2QKS A;  5LHI A;  2B1G A;  2JDI G;  1MZE A;  2CH7 A;  2EIN B;  3FAV A;  1PV0 A;  4LFA O;  5LP6 A;  1Y67 A;  4QJF B;  3CRM A;  2YI8 A;  1OCC B;  1K9M W;  1SQG A;  4WFF A;  4PD4 F;  5LXT A;  2UXD B;  1NS1 A;  4JI3 B;  1GRJ A;  5JQG A;  2Q7H A;  1WJZ A;  3BFR A;  4LWS B;  4YIO A;  3B8M A;  1H2K A;  2RDC A;  3JAW A;  1FXV A;  1XHZ A;  3NR7 A;  1JA8 A;  1NTK H;  3O65 A;  1XL6 A;  4YIP A;  3ZMZ A;  1VQL V;  3LSS A;  5IYZ B;  5CA0 B;  5CMU A;  5H2F Z;  2PYL A;  5EBW C;  1VF6 A;  3APO A;  4GX1 A;  1MOF A;  2OTJ V;  1DK1 A;  4TV8 B;  5KHJ A;  2Q7E A;  4DR3 B;  4FK5 C;  3CCS V;  2UXB B;  1Q8I A;  1XDC A;  1FFX B;  4JI0 B;  4R6Z A;  4TV9 A;  1H2G A;  4FVM A;  5B1O A;  3CSX A;  4JZ2 A;  5LMU B;  2JVD A;  4W4K A;  2XAQ A;  1QLE C;  3MHS C;  4FZ1 A;  1IDS A;  1MAB G;  4JYA B;  3JAR A;  5JVD B;  3CHX A;  4UVB A;  3K03 A;  3ABK C;  5C93 A;  1MA1 A;  4Z2W A;  2Q68 A;  3W7W A;  1HNX B;  4FZ0 A;  1QR8 A;  3ETG A;  4IT5 A;  2QDO A;  4OXS A;  3CCR V;  3BA8 A;  2XAH A;  2YI9 A;  1PNL A;  1RSO B;  1XRE A;  1HDJ A;  3JAS A;  4WFA V;  1YIJ V;  4GKK B;  4D7T A;  4DV5 O;  1SC5 B;  4BIZ A;  1N32 B;  3IGA C;  2QWQ B;  5IWA O;  4JI6 O;  1F4N A;  2WLL A;  1VIB A;  2L35 A;  3U10 A;  4GKJ B;  5B3S B;  1N0N A;  2KG7 A;  4JI5 B;  2KQX A;  1VEW A;  2DJV A;  3LUT B;  1OCO C;  1NKD A;  4HAM A;  4J41 A;  4JYC A;  1BHA A;  2Q73 A;  2L6L A;  4JI3 O;  5LYJ B;  2ETN A;  3OR7 C;  2KB1 A;  3K0G A;  4FFB A;  4DW1 A;  1H38 A;  2QSA A;  5IJ9 A;  1NTZ H;  3ZRX A;  4F4L A;  5ITZ A;  2YIB A;  3GWK C;  1UFI A;  2A9H A;  3D3Q A;  2YEV A;  3L9D A;  1M56 B;  4DR3 O;  2HJF C;  4PA7 A;  4JI0 O;  1SZX A;  2RMK B;  3GVM A;  3A0R A;  4O4H A;  2BSK B;  3SPC A;  4D6T H;  3WG7 B;  1BHB A;  2JRI A;  4WF9 V;  1Q6H A;  2EUL A;  2QJ1 A;  3AK3 A;  4JYA O;  3FD9 A;  4JAV A;  1JR9 A;  4JI8 O;  3N2G B;  1K4D C;  3OUS A;  2Z3Y A;  5LP6 C;  1IXM A;  3DSQ A;  1TUB B;  3TXQ A;  2QKA A;  4Q20 A;  2AZ0 A;  3WFV A;  3ZRW A;  1K33 A;  5C8Y A;  1XNQ B;  3UCS C;  4GKK O;  2ZCE A;  2CTQ A;  1VQM V;  1M57 B;  1AI7 A;  3SPI A;  5H9C A;  4UCT A;  1PD3 A;  4JYY A;  5B1A B;  1TVK A;  5DED A;  2F4V B;  3WB1 A;  1WN7 A;  1S72 V;  3D8C A;  1VF6 C;  4IHJ B;  4UCO A;  1KQS U;  5J2T A;  4FLX A;  1SRY A;  4FFK A;  4GKJ O;  4JI5 O;  3H1J H;  1SS3 A;  1J5E B;  3RYH B;  3MD0 A;  3OUF A;  3FX7 A;  4I50 A;  4DUZ B;  2EIM B;  4MTO A;  2E75 B;  2P67 A;  1W2B U;  1SA0 B;  1FXH A;  4U3J B;  2BE3 A;  4WCE V;  1HWY A;  2AW9 A;  4U7O A;  4HZ3 A;  4X8A A;  1M5I A;  5AG2 A;  4B08 A;  1JVM A;  1AIL A;  1NZ6 A;  1KC8 W;  2NLJ C;  2LP7 A;  2LFR A;  1XMQ O;  4HNA B;  3ETD A;  3ASN C;  3JSL A;  3CWB H;  3CRC A;  1XMO B;  4JTA B;  2F1M A;  2CAZ C;  1TA8 A;  1EN4 A;  3HR0 A;  4X66 O;  3AK1 A;  5IE9 A;  5LGU A;  2QTO A;  3ZED A;  5FPR A;  1VQ9 V;  1AP6 A;  5L3G A;  4PA6 A;  4XBF A;  4IGG A;  3I56 V;  1T5E A;  3K5O A;  3DXR A;  3QF7 A;  1RM1 C;  2BTQ B;  5TIS Z;  4DV3 O;  2DMX A;  2AHZ A;  1JX9 A;  2CTP A;  2DE0 X;  2YXH A;  1AR5 A;  3B09 A;  1L1F A;  1XUQ A;  1JFF A;  3VQV A;  4JTC B;  2N04 A;  4NTW A;  4J7Z A;  4QPJ A;  1MNG A;  3W7S A;  1JJO A;  1WP8 A;  1GAX A;  2ZNJ A;  1YSC A;  1IBM B;  3CJH B;  4MTX A;  1YF2 A;  1ARO P;  5B1B B;  1GMG A;  1R3L C;  4PV1 B;  4GX5 A;  4DR4 B;  5EYP A;  2OCC B;  1KYO F;  4EB6 A;  2QGN A;  3ASO C;  2XAF A;  3RVZ A;  2Y0P A;  3IC7 A;  2JGD A;  2Y0I A;  2Z0A A;  5B66 Z;  3P30 A;  4PDL A;  2UXC B;  3N2K B;  3CCL V;  1J5E O;  2X6A A;  5LA6 A;  1BL8 A;  5LHG A;  4DUZ O;  1K7D A;  3I5D A;  4WBN B;  3JAT B;  3NXS A;  2CUG A;  2QM4 A;  3G71 V;  4NXM B;  3RW0 A;  4EFE A;  1KEC A;  1YJW V;  3CCE V;  4GCZ A;  3JD4 A;  5D5Q A;  3RBZ A;  3K59 A;  3ZN0 A;  3KKY A;  3CCJ V;  2IBZ H;  4ZI7 B;  1NH2 B;  2HVJ C;  1OCZ B;  4TQF A;  4DXW A;  4Z1M G;  1THZ A;  3VQW A;  4ZHQ A;  4IYH A;  1H2L A;  4UVC A;  3J81 N;  1XMO O;  1G8M A;  1URF A;  4LBE C;  1K97 A;  1AJQ A;  1FXK B;  4X89 A;  3CC7 V;  3TCU A;  2JJ1 G;  1WA8 A;  3ZS8 C;  4MVQ A;  1YHQ V;  3ZMU A;  2Q9L A;  1EN6 A;  1FS0 G;  4LF5 B;  3HKD B;  1IBK O;  2YUA A;  1R3J C;  1XL4 A;  2QEX V;  2VWK A;  2JK5 C;  2FB5 A;  4RQE A;  2GTS A;  3MDS A;  4K0K B;  4FLV A;  1ROP A;  3RYI B;  1MG1 A;  4JI7 B;  1COW G;  1NR7 A;  4PDV A;  2P6J A;  4J9Z B;  3LDD A;  1QU7 A;  2ZD9 A;  4LF6 B;  1PKX A;  4DR4 O;  3KCX A;  1FAF A;  4AI8 A;  3QVN A;  1VQ5 V;  4J9Y B;  1Q81 W;  2AXT Z;  3RYC B;  3RYF B;  3BHP A;  2FTK A;  1M1K W;  4QNH B;  5KHG A;  2WLI A;  2ZE7 A;  1KMI Z;  3BEH A;  4N23 A;  4BIO A;  2E74 B;  3OGC C;  2HR3 A;  1HNW B;  4NB5 A;  5KX5 B;  3OW2 U;  2HVK C;  2PYJ A;  1XEQ A;  5KAF Z;  5HFM A;  1OZ0 A;  4MVU A;  3ZN1 A;  1R73 A;  4UCR A;  1ZL8 B;  4DRX B;  1F51 A;  1FD9 A;  4TSF G;  3X2Q B;  4UV9 A;  3OEE G;  2LW7 A;  1X59 A;  4PDR A;  2EIL B;  4J10 A;  1KUQ A;  3E22 B;  3L71 H;  5FPO A;  5EIB D;  5CA1 B;  1BQ0 A;  3UT5 A;  4YXW G;  4O4I B;  1SQX H;  4RQF A;  4DV0 B;  4YJ2 B;  4DR1 B;  1IVS A;  2DWE C;  3CCU V;  2Q5Z A;  2B1I A;  2WAM A;  1VQK V;  4O2B A;  3CP1 A;  3L75 H;  5KA5 A;  4LF5 O;  1Z5W A;  4FM2 A;  1S5H C;  1MZF A;  3ZIA G;  2KSD A;  1JJ2 U;  2PI4 A;  2BCC H;  1Q7Y W;  4QE7 A;  4K0K O;  1OCR C;  2ITC C;  2FYU H;  4IIJ A;  1YTF B;  1O9G A;  4J80 A;  2XT9 A;  1VQ7 V;  1P7B A;  2CH7 B;  4GX0 A;  1I08 A;  5BY1 A;  3QTC A;  1E1Q G;  3SJB C;  1Q82 W;  2OIE A;  3F5T A;  4LF6 O;  4DYL A;  4O2A B;  1FJG O;  2ZXW C;  5DN6 G;  4IL6 Z;  4NXN B;  1EM1 A;  5LXT B;  4MW3 A;  3AG1 B;  5J2U A;  5JQG B;  1JCH A;  4RWU A;  2BTO A;  4JI2 O;  4KFM A;  3ZHT A;  4YY3 O;  4FM1 A;  1HNW O;  1I0H A;  1RFY A;  3SDL A;  1QVF U;  3LSQ A;  4MT8 A;  3ZHS A;  4UCU A;  1A32 A;  4A5U B;  1WLE A;  5IY5 C;  3B2E E;  5CA3 A;  1WPX A;  3BA9 A;  2EJ7 A;  1G1X B;  4DO2 A;  2R70 A;  3QO5 A;  4E4E A;  5LGT A;  3SYO A;  2DYS B;  3AG3 B;  2Q69 A;  3ABL B;  2YC0 A;  3JAR B;  3E8B A;  4B3R B;  4DV0 O;  2IJH A;  4DR1 O;  1HR0 B;  4E2L A;  4B3S B;  1Y74 A;  4DV7 B;  1UPG A;  4XDL A;  2Q6A A;  2B9Z A;  3E8G A;  1AJP A;  4L87 A;  5KMG A;  4CC6 A;  5BR8 B;  3SPG A;  4Z1V A;  3JAS B;  1EFR G;  1WNS A;  4RUF A;  3OTF A;  3K9A A;  5KHK A;  1NVP B;  1GM7 A;  4OX9 B;  4I4T A;  1CEZ A;  4PHZ A;  2LJ2 A;  3JYC A;  3MHH C;  3U0Z A;  1N0J A;  4R7C A;  2JS5 A;  2ODM A;  2WLL B;  5EBL C;  1QQC A;  1V54 B;  2KG7 B;  1L0L H;  2DQ3 A;  1RP3 B;  3K9S A;  4FPP A;  3CCQ V;  1NT2 B;  5IYC O;  1R1B A;  1QR9 A;  2WLN A;  3KG2 A;  4WFB V;  2PUS A;  3FYE B;  1I94 B;  2XAS A;  1NJI W;  2V4D A;  4FFB B;  3SYQ A;  4DUY B;  4EFB A;  4HBN A;  3F5W C;  1IBL B;  3OE7 G;  4OPH A;  1Q6I A;  5IJ9 B;  2ARH A;  4OGQ B;  4DV1 O;  5ITZ B;  2YID A;  4X20 B;  3IJ4 A;  5GTH Z;  3ASO B;  5GW7 A;  1KB9 F;  3CME V;  4X1I A;  2D3O W;  2IM9 A;  5KHH A;  1SF9 A;  5IYZ A;  1N8R W;  3ICX A;  4ZOL B;  3LDC A;  4TT3 G;  1VQ8 V;  2BOB C;  3N27 A;  2ATK C;  3L74 H;  1BT8 A;  1W0K G;  5FNV A;  4CC5 A;  3J7A U;  1NH2 D;  4B3R O;  1L8D A;  2UXD O;  4DV6 B;  5J9P C;  4KHP B;  4B3S O;  4DV7 O;  1IUR A;  2IU3 A;  2JIZ G;  2ILM A;  2LW1 A;  5BR8 O;  2Y69 B;  2CTW A;  3ZRW B;  3STL C;  5C8Y B;  3QO8 A;  5JVD A;  5CB4 B;  4O4J A;  3W7T A;  1YI2 V;  1B04 A;  2UXB O;  2YSU B;  4OX9 O;  1TVK B;  3ZMT A;  2AHY A;  2UXN A;  1PL0 A;  2LQT A;  2P22 C;  4I55 A;  2LO1 A;  4BAY A;  2ADP A;  1SZT A;  2WPD G;  5J2T B;  5LMU O;  5BZB A;  4QGP A;  4FM0 A;  1HP8 A;  5KA6 A;  2CK3 G;  2EIJ C;  3K5M A;  1WAZ A;  4EKW A;  3BVO A;  2PI5 A;  2AZ2 A;  1S77 D;  1HNX O;  2CGN A;  1I94 O;  4JAS A;  2DWD C;  4H37 A;  3UKM A;  3EHB B;  4UFZ A;  3ZHQ A;  1Z5V A;  1S5J A;  1V55 C;  4QPK A;  1HNZ B;  1JQ0 A;  3OMA B;  3B4S A;  4O4L A;  5H5N A;  3GB7 C;  4GLX A;  3DTU B;  2FL4 A;  5IYB O;  5JJN B;  4YHH B;  1N32 O;  4ZIB A;  4U7N A;  1AVM A;  3D36 A;  1SQV H;  3FB6 C;  4X62 B;  4RO2 A;  1RPO A;  2EIK C;  3RWR D;  2EBO A;  4WFG A;  3HKE A;  3P3P A;  4DK1 A;  2W6I G;  3AG2 B;  2E5L B;  1P84 F;  3OEH G;  3CC2 V;  4DV4 B;  5JJJ B;  4AQY B;  4ASU G;  3AG4 C;  2DQ0 A;  4WFE A;  3QO7 A;  3JAL A;  4DV6 O;  1YJ9 V;  1GKF A;  1BZK A;  4MVS A;  1P4R A;  4X88 A;  1X4T A;  3SPH A;  3ZHU A;  1OJH A;  4PI2 A;  3ABU A;  5JCO C;  3CMA V;  2XHB A;  2EIN C;  1Q43 A;  2XAJ A;  3WU2 Z;  3ZRS A;  1XHX A;  5GON A;  2QM8 A;  3Q4H A;  1KBH A;  4UUJ C;  3JAK A;  2B5U A;  1OCC C;  3BRC A;  4EB6 B;  1DTO A;  5IT9 N;  1YZB A;  1OV9 A;  1XBL A;  4X64 B;  1GO3 F;  3K58 A;  2JGD B;  3E86 A;  3ZMS A;  2LGW A;  2M7W A;  3OAA G;  1GM9 A;  1H8E G;  2F43 G; 
#chains in the Genus database with same CATH homology
 4I0X A;  3G80 A;  3FD9 A;  3ZBH A;  2DE0 X;  4I0X B;  3O9O A;  2AZ2 A;  4LWS A;  4GZR B;  3Q4H A;  4LWS B;  3GVM A;  3HR0 A;  3OGI B;  2VRZ A;  3TXQ A;  3Q4H B;  2B9Z A;  2AZ0 A;  1WA8 A;  3FAV A;  3TXS A;  2KG7 A;  1WA8 B;  2VS0 A;  3FAV B;  2KG7 B;  4ABM A;  3GWK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...