3GW0A

Urod mutant g318r
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIRQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic characterization of mutant human uroporphyrinogen decarboxylases.
pubmed rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
total genus 124
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gw0A00
3GVVA 3GW0A 1XR2A 4AY8A 4L6HA 4WSHA 1R3SA 1R3WA 1T7LA 3RPDA 1JPIA 3PPHA 1U22A 3GVRA 3PPFA 4L61A 1R3VA 1U1JA 3T0CA 3BQ6A 1R3YA 4QQUA 1R3QA 3CYVA 3BQ5A 1U1UA 3PPGA 4ZR8A 1JPHA 4L6OA 4L65A 1R3TA 2INFA 3GVWA 4AY7A 3GVQA 4L64A 4ZTXA 1YPXA 2NQ5A 1XPGA 1J93A 1U1HA 1XDJA 1UROA 4EXQA 4L5ZA 3GW3A 3L7RA 3PPCA 4ZTYA 1JPKA 2Q71A 2Q6ZA 2EJAA 1R3RA
chains in the Genus database with same CATH superfamily
3G0UA 2OYLA 4NYUA 4G7FA 4PTVA 4CCEA 4KMQA 5C9ZA 1FA2A 3BCDA 4EP8C 5G1MA 1UKOA 1QBAA 5BRBA 1C3FA 1H4PA 1K7XA 4QP0A 4DZ5A 1B2YA 2YBUA 1MEWA 1WV2A 4C1NA 1OG0A 2CXEA 2WNQA 2PFHA 1MZRA 4N2YA 5XIMA 5F7UA 4UR7A 6TIMA 1PYMA 1EDGA 2CPUA 2DH3A 4JX4A 4GXMA 5CPQA 4KWOA 3MUIA 3VD3A 1WAWA 1TWIA 1R85A 3VCRA 5FF0A 3F4DA 1CB2A 4Q6XA 4NP7A 5T9BG 4BI7A 4N42A 4HMCA 2CLEA 3R0DA 1QRQA 1PIIA 3K4WA 2XFYA 2W27A 4TUFA 2ZE0A 3MO7A 3GO2A 3B0YA 4JTKA 2R6OA 3KBVA 3ZT7A 3IJQA 1PPIA 3EKGA 1C8YA 3EWXA 1TPH1 1UB3A 3ES8A 3C0SA 3LRLA 3LENA 1C7SA 4WOZA 1VCVA 2PZ0A 1E4LA 1ALDA 3TFXA 4ACZB 2GOKA 4O0ZA 1OC7A 4KEVA 4UTKA 5TF0A 4IX0A 2HRWA 1AJ0A 1XBXA 4HK5A 3NSMA 1HJXA 3LM7A 2J77A 4REQB 3CH9A 2WO5A 2ZUTA 1G7UA 1R2RA 2YBVA 2GL5A 1ITCA 5A6BA 4ZO8A 1XCXA 3SDOA 3MP4A 1J0KA 2D3LA 2NSOA 1JYNA 4UCFA 4FXJA 1ZUAX 1UPMB 4ICCX 4GLEA 2NUYA 1MQRA 2JKAA 1KV8A 2Z00A 5HQLA 4E4PA 3CT2A 3U2ZA 3KS5A 1OFOA 3RX3A 3TE9A 4PCTA 1XGZA 3WJZA 1RP9A 3OZOA 1AH3A 3GIPA 2ZOXA 2X0YA 5IFTA 3T0DA 3URBA 1GJPA 4OECA 3LGDA 4Z1CA 3AWOA 3O0FA 1E0TA 1CDGA 2YB4A 4O57A 1V3JA 3WJXA 2PTXA 4EWJA 1SR9A 3O05A 2JGYA 5KETA 3L68A 2XH7A 4IL2A 3EOOA 1RJQA 1CB7B 5EMMA 3UPBA 4R7JA 3N3TA 3WLKX 3PZQA 2V0TA 4LV4A 4A22A 2YL6A 4EX4A 1JUEA 3KL3A 6CGTA 4C6IA 2WC4A 4I3GA 1WZAA 3EB2A 1ZB5A 2NVAA 1M9HA 3S8HA 2C3ZA 4Q8VA 2F9RA 4KWUA 2PLCA 4GY1A 4KH2A 2FVKA 4UFMA 1P1MA 3HV8A 3L0NA 2ZRZA 3SRDA 3KTCA 1EF3A 2WPGA 2PBGA 2A6NA 3APGA 5CZSA 3W7EA 3VX1A 1EYWA 1IE7C 1W2VA 1U30A 4DPQA 1UIOA 3CUHA 2X2GA 1N82A 4WSKA 2MUCA 4M80A 3EDJA 1WNOA 3VNMA 3P2VA 3QTPA 3V75A 1TJRA 1NDWA 3H70A 4PMUA 4PRWA 1MXDA 2AQWA 3MV11 1RLDA 3LXAA 3RJXA 1E73M 1RK5A 4WDXA 3M41A 3LHUA 1WBHA 4M8UA 1PHQA 3CUZA 3P6LA 4YVVA 3EKLA 4C6KA 1Q7MA 1KRBC 3A9IA 4NSBA 4Q4SA 2WVSA 2XG9A 3RAOA 3M7WA 4GJ1A 5AC4A 4I90A 2D2HA 1W1ZA 1GHRA 1M3UA 2C6QA 4MZ8A 4WR3A 5I3GA 2RUSA 2WMIA 3VNIA 3G1HA 2Q3OA 2VRKA 3VNKA 1W1B1 3D47A 4S39A 2YW4A 3CZKA 3DGBA 3MV01 1C9WA 1XDLA 3K8KA 4NZFA 1GOWA 3CTLA 1NP2A 2WLZA 4G6CA 4Z2KA 1OK4A 3UG3A 4C7FA 3L5MA 4Q4OA 1P0NA 3W2KA 1CIUA 4GK8A 2D3NA 4UNLA 4JTTA 3HO8A 2GK1A 1NWUA 1B5TA 4QCFA 4WGHA 3N29A 1VBHA 4TX6A 1XYLA 5ECVA 2WHMA 3MSGA 4IPNB 4HK7A 4WDWA 2Z2UA 4AWSA 1N7KA 3B97A 4FALA 5J5DA 4WK9A 1L9WA 3KTXA 5K7JA 3SQLA 3PNZA 2FFIA 1SO4A 4KCUA 4NXKA 3KVMA 3RUBL 2DDXA 3FA3A 4DBDA 4U4MA 1G7VA 4Z0JA 3W07A 3WD3A 4QDMA 5LGZA 3L65A 2PAJA 1GTEA 4MG4A 1TR1A 4M19A 1I0DA 1LORA 1S5MA 4C5ZA 3NEVA 5A6TC 1QOPA 3RJYA 3EA2A 2A5HA 1ONEA 1FVPA 3A4XA 3ZSSA 4KKXA 2IPJA 2FTWA 4D6FA 3CGTA 4PBFA 2V9DA 3WLLA 5HINA 1CCWB 3B0XA 4DLFA 2VL4A 4H9MA 5CC7A 1WKFA 4W7VA 2TRSA 4K2SA 4GHRA 4DBEA 1B9ZA 1B4EA 3KCLA 1Q66A 1AK5A 4OUIA 1B57A 4F0SA 1LT8A 2DZAA 4JQ3A 1UC5A 1F05A 5AVHA 1BAGA 3RXZA 5ABTA 1XYZA 3DFYA 4ZB2A 1P6CA 3IJLA 4GH3A 2WW5A 2WJFA 4Z2GA 1UP2A 2RKXA 1GONA 2O9PA 4UOQA 1XYCA 1FFRA 1J9YA 3VM5A 2D2JA 2XN2A 2OQHA 5LIUX 1GVSA 2W4XA 3C2EA 3KBMA 3GVGA 1CW2A 4B5XA 5E0KA 1ECEA 5LNSA 4C90A 5M1TA 2QMKA 1GVOA 1NOUA 2G3NA 3TN6A 3KP1A 5JMUA 3OOQA 4DUXA 4P7NA 3TC7A 1Q6QA 5GPRA 1BKHA 2Z1KA 3R43A 2MNRA 2ZRWA 3DG7A 1NP0A 1JPMA 1HO1A 3HJZA 3TYAA 4PB5A 1EIXA 2RH9A 4P8XA 2GJNA 2J7CA 1OCJA 2Q8XA 3R8RA 3W7IA 1O1ZA 1ZJHA 2R14A 2QCDA 5IRPA 3SN1A 3ZLGA 3CQJA 3CHEA 3SGUA 5F2LA 3WNKA 2GPTA 4F2TA 4J7RA 2YCLB 1ZQ5A 2YCIX 4ZQMA 3GHTA 2HSAA 4A8RA 3U4AA 4MJMA 2IPWA 2ZTKA 2H6RA 4NAFA 4WF7A 1V0KA 4RCXA 4AD4A 3MZ2A 4G8TA 1M04A 3WUEA 3DI0A 2J88A 2ZA2A 2BHZA 4JFWA 1KTNA 2GFTA 2H8XA 2I1OA 1DJZA 1HVQA 3NQ7A 4OE7A 1RBLA 5A2AA 3RHGA 9CGTA 4LVFA 1V77A 5AVNA 1CYGA 5AB3A 2A1YA 3TK7A 3QQ0A 3EX3A 3T9PA 5KEZA 5BW6A 4I9JA 2PDGA 5BU6A 2GQAA 1ZBWA 2FMOA 1MW3A 3MB9A 1UC4A 2PWGA 1SO5A 1Q63A 4DZHA 3JS3A 2E1DA 1PIGA 3AHYA 4L5ZA 5I78A 1EB3A 1CGYA 1FDZA 1O7AA 4ADSA 1EXBA 3PZUA 4NUWA 4HNVA 4AC7C 1JZ2A 4OBTA 3R12A 3SQSA 2DZTA 3MVTA 1PUDA 4LYKA 4LS0A 4G1NA 1EJSC 3GBDA 2PTDA 3HPFA 3MUCA 4K7YA 1JXKA 3VIIA 4BZYA 3GZAA 2OPJA 1K02A 1DYSA 2PDCA 1A5NC 1X98A 3LHVA 1RD5A 4XO7A 4MWAB 4P61A 1D7KA 3PAOA 4FX7A 3ERPA 4IUOA 3RRXA 3ITYA 2O9TA 4AVOA 4GD0A 2G3IA 2PDMA 1X97A 1B31A 3H54A 1E3ZA 1S2AA 3A13A 2IS7A 4YTTA 4I6KA 4I5RA 4BJHA 5CLWA 2OXNA 4HMEA 4JYFA 4O14A 2VGIA 4I7UA 3FN9A 4LY4A 1RVKA 1GOOA 3GNXA 5FAJA 6ENLA 5C0QA 3T09A 3MQTA 4ZO6A 3MCOA 5ENLA 3RCYA 3VKKA 3VGHA 4S3JA 3S42A 3UXAA 3AZTA 2ZUSA 3ZJ6A 1EXPA 2Y6ZA 2YOCA 3W6LA 3UYCA 1RQEA 2HS6A 2PEVA 4NAEA 1TUFA 4OBSA 4UQEA 4AWTA 2RAGA 1ZNNA 3GNNA 4IG2A 1O5RA 3A23A 4GZIA 2O7SA 3PZVA 4UIOA 1BPLB 3OQEA 1LWHA 4AEFA 3CHCA 3PPHA 4NY2A 1EP2A 2VKZG 3T05A 3HN3A 1N8FA 3MSRA 1V6UA 1WZKA 4Q4KA 1PTAA 4JAWA 3QFWA 3N34A 2GGIA 2YL8A 2PGEA 3G1VA 1DIDA 5FIPA 2I17A 1E51A 3K46A 5J5RA 1WE5A 8A3HA 4JTDA 4WVXA 4Z1BA 2E09A 4AF0A 2JEPA 5C2XA 4HK6A 1LOQA 4KESA 1MNSA 3MHFA 4DY1A 2OG9A 5C9XA 5DY3A 3CZGA 3PM6A 3B0PA 3BAXA 4ZQRA 3UCQA 2Y61A 1P7TA 1B3WA 2Y1HA 3QRHA 4KEUA 3G1DA 3C61A 4HPNA 1V3LA 1A3XA 4LAMA 3PF3A 4F0KA 3S1VA 2ZVIA 1XGEA 1HXJA 5E1QA 1H60A 4XSMA 3UWZA 1NM9A 4DNMA 3GFXA 3W23A 3A4AA 2I14A 1VF8A 4DBUA 3KCOA 2CCRA 1SSDA 2DJLA 1GUVA 1JDAA 1YRRA 4YNGA 3IUIA 4XD4A 1YQ2A 5EYWA 3PN8A 3MDWA 3U2EA 5H2ZA 4WCJA 4YL2A 1JR1A 5BRPA 4OQVA 5G4WA 5FOOA 1VPYA 1A0DA 2PRMA 2ZUUA 4H9UA 4B9YA 3N2XA 3O16A 5AY7A 1VHNA 4Q8NA 3FK4A 2E9BA 4A3HA 3UEQA 4CQ9A 4IJCA 3OVRA 2VM8A 4IMDA 4XG1A 4TOQA 2XH2A 1XLGA 3AHVA 2ODOA 5AZ1A 1C9DA 1J2BA 5GJPA 3F03K 5CC3A 2CIPA 1N2VA 1DWAM 3KM8A 1OT2A 5CH9A 3CQKA 3MP3A 3BMWA 4PBGA 2VJXA 3WDQA 4WGXA 2JIEA 3QHOA 3AIEA 1S46A 4LPCA 3W7HA 4P7OA 4AVFA 3QLDA 4HNLA 3AS3A 4J2MA 3KZPA 1FCVA 1TZ7A 4DHGA 3UG8A 4PUMA 5BXSA 4ECLA 1HT6A 3BAYA 4LBUA 1PX8A 3HQ1A 3AOFA 3BGGA 5CQ1A 4DO4A 1OCQA 3H4XA 3DFTA 1AH4A 3CU2A 4D8LA 3QBUA 5HMFA 3K8MA 2CHNA 5KZ6A 3WMSA 4M3PA 1YX1A 2XDFA 1KWKA 2QUTA 3E74A 3W7PA 1JQVA 2BGQA 1Z7AA 3EWYA 1OX4A 5CSRA 1OCBA 2ZX5A 1E6RA 4HQVA 1PKNA 2ABAA 2W3ZA 2CHRA 2R1KA 3FV9A 1JZ8A 4IGSA 2CLIA 2NWSA 1ME9A 1EBGA 1MXGA 4J1OA 1JD9A 1VYRA 4S3CA 1QTWA 1QPNA 4FO4A 4J3TA 1TKKA 1DP0A 2P8BA 4QSHA 5RUBA 1GVYA 1F61A 3HF3A 1ESWA 4D6EA 3IGHX 4WIWA 2CC0A 4UTLA 3SCTA 4L1XA 4UTWC 2HK0A 4KIEA 4O15A 3DZ1A 4XVEA 1JUBA 2ONEA 3NQMA 1HTIA 3AIQA 1XBVA 2Z24A 3HJEA 4K1WA 3E49A 3GR7A 1CXLA 1ZENA 2O55A 3TNOA 3S9YA 5HOSA 3U57A 3QR1A 3GXNA 2V81A 2REQA 3MJMA 1RY0A 1UUMA 2VI0A 1EO5A 4XAZA 3TKFA 1H7XA 3BSHA 3UXKA 4YYFA 5FEPA 3ONCA 1TCMA 4NNAA 1Q4NX 4L9ZA 1EQCA 2VCCA 5E9XA 4AXNA 3QEZA 1ZCOA 2V69A 4RDVA 4NQ1A 1VP5A 4Q8WA 1JCXA 1SJAA 3G18A 3AMDA 4J3VA 1V6WA 1IXPA 2W66A 2YDQA 3HPSA 5DLCA 6XIAA 2WSKA 1E6ZA 1ZAJA 4LUTB 5GNXA 2DZWA 3UESA 1EC9A 1EBHA 1BQCA 1D3HA 1Z42A 4WJEA 2XWDA 4X61A 4US5D 3ICJA 3NDYA 3AIWA 3WEMA 1ITUA 2QCCA 1H09A 3LS9A 3MI6A 4JHZA 2NT1A 2O9OA 4H8UA 4QJ1A 2AL2B 3GNPA 1R30A 3CZJA 4PB3A 1Y7VA 5I3DA 1PJ9A 3PG8A 4AQLA 2C8NA 2QIWA 4FF7A 3W83A 1HFBA 1TVNA 3QYQA 5D09A 3MUY1 5I7GA 4BI6A 3PPFA 3ZO9A 5C2CA 1SFJA 3NPXA 5HQEA 4ZFMA 5BWFA 1CX9A 1VYSX 4JZ5A 2X1TA 3LXCA 4LTSA 4JTGA 2YKKA 1EQPA 1UA3A 4O0KA 1JDCA 1AW1A 1KBLA 1BRLB 1OC6A 3UF9A 3U5YA 1TTJA 4AB4A 3PSWA 2FZMA 3NL2A 3TYDA 3UZXA 2J75A 3A3WA 4ZODA 1ENUA 1BWKA 3RM4A 1CWYA 2C13A 4NASA 4K68A 3R0UA 2QUNA 2HXUA 5A1AA 1OHLA 3RILA 3WKZA 3CLWA 1W5PA 1JF6A 3H2AA 1TV4A 2OX4A 1C90A 3VGEA 2BP1A 4MWAC 4Q8MA 2V38A 1XYAA 2DUZA 4JTEA 4IPJA 4Q7IA 2D2OA 1QK0A 3SGGA 1TCDA 4W5ZA 3IJ6A 3MWCA 4YVXA 3KRZA 5D9PA 1SQ7A 1OY0A 2WJZA 3B9DA 5IBXC 2BMBA 1UWQA 2ZFAA 4DJFA 4GQGA 3K30A 4Q7NA 4NZ3A 4H41A 5JBFA 4CD5A 1WPCA 2DSVA 5DMYA 2XN0A 1VH7A 1V3HA 4AYGA 1I8JA 5EU9A 1K8XA 4M6PA 3FOKA 4H8VA 2B31A 4R27A 1V08A 1XLEA 3NO5A 2UY4A 4K39A 1QWGA 4B3LA 2VZUA 5JIPA 5AHLA 3GDRA 2PWHA 4AUBA 3BW2A 3LPOA 3TA9A 2OEMA 1Z48A 3S5ZA 2GVYA 2YB1A 5REQA 1KLZA 5FJUA 4JS3A 2VDHA 2I7GA 3W2UA 3BV7A 4F9DA 2D22A 5D04C 3VC6A 1E43A 3H4GA 3G1AA 3VE9A 1AZ1A 3BE7A 4JHMA 2ZX8A 3O07A 4GVFA 4INFA 3BQ5A 4LVDA 3ZR5A 2YFNA 4O1CA 2HVNA 3H6OA 6ALDA 1BYAA 3A3XA 4NZ4A 1S2TA 4I7WA 3HFYA 4LF1A 4DEFA 3VVGA 3U48A 3WO8A 4ADUA 4MAVA 4EIVA 1MW2A 4I8YA 1EEPA 2FLIA 3MC5A 1YHTA 4HU0A 1F3WA 4OTKA 2G97A 4LX4A 3W1TA 3R8GA 3LY0A 1GGOA 2WKJA 4GMEA 5EFFA 3DBNA 4B15A 4OUEA 1AZ2A 1R8LA 1AMYA 3HOJA 2EF9A 1J0IA 3N2TA 2VFGA 3WENA 3M0YA 4U2ZA 1ISXA 2YYTA 3UP8A 2J8FA 3BLDA 3CPGA 2J13A 2C18A 3LBCA 3RIKA 1LLZA 1RHCA 2YXOA 4LY8A 1CT5A 3FLUA 3KS6A 4U10A 5CPNA 5CPLA 1ISVA 1JPKA 3QSTA 2AGKA 3GXTA 2QVHA 4WJ8A 2EHHA 4IISA 3E0WA 3KBSA 2WANA 2X0SA 1VRDA 1BTMA 3QC3A 2Y5JA 3UZJA 3KAOA 2WHJA 4RL3A 4W4QA 4GC4A 3CS2A 1HUVA 3W75A 2WC3A 3CV7A 3FHAA 2AGTA 4XWUA 3WQEA 1NY1A 1TIMA 1A0CA 4LV9A 3M0IA 3BMVA 3OBEA 1SFSA 5L6UA 4GYPA 5G4EA 4RE0A 3W76A 3PULA 2B7QA 2Y88A 4CCCA 3CIXA 3TW9A 2AKZA 2OJPA 3N2OA 4NILA 4HOWA 1G94A 2BHYA 1OGBA 2EXOA 2WVUA 4N6FA 1VLIA 3V35A 2JIWA 3SCRA 3W6MA 3PY2A 2XWEA 3I6RA 5C71A 1PZ2A 4HT3A 3W1QA 3PTDA 3PNUA 4P8WA 3LV6A 4LAUA 5EMYA 3DHPA 1H5YA 1O5QA 1V6XA 4DO5A 4LAKA 1TE1A 2ZTJA 2G3MA 1OINA 1SPQA 3ITOA 1EFZA 3S1XA 3FS2A 4KQNA 4BWLA 2HCVA 1BRLA 5FL0A 4JFVA 2GDUA 1OCNA 2Z2AA 1Q2SA 1OIFA 1VFMA 4L4OA 4R9OA 3VZZA 4IMAA 2EKCA 2WSRA 1VIZA 4WDUA 3AXMA 2IXVA 3A3HA 3KEHA 4MKNA 1KV5A 4ICMA 2X41A 4W88A 5IHSA 1OM0A 2FGBA 2BHUA 1W8GA 1DKWA 1QPOA 2ISWA 3GRIA 3A5VA 1UH2A 3O9NA 2VFHA 3EMZA 2V3GA 4MZYA 1Q6DA 1DBTA 4QAIA 1UWTA 2VZTA 3HQNA 1CXKA 5C5YA 2Y85A 4EE9A 2OMAA 3A6OA 2BSLA 3NO1A 4DNHA 3S9ZA 3TVAA 4XAPA 3GU1A 2VEPA 1VJZA 1DV7A 3EDEA 4RX0A 3FJ6A 3CQIA 4JIQA 2BX7A 3BGAA 3WMCA 3TQ0A 4CVUA 2HROA 4RNJA 4WRHA 1WXZA 1TE6A 2CEQA 3MHGA 5HNRA 2QR6A 2VGFA 1DTUA 1H7RA 2A79A 1KXTA 3UJSA 4ZCWA 2FB2A 3KLKA 3OLGA 1E6QM 2UWFA 1S2UA 4ZR8A 5E6YA 1SO3A 4LB3A 1KCKA 1VIWA 3DYMA 4H6QA 3NOEA 2HEJA 3MBFA 3W3OA 2VR4A 3P74A 5EMLA 5BXRA 1C29A 3SM0A 1C8VA 1P0KA 5AYBA 4LUSB 4NZJA 4QE5A 4E38A 3BOXA 1FH8A 3VDCA 4ERIA 3CAWA 3FW6A 1TG7A 3AS2A 4UZUA 3S1WA 3S6DA 1XS2A 1MO0A 2VZSA 2VGBA 1XRFA 4H3DA 5D2TA 1VS1A 4O18A 4W7UA 4KRUA 1EC8A 3RU6A 2X09A 3BZJA 5LIKX 3VD4A 2VX4A 1YADA 6XIMA 1SW3A 4J9JA 2Z1XA 3W2JA 3CC1A 3HA1A 3TTYA 2X42A 4RLIA 3F2CA 3LHTA 1KBJA 2D20A 4E6MA 4DBWA 1NARA 4Q4MA 2V68A 2P53A 1D7FA 1C91A 2ACSA 1B9BA 1ISYA 5DANA 3NQEA 4XZHA 4ZTYA 2TYSA 2VEIA 2WZIA 1W9XA 1KXHA 4PSRA 1Y5XA 1UKQA 4AC1X 4TTGA 2FZNA 1RQHA 1Q3NA 2EJ1A 5FEWA 5I09A 3C3UA 5HPOA 3FEMA 4N4PA 2PWUA 1BEUA 3PJUA 5D30A 3EEZA 3K8LA 1JZ6A 3WJWA 2YA0A 2VEFA 3W0KA 3N6JA 4JD4A 5EY5A 2EAWA 1V02E 3OIXA 3ZLHA 1XKYA 3T2QA 5AYIA 5DBUA 3TAOA 1ZLPA 4DAIA 2ZZ6A 4B5UA 2NQZA 3M6YA 4Q8QA 4H7VA 4FEZA 2PDBA 2YDRA 4TIMA 1JI2A 1FWSA 3ISIX 1VBUA 2A3HA 1Q2RA 2EG8A 2PWDA 2CBVA 4MOZA 3GWQA 3D3AA 5GNZA 3OW1A 2CETA 3TIMA 3HG5A 1CZ1A 1K9EA 3V5OA 1B4KA 4MKSA 1ZY9A 3ARTA 3SN0A 4IP4A 1JCYA 4K8GA 1J0JA 1W17A 4M6UA 1FCUA 4XZBA 4YYCA 3R13A 4EXAA 2Q09A 2A85A 1SJCA 3WK3A 1EX1A 1JZ4A 4UC5A 4AVNA 1PTGA 5U4NA 4LUIA 3VKAA 3ZT5A 5EA9A 2BY2A 4MB1A 1LQAA 3V0SA 4IM4A 2DY3A 5MHBA 2VC6A 1JVNA 3B3DA 2J9XA 1M7JA 2PDYA 4RDWA 4UTIA 1FKWA 3FEQA 1SZNA 3AFBA 1XC4A 2O4MA 5G2IA 2BZNA 3NZGA 2OELA 1PXGA 1QO2A 4LUSA 3ITTA 4MJ2A 1KTCA 1UJPA 1FCBA 4XD6A 2J8TA 4LRTA 1F5ZA 2OWWA 1P4CA 5A8MA 1U33A 1L2UA 4GO9A 1DIKA 4PMJA 2PWVA 5BRQA 3ITGA 2FVLA 1XYMA 4GUHA 3IV8A 1TV8A 3NDZA 5HJYA 3G6MA 4GX9A 3I4KA 2ZC8A 4OV9A 1WAUA 2EBNA 3NQDA 1BFNA 2EGZA 3PZGA 3RM8A 4OWGA 1HW6A 2E6FA 4DJEC 5ABFA 1WBJA 1KM1A 2J9YA 2CITA 2PUZA 1ZZMA 1X8CA 2CZ5A 3RYSA 4X63A 4ADTA 1AW5A 3QH2A 3O7UA 4HZ8A 1W1IE 2PU0A 4ZQNA 4AD3A 2BXZA 2X1IA 3U6WA 3EXSA 4GA8A 1TRDA 1UUQA 3E12A 3PWGA 3SUSA 4FXSA 3NR0A 3PWIA 4I6VA 1OSEA 1XLLA 3DC0A 4HZMA 1YNQA 1W5MA 3CIWA 5CSUA 4B16A 5LZLA 4QG8A 4E4FA 4CUCA 1YYAA 3TC3A 3G24A 1VGAA 1D3GA 2FDSA 5C7HA 3JZEA 1KCXA 2OYKA 1PKMA 1O5KA 1E6XM 3W9ZA 1GOQA 5G1TA 5I3JA 4N9CA 4N9DA 3RCNA 4Y90A 3GFZA 5LIYX 1KM2A 3WIJA 4NI3A 2BVDA 2YDSA 3ZWTA 4YHGA 3QMTA 4V2XA 4IMCA 1HJUA 1JZ3A 4GZEA 2WV8A 3SRKA 3MO4A 2PTZA 2C1GA 2YCLA 4W93A 2WKGA 1PIFA 2JQXA 2J47A 3PZTA 3SAZA 1QR7A 3CWNA 4FB7A 4QHRA 3R5EA 3QMRA 2IW0A 2IQTA 2A6LA 1BSLA 5DX7A 5TAOA 4NJGA 3TV8A 2NVDA 5AHEA 1FWFC 4GYJA 7REQB 1ODZA 2PLMA 1TV7A 4JIIX 4D1JA 1DIEA 3IJ7A 3C86A 3M1ZA 3VCNA 3EPMA 4ML4A 1S3HA 1C92A 3OZMA 4D6JA 3T2OA 3IGSA 7TAAA 5GJMA 3NVTA 4UUIA 3BL3A 2R8WA 4MWAE 2QJMA 1N8WA 3DX5A 2VC7A 2D2GA 5HPCA 3KOYA 1WKDA 1A5UA 1LL6A 2Z1SA 4W8BA 2HV5A 3NUKA 4DXKA 4BKNA 4IGNA 2WQPA 2PWEA 3TTQA 4UMAA 4OGZA 1CLXA 3F1QA 1XQLA 3UZYA 4GRSA 4UOZA 3MA8A 1RD6A 3B9EA 1M1BA 1H1YA 1SMAA 2GWNA 2CWXA 3QYSA 4JN7A 3JVAA 3ZOAA 3QZAA 4RPQA 2G3JA 1L6WA 2QQ6A 2GJXB 4H9XA 5MKGB 4DZAA 1JG9A 4N7QA 2X2YA 2JKEA 3G5EA 3FXGA 4ALDA 3DFOA 2XSBA 4PCNA 3ZZ1A 1JXJA 3GNOA 5FACA 3UG5A 3WNNA 2XSAA 4LJ3A 1R38A 3F4VA 5HBFA 5C7VA 1RLCL 3W7JA 3BSGA 4AAJA 2GOUA 4AZIA 1BHGA 3R0KA 4EF9A 3WNOA 1GKQA 1ZPTA 2CZFA 3EMQA 2Z7GA 4UMCA 4AHQA 4XZNX 1AD1A 2QCEA 4PMOA 2ZRUA 3S46A 2D0FA 2G96A 2VUYA 1UKSA 3BLOA 4XO6A 1Z44A 5LHEA 3C2OA 3GVRA 2ZE3A 4V27A 3WQDA 4Y9MA 2XIBA 1UYQA 1FWBC 4IIHA 3UA3A 4IP7A 2YJQA 3VFCA 2E6AA 5AHMA 4Q3MA 5LNRA 1GG1A 1QAPA 3QQ1A 2WOQA 1ZRQA 4CNSA 3RMJA 3ABXA 2Z6JA 3TSBA 5C2GA 2BVTA 1JDDA 3LLXA 7A3HA 3EWWA 2YX0A 4MY8A 3DH7A 2TMDA 3B8VA 3AJ7A 1C7TA 3S2MA 1LBLA 3H23A 2OB3A 1F8MA 4UQDA 3MVIA 4F0MA 3OG3A 3LM3A 1DQWA 1VEOA 4IICA 1XBYA 2FPVA 4FR1A 3EWZA 1U83A 1EJXC 3MHUA 1DOSA 2NXGA 3KBNA 5K4XA 4DI8A 2Y24A 2HVMA 2I57A 3F4WA 3ANVA 3WUFA 1TFVA 2HWGA 2WWDA 4GNJA 1LZOA 3BMXA 7REQA 1CGWA 5A2CA 4DPPA 4KEMA 1O12A 3GNDA 1UPPA 3N9SA 4Y9NA 3RPMA 4BF5A 1EHAA 2QEZA 2IPFA 4QROA 4XTIA 2E3ZA 1EGVA 1S5VA 2B4GA 2WSYA 4L7ZA 4K3ZA 2DZSA 4WXZA 5JU6A 1GJWA 4JTHA 1Q6LA 3I3DA 2DV0A 1GPFA 3QN3A 1UIPA 3PJXA 4AZ5A 1DHPA 4NX5A 1JUKA 4BHYA 2QJJA 3PC0A 3H2NA 4RV3A 3LDVA 5GVJA 4QS5A 4V15A 2G8ZA 4N9EA 3VOJA 2HXTA 1IT7A 2FHCA 4M24A 3L9CA 1TJ1A 1VEPA 5I24A 2CBUA 3SQMA 4P7RA 2ZX9A 1KR0A 2J7EA 3LQLA 3NL6A 3ZJ7A 1ICQA 2BFGA 3VIJA 5M03A 1I2RA 4FAMA 2WMHA 3P8IA 3WFAA 5FSDC 3WLMA 1KBIA 4H2CA 2DT0A 2A7RA 3FAWA 2DGAA 4M81A 4PMZA 1W3NA 4P8VA 5G5IA 3R11A 5FESA 6TAAA 1FHVA 3G8RA 1H7WA 5A6AA 3NXLA 3NXFA 1HVXA 3OA3A 2X1SA 3IV3A 2AQOA 1GQNA 1K7FA 2WM0A 1QASA 1HL2A 1BVWA 4O19A 4PL1A 1XF0A 2QPUA 2W0UA 3W7RA 3VTRA 1MFUA 3BGJA 1R3RA 4DWSD 3M5XA 2VZOA 4EACA 1EWEA 3SRHA 3W2LA 4GUGA 1JJKA 4GXPA 1FX6A 4QLKA 5A5WA 2XHYA 3CZ8A 3GU2A 2VC5A 1Y5WA 4Q4RA 4ZL1A 4WZHA 1H51A 3VIGA 2PDFA 4RNFA 1E5JA 5HNNA 3VIFA 4GFIA 3DCPA 4GY0A 4X9SA 3KOWA 3ARYA 5EBAA 3O15A 4GUFA 5M2FX 3SCPA 3GHRA 3APYA 4LF2A 3UD6A 4DWSB 1EP3A 4UFJA 4HB7A 4POCA 4UBPC 5HATA 3NURA 1OF8A 3ID7A 1DXFA 3N25A 3L4UA 2QGYA 4JTAA 4XUYA 3T4WA 2E5BA 4FA3A 4XX6A 4PA8A 3QMSA 1DWFM 1FXPA 3L66A 1PCWA 4QG6A 2WKLA 4D6IA 5LKYA 4NZCA 2OOFA 1HG3A 1IR1A 2DORA 3S3GA 5KITA 1D2KA 3EPOA 4L61A 3T0CA 3WBAA 1MQQA 2A3CA 1J5TA 3WK1A 1O1HA 3T8LA 5AHIA 1SFLA 3BO9A 4CNUA 4REQA 1ITXA 4AISA 4FNUA 1ME7A 4MB3A 4XKYB 3MKKA 4R33A 1K3UA 1FP9A 2OWCA 1Z69A 2BS9A 3DYOA 3S4TA 3QSRA 2EPNA 2WQDA 2WMGA 2WZHA 4C1LA 3U3HA 4M6VA 4C6CA 4LS2A 5K4ZA 3QLLA 4RXFA 2FH6A 1KC7A 4RUBA 3NO3A 1HP5A 1W3LA 5A8QA 2Y4SA 3B8WA 3UWYA 1UMLA 2XUCA 4LS1A 1ZGDA 3WLHA 2ACRA 2ZA3A 4KWVA 4D6DA 4IIBA 1EYEA 2GJLA 3TTSA 5JBDA 2Q01A 1JQXA 3GIQA 3LD5A 3MMUA 5A2BA 4HOZA 3SUUA 3BWWA 4MKVA 3A21A 3UFYA 3WF2A 4AHPA 3EX1A 1GW1A 3D5HA 4V1YA 4EF8A 3ES7A 3WH7A 5D2YA 4GYPC 3WLTA 2O7QA 4IHCA 4KGLA 4KRTA 2FIQA 4PMYA 3G3MA 5E09A 1IQ8A 4HZ7A 4GQ0A 4W85A 2I9UA 2V6AA 1M7XA 3TTOA 3QKZA 1X1OA 3S6TA 3VD9A 4RR4A 1VFFA 4RNIA 4MY1A 3M5ZA 4ZOBA 3LRMA 1OX6A 2E25A 2ZYFA 3P67A 4HNOA 1XW8A 1GYLA 4HGXA 4Y2WA 1A5BA 5BROA 3UG4A 1UWSA 3W2MA 1MVYA 1JPHA 4UNIA 5C8BB 3NPUA 1GPWA 3H2CA 3T55A 3SY8A 4KGJA 4J35A 4UTFA 2XIJA 5G2HA 3H7VA 1OWQA 3O3RA 4Z0SA 2X7WA 2NX9A 3IAQA 3GM8A 3LGGA 2TSYA 4QX4A 3KVLA 3NVDA 4MHBA 4LU0A 1R3TA 1FWDC 1US3A 2D1ZA 2INFA 3FDGA 4ZZ9A 5LA1A 2PP3A 3OGRA 1T0OA 4TX9A 2ZIDA 1O4UA 1R2SA 3PAJA 4UTMA 4CD6A 1RCQA 4DJDA 4A8NA 3EWDA 5AN7A 4GPNA 3N19B 2YCKX 3BAWA 1CEOA 5TD4A 4GQRA 4KETA 3V0TA 2W61A 4IMGA 1BXCA 1OK6A 4DF0A 1TTPA 4H2HA 2QV5A 3HZ3A 3VU2A 1XPGA 2QW5A 3DI1A 1GWJA 3G1XA 2X7VA 1UD2A 4Q8TA 2QZRA 5DEZA 3CWHA 4Q22A 5F2MA 4DO6A 1MYRA 3QR3A 1Q8JA 1XI3A 1EWDA 1ONXA 1XG3A 5AC7A 1I1XA 4GG9A 2G37A 2X30A 1LOSA 4R7WA 3W1PA 3N2BA 2PF8A 3TW7A 3WFLA 2PBOA 3WLQA 1Z9AA 4IUGA 1ZHAA 7ODCA 1UWRA 4P2VA 2PRLA 1EOMA 4IQDA 3LU2A 3LCXA 3QV9A 4NHVA 5HDRA 4DWSA 3LCIA 1MUWA 2DIJA 2R9RA 1I4NA 1I6NA 2R24A 5K9DA 2I5QA 1AODA 2H9AB 1AA1B 2Q8ZA 4EXQA 3GLCA 4H83A 4Q33A 1R7OA 2E9LA 5E9AA 3MY9A 1YDVA 3EEGA 3HGOA 1O6IA 1XIDA 3PHAA 2ZXBA 4LVBA 1XLAA 1XX1A 1X1NA 2INZA 3HIJA 1BYDA 1J12A 3MMWA 1F8IA 2P0OA 4PRTA 3EKZA 4JBRA 1JNEA 1M41A 3URNA 4MADA 4H9VA 1H5VA 3LLDA 4HMNA 3CUXA 5D4YA 2ZA1A 1LLWA 4JOMA 2GSJA 3M47A 4IXXA 2QAPA 2XIMA 1VLWA 3TJLA 1RH9A 3WJYA 2Q02A 1XC6A 4GGHA 4PUJA 2OGYA 3T08A 2CLHA 1XJBA 3CM4A 3BOLA 3R79A 3AICA 3F2BA 3FGCB 3T7VA 3LGEA 3KE0A 3VOIA 1F3TA 4WY0B 1O68A 1G01A 4D72A 4KRZA 1VRXA 3V18A 2NSXA 3WLNA 2V2HA 3DHUA 3W7GA 3QGVA 5CZJA 4DUVA 1TUXA 1KGUA 4PMVA 4B9ZA 5B7YA 2J7DA 4O13A 1K6AA 3UT0A 1E0WA 1UUOA 2CNCA 2QDDA 1VFHA 4EK7A 3C2RA 6REQA 3EDFA 4GISA 1V6VA 3ZT6A 3CUJA 3CHDA 2DU2A 1ZFJA 1QHOA 1MEHA 1XRTA 1EJWC 1V02A 1VYPX 5HJLA 1VFOA 5E6ZA 1E0UA 5LNVA 4JEJA 3LG3A 3H53A 2ZZ3A 1RA0A 4NKCA 3UA4A 2Z7KA 1ADSA 1OX4B 2G4FA 2ZUMA 3PR2A 3L4YA 2QCDB 4UNKA 3HFTA 4LT9A 3CQHA 1RP8A 3FCPA 3GC4A 4A3UA 4JQ2A 2ATSA 4CN1A 1WKEA 5AZ0A 2XVGA 4HNCA 3EA1A 4B2DD 3W2NA 2XVKA 1ZCCA 4MNMA 2QAFA 5LA2A 2HTMA 4WD0A 2ACQA 1GOMA 1HF6A 3M16A 4XAFA 1B3YA 1IZJA 1PVNA 3HPZA 4AMCA 4B90A 1TTIA 4CNNA 2FYMA 3R94A 2AMXA 3B04A 4F8XA 1IIGA 1KGWA 1XV8A 3LLFA 4FZIA 1O94A 4Z17A 4H6EA 1UWUA 3GQYA 1TA3A 3II1A 4IG2B 5BMXA 3I7QA 1FWJC 3AMCA 1EUAA 1UKTA 2R1MA 1TMLA 4ZA0A 2AL2A 3M6DA 4HU3A 3VKCA 1VZWA 4AIBA 2YZ5A 5T8GA 4ATLA 2IMRA 3UWQA 1V93A 1KCLA 3Q67A 3N73A 1HJVA 4QM1A 1Y5VA 3DKJA 1LWJA 1US0A 3VNDA 3JUGA 4J27A 4C60A 3KL5A 3T6CA 2YBTA 3B0UX 4JYEA 4HYRA 1EPVA 1R5YA 3LBMA 1EF2A 4XB3A 4LUJA 4A3QA 4HNUA 1XIFA 2IQDA 2VRQA 3DHFA 3KDNA 4ZSUA 2GUBA 3RLVA 4JNZA 1WDQA 2CKSA 3OZPA 2AKMA 1UD5A 5M5DA 3B05A 2Z29A 1XXXA 3RO8A 1VFTA 1HKWA 3SN4A 2RJHA 1J93A 3OPSA 4HN8A 4XAYA 1RBOB 2BOEX 1P0DA 3HPXA 4LOCA 2GJPA 3KTSA 3MW7A 2DZBA 1KQZA 4PYSA 4NI8A 2XVLA 3HG2A 1FWEC 2OZ3A 2A7NA 4LVGA 2OEKA 3CV6A 3KW3A 1IZCA 3CL7A 1J10A 3SW6A 4UOJA 3SADA 4GZJA 4DBSA 1FHUA 1WDSA 1I45A 3TTEA 5HA7A 3E2VA 4JDBA 5T91A 3LTYA 4JR5A 3CO8A 1S1PA 2Z27A 2XZ9A 5LGXA 1LJYA 4J3SA 1J4EA 3M5YA 4OIFA 4V28A 1XLIA 3BG9A 1TZZA 3H22A 2QIIA 1V3MA 1BF6A 4W5UA 2VRJA 3B8TA 3NJ3A 3S1GA 3TH6A 4CQBA 3L7RA 1S5TA 5HK4A 1IT0A 5CJMA 1SW0A 1TJ2A 2J25A 3FIGA 3ELFA 3UWUA 3MSYA 3ARXA 1HL8A 2HK1A 4UXDA 2NUXA 4ILSA 4JIRA 1DPMA 3O6AA 2NUWA 3L0GA 4WDTA 1HP4A 1MEIA 1Z6KA 3G77A 3NSXA 4AZCA 3TYCA 2F6UA 3MSDA 1E70M 1H61A 4KERA 2WMIB 1UH4A 1HO4A 3PFMA 2W92A 2ATMA 4CEUC 1AJZA 5AOUA 6PTDA 1W5QA 1FHLA 2KZHA 1T8XA 3S47A 4ACZA 3VIPA 4O53A 3ABQA 1K9DA 3OB8A 3SY5A 3W37A 1PZ3A 3EOEA 3UPWA 3SCOA 3MWAA 3HGRA 5DCEA 3PBGA 2XM2A 1QXLA 3V0UA 4AG0A 4MJZA 1EOKA 1Q13A 1UWAA 4XD3A 3OIHA 1IYXA 2WYSA 4FLOA 4MNJA 1QNRA 3AYRA 2J74A 2OQYA 3EWBX 2OZ8A 5L9FA 4G9PA 4YTRA 4GKLA 1A5OC 4QG9A 1FH7A 3PTQA 3FNDA 3E2SA 5REQB 3RO6A 5C54A 4CQAA 3DENA 4MNLA 3R2GA 5JH1A 2P3EA 4U5IA 2VR2A 3DDMA 3WMBA 2Y7EA 5HNTA 1QI4A 4FNTA 2YZRA 4LYRA 3NQGA 4Y8EA 4S2BA 5C55A 4LEFA 1TPWA 2EG7A 2J9ZA 1QCWA 3MANA 3PK7A 3GH5A 1DWIM 3EDDA 3GW0A 3BLFA 3UZWA 5ECUA 1MMFA 1R3VA 4NXSA 1G4SA 4A6GA 3BANA 2VQUA 5TIMA 1XGDA 3P7YA 1I2QA 2AOSA 1KRAC 2VR5A 4XK2A 1W54A 2X16A 3LPFA 1KFKA 4ZQOA 1G67A 1VPXA 4Z2HA 2YW3A 3VGFA 4URIA 1DJGA 1XLDA 1H63A 1R0MA 4ERAA 1TR9A 4Y9AA 4QRNA 4FHAA 3A64A 1F2JA 3CAQA 1BVNP 5I3HA 3NQBA 3K1GA 5FAGA 2E67A 3UJ2A 4I8DA 3NSNA 4FNQA 4XV0A 3TR2A 2GDQA 4M0XA 3BJFA 1J8VA 4QJ3B 2JF7A 4A8IA 3L21A 3HMJG 3SUWA 1TTQA 1ZSXA 1LDCA 3GG1A 1EH9A 2NWRA 1YMYA 4V1XA 4QSFA 5EKYA 2XVNA 2WM1A 3WQ5A 3WH9A 4EKJA 4DYKA 4WKAA 3IIPA 5BNKA 5CC5A 4BF9A 2BXYA 1UR0A 4TX8A 3AMGA 4DB7A 1XSJA 4Z42C 2DQWA 5AC5A 1GZJA 4HCDA 4JTSA 1T6MA 2ZZ4A 4Q7BA 2FQIA 4L6DA 3EB4A 3MMDA 4ERGA 4NZ1A 4C6JA 2E77A 3WBWA 4AXKA 4MYXA 3ONBA 1K8ZA 2WCGA 4GACA 3IGUA 1W91A 2GGJA 2MANA 3GTNA 5IOBA 3W87A 5BXPA 3IWPA 4HHMA 2RGMA 4K8EA 3EXRA 1TWWA 1OFPA 4FMVA 3B40A 4RK8A 2OWXA 1H7OA 5CZKA 1L2QA 2WWCA 1UR9A 3RPTA 3CPRA 1FUYA 1GKPA 2YPIA 3P8JA 5FKYA 3WQFA 4JPGA 1A49A 2VVNA 4CU7A 3MJYA 1XRVA 1NWTA 2PE4A 3TMQA 4P7LA 3W85A 4C6PA 1JCTA 2E28A 4Y96A 4HHHA 4YWSA 2OCZA 2A4AA 2DVTA 1SZGA 2QCNA 4O12A 4R9XA 3KZSA 5LNWA 3D3FA 1GHSA 1X38A 1PKYA 2UY2A 3H4WA 4PE8A 4KW2A 4MB4A 3G1YA 4ZE4A 1J96A 4KEZA 2CKRA 4LALA 1QJWA 3UR5A 2ZX7A 4M1RA 3U7VA 5F1VA 4ZVJA 3IRSA 4YCPA 3NWRA 1V0MA 4UTTA 5LNUA 3VKBA 3U2OA 1K8YA 2VDIA 3B03A 4M51A 3WH5A 4MWAA 2HE5A 2NXHA 1R87A 3MMTA 3MUZ1 1W3JA 3KVJA 3OHIA 3R8HA 1AD4A 2NZLA 1DJHA 5G2WA 1JAKA 7ENLA 3ZIZA 5F1UA 4KCTA 5DELA 5A94A 2J79A 3CZLA 1AL8A 2V82A 3GXFA 3ZS4A 3HBLA 1V7AA 2V5LA 4IH3A 1UP0A 3QOMA 1VBRA 1I0BA 3ABOA 5D05A 1X6UA 5B7ZA 1VAHA 1E71M 1XP3A 1GVRA 1K8CA 4U5KA 3RMEA 3W71A 2DUAA 1J01A 1TPFA 3W7OA 2Y8KA 1A0EA 3SUVA 8RUCA 4IJRA 1PWMA 5EFDA 2VVSA 3ALGA 3IVTA 4HIBA 2E8ZA 6REQB 2PTYA 5JUVA 2Y0FA 4DF1A 2V3DA 3IUHA 3QC0A 3L4XA 3EDKA 3HG3A 4UQ9A 2XTKA 4MIMA 4L4PA 2GVJA 1PL9A 3GC2A 5EL1A 1MXSA 3W7MA 1IEIA 1SO6A 4M6QA 1KM4A 4L4MA 2A3EA 1JIBA 3AZSA 1NOFA 3FY1A 4AZHA 3UU0A 2WSQA 4C1NB 4J3ZA 3VNJA 3VOHA 3T07A 1XD0A 1TIWA 4HVXA 4B91A 2OLAA 5A8GA 5GNYA 3F4NA 3QPYA 1YDOA 2POTA 1YW1A 1OB0A 5H8MA 9XIAA 2W79A 2QYGA 3M0KA 1J6PA 3T2PA 4NJJA 4PUWA 2QUUA 1QI2A 3MI3A 4HU4A 2XINA 3TCSA 4LYQA 4HBKA 4GJJA 1VR6A 4O50A 2NW0A 1KXQA 4YTUA 2XIOA 2AMGA 3H21A 2GSHA 4HA4A 4LH8A 3CL6A 1LUCA 3PBYA 1DE6A 2J66A 3GC5A 3SRFA 3FA5A 1D9EA 1NDYA 2H8ZA 3FKRA 2GQ3A 1K6WA 4DJFD 1UW9A 4NU7A 1I2NA 5I03A 5A6MA 4MVAA 5EBUA 2ZDRA 4H04A 4PEEA 1P6BA 4DLMA 2J7GA 2DT1A 3RRAA 4PH6A 1NSJA 3AWNA 4HCLA 4ACYA 1C8QA 1YBQB 3K4AA 1D8WA 1F76A 2DSWA 3PUDA 4QFUA 1NU5A 3DOPA 2OODA 1X39A 3W53A 3H2OA 3T1GA 2OQLA 2DIKA 1KQYA 3OZYA 3PJTA 1ZU8A 2TAAA 4Z1YA 3IPWA 1UR3M 4NVTA 1EKOA 1FH9A 5A8OA 3P82A 3WBEA 3THCA 2PDJA 2WLYA 5EMJA 3W1LA 3L2LA 4LNCA 4R3UA 3W81A 3P93A 3NZRA 3QV7A 3N4FA 3UXLA 3VK5A 4KFNA 2FMNA 3QM3A 4IIGA 2DZXA 2HZGA 4PTNA 1EA9C 4PMDA 1UBSA 3BLEA 3DU0A 1X6NA 1K70A 1GTHA 1NIUA 2CXGA 3R25A 3UVIA 2AQVA 2Z6IA 3QTGA 2ZDSA 3W29A 1IXNA 1JRBA 1LCOA 1U1JA 4FOUA 3GTXA 2VWSA 8CGTA 5FI8A 1CXHA 1W5NA 4U33A 2PPGA 2FGLA 3OG2A 1R3SA 3IVUA 3JRKA 2OR2A 3VCCA 3E0VA 4MPQA 4YS1A 4PMXA 3RU8X 1VJSA 2EQDA 1FQ0A 1LG2A 4TVCA 2WVVB 2Y70A 3WD2A 3U2CA 3SB0A 5FA5A 4JIPA 2O4QA 3CBWA 1S2WA 2XFFA 3DECA 5GQBA 3ARSA 2FH8A 4ASTA 5LSMA 4S3GA 1BGGA 4XTDA 3G22A 1ZTVA 3SFWA 3CV1A 2XYLA 1V4YA 4DXVA 1Q7ZA 1K4GA 3IGXA 1DJXA 5E5CA 3SFKA 4ZTXA 1OG6A 1F73A 2NQLA 4JY8A 2HJPA 3JU2A 3S2JA 4JX5A 4GVHA 1JD7A 3LHYA 4US6A 2HBVA 4MUZA 4XAGA 2YGYA 5CPSA 3RM9A 3LOTA 5AYXA 5HWJA 1UH3A 3DG3A 3KX6A 4JKKA 1IZKA 3SIMA 3LEPA 5CZTA 5D02A 1E0VA 3CTTA 3GKFA 3T4CA 1HZYA 1ME8A 2ZADA 3M0ZA 4B5NA 3LQGA 3T42A 4RJEA 5FCZA 5CKSA 4CQCA 4L6OA 3LRKA 4PL2A 3L2MA 3TA6A 4TV5A 1AL7A 4H6KA 1F3XA 3D6NA 3PZ9A 1SZRA 2NQHA 4E3TA 1QO5A 1TPB1 3OP2A 1QI3A 4RV8A 1DXEA 2E8YA 2XFRA 1OX5A 4O8AA 1XIIA 2HQAA 3UY8A 1TRIA 3FAXA 4BEUA 2E1WA 5BZAA 1Q6EA 1BD0A 3OVQA 5ABGA 1TWSA 5AKQA 3PVFA 3PTMA 2FTPA 1YEYA 3EZ4A 1CXEA 2YCEA 3NA8A 4JTIA 3S2NA 2PODA 3UVAA 5XIAA 1XD1A 4GY7A 2EPMX 4JYDA 3GYCA 2Z1BA 3GXIA 1F4AA 1M6JA 3P60A 3V5CA 3A9BA 1NDVA 2Y89A 4S3EA 3HTWA 2G3FA 1PHWA 3VOGA 1FY6A 5F4WA 5FEZA 3DIPA 2OLSA 1FTXA 3GDLA 1TV2A 3P61A 4LC6A 3KUMA 2QT3A 1AMKA 4UFKA 3CUGA 3S6OA 3NZPA 4AZ6A 3A4WA 1KXVA 1LROA 3Q94A 1XUUA 2NXIA 2IXUA 1F07A 1W37A 1QPKA 4ATWA 3ZR4A 4A29A 1K4HA 3BTNA 3CASA 3O2LA 4BQ5A 4MGGA 3WLRA 2E68A 2BASA 3RCMA 2NQ9A 1TZ9A 3IAPA 1NEYA 2OGJA 1LWIA 3W1AA 3GAKA 4QR6A 3NGJA 2O0TA 1F74A 4QJ5B 1W8SA 5DF0A 2C1HA 3WQGA 2NVCA 3VDGA 3C8NA 3ZVHA 3S9IA 4NT0A 4LQ1A 2SFPA 3C56A 5I77A 3W38A 4IX2A 4L9YA 4YLWA 2F2KA 1KM3A 5I3FA 4IXHA 4D2JA 3RR1A 4HN4A 2DSZA 3AYSA 2QF7A 3M0XA 1MFVA 1OD0A 4RE3A 5I06A 2OTDA 4FNSA 3WFZA 3ARUA 2HNHA 2CZDA 4NIRA 1JL8A 3BCFA 1TELA 4G5DA 1R2TA 4OKDA 3LTPA 4GCXA 1E6PA 5CPTA 1H7NA 2WVTA 2UY5A 3TLQA 2XIQA 1BSIA 3M0JA 2ADAA 1ZBVA 4DX3A 7XIMA 1V0NA 2FFCA 1B90A 3N2MA 3U9IA 1UKPA 1JYVA 2GJRA 4GYFA 2V2DA 1M7OA 1PTDA 1OFAA 1TV3A 1M65A 3N11A 1XIGA 4FS9A 1CENA 5CXPA 4BQ2A 4XQ6A 1IXQA 3BH4A 3N14A 3VDHA 3LCLA 1DXIA 3WMLA 4M56A 4HHLA 3GSMA 1MW0A 5AFDA 1BXBA 3QHNA 5J04A 3OO2A 1WZLA 1KB3A 3QW3A 3AAMA 3VZXA 1KFCA 4O16A 4MLJA 4AD0A 5H1WA 3WDIA 1EL3A 3TONA 3BLKA 2Y63A 2ANUA 1VQTA 1OEPA 1WCGA 4LUYA 1Q6CA 5CBBA 4JTQA 5K3VA 2VEKA 1NOWA 3RLUA 1G9HA 4GCAA 5IBXA 1JRCA 2F6XA 3ANUA 2QXWA 4QS6A 4HYVA 4BQ3A 3EX6A 4JX6A 3AISA 2QPXA 4ROPA 3LYEA 5FEXA 1KWGA 2XSXA 3DFNA 3TNBA 1JCLA 3SJNA 1TVLA 2P0IA 3H7RA 3GD6A 5LA0A 3R4IA 3QGAC 1H62A 1EDQA 1B3ZA 3P5YA 4UTTC 2JK2A 3XIMA 4H00A 2ZC1A 3AXIA 3EPNA 5MF5A 1BGAA 4U31A 1H3GA 2DZUA 4GXWA 4B3ZA 3DFSA 1NFGA 1WDDA 1KFEA 2BNJA 3ITVA 2RHGA 3OJGA 3C6CA 3UR2A 3GR4A 1F3EA 3L4ZA 2A7PA 3B9OA 1WDWA 4Z1AA 1X7FA 4H01A 4C6MA 3BLLA 1GK8A 4YHEA 4C6EA 1S2CA 3W00A 2RDWA 1J0ZA 1A53A 2VXNA 3E6EA 4R53A 4M29A 3AQUA 4CLMA 4IOTA 4GNVA 4KWWA 5DXXA 1V6TA 3OVPA 1OZMA 1ODUA 4A4AA 4H7ZA 3ALFA 2AAAA 1W5OA 3HURA 2FHFA 1XDMA 3QY8A 4YVPA 2GQ8A 1Q6RA 4MZ1A 1GVQA 3BARA 3IVSA 3IANA 2CYGA 3FDKA 2ZRXA 4F9JA 4UFHA 1F7BA 2GQ9A 4PRRA 1XRSA 2E5CA 4ZO9A 3MU7A 4AZBA 3B8IA 3C2FA 4HA3A 3K2GA 4MTVA 3KWSA 3VXGA 1NTHA 4IFKA 1P5BA 3IEBA 3PFRA 1XCWA 3P84A 1TJPA 4J28A 1VC4A 1OJXA 2DT3A 4DF2A 3PPCA 3M0LA 4WOQA 1V8EA 3UERA 2ESCA 4L6HA 3GG7A 1YDYA 2QF8A 1VPQA 4EPBC 1UASA 2XM1A 2ZXQA 4S3AA 5I2UA 4J2PA 8XIMA 1F6YA 2NLYA 2OKOA 4EAMA 3DEQA 4KFPA 1X7IA 1S2VA 3CMJA 4KPLA 3RITA 1V03A 3TQPA 1XLMA 5TNVA 3ATZA 4GVIA 1VJIA 1V3IA 5CPOA 3VABA 3CH0A 5I3KA 1YBQA 3LB0A 4CQ8A 4QQ3A 4L9XA 3RNDA 2DW6A 4PZVA 1E1FA 3O6CA 3LHWA 4NRSA 2CHOA 2F7FA 2Y8VA 1A4MA 5TQLA 3VYLA 1E40A 2PDPA 4Q8PA 1R3YA 1PDYA 2PDNA 1NH6A 2IKGA 4RE2A 4PEKA 2VD9A 1R6WA 2XIIA 2WXDM 1Z8AA 1B3XA 1WOBA 1PWLA 5U7SA 2Z4GA 2XGZA 1HKIA 1YXYA 2YFOA 1QNSA 5E70A 3VO0A 1CGUA 2QVNA 2ZZ5A 4J40A 1UR4A 4DAFA 4JEQA 1PBGA 5K2ZA 2OLHA 3Q65A 1EHNA 1H11A 1KRMA 1BG9A 5DMMA 1GJUA 1V51A 1RVGA 3H2FA 3B0VC 3W28A 2DT2A 4XVDA 1G4PA 3FA4A 4JCMA 3UCDA 5BYWA 4S2CA 4YTQA 2EPHA 1A50A 2JKPA 4BCEA 4L65A 1OYCA 2VMFA 4MFEA 4FOKA 1S3TC 3LA4A 4ZSTA 4CCZA 1Z41A 4H9YA 1ADDA 1UR1A 1IF2A 1L6FA 3E9AA 3F4CA 2F38A 2R94A 2E6YA 2GZXA 2WVVA 4E2OA 1TPEA 2NQ5A 3KWXA 7TIMA 1HNYA 4UR8A 2QUMA 3NNTA 3QKEA 4X2RA 1QNPA 3H2EA 1LRQA 3IARA 1H7PA 3WYZA 2VFEA 1PB0A 4V33A 2A3BA 1MRQA 4CKQA 3THQA 1G69A 3TFCA 3BAKA 3XINA 2ZXDA 3ANYA 4XBJA 4IP5A 5CCZA 1DQXA 4XSLA 1EO7A 3TSMA 4IFKB 1XLKA 5CGQA 2ISDA 3UW6A 4U3AA 3B8UA 1LL7A 4W8LA 3EB3A 2EPLX 1JFXA 1J5SA 4GINA 4HYWA 2Y2WA 2YYUA 4XUGA 3C3NA 4HA1A 2QDEA 1EEXA 3CZEA 3GYEA 2PWFA 2B7NA 5CGMA 1TREA 2G50A 2WB5A 4LB4A 1IEWA 3LNMA 4ROQA 5B80A 3GUWA 3WQ6A 4MSSA 5IDZA 4J3WA 3S2CA 4X22A 3ZM8A 4DWSC 1JCJA 5T26A 1XICA 1B1YA 2WBGA 3IACA 1QUMA 1E4IA 3DKLA 3UY7A 3NYDA 4FNRA 1EC7A 3FYPA 5HWNA 3SJ3A 3EOSA 4H9ZA 3LX9A 4PUDA 1GVEA 3M43A 4AY8A 5I02A 3MYOA 1V5XA 3GY1A 4AD5A 4M5PA 3WH8A 4LCQA 3FJ4A 2V5CA 3SO7A 5I3IA 3I6EA 1UZ4A 2WAGA 3ABZA 3WLJA 4FX8A 4J3XA 3VD7A 1R86A 2W6RA 3V36A 3QVQA 2DQXA 5A3HA 4Q32A 3DAQA 4GVGA 3VA8A 4GBUA 1WO2A 4WLCA 3EX2A 4I9MA 1P7TB 1TQJA 4ZXOA 2WMFA 5LIXX 1IWAA 2HVOA 1ZAIA 1JFHA 1QNVA 1XLBA 4JL1A 4RZ4A 1UZDA 3GG0A 1RALA 1W0MA 3LCGA 1KGXA 3B9AA 1YNPA 3W1UA 2OEJA 1L6SA 1TPDA 4UFLA 1DTNA 5A6SA 5LXEA 1EJRC 4A2SA 1GOXA 1TMQA 1T8QA 4AD1A 1FWCC 1IR2A 5A8PA 2PMQA 1E9LA 5JIWA 3LSCA 2G5WA 3G0XA 4HD5A 3W1NA 4MF4A 2Y7GA 1PSCA 3W86A 1QPQA 3R1ZA 1BG4A 1YIXA 2QCLA 2Z1VA 3RFAA 1E1EA 3B8SA 3CMGA 4K7VA 1I1WA 1ECQA 2EO7A 3RLHA 3SSJA 3WQPA 1Q45A 3GVVA 3URAA 2R1PA 1POJA 3CT7A 5AC8A 1O66A 4IF2A 3W88A 4GIYA 2FTYA 2NLIA 4GUIA 2VHLA 4OT7A 1AQ0A 4BI5A 2PB1A 2PCEA 3AROA 1I60A 4JICA 1WYIA 1UWIA 4JNMA 4KCWA 3RK8A 4IIEA 1OD8A 3KP0A 4S3BA 5KZDA 2VOMA 2QCFA 3W70A 1CECA 3QJAA 1OADA 1RK6A 3N1AA 1THFD 3G1RA 2ICSA 1H2JA 3WLSA 3W27A 3N2CA 1TO3A 4NX0A 1AH0A 4S23A 2P5NA 5HMSA 4OBRA 4PTDA 1D3CA 1DL3A 1VENA 4MMWA 1W31A 1XBZA 1ZAHA 3DXIA 3I10A 2Y62A 3GAYA 2IPGA 1AFSA 5D33A 5XINA 5BOOA 1DEDA 4DIAA 4XZWA 1GNXA 1UD8A 3GE7A 4H8HA 1W3HA 3RG6A 3AMKA 3V1PA 2VUNA 3UWVA 2RDTA 1TSIA 1Y65A 4D8ZA 3WD4A 3GTHA 4BS0A 1NFPA 3WNPA 2VD8A 3OYXA 4HTBA 4QE1A 5KINA 5DRCA 2C0AA 1OT1A 1W1PA 1ZBCA 4LRSA 4ATDA 3QZEA 1LRNA 3MYPA 5F2GA 2GGHA 1CLKA 3A4JA 3M07A 1IT8A 2IKJA 3CEUA 4FF5A 2WNNA 3Q45A 4F0RA 4OHQA 1Q6FA 2OX1A 3M0HA 5DQPA 5A8NA 1FKXA 3VUSA 3ARZA 4B5SA 4PMNA 1A4LA 1TQXA 4QNWA 3WH6A 2PS2A 4D71A 4YWIA 2OSWA 2F8QA 3G6LA 1LQ2A 3TWBA 4H8NA 2PDXA 2QS8A 4DJEA 4XISA 3C2VA 4IPPA 3PB0A 2C15A 2J7FA 3WSUA 2BG5A 5DY2A 3TCEA 1ICPA 4M7TA 3B8DA 4GIAA 3WF1A 2NT0A 1XIBA 3TC6A 2V5JA 4ICNA 1YTDA 2GVLA 4DM1A 2I56A 5D32A 5I00A 2DSKA 4WX2A 3WBXA 5H8PA 1IIHA 2W5FA 5T9CE 3TZNA 3ZR6A 2GJXA 2WJDA 3FYYA 5AECA 1NF7A 4GZ7A 4NNBA 1JPIA 3VC5A 1E55A 4WHBA 4N4QA 1FXQA 4EAYA 3E02A 3QQWA 1R47A 2ASHA 4O11A 4C6DA 1P43A 1XIEA 4KWSA 3VMPA 3E5BA 3VGBA 2Q3RA 5PTDA 3UNTA 1HGYA 1T5AA 5G4HC 2YCJA 2J27A 4CGTA 4JDYA 3AIBA 2Z2BA 3I4EA 3AHTA 1D8CA 3TN5A 2R1LA 2CU0A 3W7NA 4HTYA 2I16A 2QCGA 1TWDA 1L6GA 3L5LA 4W86A 1ZS2A 4ZE5A 3QXBA 3ABSA 4US5A 3RF9A 4QBXA 2A0NA 1FBAA 1WUFA 1UBPC 1J11A 3CAVA 2EEXA 3NYZA 2EJAA 2YXXA 1SGJA 4JHOA 1OC5A 1FWGC 1QHZA 4PTWA 4UTJA 1EGMA 4O1FA 5HAOA 1C8XA 2E5DA 3AXKA 4PSPA 1R3QA 2YDAA 3CUIA 4BR1A 2FKPA 2V5KA 4QDPA 1HKKA 2YSWA 4FXRA 1S1RA 3WQWA 4L64A 4RZBA 4DM2A 5FL1A 3UJRA 3O0KA 1RUSA 2CZEA 4YTSA 4NJIA 1QDSA 1XUZA 3SUTA 1CBGA 3BURA 4QITA 1DWGM 2D73A 2VP8A 3AZRA 4PFHA 5CBJA 1AQFA 1RPKA 4D6GA 4O0QA 1P6WA 5AHFA 3PZMA 1CNVA 3BLPX 4KS0A 4XKMA 2V30A 2QUVA 2B7PA 1XG4A 1DIOA 4JTFA 3VGDA 1YXCA 2QJNA 2HDJA 4PR4A 3OEXA 4D9PA 1YPXA 1K03A 4AH7A 3LNPA 2GVGA 4FOJA 4HSHA 3LCWA 1MNZA 4CNOA 2H9AA 1REQB 4AFYA 1DVJA 4RDZA 1R7AA 1TX2A 2ABBA 1T96A 1HKVA 1VKFA 1KFLA 3B9NA 4ZB0A 3DFPA 4ZOAA 3V4BA 1CGXA 3G1SA 3T0TA 1BYBA 3EA3A 3XISA 3TQKA 3NQ2A 4I5XA 4HPJA 3AJXA 1E5NA 3WEZA 3I3BA 2PLJA 1H1NA 2BOFX 1XSIA 3BUVA 1XH2A 1XIHA 3NL5A 1WKYA 1U5VA 2QV4A 1ZJAA 4QAWA 2DFAA 2IKHA 5MKGA 3E1F1 1ZP3A 3VE7A 2XH0A 3NEHA 4A3RA 4PUNA 3ARWA 4HPGA 4E8DA 4PN2A 3WBYA 3NQ6A 1YNYA 4UTWA 3NL3A 1MQPA 2PDUA 1B54A 3CAKA 4K1GA 3HM7A 2GYIA 4FLQA 3JW7A 1IEVA 3TXZA 2JEQA 4Y8FA 2NV9A 4MAZA 4PTMA 4IIFA 4QIUA 5FF2A 3BJTA 2D0GA 1E4MM 2GUYA 1MDRA 3S1UA 2QJHA 4FNPA 3WY1A 5C9UA 1OFDA 5A6BD 1PO9A 1V7YA 1K77A 4JCLA 3VM7A 1YLVA 4WY0A 3J7HA 3BAJA 2BLEA 3ITXA 3BXWA 3KXQA 1O95A 3OODA 1QW9A 2E4TA 3NIYA 4O1DA 5BU9A 2JBMA 1W1A1 1QNOA 4Z08A 4GE8A 9XIMA 2JALA 2QLYA 4TQTA 4A05A 1XLCA 3M9YA 3REQA 3BZGA 3IRDA 1FCQA 4DVOA 3MCMA 1XSKA 2PSNA 3AO0A 3I7SA 3S2LA 3S5NA 1SMDA 5DBTA 4IFRA 3GTIA 5DCBA 3KOZA 1GOIA 2YL5A 3ZXWA 3QGKC 4X3ZA 1E9IA 2DH2A 5D8WA 3SBFA 2ZWZA 1CLVA 3TLLA 1UCWA 3LZ3A 3R7MA 4QLLA 3K13A 4CEXC 4DRSA 1Q6GA 3GH4A 3KRBA 3RGTA 3ZSTA 3KBJA 4AZ7A 3HGJA 4U2YA 3NTYA 4LSBA 4FIRA 1GCYA 4DWDA 3V3WA 3K5XA 1Y0EA 2CLPA 2CLFA 1KRCC 3BW4A 3BCJA 3DN5A 4H7CA 2QNEA 4O4VA 3SECA 3AUOA 3FFSA 2ISFA 4F2BA 4F3HA 4B5TA 2WHKA 4GNKB 2E0PA 1VFUA 4Q4PA 3LI1A 3C0JA 4QLJA 1HKMA 3H12A 2GK1B 1FWIC 3C52A 3B06A 3VINA 4YMZA 2G4JA 3VDAA 2PZNA 1XYBA 3S0CA 1TA3B 3NQCA 3QV8A 3LUTA 3UR8A 2ZRYA 2E9MA 1UMYA 4IT1A 1RQBA 4IPIA 1XWYA 5IHRA 2VEMA 4C7GA 2VNCA 3GS6A 5CLTA 3WQ8A 2HPIA 4K36A 3E96A 1ICSA 2DUXA 1MUMA 4RW5A 1G5AA 4YCOA 5HUOA 4Q6JA 3OLDA 3CPUA 2FJKA 3QPEA 3P14A 1KW1A 3SIZA 3SR7A 3EWUA 3UBPC 3CYVA 3R6IA 1RJPA 3V7PA 2YA1A 5F4XA 3GVWA 3NQ8A 2VFDA 2FPTA 5I79A 3DC8A 3FSUA 1FOBA 5JVLA 4XZMX 3TSDA 1P0BA 1X8FA 1O60A 5DT7A 3CB3A 2PC4A 4O1BA 1CGVA 1CXIA 3BQ6A 5CGTA 1U1UA 8TIMA 3WELA 4FIQA 1LP6A 4L80A 5HR6A 4D8AA 4LFYA 3K1DA 4BQ4A 3WUBA 3FVMA 5IFPA 1QK2A 2GSEA 1ONWA 2XGBA 1WA3A 3DERA 4GI4A 2ZUVA 3TMLA 3CB8A 4TTUA 2EPOA 1UA7A 3VMOA 1PZ0A 2GDVA 4GIEA 2VO5A 2R91A 2HPMA 4BEQA 2C91A 4MB5A 4EANA 1KM0A 1DJQA 2GWGA 3GDMA 3SCVA 1PKLA 3CNYA 4ZXLA 4BK9A 3EX4A 1I2PA 5CG0A 3SCUA 5CAKA 1CI1A 3H2MA 1UOZA 2ALDA 3KVKA 1BWVA 1K9FA 3VIHA 1SW7A 2OSXA 3POHA 3SEPA 5KMYA 3KBWA 4D6HA 3N6QA 2PDWA 3OBAA 3TYUA 3CQ0A 3GXMA 2KAUC 3AXHA 2O9RA 1S38A 3FSTA 3EBVA 3UWEA 1W9UA 5HNUA 2WJEA 5H91A 4DUOA 4R7OA 3W7QA 4W84A 5BWAA 2PTWA 4F79A 1NQ6A 2GUUA 1GEHA 3VNZA 2VEGA 3VILA 1E0XA 3WNMA 4PUKA 2XFWA 2OSYA 1LTDA 2FZ8A 2PGRA 1XISA 1UOKA 4E2VA 3TJ4A 4QE4A 3NCOA 3BLIA 1R3WA 1AVAA 3LSBA 1E1CB 4N0RA 4Q8OA 1JZ7A 4JFUA 1NWRA 5JBEA 2A3AA 2DJXA 3BG3A 3GXDA 3KDOA 4E0CA 1WDPA 3EOLA 1JGMA 1KD0A 1F6KA 2BDQA 5EMUA 1JULA 3C0LA 1F4HA 2XH4A 4ZO7A 3M46A 1VBGA 1GEQA 2CFFA 1TJ0A 1JDEA 3AU6A 1J6OA 2HE8A 3IS4A 1OYBA 4B3KA 5CPMA 2DPEA 2OFJA 1YTKA 1LF1A 4RNHA 1GG0A 2GGGA 5DMNA 1WDRA 4DJED 4LW7A 4UQAA 1DJNA 3BG5A 3VIKA 2PRHA 2RDXA 4AY1A 1PZ1A 3PUEA 3IIVA 1XLHA 2I5GA 2DW7A 3NFUA 4R85A 3AHXA 1UR2A 2ZXAA 2X40A 2C1IA 5GJNA 5HMEA 3I3EA 2PD9A 3URQA 2NV1A 3WJSA 2QCMA 2P76A 4BWLC 1CPUA 3NZQA 3UETA 4PFMA 4N02A 4AMAA 1U5HA 1HL9A 4KT2A 5CG7A 1FDJA 5IM51 1W6TA 1OABA 2XISA 2H3BA 2XZ7A 4JIHA 3D46A 1QW8A 1GOKA 3WDRA 4WSHA 4GABA 2BXVA 5H8UA 3W1XA 3AS1A 4HKPA 3VKJA 2X05A 4RKAA 2BB0A 3PB2A 1YPFA 2PU1A 2QHAA 3WQOA 4CU6A 5TBOA 4LBSA 2P3ZA 4X0NA 3WF0A 3M4HA 3LERA 2FGZA 1W9DM 4ZQCA 4GH1A 4IIDA 1YE4A 3LBOA 1IV8A 4TMCA 4PCSA 5EB8A 1MWOA 3TAKA 3RLGA 3ARRA 4RXGA 3WX7A 2NV2A 4E5TA 4LUTA 3U4FA 2J24A 3TWAA 4CU8A 3TYZA 5CSSA 4B2DA 1LBMA 1MZHA 1E9YB 3QY6A 5LIWX 3KOFA 2OO6A 1PE1A 2P50A 1XQKA 2C14A 3MP5A 1RSCA 2P8CA 4Z2IA 1I2OA 2PP1A 2YR1A 1OFQA 2QKFA 3FX4A 1AQHA 3T44A 1QI5A 2Q6ZA 5HR7A 3TJIA 1W32A 4HPHA 2X1RA 4ML9A 3IJ9A 3Q37A 2B0MA 4XIAA 4JIEA 1PDZA 1H50A 4KFOA 3CJPA 2V2CA 2PDKA 1GYMA 3W25A 1JCNA 4FLSA 3L4VA 3WD1A 3WLOA 3FXYA 1GQKA 2PGFA 4O28A 1EPXA 3WL0A 1H1ZA 4G7EB 5FD0A 4O54A 1R9YA 4CVWA 1GKRA 3NGFA 1NQKA 4UB9A 1RXOB 2Y5EA 3EGJA 2F61A 3L4TA 2PDHA 3PUOA 4DYJA 3S5OA 1OQFA 2CZVA 2X0HA 3FHQA 3THAA 3VIOA 2NX3A 1PS9A 3BDKA 1BXNA 4C65A 2FJUB 1W1YA 3CO4A 1K1DA 3WDHA 3PTKA 3AU2A 1VFLA 2D69A 2YL9A 5AYZA 4AY7A 3GX9A 3PP7A 4CNPA 1Q85A 4F4RA 3O8AA 4LWWA 1KA9F 1PX4A 2BY0A 4JY9A 1HKJA 5FJIA 1TX0A 3NM3A 3CEPA 4O52A 2PGWA 1ONRA 2GVEA 2VENA 4IQEA 2VCBA 3FJNA 1HX0A 1Y8BA 3LZ5A 1QI0A 2YLAA 1PCKA 5DO8A 1HN1A 2XU2A 2OVLA 1VBJA 4W9TA 4FP1A 3W7DA 3F2DA 3KL0A 3O63A 1KO0A 3TDFA 3UGRA 1C93A 2WK2A 4MWAD 4WKHA 4A35A 4AWEA 4CQDA 2PP0A 4GYKA 3CWOX 1SM9A 2J62A 3W01A 3B4YA 3H55A 3M7SA 1A80A 5JH2A 3APTA 4GWEA 2V67A 4JTUA 2WHLA 6A3HA 3EOUA 2WZEA 1SJDA 2UBPC 3C8FA 1BTCA 3CHVA 1R9ZA 2VDGA 2E40A 1MRAA 2OZTA 5C6MA 2PLKA 1Z32X 3WQ4A 4WSJA 3WZ0E 4CD4A 4TXEA 1TWZA 3PBUA 4AIEA 3WK2A 1UHVA 4H9TA 2OOGA 1MI3A 1EDTA 4JGDA 1VHCA 3DGRA 2QJGA 2RJGA 4RE4A 3GIYA 3UZ5A 1HGWA 2H3DA 3N18A 3MI2A 1GVIA 2PURA 4QXIA 3SY1A 4LEQA 1JPDX 2IQ0A 3S5YA 1P1XA 4WUIA 1AUSL 4E3VA 1FDYA 1SYTA 1DE5A 3SURA 4A8LA 4R34A 3DFQA 3HV9A 2X1UA 4OOUA 2QCHA 1U22A 3W24A 3LHZA 1KCZA 4CD7A 5H6HA 3WF3A 1WUEA 1TVPA 4O4WA 3E38A 3OA5A 1UG6A 3AI0A 5ABEA 3OGVA 2ALRA 3RDKA 1B3OA 1FWRA 3OU8A 1VB9A 1L8NA 4J5NA 4AHOA 1A5CA 4NJHA 3TROA 4QNEA 1W3IA 5LYRA 5D37A 3CXOA 1NVMA 3MS8A 1X6LA 4D1IA 4PULA 3NZ1A 3VUPA 1LOLA 4O1EA 3H26A 3ZFHA 1AJ2A 1T41A 1XFCA 3K4DA 3M44A 3N12A 3OQ8A 3HQPA 2P1FA 1M68A 2ZVRA 1XPYA 1XCFA 3RR4A 1W9PA 4OJYA 1POKA 1SFTA 3D0CA 3POCA 1BLIA 2ZBTA 3BC9A 1REQA 3ECQA 3IJIA 2VX7A 3DYPA 3STFA 2REQB 3TN3A 1UJQA 3G8EA 1HJSA 2ZZ2A 4IGMA 3WD0A 5HMDA 2WC7A 2JF6A 4H4IA 4NJKA 1UQZA 1XFBA 4HSOA 5JXQA 1OFRA 3VOCA 2Q71A 4GFSA 1F9CA 1JGIA 3INPA 2PD5A 3G2GA 2CWNA 3MZNA 1PX3A 3BVJA 4PUUA 1MW1A 4NG3A 4IWWA 3N9RA 3V16A 4WKFA 4J4KA 2VC9A 3L2IA 2VFFA 4XKYA 1Q4WA 1OVDA 5HULA 1WOAA 4JQ4A 3W82A 3IK2A 1HJQA 4CN4A 5DRIA 3BJSA 3UXIA 5A95A 5I0DA 4MDPA 1ZALA 3ZYZA 3HU7A 1DWJM 4JFTA 4C6NA 2ZX6A 2OO0A 1JYXA 3LCFA 3A22A 5CAHA 1Q6OA 3OTRA 1QVBA 4KIRA 5K9XA 5HJXA 4I7VA 2J6XA 2IUZA 3WUGA 3VZYA 1GW9A 3GXPA 2PDIA 3UZZA 3MUXA 1E15A 3VPLA 3AIUA 4PUEA 1G1YA 4XBSA 4QCEA 3WQVA 5HWMA 1EUNA 4Z1DA 4AW7A 3DUGA 3TUUA 3N13A 1FWTA 2DP3A 4Y6GA 3VIMA 3HPAA 3ARQA 4I9TA 1RAKA 2G0WA 2OU4A 4DO7A 1K9TA 2PI6A 3Q2DA 1WZMA 4WEVX 3TN4A 2BVWA 1UZHA 3BW3A 1XR2A 3EWCA 4HU8A 1I75A 2OKTA 4JTRA 4GQQA 3W22A 3MDUA 4K37A 4MFDA 4HHPA 4LC8A 4EPKA 1QW7A 4AZCB 3AALA 2A21A 3C2YA 1KKOA 2B81A 1E72M 4W8AA 1RR2A 4Q4QA 3SCWA 2CBJA 4LCSA 3I65A 4PBEA 3Q4DA 3H24A 1LG1A 1DHKA 1RA5A 1TPC1 2POZA 3OLEA 5HQMA 4RZ6A 3KHJA 4DXXA 3VDBA 4XZIA 4QEEA 2PCQA 3ME3A 4IMFA 1I9CB 2ZUNA 1KTBA 1KNWA 3S5SA 1SR0A 3NG3A 4UZSA 1JI1A 4IJBA 1TPUA 2RDUA 5CC6A 3E5PA 1J79A 1J0YA 1L8PA 2E7FA 3R10A 4QQUA 3CL8A 4KCVA 4GI9A 1AG1O 1M01A 1EIBA 3BK0A 4IQJA 4MM1A 3W72A 3WL1A 3FKKA 3GFYA 3AIRA 3GDTA 4PMQA 1SSGA 4JQ1A 4ORMA 2VZVA 4XIMA 1TV5A 2BY3A 1UQYA 1PYFA 1QOQA 3VOFA 1KM6A 4LNYA 4C6QA 3T78A 5D9NA 4A3YA 1J2WA 2VTFA 1KBKA 1UD4A 3JZUA 2G95A 3IJDA 3C4UA 2QJIA 1U5JA 3NAVA 1HJWA 2DEPA 2FZDA 3NOYA 4C5YA 5IXEA 4M82A 1ZP4A 4ONVA 5EGRA 3VMNA 3L5AA 1WP6A 3UWWA 1E9ZB 3GG8A 3RN6A 1XKJA 1G4TA 3NM1A 1UD6A 5LHFA 4E2DA 5C9WA 2C79A 4G56A 3ZQ9A 4N6EA 3E0IA 3BPWA 4OZOA 4C7DA 2C71A 2X8RA 4HA0A 2OZ0A 4DUWA 2AAMA 4PB4A 1OGGA 1XDJA 1MDLA 1E3XA 4FPSA 4MY9A 3WCZA 1OZQA 1JCMP 3AXXA 3BV4A 4TVUA 4AD2A 1EX5A 4BF7A 2Z25A 2ZRVA 1XYFA 4MYAA 4JQAA 4UQBA 4X0VA 3ZMRA 5E0FA 4C6BA 1DJWA 3TU9A 3U8GA 3DHDA 1A5KC 2V5DA 1ISWA 1G6CA 1SJBA 3OHMB 4DELA 1HQTA 1TB3A 2QDGA 1OGSA 1KFWA 4IL0A 3F5LA 2H90A 4UTHA 4EPEC 4HNTA 4IFOA 4Y9PA 1BKSA 3GBEA 1DORA 3F5JA 1DQUA 2Y5SA 2WMJA 2DZPA 2R1NA 3W7KA 1VFSA 3PBMA 3Q58A 3WQCA 3UJEA 4QEHA 3BOFA 1GZ1A 3SZ8A 3W02A 3PJWA 1SZFA 4AX7A 2CLMA 1OIMA 2J8GA 1KKRA 2HMCA 4Z2LA 4L56A 4EWND 2HBXA 4B92A 4U3CA 2CESA 4TR9A 3DBPA 1B30A 1QT1A 2NQJA 4Y9OA 4HNNA 1NJJA 1E6SM 1UZ1A 1M03A 4PGLA 3UR7A 1H0IA 4YU1A 4H19A 1X1ZA 3ATYA 1FP8A 4I9AA 4L4LA 4UR9A 3SI9A 1JNDA 4S3KA 4GOAA 2Y7DA 4RPPA 2Z1WA 3REQB 5I6SA 2BGSA 4DJFC 3CIVA 2HNEA 4NAEB 4MLRA 4G7EA 2KX9A 4AEOA 5FJOA 2A3LA 4EVZA 1IEXA 5CJNA 2PA6A 1UR8A 4ZGYA 1TYGA 2TPSA 3N9KA 3PZOA 1A5MC 1N55A 4ZQPA 4W87A 3NQAA 4H6RA 4C6LA 1XH1A 2VOTA 3A47A 3WF4A 3W7CA 3GNRA 3AUJA 5DFAA 4FX6M 1IWBA 1G4EA 4XZ9A 2V5BA 3WN6A 1DWHM 3L4WA 1QATA 3PG9A 1GORA 4K8HA 3SCQA 3T40A 3N15A 3HQOA 3JR2A 4FR6A 4ORIA 3NQVA 1BVZA 3LN3A 2DZVA 4M1BA 3E3HA 4E2BA 4AF0B 3VGGA 2W91A 4X60A 4A21A 3TOYA 5FF3A 2VQTA 2UZ9A 1JAEA 1LLOA 2WZTA 2BV9A 3R58A 1NAL1 3IIZA 2CBIA 3OLIA 1ML1A 5BMWA 2VGGA 2V3FA 4CCDA 3CK5A 2NX1A 2OYMA 4ZBCA 5A6KA 3T0BA 1YPIA 3WK0A 2JFEX 1K7EA 4JL2A 2VFIA 4O10A 7PTDA 2Y8UA 3AC0A 5I5RA 3OYZA 1W9VA 1EJUC 4DI9A 1XHGA 3MUAA 7CGTA 1ISZA 4W7WA 4B5WA 1VCGA 1EZWA 1SVDA 3GB6A 3UQNA 2FB3A 4CNTA 1FHDA 4UMBA 4LVAA 5HANA 5DT5A 2OT1A 4HJFA 1EJVC 3PWAA 4GUJA 3MKCA 3G1FA 4GI6A 4HZ6A 1CXFA 4RDYA 3SCSA 5D2WA 1IEQA 3GTFA 3KCJA 3G0SA 1EJTC 3S83A 2QPSA 3QHMA 4BA0A 1Z89A 5D2XA 1GQLA 4UQCA 4JKLA 1M5WA 3CYJA 3VNLA 3W84A 2Y7FA 5D2VA 3E2RA 4HCHA 2V63A 1GYNA 3LTSA 5D8ZA 5IDIA 4PCPA 5C9RA 1QFEA 1N8IA 3KOXA 4YJ5A 3ZJKA 3LCHA 1UP3A 4JN6A 3STGA 3P5ZA 3YPIA 1A5LC 4WXYA 4S38A 1VEMA 4YIWA 1US2A 3TYEA 4EOUA 3VNYA 2DSUA 2HS8A 3GK0A 1GZGA 1A3HA 2ON3A 2Z0IA 5D38A 3AYTA 1KFBA 2BTMA 4QGCA 1QU4A 1T40A 3PZNA 1YDNA 1F6PA 1L6YA 3ARPA 3KLLA 8XIAA 5F2IA 3EAUA 1NFBA 3ITCA 3OGSA 3UCCA 3BICA 2WNWA 4JXCA 4FXFA 2A2IA 4ZOEA 4BFAA 3F5KA 2BGNE 4NZ5A 4LANA 3DESA 4YPJA 1IGWA 1GQJA 4M7SA 2AL1A 4TU1A 4AEEA 2FPYA 3T81A 2UV8G 5D03A 3U0HA 4FK9A 3UPMA 2VELA 4NYYA 3ENLA 2D23A 4ZEPA 2GGEA 3TQVA 3UGVA 1W3TA 4HPXA 2QMJA 4DJDC 4U28A 4BY3A 3W6YA 2TODA 5M3WA 3WDJA 4ENLA 2V3EA 5F4SA 1MUCA 3CUFA 1U2YA 1P0EA 3RX4A 2CERA 1E6NA 3AIVA 2FZBA 4DYEA 4D6CA 4OV4A 3N4EA 3SGZA 4Z2JA 3EMCA 2PDQA 5FF7A 3WNLA 4XZLX 3GU9A 3PS7A 3LMZA 1ITQA 3M64A 1QWKA 2WNZA 4GI8A 3UNDA 2CLKA 3PBVA 4NAFB 3PUGA 3TP4A 3W73A 4E4UA 5HUPA 4IMEA 4JTJA 2ZQ0A 4F0HA 3IUDA 4B4FA 2ISVA 3GDKA 2J7HA 1W1VA 2ZZ7A 1E56A 1PEZA 4LYPA 1S39A 3L12A 4UFIA 4LXFA 4X9YA 4P8UA 3P80A 4GC3A 4IZGA 5JQ9A 2DVXA 3TYBA 3LI0A 4CD8A 3IK4A 3P62A 1P48A 1RV8A 1FWHC 4GX8A 4QJ4B 2INEA 5AC6A 1Q7QA 2ISSA 2GLKA 4XBKA 1KFJA 1GQIA 2XPKA 1YXDA 3BAIA 3PSVA 4GKTA 3LXBA 3LV5A 4EPDC 3TXVA 2QDHA 3AS0A 4LGXA 1IHIA 3NDOA 4L1WA 2FDMA 4PMRA 3E0LA 4CN6A 1XLFA 4OFCA 2W67A 4RZ5A 4OVXA 2FHBA 2PF0A 3QPZA 3KRSA 1PAMA 4PCFA 3FVDA 3COTA 1XL9A 3LK6A 3P0WA 4FLRA 3UYIA 1V0LA 2ZZ1A 3H7UA 3USBA 3U5UA 4JKMA 5ABFB 3VX0A 4ZFCA 5M17A 4QDWA 2P88A 1V3KA 5FSEC 2V8ZA 1OFBA 3W1RA 2VURA 2UY3A 4YN5A 4E8CA 4OOZA