3GW0A

Urod mutant g318r
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIRQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic characterization of mutant human uroporphyrinogen decarboxylases.
pubmed rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
total genus 124
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gw0A00
2Q71A 3GVQA 1U1UA 4ZR8A 4ZTYA 3L7RA 3CYVA 1R3SA 4ZTXA 3GVWA 3GW3A 1XPGA 1XR2A 1U1HA 3GW0A 1U1JA 3PPFA 3T0CA 1R3VA 1R3YA 2INFA 3GVRA 1UROA 2NQ5A 4L6HA 4AY7A 1R3RA 3PPHA 4QQUA 4L61A 1J93A 1JPHA 1R3QA 1T7LA 1JPKA 1R3TA 3BQ5A 3BQ6A 3PPCA 4L64A 1XDJA 3RPDA 4EXQA 2EJAA 1R3WA 4L65A 4L6OA 4WSHA 1JPIA 1U22A 3GVVA 1YPXA 4L5ZA 2Q6ZA 3PPGA 4AY8A
chains in the Genus database with same CATH superfamily
4W93A 1EXBA 1H5YA 2PWHA 1L6WA 1WDQA 3DZ1A 1HO1A 4E8GA 3LENA 5J04A 2VFIA 1A5BA 2G96A 2YXGA 1E4IA 3TP4A 1HKWA 2XUCA 4F9DA 2B7NA 2Y24A 4Q7BA 4JFSA 3QY6A 4XBSA 4C5YA 3VD4A 4A3QA 3NOEA 2LLEA 1H50A 3R13A 3S5YA 3WD1A 3PHAA 1OCJA 1AW5A 4MKSA 4C1LA 3VMNA 3K4AA 1GVSA 1QATA 1EUNA 1YRRA 4AQLA 4FX7A 1Y5VA 3E74A 4K39A 3R0DA 4UTTA 1NIUA 5H91A 3M6DA 3SECA 3PNUA 1XLAA 2XN0A 2IQTA 5FJRA 4C7DA 1NOUA 5I79A 3IEBA 1QI3A 3E5PA 5E6YA 3LPFA 4E38A 3MHGA 3EDKA 3RYSA 5D2TA 3OA5A 4TV5A 2QCDA 2C7FA 4UFKA 3VOJA 4E3VA 5G4EA 5FJPA 3TMQA 3VKAA 1LQAA 3WUEA 2XIBA 1W9UA 4DBDA 2UV8G 5HJLA 5A1AA 2Y7DA 3DC8A 4XBKA 3D47A 2OSWA 4KWVA 3LGEA 3EXTA 5TAOA 1E1FA 1MRQA 4JIPA 3THDA 1A3XA 4JTKA 4QX4A 4RZ6A 4C5ZA 3GG1A 1W1TA 1BD0A 4POCA 3ZLGA 1CT5A 1F3EA 4AY1A 4DO4A 1WP6A 2G0WA 1TQJA 2WM0A 1A5AA 1MEWA 2WSRA 1RA0A 3IUHA 3O63A 1UWRA 4AF0A 3B04A 1XLEA 4GRSA 4MNMA 3EOUA 3KP0A 5CBIA 1R2RA 3CQKA 2Y63A 2VX7A 1OHLA 3T81A 1X38A 1M7JA 1VPQA 2ISWA 3LX9A 3VC5A 1XYAA 2VRJA 3SO7A 3UJSA 1XIJA 3VXGA 3B9EA 1IT7A 1X7IA 1XYFA 3GO2A 3DECA 2QKFA 4WLCA 2O55A 1K9FA 4O0KA 3R43A 1ECQA 2XIQA 1E71M 2OEMA 4GUIA 4K8EA 4QRNA 1AH0A 4JR5A 1VQTA 3WX7A 1XLGA 3CZEA 3CS2A 4US5D 1QMLA 4PTMA 5FEZA 4AZBA 1FDZA 3A21A 3VK5A 3UZXA 4ZSUA 3STFA 1GCYA 2REQA 5D9PA 2VELA 2WMIB 3W29A 1OYCA 3ARPA 5C2GA 1E0WA 2E6DA 4H6QA 3O2LA 1JIBA 4L4LA 5EBUA 3UCDA 3KBMA 3GU1A 2YL9A 3CUJA 4NL1A 2C6QA 1GONA 3CAKA 4YVXA 1EJWC 2AAAA 4MZ1A 2NW0A 3PVFA 4CD5A 2DT1A 2DVXA 3LYEA 4JTIA 5BWFA 1VHNA 3B8DA 3H4XA 1R8LA 4WEVX 3N2CA 1O5QA 4L4MA 4IP7A 2ON3A 3TSDA 2ZA1A 4FLQA 3H2EA 5H8MA 2YL5A 1RA5A 2IXUA 4JN8A 4IFOA 4Y6GA 4GBUA 3PTDA 3KP1A 1N55A 5FA5A 4Q8QA 1V93A 1PTDA 3G5EA 3P62A 4JHMA 2Q01A 4JL2A 2H90A 4MB1A 2ZQ0A 1K8CA 1YE6A 2IKHA 5HJXA 2WZHA 1XRFA 3GWQA 1W5QA 1NP0A 4UR9A 4TTGA 2X2YA 3VFLA 4B5UA 1W56A 3ABRA 3UR8A 3CWHA 4OIFA 2PWUA 4M81A 2GJXB 3L4YA 2J75A 5A2CA 1PBGA 4UTUA 1QAPA 1J6OA 3M44A 3MSGA 2WJEA 2OKTA 5DMLA 1J0IA 3OA3A 4HK5A 4MHBA 2NUWA 2H3BA 2WC3A 2DGAA 3KFTA 3P6LA 3LTYA 4IIDA 3LPPA 4L1XA 3UZJA 1P0BA 4DJDC 2V8ZA 2J7GA 3P5ZA 4YS1A 1UR9A 4TX8A 2HQAA 2BASA 3WMBA 1U5VA 1EJ7L 5BRBA 3RHGA 2FZBA 2PGRA 2BHZA 2GGIA 3WDQA 1SO3A 4H01A 2E1WA 4L1GA 4IOTA 4U5IA 4GJ1A 1DWIM 4CN6A 2D20A 4HPNA 2QPUA 1SZGA 4N02A 1G1YA 3QEZA 5CZ0A 5U7SA 2VO5A 4IMGA 1GOXA 2Y62A 4MOZA 2E0PA 4TUFA 1WAWA 1JPMA 3QFWA 3BH4A 2WMGA 3KX6A 1O68A 4AUBA 2A79A 2ZA2A 3TVAA 1THFD 1KRBC 4L9XA 1CXEA 1TX0A 4FZIA 3V18A 3ZT5A 1H7OA 5CBBA 3R0KA 2OXNA 3G1RA 4W84A 1Q4WA 3HM7A 4C1KA 2ACUA 3K8MA 3M0HA 5IDZA 1H7RA 1P48A 4KESA 2NQZA 4JGDA 4B2DA 1YXCA 4C6NA 2NVDA 3DCPA 2XZ9A 1DKWA 4TMBA 2F61A 1RK6A 4J2PA 2YGYA 2WC7A 3CWOX 3GXIA 3VIPA 2W79A 2GJXA 3GHTA 1MZRA 1W3LA 1XBZA 3QPZA 1J0KA 5I6SA 4E2DA 2J47A 2E9BA 4NUWA 2Z1XA 4S3FA 4XSLA 4PYSA 2OB3A 3M64A 3V5FA 3ZWSA 5DY3A 5REQA 3WD4A 4HMNA 5LHFA 3N1AA 3WNNA 4NAFA 3FJ4A 5D37A 4BJHA 4Q7IA 2Z1KA 3GZAA 3W7KA 2FFCA 3MUCA 3ARTA 2XGIA 4MNJA 1WAUA 2C13A 1G69A 5H8PA 3N4EA 3S0CA 1R30A 5AVNA 4L61A 3RLVA 3IVUA 2VEPA 1WXZA 4D9PA 5HBFA 4RE2A 4GVGA 3GM8A 5FF7A 3OEXA 3EKGA 1WCGA 3B05A 3LNPA 4Z2HA 5IM51 4QP0A 3B3DA 3B9OA 4HNLA 3VD3A 4ERAA 2V5DA 3GXMA 4HVXA 4YNGA 1UROA 3APTA 4RXGA 4ZMGA 3GXPA 3WNKA 2IMRA 1JEZA 3MSDA 4FHAA 2Z24A 4UTKA 3PTQA 4WJ8A 5CSUA 3GUWA 3LM7A 4L6DA 1J01A 5B7ZA 3NPWA 2IW0A 4E4FA 1XGDA 4S38A 3SSZA 1UR4A 2NQLA 1OSEA 4JCLA 1MW2A 3MCOA 1KBKA 1K8ZA 3I7RA 3NYZA 1D3HA 1X8CA 2V2CA 4O1DA 1UH2A 3MZNA 4GCAA 1KLYA 3SCUA 3W28A 2Z2BA 2WCAA 3QSRA 1QBAA 3GIQA 3NQ7A 3SQLA 4DO7A 3D46A 3CZKA 2OKOA 3WQWA 4GMEA 3FN9A 1LORA 2DP3A 5J8LA 3W82A 1XC6A 4NZ5A 4DJDD 1S5VA 1TE1A 3M1ZA 3PZMA 5ABFB 3L5MA 1YPFA 2E09A 1DXEA 3UW6A 4IPNB 5K9XA 2VUNA 1C9DA 2Z1SA 3F2DA 2CWXA 4I7UA 4JPGA 3OB8A 3KTSA 4IZGA 3CTTA 3ZJKA 3MP3A 5I3KA 3O6DA 3TTYA 5K2ZA 4J3SA 3W1UA 1K6WA 1XDMA 3WQFA 1UBSA 2XM2A 4OBSA 1Y65A 2YKKA 4DO6A 1Z42A 3URAA 3SB0A 5IRPA 2QJJA 4DLFA 1K3UA 1I0BA 1MMFA 4G9PA 5DCEA 1I1WA 3MWCA 3O07A 2DUXA 1UJQA 2DSKA 4JTDA 4O1EA 2YIHA 2CLPA 4GFIA 4FALA 1A80A 3VAVA 1NU5A 4FIQA 4AF0B 1RH9A 3ZJ7A 1D7FA 1G4SA 1V77A 1OFQA 1SW7A 2NUYA 2QJGA 3CJPA 3LHWA 2YW3A 4A3HA 1CXIA 1V6VA 4IFRA 2REQB 3G6MA 1WDWA 3A4XA 3O6YX 3CMJA 3TNOA 2UBPC 2OSXA 1KQYA 4HOZA 1QK0A 1HJXA 3GSMA 4F48A 4ZL1A 2VFEA 1OJXA 1TPWA 3VVGA 4NAEB 2GSEA 4PUWA 1Z44A 2GQ8A 3PPCA 2PDKA 3O0FA 3ZLHA 5ABFA 1AA1B 4D6IA 1GJWA 2UWFA 2F9RA 2G95A 3OIXA 3M6YA 2PE4A 3IANA 1XGZA 2PDNA 4Y8EA 2XPKA 3FV9A 5G4WA 1K4HA 1OYAA 1ZENA 1P7TB 1VR6A 2W4XA 4J2MA 4PMQA 3IJ7A 4DUWA 3WH5A 3NJ3A 1R85A 4W7UA 4ERGA 3LI1A 4K37A 4MMWA 4X61A 4ZOBA 3KTCA 3BLDA 1ZS2A 2D0GA 4QAWA 4XB3A 1IQ8A 3GBDA 2AL2B 4XISA 2GVEA 1IWPA 1E5NA 4CU7A 3TW6A 3GKAA 2Z7GA 2PDGA 1JCJA 1RALA 1TMLA 3N2OA 4DYKA 1OM0A 3EPMA 4BQ2A 1OFDA 3CQJA 1ZAIA 1B4EA 1Z6KA 1UH3A 2ZX7A 1EDGA 2PTXA 3W83A 7CGTA 2OGYA 1E0XA 2F6KA 4JQ3A 4UNIA 4EPBC 2P8BA 3QYQA 5CGQA 3BZJA 1UCWA 1UKOA 4XIMA 3TLQA 4RNJA 1HNYA 2I5IA 1EZ2A 4OFCA 4A05A 1YW1A 5CSSA 5JIPA 1IGWA 4PBFA 2PC4A 1XYCA 5C9XA 1LM1A 4B2DD 4ROQA 5DLCA 4R27A 3LHTA 3NTYA 4Q8NA 5HUPA 2FVMA 4LVDA 1OFBA 4UQ9A 4DJFC 1KM5A 3TW7A 5CG7A 3LMZA 3UVAA 3GUGA 1KQZA 3VMOA 1AZ2A 1CXKA 1YE4A 1KTCA 2XIIA 1ZTVA 3G3DA 4CQDA 4K1WA 3UPBA 3PP7A 2WSPA 4NQ1A 2ZTKA 1K7XA 2E6AA 1Q8JA 1GVEA 1VFSA 1GHSA 2WPGA 2Z2UA 5KINA 4BWLA 2C79A 4EF8A 1UWQA 2FGLA 3BWWA 4PTWA 4K1GA 4WJXA 2DPEA 1W31A 3HA1A 1Y5XA 1JDEA 3V35A 2W3ZA 4ZQOA 1FWIC 5E70A 3GFYA 5IDIA 1RY0A 3THQA 3MMDA 2DH3A 3M0IA 3NUKA 1Q45A 1UKSA 4J1OA 4OHQA 2CFFA 2A3EA 4XO7A 1S2AA 1FWHC 1ZL1A 4UCFA 4WY0B 4BKNA 2G3JA 4PUKA 1BYAA 1SW0A 2AKMA 2OX4A 4QBXA 4R3UA 1ZQ5A 4HNUA 1AL7A 2R14A 2VX5A 1XFBA 3RIKA 4B5WA 1OVDA 4KEMA 1JVNA 1LL6A 1TRIA 2WC4A 2FHFA 3THAA 5DCBA 4IF2A 4QCFA 3VU2A 4AISA 3TH6A 1I45A 3WD3A 4O8RA 1GHRA 4E2OA 3UA3A 2C8NA 3KOYA 1BXNA 2R24A 1GVIA 5DMNA 3ZS4A 1T99A 3SURA 1UQZA 2OOGA 1X1NA 4CN1A 1GVQA 5AHFA 3AS3A 4GBDA 1S2CA 3UR7A 5KMYA 3TOPA 1VENA 1VB9A 4O17A 3LB0A 4DNHA 5E9XA 4WX2A 2C14A 2ZXAA 3ZR5A 1R3SA 1SW3A 4Z42C 2J7FA 5D33A 1VBGA 4DM2A 3SSJA 2IQDA 4HU0A 4ES4A 2XFRA 4EXQA 4GX9A 3BDKA 3PBMA 4CCDA 4K7YA 4D8AA 5EY5A 1CX9A 2DEPA 4JIEA 4UFHA 2V3DA 1E51A 3XINA 3UJFA 1PIGA 1CBGA 1V08A 3VIIA 4HOXA 2DZPA 2XGBA 3IIOA 2QIIA 1TZ7A 2WCSA 4Y2WA 5FJUA 8A3HA 2QV5A 1CIUA 1UKPA 2BMBA 5BXTA 5BWAA 1GW1A 4B3ZA 1C92A 2Y5SA 3UJEA 1TWZA 1PDYA 1H51A 1MO0A 1S5NA 1RCOB 2ZUMA 3TROA 3MP4A 1HJWA 3K8LA 2CHNA 5AZ1A 2TRSA 1Q6OA 3EWUA 3UPWA 3SUWA 2VEFA 4K8GA 3R25A 5E0KA 3HJEA 3INPA 3WFLA 3ZWTA 3CAQA 1LOLA 3QBUA 2D2HA 5J5DA 2WQPA 1W5PA 3CQ0A 3HG2A 3IRSA 2NSXA 4EXAA 5CH9A 4D6FA 4QISA 1NQKA 1E9ZB 1W1B1 3A23A 1KV5A 2GWNA 1ONEA 3BJFA 1DTNA 3TFCA 1EGMA 4HBKA 4JX6A 4FAMA 1QCWA 1EIXA 2YB4A 3WJSA 3L4ZA 1HKMA 5G4HC 2EGZA 1QW8A 4UFLA 3TV8A 1RCQA 4YMZA 2WJZA 3DBPA 1WUFA 2WLYA 5EMMA 3FSTA 3A3WA 4FI4A 3APYA 2HRWA 3FCPA 3AZSA 4X2RA 1KFWA 4NZ3A 2P0IA 6PTDA 4L7ZA 1NJJA 3UG4A 3H2MA 4LAUA 1ZGDA 1FWTA 3RX3A 5M2FX 5C5YA 2B7OA 2BHUA 3AHVA 4H9VA 4KWWA 5CJNA 4L80A 4LOCA 1YHTA 3R0UA 5AECA 1FP8A 4L9YA 3UBPC 5G2IA 5JQ9A 3S9IA 2HBXA 4OWGA 2OEJA 4Q4OA 1AQMA 3MUAA 4F3HA 5CXPA 4DWSB 1IT8A 1JCYA 4HHPA 2Y7EA 4YHEA 1GOWA 5GNXA 3QH2A 3ANUA 3OGVA 1PE1A 3NVTA 2Q8XA 4FR1A 4DZAA 3T4CA 1QNPA 4IX2A 4MWAE 3ARQA 5MF5A 4NASA 4WUIA 3WH7A 4IMAA 2PDBA 3C2YA 2R6OA 2CNCA 3Q37A 5CAKA 2IPJA 1MUCA 5FI8A 3GYEA 2A3LA 2X2GA 1XLHA 2FPVA 1TPUA 1W9VA 1CLVA 4ZE5A 2I7GA 4AVOA 1RUSA 4CQCA 2FPTA 3GH5A 2NX9A 5I3FA 2Y5JA 1HJVA 3SFWA 3AYSA 4HKPA 3WLMA 2Z7KA 5AC7A 3TYZA 1T8XA 4GUGA 4D6GA 4DJFA 1C7SA 1H7XA 3ZSTA 2RDXA 2DZAA 1NWSA 1Y5WA 4AZCB 3P80A 3M4HA 4M24A 3HGOA 4D2JA 1E55A 3KRSA 3EA3A 4Q8OA 3AHZA 1KRCC 4FNSA 3RJYA 1W1IE 3BC9A 7REQB 5CPNA 1N8IA 1Z69A 3A5VA 2A3BA 1NDZA 3T78A 2CITA 3LK6A 2WKLA 2G41A 2FMNA 4R9XA 4M3PA 4PUJA 1R3QA 2VZOA 1YNPA 4UMCA 3NPXA 4A8NA 1PUDA 3HQNA 4Q32A 3LGGA 5FF3A 3GH7A 3BW2A 4GISA 1CXLA 3VX1A 1B3YA 4DZIA 1VFOA 1OC6A 3OVGA 1OX6A 3TTSA 2PP1A 4BR1A 2JALA 1CGXA 5E9AA 3P0XA 3W26A 2PDYA 4QR6A 1NFGA 4UQBA 3GDTA 3O15A 3CNYA 4DF0A 1RQBA 3CIXA 4TX6A 2EBNA 2NLYA 3I3DA 3LLDA 5JBEA 4F0MA 1GORA 5E09A 3TYDA 1PZ0A 4KEUA 4WDUA 5E0FA 3RX2A 4HA4A 3S5ZA 1R7AA 3UY7A 3PAJA 2JKAA 1V03A 4IIGA 3GZ3A 4S3KA 3VDHA 4A8IA 3FJNA 4NYUA 2VDHA 3DFOA 3UWVA 3SRHA 1BVZA 3ABZA 5IHSA 1TQXA 4QS6A 4DPQA 3HB9A 3MBFA 1H49A 3EX3A 4MJ2A 2HK1A 1J9YA 3LI0A 4Z0JA 3WLOA 4QDWA 3SR7A 1PYFA 4DWSA 2R91A 1X39A 1W3IA 2NX3A 2OQHA 3V36A 4J9JA 4DWSC 5H2ZA 1QOPA 1TA3B 2R1PA 1L2QA 1GJPA 1KFKA 3WQ5A 5HPCA 4LBUA 5A2BA 3WDHA 2IUZA 4JTGA 3BG9A 2V6AA 4B5NA 1MFVA 3D6NA 2D2GA 2TODA 3AI0A 3SAZA 5CZTA 2HMCA 1HFBA 2Y85A 4WKHA 2D69A 1KM4A 1IR1A 4QTGA 5HNTA 1U1UA 3MW7A 5A6LA 2YFOA 4FK9A 1M9HA 3BGJA 1VFFA 3IS4A 5EA9A 2E67A 1BLIA 4LAMA 3R89A 4DI8A 4H6RA 3WQPA 3E2QA 1J0JA 4PSPA 1A49A 3BQ6A 5LGXA 1PSCA 2ISVA 3T05A 4AW7A 1P1MA 3MVIA 4EAMA 3EKZA 3R8GA 1V7AA 1R9ZA 3VA8A 2C3ZA 3GC2A 1DTUA 2J25A 4ZEPA 3FJ6A 3WLNA 3KEHA 3VNIA 1WQ5A 1VF8A 5E6ZA 5C2XA 4DVOA 3FS2A 4LB4A 1T8QA 3A5FA 3LGDA 1BKSA 3E9AA 3O9NA 3WQGA 3LZ5A 4XO6A 5CC7A 3E0IA 3AXHA 3O05A 1A3HA 1Q85A 4MFDA 3W7JA 3VKJA 3E3HA 4QROA 4QG8A 3NQDA 4UZUA 2BNJA 2O92A 1XFCA 1YXDA 1AL8A 3RX4A 3S42A 3TCEA 3L66A 3FXGA 1MDLA 1F9CA 3QQ0A 4O8AA 4GACA 2QCGA 3AIQA 4GK8A 4B4FA 3DENA 1Q3NA 3MMWA 1UD6A 3VOCA 4GUFA 1YX1A 3MVTA 2ADAA 3I10A 2Y1HA 3QGAC 9XIMA 1B54A 1UD4A 3QLDA 3EZ4A 3F4VA 1VPYA 4YN5A 5I7GA 2ZDSA 5FF4A 2I16A 2GLKA 2ACRA 3GNRA 1REQA 3VINA 3AMKA 1RD6A 2WSQA 2ZVIA 2ZVRA 3KVLA 4U10A 2I9EA 4GC4A 1S1RA 3OIHA 3CZ8A 2XG9A 3AWOA 5IBXC 4M6QA 4YYCA 4TU1A 3OGRA 1KW1A 4J3UA 2VEGA 2DSZA 4KIEA 1E3XA 1QI5A 1LTDA 3SCSA 4KCUA 3O1NA 1E1CB 2ZUWA 3TFXA 3P14A 4JNZA 5F2GA 3A6OA 1BGGA 1JL8A 4ZFCA 5CZSA 2XIMA 2BGSA 1S38A 2PP0A 2H9AB 3FJLA 1S5WA 2J9YA 5K9CA 5GJMA 1V6WA 2BGNE 1WPCA 2OVLA 4IMDA 1XLBA 1ZP4A 5T9CE 3L68A 3TJLA 3DBNA 3G18A 4AZGA 3BCFA 3BLPX 3I7QA 1DWJM 2POZA 2OWXA 2FQIA 3AS0A 2XDFA 4IPIA 3BANA 1Y8BA 3NOYA 2B4GA 3ABQA 5AHEA 2BSLA 2VTFA 3H53A 3KZPA 1W2PA 7XIMA 4Q8MA 4UWMA 4G1KA 1KRAC 2A7PA 5C55A 3QYSA 3UZ5A 1YLVA 2EAWA 2HBVA 1JQXA 2OQYA 3GIPA 1QPQA 3POHA 3WBYA 4EE9A 4XZLX 3ZM8A 1Z41A 1OB0A 4XD3A 4JKKA 3DX5A 5K4ZA 3IVTA 4IG2A 9CGTA 4DBWA 4RLIA 1SJDA 4J3XA 3ANVA 3BCJA 1Z89A 1U2YA 2PLJA 4GXWA 3BL3A 4V1XA 4W86A 2WNNA 3S6DA 1QXLA 3TU9A 1W3HA 3UXIA 1UH4A 1ZJAA 4AEOA 2RFGA 1UP0A 2POTA 2IS7A 1NOFA 5DBUA 1SVDA 3I4KA 3G77A 4JXCA 3FYPA 3GC5A 3JS3A 5J5RA 4US5A 4H41A 1P6BA 2HK0A 3A9BA 3N9SA 3PTMA 3VPLA 3NQEA 1TPB1 3H55A 2NZLA 5CC3A 2E5DA 4HYRA 4GI9A 1LRNA 3W38A 4AD2A 3GE7A 4ZENA 1XBVA 3W75A 4KCVA 4BQ3A 3L7RA 5H6HA 2HCVA 1RVKA 1QT1A 3NO5A 2WXDM 3RF9A 3M43A 2P50A 3I3BA 4QCEA 2J8FA 4AYGA 1XS2A 4LYKA 4XWUA 3U3HA 3EB2A 1ZBVA 4H9ZA 3CUGA 2GOUA 1S5TA 4JTQA 1REQB 3IK4A 1L6YA 4QQUA 5D2WA 2VCCA 4F0SA 1BQCA 2X1UA 1J0YA 1IGSA 3VD5A 1MQRA 1CDGA 4IGNA 1XYLA 4L6OA 2ZRXA 1V3IA 3GYCA 4PRTA 3U5UA 4OUEA 1R46A 1WB0A 3UZWA 3WLKX 4DUOA 1VYPX 1XBXA 3IWPA 4L4PA 4EF9A 9RUBA 1J6PA 1H41A 3NGJA 4ICNA 4KETA 1OT1A 2J78A 3BG5A 2ESCA 4GJJA 1AJ2A 1IIHA 4V2XA 4YIWA 3P8JA 1JQVA 1Z9AA 1IV8A 2AL2A 4A6GA 2Q6ZA 3OLIA 2O7SA 2CBIA 1ESWA 1QUMA 1LWJA 3W3OA 3UF9A 3T8QA 4HCDA 3W74A 2WM1A 4S3EA 3WEOA 4J35A 7REQA 4HSOA 1T41A 4KFPA 2A7RA 4H7ZA 2HEJA 4NG3A 2X0YA 2V0TA 1UUOA 4L65A 1XP3A 3WCZA 3B97A 1XIBA 1JI2A 1OZMA 3DHPA 3NQMA 3R58A 4IP5A 3V0SA 5CCZA 2ZFAA 4UNLA 1TJ0A 1XLIA 2ODOA 4NZ4A 3GAKA 5U4NA 5A6BD 4J27A 1VBJA 3GTNA 1ZJHA 4HA0A 3G1FA 3S5SA 1V6TA 4OOUA 3VCNA 4FP1A 1TPC1 2GZXA 2YDSA 4QQ3A 4BFAA 1GOMA 4H8HA 4PE8A 3TYCA 1GVOA 1XX1A 4JHZA 5TNVA 2ZC1A 1D7KA 2ZXBA 4CQAA 2VI0A 1TTJA 2RAGA 2PDMA 4YL2A 3RRAA 3S1GA 1W91A 2NXIA 1QBBA 2DUAA 4GI4A 4MZYA 1BHGA 4P2VA 1BAGA 3TAOA 2FLIA 1ME8A 3C2VA 4HJFA 3LBOA 1G7VA 2EG7A 5HR7A 1SO5A 5A95A 2Y0FA 1OINA 2AOSA 5H8UA 4IJBA 1XUUA 1GQIA 1ZPTA 4H8NA 1XYBA 2XYLA 3F5LA 4KRUA 3HQPA 1XLLA 4GCXA 5LNVA 1GPWA 3W6LA 3KOWA 4XZWA 3AYRA 4HNTA 2V2DA 1E0VA 4G2DA 4NNAA 2XN2A 1H09A 3IGHX 1ZBKA 1HVQA 3BLLA 4ML4A 1BSIA 2F8QA 3L21A 4LRSA 4NJKA 3GR4A 3AICA 4HYVA 3ES8A 3WKZA 4JIQA 4DWDA 4JDBA 1VH7A 4B5TA 4CUCA 1F05A 4HK7A 2V30A 3N6HA 1S3TC 3O6CA 4PUEA 2P53A 3MMTA 3PZIA 2DV0A 3W27A 1RBLA 2E3ZA 3GDMA 1EC7A 4ADSA 3FEQA 3OJGA 1EGVA 1UZ4A 2WJDA 3EXSA 4N6EA 3RLGA 3AHXA 3A4WA 4Z2IA 4HB7A 4LS0A 1HGYA 1RY8A 5CEWA 3T2PA 4WOZA 3AAMA 3IIXA 5LA1A 3VD9A 4V33A 1PKLA 4S23A 3CUIA 5D32A 2VCAA 5ENLA 3H7VA 4KF1A 3S9ZA 4DYEA 6REQA 3HGSA 1V6UA 4GQGA 2HISA 1KO0A 3KRZA 3NQFA 2CLIA 2YBUA 1L2UA 4QHRA 4NXKA 1AJ0A 1B90A 3WL1A 4US6A 4CNOA 3E12A 4X9SA 3LZ3A 2D1ZA 3LA4A 3MKCA 5CGMA 2EJ1A 4F2TA 2CIPA 1EJUC 4HQVA 3CB3A 1DJGA 3M0KA 1J79A 3ZSSA 1JDDA 1RQEA 2XVGA 4HK6A 3IRDA 2DT0A 2EXOA 1XQLA 3PJWA 1BFNA 5F4XA 3PPHA 1SSGA 3HQ1A 4JKMA 4J3VA 1C8YA 4JQ1A 3PF3A 2AQWA 1QHZA 3LXCA 1AODA 1U22A 4H9YA 1LUCB 3M9YA 2ZRZA 3VDGA 4RE3A 1KFBA 1EX1A 4QJ1A 4YVPA 2GVYA 5MKGA 1J96A 4AZ5A 4K38A 3NSXA 2BWGA 2D24A 3ATZA 5DT7A 3WUGA 4EACA 1ME9A 3PZVA 2FMOA 3A13A 1WDDA 3EPNA 2PDUA 3RITA 4MPKA 2V3FA 1D3CA 4B5XA 1F7BA 1E6SM 3N2BA 3RR4A 3TQPA 4DJEC 3ZVHA 5KSWA 1RQHA 2WW5A 2FZDA 4GIAA 4Z1CA 4UTWA 5BMXA 1SUXA 3LLFA 3K4DA 3VD7A 2XIOA 3WF2A 4DNMA 3K1GA 3KWXA 2E5BA 4NJJA 2FVLA 3IJQA 1RK5A 2QW5A 4H8UA 3CHDA 4MWAA 4PCTA 3FYYA 4PMVA 3AYVA 3ELFA 3FFSA 5JXQA 1EP1A 4GPNA 4ECLA 1XH1A 2OO0A 2YW4A 3BUVA 2CZFA 4QS5A 5C54A 3L4WA 3RO6A 2KZHA 4ORIA 1JDAA 2O9RA 5IXEA 4BEQA 4BI7A 4GINA 3R79A 3SY8A 1WA3A 1J4EA 1Q6RA 1EHAA 2VXNA 3A3XA 3SJNA 3DKJA 5I2UA 5FSEC 4DJFD 4NF7A 1TWIA 4GKLA 4YXGA 1A0EA 1Q6FA 3F4WA 1GEHA 4DO5A 2JIEA 4W8AA 4JQ4A 3G1SA 3WEZA 4PR4A 3LMYA 4H04A 5EMUA 1P5BA 5D9NA 2DFAA 3OHIA 5DXYA 2OG9A 1CENA 5FJIA 4HMDA 1GWJA 4MLRA 2XVNA 2OMAA 1W8SA 1W5NA 4PB5A 1AG1O 1L6FA 4XAFA 4MJMA 3QTPA 1I2QA 4JIHA 4WSHA 2VP8A 1JG9A 1UD5A 2GL5A 1ADOA 4GIYA 4MG4A 5EMJA 1QO2A 4UTIA 4ZGYA 2QUNA 4C90A 2YCLA 4OUIA 4IMEA 3URNA 4MB5A 1XG4A 1V3JA 1E1CA 3B0XA 1ICPA 5A8OA 4QE1A 1SZEA 1FY6A 1IEIA 3FVMA 2PDFA 4UB9A 2VWSA 3YPIA 2IPWA 4ICCX 3T0CA 5AYZA 3V5OA 3W85A 4JTJA 3WQOA 4Y9AA 4OT7A 1EDTA 3UWYA 3FA5A 3WBEA 3G1YA 4JTEA 1TWWA 1DJIA 2PEVA 1KM2A 3LTSA 2ZRYA 4EK7A 3MV11 3H24A 1KNWA 2R82A 1OZQA 3TR9A 4OKDA 4UZSA 3EX1A 5BYWA 4O1FA 3SCTA 2NWRA 3EWXA 2PDHA 3SCQA 2PDLA 4F0KA 5T26A 4FA3A 1ELSA 3VIMA 3B9AA 4BEUA 1PX8A 3TYEA 2NXHA 3IGUA 3LTPA 2C15A 3HG5A 3ZYZA 3DFHA 1DOSA 2X05A 3R8HA 2EKCA 3OZYA 5FIPA 3B8WA 4KKXA 1GOOA 5FJTA 4Q4KA 2AMGA 1V7YA 4FXRA 3EMCA 3WK1A 5I23A 1FWEC 2R1MA 4GUJA 5HPOA 2VNCA 2PFHA 1H7WA 3VCCA 5AYIA 3HMJG 3GW3A 3QR0A 1Z7AA 1NDYA 1Q7QA 4KWSA 1JYXA 1ODUA 1V0KA 1QASA 3CEUA 2ACQA 2TYSA 3UWUA 1X7FA 3VGHA 4XKMA 2QAPA 1FWRA 2GSHA 1MFUA 3KDOA 3EWYA 5FJJA 2PWEA 2ZXDA 1L9WA 1Q66A 2WANA 2PDXA 4Q33A 3HGJA 1GOIA 4NJHA 5T91A 3W37A 3ZLFA 4P7OA 4HU8A 4YTSA 4MWAD 4PEEA 2C0AA 2PWGA 3PSWA 3AALA 3W7RA 4HHMA 4IG2B 2ZRVA 1E9YB 5A8GA 1WX0A 1T7LA 1DV7A 4LSBA 4XKYA 1BGAA 1XRSA 1GK8A 2J7DA 3MT1A 4JTCA 2EPOA 3SUTA 4XKYB 1XLKA 3G1VA 1B3VA 2O9TA 3WFZA 1V3HA 2X09A 3CMFA 5CPTA 3MI2A 3G1XA 1SZFA 3LBMA 2YBVA 3ZMRA 5CLTA 1AD4A 3WQ8A 1OGGA 1B3WA 5D2XA 4IQEA 2QNEA 2QCHA 3THUA 3MMUA 3TXZA 2P88A 3TSMA 2PPGA 4ZB2A 4GYJA 3ARYA 2PU0A 3EWZA 4W5ZA 1ONRA 3POCA 1LLZA 2XIJA 2FDMA 4D6DA 3BK0A 3WDRA 2PWFA 4U3AA 3A4JA 1JZ6A 4LV9A 4XBJA 4LX4A 3W2MA 1BG4A 2XFYA 4PZVA 3W00A 3B8UA 2FPYA 1B30A 4O1CA 3H7UA 1NOWA 4LEQA 4O4VA 4QLJA 1IT0A 4KEZA 1B3XA 2VR2A 2H8ZA 2F38A 3E0VA 1OFEA 3BW4A 1RJPA 2B31A 3AIUA 2UZ9A 1I9CB 3MCMA 2H8XA 2CLHA 3CGTA 4IICA 3OQEA 3WK0A 3PR2A 3BMWA 4HNNA 4IUOA 1DWFM 4IGSA 3PUOA 2W27A 3QJAA 3V5CA 4F2BA 4IWWA 3BVJA 3CV2A 1KR1A 3VE9A 5D38A 3L23A 1C91A 1LT7A 5LNWA 3NZQA 1GKPA 2R94A 3F1QA 5BU9A 1CB2A 3XIMA 1PXGA 3ZQ9A 3WQ4A 5DCDA 2GJLA 1LT8A 4J3TA 4S3DA 4EPEC 1B0IA 5M3WA 3W7IA 7ENLA 3BQ5A 3B03A 3WFAA 4UTTC 3IAPA 3P0WA 1CGUA 2Z26A 2DIJA 3V1HA 3SQSA 2R8WA 1X1OA 4IJRA 2DZWA 3WQCA 3FDGA 1OY0A 5T8GA 4LWWA 1J0HA 3H7RA 4JTUA 5M03A 2H9AA 2O4MA 4EIVA 3EWCA 1HX0A 2QULA 1YPXA 1E4MM 2XWEA 4O16A 3EWWA 5LA2A 1B9ZA 3N17A 2J79A 1KM1A 2XU2A 1X8FA 4M7SA 4FR6A 4ZE4A 5K3VA 1QVBA 2RJHA 4KGJA 2F2HA 1SGJA 3G0XA 4JL1A 1YYAA 2OFJA 4F0HA 3Q58A 2PURA 3H6OA 3PBUA 3M5XA 4PTXA 2J9ZA 3H23A 2F2KA 2GVJA 4JQ2A 1BSLA 4B3LA 3NIYA 4P8UA 3ZR4A 3W86A 1DWGM 1WZLA 2VZUA 3GDLA 3WDJA 1UASA 4OBTA 4A29A 1HTIA 5A6JA 4HPGA 5FEXA 1F6YA 3NQ6A 3U5YA 1G67A 5GNYA 5GVJA 1W1YA 1WOAA 4IMCA 3UY8A 2CEQA 4LF1A 4IQDA 1JCLA 3K1DA 4YCPA 2CESA 5BXRA 3GNDA 3S6OA 3T2OA 3CHCA 2VFFA 2TSYA 2OZ0A 1Y0EA 1KFEA 3C3NA 3TMLA 1OCQA 3RR1A 5FCZA 3PZNA 3SCWA 3DEQA 1MNZA 2FJUB 5C9UA 3U7VA 3CO4A 2QGHA 3SQMA 5JU6A 3TOYA 3T55A 2XH2A 4MNLA 2PAJA 4LALA 3W01A 4D8LA 4G56A 5XINA 1A5LC 2RJGA 3LCXA 2HZGA 1JRCA 1DXIA 2JF6A 4PFMA 1VFLA 4LV4A 3T0DA 4M7TA 1S46A 3IPWA 3C0QA 4LCSA 4ZCWA 3EOEA 3OBAA 4WDTA 2DSVA 1KFJA 3W22A 4A2RA 4B92A 4Z1YA 1KXVA 4GY1A 3W76A 3MS8A 4L64A 1LUCA 2ZZ5A 5JH1A 1I8JA 4LUTA 1PO9A 1WYIA 2VYOA 4Z17A 4QLKA 2E25A 5I02A 1YDVA 5C9RA 4FNPA 4DWSD 4U33A 1TG7A 3HGRA 2IXVA 5DXXA 5LKYA 2AMXA 3RPDA 3O7UA 2PWDA 2Z6IA 3H12A 3L4XA 3QC0A 3CHFA 4W5UA 4W8BA 2QUUA 4CD8A 3UCQA 2AGTA 3WQVA 1AQFA 5LA0A 2HVNA 3O0KA 4F0RA 3AUJA 3UJRA 2V5JA 3GD6A 3PULA 4J28A 3NZRA 3QW3A 3TAKA 1TTQA 3PFMA 5IOBA 3P5YA 1PDZA 1ODZA 1TTPA 3IACA 1TPFA 1DJXA 1LROA 1S39A 4S2BA 3CYVA 5D2VA 3T8LA 5KITA 4RDYA 4LYRA 1CB7B 4C65A 3NQ2A 3WLPA 1XIIA 1UWIA 1UWUA 1XLFA 2GGJA 3VDCA 1EF3A 3GFZA 4LYQA 1UR1A 5E0CA 1E6RA 3BURA 1Q13A 3AMDA 1TIWA 1D8CA 1AD1A 4DBSA 1V0LA 1UB3A 4WJEA 3QHNA 1T40A 5TD4A 3GVRA 3ALGA 1UYQA 5DQPA 1FWFC 3C0JA 3A9IA 3GX9A 4AAJA 3S8HA 1QPNA 3L4TA 1QHPA 3B06A 3P84A 3SCOA 4A4AA 1E9IA 4AIOA 3FAWA 2PD5A 3IK2A 1FHDA 1H7PA 2XFFA 3NL3A 2PTDA 5ABHA 3PUGA 3OVPA 1TPVA 3WLRA 1LJYA 1C9WA 2A6NA 4RNIA 1J10A 3QXBA 4H2HA 3KLLA 3VCRA 4B9YA 3EKLA 3EDFA 4S3CA 4Y9OA 2FZMA 3ITVA 2YA1A 1MVYA 1KCZA 3R1ZA 5F2MA 2QT3A 3ATYA 1MUMA 3ENLA 1B57A 2Z28A 3REQA 1V79A 3T44A 3CUXA 2GJRA 1UWSA 4TR9A 2NVCA 3SRFA 4WCJA 4FEZA 1HJSA 4F9JA 1QK2A 4FX8A 2HSAA 3GVGA 4M8UA 3W7OA 3D5HA 1P7TA 4R7JA 3PK7A 1KBJA 3XISA 4ZO6A 1PKNA 3CUZA 3P7YA 4O50A 4WY0A 4HMEA 2JK2A 3E5BA 2PCEA 3F2CA 2HNEA 2DJLA 4F4RA 1FWSA 3N18A 1TJ2A 3E2VA 1YADA 5G1MA 2PDCA 4PMDA 3FKRA 3N29A 4WIWA 1POJA 4R34A 4K36A 4U31A 3N9KA 4TX9A 4GXMA 1JAEA 1BWKA 3KAOA 4RDVA 4LBSA 3ARVA 1IXOA 1H1YA 4DJEA 2Y6ZA 4O1BA 2ZYFA 5I00A 3T4WA 1BYCA 5F2LA 3W0KA 4ZQMA 1V6XA 3AIRA 4ZXOA 3R4IA 3E96A 3L65A 1I2RA 4HPHA 4LUJA 3VDAA 1ADSA 4YTTA 1ZY9A 1DQXA 3OP2A 5L6UA 4O18A 4MUPA 2YPIA 1NF0A 1E6NA 2XN1A 1IEXA 2E5CA 2E40A 1ITUA 3W7MA 6ENLA 2W0UA 3H2OA 5FESA 4AMAA 4AVNA 3T9PA 1H7NA 2DY3A 3AU2A 5H1WA 4RDZA 3PZUA 4DYJA 2W67A 4JEJA 1EBHA 2P76A 3R11A 5E93A 4REQB 3C3UA 3RCNA 4FF5A 4HNOA 2Y7GA 1O12A 4MTVA 3GFXA 1DJNA 1OWQA 5HXMA 3ES7A 3NZGA 5LIUX 4LC8A 1YNYA 1RBAA 1A5UA 2ISFA 1YBQB 2A0NA 1UR8A 4ATLA 3G6LA 3F4NA 5D8WA 1C29A 4MLJA 3TX9A 2RDTA 3I7SA 4RCXA 4GQQA 2J24A 1OADA 2YSWA 5AC6A 4CCEA 1PWMA 2VC5A 3V0UA 3ORWA 4PODA 1ENUA 1OX4B 2BFGA 3PBWA 2EPKX 1GYLA 5D30A 2WK2A 1NF7A 4XD4A 3SRKA 2YL6A 1LQ0A 3HPSA 1WOBA 5BU6A 3TJ4A 2OEKA 2D3LA 4D6HA 3N19B 3S1XA 2GDQA 3CYJA 5TF0A 2BP1A 3LD5A 1XV8A 4AX7A 3N4FA 3UNTA 1TV5A 1DJHA 2Z27A 1UP2A 1EXPA 1SJAA 4AWSA 2QPSA 1M01A 3NQ8A 1DORA 3RRXA 3MB9A 2WSYA 2Y2WA 3UT0A 7PTDA 4Z2LA 3DXIA 1MEIA 1PWLA 1JJKA 2VMFA 3LXBA 1RLDA 1FWBC 3PC0A 4TVDA 1SR9A 2A2IA 1FDJA 3M0MA 4CQ8A 3W02A 3GDRA 3QGKC 2Z1WA 2HVOA 1E43A 4IIEA 3VX0A 2Y88A 2QCLA 3CPGA 4DB7A 3W84A 3MKVA 2VX4A 3GXFA 1V3LA 3GNXA 4JTAA 1Q4NX 4LAKA 3C52A 4NZFA 1EC8A 1TPDA 4I5RA 4HZ8A 4H83A 3VABA 1AH3A 3ZZ1A 1PHQA 4HGXA 4NX0A 4UQAA 3NFUA 1KXHA 1PX4A 4GABA 2ZXQA 2QCNA 2BVDA 1EBGA 2BB0A 3GXTA 2J66A 3U2EA 6REQB 2GQ9A 3SRDA 3J7HA 4AIEA 5CLWA 1TIMA 1L0PA 1AQHA 2V3EA 4AU0A 1N82A 2A3CA 3L9CA 1FP9A 1HJQA 1R9YA 4Y7EA 2EJAA 2WKGA 1LBFA 3IUIA 3S47A 1ECEA 2KAUC 2E6YA 1V02A 1W9DM 4CD6A 1M03A 1XKYA 2EG8A 3BOFA 1QFEA 4FX6M 4S39A 4ATDA 4DF2A 1J5SA 3E49A 4Y9PA 1ZJIA 2D0FA 3EYPA 4IIFA 2Q09A 1VEMA 4AXKA 5K4XA 5CC5A 2BVYA 2YYTA 2DZSA 2CPUA 3CK5A 2QJHA 5TBOA 3NQVA 1YDOA 2RDWA 4KWOA 4PB3A 3CM4A 4WXZA 4WF7A 3S2LA 3FA3A 3P61A 3VKKA 3CMGA 2QDEA 5HDRA 3VM7A 3LQGA 3RILA 1VBHA 4QM1A 1TA3A 1GOKA 2BG5A 1GQKA 5IHRA 3C8NA 1M7XA 3K2GA 2HE5A 5C6MA 3C4UA 2I17A 3GHUA 3LM3A 1UJPA 2R1KA 3WELA 1G4EA 4JFUA 1P6WA 3OVRA 4DXKA 5A8NA 6XIAA 3CUFA 3IIVA 4ERIA 1BKHA 3LN3A 3HG4A 3LHVA 3AXIA 5CQ1A 1XLJA 5D05A 4ZR8A 3H2NA 4DUVA 5HR6A 1QI0A 3MHFA 1VGAA 3FVDA 3UWEA 4KPLA 3SI9A 5KEZA 4AYSA 4GA8A 2WWCA 3BV7A 4JFVA 4LVBA 1VFTA 2I9UA 4PCNA 3UETA 3PSVA 4BI6A 1XCFA 4JTRA 3AIEA 3CEPA 3NQGA 1XRVA 2QDHA 3DG6A 3HFTA 5IFPA 1G5AA 4NIRA 1R3RA 1XM3A 3IJ8A 1J0ZA 1XD0A 3DI0A 1A5CA 4I8YA 4GH3A 5I24A 2J7HA 3NG3A 2QYGA 3AOFA 3LUTA 2PODA 3MV01 3F7JA 3FK4A 5EBAA 4GIRA 5C71A 2OCZA 3AS2A 1OD8A 1FTXA 4FB7A 2VC9A 2WNZA 3LCGA 3PANA 3VNKA 3BO9A 5A2AA 4JTLA 1EPXA 1WE5A 5DRIA 1DHPA 2Q71A 2NXGA 2VR5A 3WDIA 2G8ZA 3U7BA 1VEOA 1H0IA 3OG2A 4LC6A 2PRMA 1R2SA 4RK8A 4WSJA 4MB3A 2SFPA 3AWNA 3CXOA 3W2KA 2XFWA 4WHBA 3O6AA 2P3ZA 2WMJA 3Q2DA 4HHHA 1QWKA 3HPZA 1QPOA 3UEQA 4AEFA 2X8RA 1JCMP 3CZLA 1AMKA 1XR2A 2JFEX 1U1HA 3BMVA 1PVNA 3WO8A 4GI8A 4FNTA 4L6HA 4Z2KA 3TZFA 4NKCA 1GYMA 3OQ8A 3VMPA 1A4LA 3PBVA 3L4UA 3W1LA 1F61A 4DAFA 4IP4A 4MY9A 4G7EB 4PL1A 4QJ3B 4OV4A 3NM3A 1C90A 3RK8A 4KCWA 3DYMA 2V68A 2VM8A 3VIGA 5CKSA 1X6NA 2WO5A 3SGUA 3HV8A 1K9TA 3NQAA 3HBLA 3WMLA 1LLOA 4J3WA 2IKIA 4MWAB 4JX4A 3VGFA 1PYMA 1E1EA 2CW6A 3W7NA 1PZ3A 4DI9A 3P67A 3B4UA 2FVKA 2ABAA 1BVWA 2NLIA 2JEPA 4YHGA 1VJSA 3H4WA 3NXLA 3AO0A 3PUEA 3VDBA 3ITXA 1HZYA 4JFWA 1NEYA 1UOZA 5LNSA 2QCFA 4HPXA 4P61A 4RW3A 5I77A 1JYNA 3P3BA 3WNOA 3FSUA 3BAKA 5DT5A 5EFDA 5L9FA 4H7CA 2WNWA 5KETA 2VT0A 1A5NC 4JQAA 1EA0A 1XIDA 3C2RA 3K13A 4J7RA 1F73A 4WK9A 5LNUA 3LOTA 4DM1A 1J5TA 4O54A 2DZUA 4ZB5A 2HNHA 5B7YA 2HPMA 3NL5A 4NU7A 1JFXA 1MI3A 4X60A 2GUBA 3QY8A 1P4CA 2GSJA 4NJGA 2NVAA 3E2RA 5AN7A 1E72M 3OW1A 2OSYA 4AHPA 2ZCGA 1A3WA 1HL2A 4ZFMA 3UR5A 3UGRA 2DQXA 3AXMA 4DN1A 2VGGA 4ZOCA 3BICA 2CBJA 2G4FA 1R0MA 3TJXA 1W1VA 1Y7VA 4WXYA 4Z0SA 4AXNA 1YTDA 3C2FA 1XG3A 3KCOA 3MI3A 3W87A 4LS1A 1PKYA 2WVUA 1KRMA 2PGFA 2BVWA 4CNNA 4AWTA 1PPIA 5I06A 1E3ZA 2E4TA 3OLDA 4R5EA 5HOSA 3JW7A 4LNCA 2OOFA 1E40A 4A21A 1OGSA 1F3TA 2TMDA 5HQMA 5A6MA 1BPLB 1I4NA 5HQEA 3UYIA 4JY8A 1ZRQA 4LT9A 5JIWA 3QM3A 1IE7C 1GOQA 2INEA 3QPYA 2P5NA 4FXJA 4C6OA 1OIMA 4ROPA 1R86A 4KFOA 2YX0A 2XSBA 4MVAA 3EB4A 3TYAA 4O1AA 4NZJA 2NQ9A 4IGHA 3NAVA 2AL1A 5EB8A 1TVPA 3VNYA 4A3RA 1D8WA 2GPTA 5D9OA 3W7PA 4BY3A 2YCEA 1TJRA 4TVUA 4GZEA 3TWAA 4DZ5A 2P8CA 3MTWA 4JFTA 3EWBX 4X9YA 4Z1DA 4UOZA 5HNRA 3ZOAA 2ZDRA 4W87A 1EJRC 5FL1A 3SIMA 3I4EA 5DN1A 4GNJA 4QXIA 4GZ7A 3STCA 3ARXA 1FWWA 1EP2A 3B0UX 3TKFA 4E3TA 2BTMA 1VFHA 3UZYA 4O0QA 2C1GA 4C6EA 3S4TA 4D1JA 2HROA 2ZOXA 3ABSA 2OWWA 1EQCA 4Y90A 2GDUA 3NDOA 3STEA 4S3BA 1BYBA 2OU4A 3ID7A 3TQKA 4YYFA 2QV4A 3A47A 1TUXA 4R53A 2E7FA 3FX4A 3H2CA 5E5CA 1BF6A 3TC7A 1KR0A 4LF2A 3W6YA 2WV8A 2WVSA 2ZICA 3AZRA 2WCGA 2NV9A 4P7RA 1PS9A 1FQ0A 2D2JA 3EDEA 3PBYA 4YVVA 3N2MA 4QJ4B 3EX4A 5CPOA 1XXXA 3BSMA 4D71A 5EKYA 3EDDA 4XX6A 1W0MA 2ZRUA 1FWGC 1T5AA 4GKTA 3IJLA 1UPPA 1F5ZA 4EPKA 4F8XA 1W3TA 5CZJA 2OLHA 2PSNA 4NSBA 2XWDA 1JZ2A 1E5JA 4IL2A 3GXDA 5A5WA 4ZODA 3RO8A 3UWZA 1XYZA 2J6XA 3LCFA 4GG9A 3RCYA 1O4UA 3M0JA 4DELA 5EMLA 4XAPA 4PGLA 5C9ZA 3BV4A 3WK2A 1EUAA 4DQWA 4L4OA 4XV0A 2E6FA 1TX2A 1HL8A 2FH8A 3HV9A 1S3HA 1POKA 3SN4A 2OGJA 2CXGA 1CLKA 1DJZA 3ONCA 2C16A 2ZKMX 3TN5A 1WV2A 1NM9A 4O10A 4HZMA 3RXZA 2HE8A 3UU0A 5DX7A 1SFSA 5LHEA 1UD8A 3W2JA 4IIBA 1FCVA 1ISXA 1YKWA 1HKIA 3NVDA 1MXGA 1UKTA 2A5HA 2XH7A 1JCNA 1UUMA 4JKLA 4Q8VA 4WGXA 4ZTXA 3W2LA 3UXKA 1EOKA 2V82A 2NV1A 1ME7A 1ZHAA 1J11A 4R85A 3KVKA 3MO7A 3S2JA 4HSNA 2GDVA 4FNUA 2PA6A 4PB4A 2HDJA 3UG3A 1EO7A 3HOJA 3STPA 1YNQA 3LEPA 3VGEA 1BRLB 3WK3A 1XI3A 4IGMA 2ATMA 5BZAA 3MI6A 5EYWA 3GNNA 1JZ5A 2VUYA 4A8RA 2B81A 2D22A 3EXRA 5ABEA 4HN8A 4X2PA 4AD1A 5LZLA 5DELA 4G8TA 1FVPA 3KBVA 3NQBA 3W81A 1TJPA 1SJBA 3E1F1 3UESA 2DZVA 1A50A 1HKKA 1NVMA 4GFSA 1FH9A 3PZ9A 1P6CA 4C6CA 1EZWA 4MB4A 5GJPA 2VEIA 3ZJ8A 2XGZA 4LUTB 5AHNA 1H5VA 3RPMA 2WMKA 1XIGA 2VEKA 5FAGA 1RAKA 2V38A 4PMUA 4MNKA 4N2YA 1Q6DA 4JCMA 3GAYA 1B3OA 3W1XA 5FF2A 1IEQA 3S6TA 1W2VA 3IGSA 2ATSA 2PF0A 2JIWA 3IJDA 4ML9A 3NNTA 4PBEA 5F7UA 3LRMA 3VYLA 1TRDA 2HVMA 2G3MA 1OF6A 5G1TA 4C6KA 4OTKA 1NAL1 1DXFA 1EJSC 3DERA 3V1PA 1E56A 4GNKB 4QLLA 8XIAA 1FDYA 1LQ2A 2W63A 1D2KA 3OG3A 5DFAA 3WNPA 2J7CA 4NT0A 4NRSA 1KGXA 3BOXA 1DHKA 3AU6A 4H2CA 3F03K 3NL6A 3VNZA 3BAYA 2FTYA 2JF7A 3R7MA 3W72A 1BWVA 2OLSA 1DIDA 3EWDA 1KB3A 3G1DA 3GS6A 1DQWA 3H26A 4LS2A 2IQ0A 3EOSA 4JYEA 1PCWA 3GHSA 2JBMA 3NPVA 1KC7A 1Q6QA 4JX5A 3KBWA 3QFEA 1JNDA 1GTHA 3RLHA 1TPH1 3GHRA 1VIZA 4KW2A 4GO8A 5BXPA 2V5KA 3QQ1A 4DHGA 1YDYA 1HO4A 3H2FA 3WD2A 1XBYA 3BAXA 2PTWA 4RX0A 3E0WA 4PSRA 2E9LA 4JN7A 3IUDA 3VTRA 4L9ZA 3AZTA 3PPFA 4E4PA 3KL3A 3BLEA 4HYWA 1O60A 1GJUA 4BQ4A 2WB5A 4BF5A 1L6SA 2V5CA 2FZNA 2C0HA 3P82A 3L0GA 1UWTA 1PEZA 2CZDA 4AH7A 4NNBA 4XG1A 4XD6A 3ERPA 3PB2A 1R5YA 4Q8WA 3SCVA 3H54A 3GKFA 5FAJA 3NDZA 1W9XA 1VLIA 3BGGA 4HPJA 2CBUA 1VBUA 4B91A 1UD3A 2A3HA 2FTWA 1TUFA 1XLCA 1TV7A 1GG0A 3HPAA 4GZJA 3GTHA 4H8VA 2O4QA 2QLYA 2HWGA 4Z1BA 3PJXA 2AKZA 3T7VA 2RGLA 3ME3A 4F2UA 2BXZA 3CH9A 1L6GA 3OO2A 2ZUNA 2OZ3A 3QGVA 3KHJA 2UY2A 2XINA 4YJ5A 1R7OA 3UFYA 4YTRA 3OPSA 4AC1X 1TV4A 2O0TA 5GPRA 3ZR6A 4NNCA 1CGVA 3MZ2A 3QC3A 1DYSA 4GVIA 5AYXA 2VENA 4GQBA 1OFAA 4AIBA 2ONEA 2HS8A 2VOTA 4YLWA 4MYXA 3W88A 2HXTA 3UG8A 4YPJA 4EAYA 2BY3A 3V3WA 1YTEA 2L5HA 1SJCA 3DIPA 1UMLA 1UOKA 3APGA 2OPJA 1LZOA 4JTHA 3LBCA 1R47A 5FACA 4CN4A 2BXYA 4RZBA 4ASTA 1G9HA 5JVLA 5CAHA 2ZADA 1IXQA 4LGXA 1S2TA 4HZ7A 2EPMX 5CPLA 4B4HA 1EH9A 3GVVA 3BAWA 4JNYA 4X3ZA 3VZYA 4FPSA 4H3DA 3FEMA 4N9EA 3GG7A 3IJ6A 5ABGA 4JTSA 2PP3A 3R5EA 2PLCA 2O9PA 1E15A 3ZJ6A 3U6WA 4D6EA 3LPOA 3AROA 2WHKA 4PMOA 5JUVA 5LIYX 3GTFA 3JU2A 2Y8KA 1PX3A 1QI2A 2VZVA 5HMEA 2QMJA 1EB3A 4A3UA 3AQUA 3CWNA 4WKAA 3MUIA 3AFBA 1W9BM 4P8VA 4MF4A 4DBUA 2VX6A 4GVFA 4MUZA 5F2IA 4KBXA 3KM8A 1O5KA 2QF8A 1V5XA 1HKVA 3F4DA 3EOOA 1R3VA 3M7WA 2J74A 3WLHA 1JYWA 2J62A 1O66A 2YDAA 1ADDA 2PLKA 2GGGA 1VIWA 2VC6A 2X7VA 1TKKA 2ABBA 3FGCB 1EWEA 1GQLA 3VGBA 3RFAA 1JGIA 3WLLA 2WHJA 4B5VA 1RHCA 4FF7A 2DORA 2VD9A 3LS9A 3MUXA 2HTMA 3ALFA 4E8DA 1KA9F 2UY4A 2W91A 4UIOA 4K2SA 1UUQA 1V8EA 4PCFA 4HCLA 1W1A1 3L2MA 2QCCA 3ZVIA 4UFMA 2DT3A 3GH4A 4FSAA 4KCTA 1H1ZA 3VIHA 2YCIX 3FHAA 3LHUA 3TQVA 3M46A 2O9OA 1KV8A 1NWTA 2VURA 4DXXA 5HANA 4O57A 1E9LA 4BI5A 3EB3A 2GOKA 4XAGA 1EX5A 2RGMA 3GR8A 3W73A 6ALDA 1HL9A 5LIWX 4U4MA 1R2TA 3DC0A 3E6EA 3PB0A 4QJ5B 1MQQA 3W25A 2YCKX 1GW9A 1OQFA 3MO4A 3WLQA 4UUIA 5HK4A 1OBAA 3U4AA 4LUIA 3EA1A 2DUZA 3W9ZA 3LG3A 4AX6A 1SZNA 4Y9MA 1US2A 4R9OA 1OG6A 3GRIA 3ITYA 4I5UA 2Q02A 2AAMA 5AFDA 4HU3A 2DH2A 2GVGA 1R9XA 3EEZA 3DGBA 4DAIA 4O4WA 1RD5A 3W24A 4AWEA 1X97A 1QU4A 2QUVA 1MW0A 4M6UA 4WR3A 3RMEA 1OABA 4REQA 1WKYA 4GC3A 3I6EA 4QEHA 2WBKA 2B7PA 4U3CA 1JXJA 1UWAA 3W1RA 4EVZA 3N9RA 2WHMA 1VBRA 3LV6A 3QLLA 1K77A 5G2HA 4PCPA 4LQ1A 2J88A 1OK4A 4X0NA 1FKXA 1LBLA 1JPHA 3SUVA 4J5NA 4IPPA 4PTDA 3RGTA 2GWGA 1U83A 3DYPA 3LHYA 1UHVA 3HU7A 3GIYA 4CD7A 2PBOA 1X6UA 2QUTA 3VI2A 2DSUA 1DJYA 4AZHA 4UTJA 1SO6A 3WMCA 4G1NA 2A6LA 2WJFA 3A4AA 1OFRA 5C2CA 4OECA 2F84A 1U5JA 2WVTA 1V0NA 1L8PA 1LDCA 1RLCL 3WYZA 4PULA 2I56A 4UMAA 4B15A 1TWDA 5AHIA 4RPPA 1CWYA 2PLMA 1IWAA 3HN3A 5DANA 1FXPA 1KBIA 1OX5A 2NV2A 1C7TA 2QUMA 1JPDX 5ECUA 3CL8A 1ICSA 4PC8A 1SMDA 4RE4A 1JF6A 4AVFA 2BY1A 4KH2A 3B8VA 3S2NA 4M6PA 4MAVA 1YQ2A 2WZEA 4XZNX 3OU8A 1XDLA 3MSRA 4PA8A 3PPGA 3L2IA 1Q6EA 4LFYA 4IT1A 5EMKA 3ARSA 3FY1A 4JTFA 4ADUA 4N4PA 4UMBA 3HTWA 5M5DA 2EF9A 4AMCA 1Q6CA 2E9MA 4HN4A 2Z0IA 1B4KA 3TJIA 3TLLA 4U28A 3RN6A 5F4WA 2Y8VA 2J6VA 1VC4A 5A69A 4MKVA 1ALDA 1AZ1A 1XF0A 4LY8A 1QNRA 2Y4SA 1GPFA 3ARWA 1CYGA 3MCNA 5C7HA 1DVJA 2OODA 3S5OA 2ZC8A 4LEFA 2NT1A 3AXXA 1BXCA 2DW7A 4TOQA 1HT6A 3RNDA 3BLOA 3H22A 1NFPA 5FJOA 1B5TA 4NJIA 4LUYA 1FHLA 1QOXA 2I5GA 3MC5A 1VCFA 2XVKA 1XPGA 4KERA 1EYWA 1W9PA 4ACYA 1E73M 1P0EA 4JICA 2OR2A 1KM0A 4UTWC 4Q4PA 4O19A 3WLIA 3O8AA 4I9JA 1EOMA 1XSJA 1E0TA 3GTXA 1XH2A 2ZX6A 5F1VA 4BF9A 1SQ7A 3CHEA 3MYPA 1XJBA 1IF2A 4OOZA 4PN2A 3C8FA 4IFKA 2Y5EA 4IFKB 1Q6GA 1J2WA 4JTTA 2OYKA 4X63A 3KCJA 4JHOA 4GWEA 3T42A 1NARA 3QZAA 3IVSA 3PN8A 3W1TA 1F3WA 3T09A 1R87A 2WMHA 4ZO8A 4GYKA 1MRAA 1DP0A 1EYEA 2YJQA 4TTUA 3SGGA 3MQTA 5KZ6A 3WLSA 3FOKA 3GDKA 4C6LA 1HKJA 2VDIA 1K02A 3TDFA 1GZJA 3TXVA 3WQDA 1LOQA 1US0A 2AQVA 1AQ0A 4EP8C 3HG3A 3UD6A 4W9TA 5CJ5A 2RHGA 1P0NA 4B90A 3C56A 3NL2A 4WVXA 1FWAC 1W32A 2X30A 5BRQA 1GVYA 5FOOA 2BBFA 3MSYA 4Q3MA 4CVWA 1CEOA 2J13A 2PMQA 2J77A 3ZT7A 2E8YA 1PAMA 3HQOA 4C6QA 3VFCA 2OYMA 3AIVA 1EQPA 3QZEA 4ZBCA 1O1ZA 2CXEA 3S9YA 1YIXA 3WJYA 4I90A 3KTXA 3MUZ1 1XSIA 4RR4A 2DVTA 2V9DA 3FAXA 4GY7A 1M5WA 1MUWA 5C7VA 1YEYA 2V3GA 3I68A 3QKEA 4MADA 3NYDA 5AY7A 5CPSA 1QHOA 3FNDA 1TYGA 5HUOA 2W92A 1TELA 3V7PA 3VIKA 1W37A 1RP8A 1Q7ZA 2V63A 5BCAA 4CLMA 2QIWA 4E6MA 4A3YA 1N7KA 1XL9A 3OODA 1V4YA 1PCKA 5A6BA 3QV8A 3STGA 1KGWA 1OCBA 2PZ0A 3HPXA 3G1HA 1HN1A 1RPKA 4LCQA 1CPUA 4LPCA 4G7EA 1EJTC 1F76A 5CPMA 1UQYA 4QG6A 1YXYA 3DFTA 4UFIA 1G94A 3TONA 1ZALA 3S1WA 1T6MA 4MY8A 4ICMA 1O1HA 2FDSA 4KT2A 1I60A 2P10A 6A3HA 3Q65A 1TB3A 5A6KA 3AS1A 4JS3A 3BLKA 3WEMA 2CZ5A 2Z1BA 3N12A 3VKCA 3N3MA 1OF8A 1WDRA 1I2NA 5K7JA 4QEEA 1FH8A 3CPUA 3GR7A 3NQCA 4NI3A 4K7VA 4H6EA 3P2VA 3QN3A 4H1ZA 2DSWA 5I3DA 3RM9A 3KWSA 1KWKA 2FB3A 4JN6A 6TAAA 2OZTA 1VKFA 3GDBA 3PBGA 4FLOA 4LVFA 4ILSA 4WSKA 3W7QA 2A4AA 2YB1A 3CV7A 2R1NA 3E0FA 3TE9A 5A3HA 2EQDA 3VIJA 2E28A 4UOQA 3CZGA 1OX4A 3U8GA 4E2BA 4CD4A 1WO2A 3SY1A 4FXSA 3UQNA 3ABOA 4EWND 4K68A 5JBDA 1BG9A 3P60A 4PCSA 1C8VA 1VS1A 1EIBA 3G8EA 4C6BA 3WZ0E 3KS5A 2CKSA 3WF0A 2HXUA 2HV5A 1UR3M 3LXAA 3IAQA 2Z00A 5CSYA 3WH8A 3B0PA 4DZHA 2YFNA 2UY5A 4IMFA 4DIAA 1E0UA 2X1TA 2PGWA 4GX8A 1HW6A 2CYGA 2VJXA 3M7SA 4M19A 3S2MA 4H9XA 3BW3A 1F4HA 3MDUA 3N34A 3SM0A 4NAFB 5AC4A 4NI8A 3G24A 1AW1A 4M56A 2RDUA 3H4GA 1KFCA 3T0BA 2FZ8A 4GI6A 1HG3A 3ZT6A 6TIMA 3WIJA 1JZ8A 1NTHA 5I3GA 2GUUA 3U9IA 2QVHA 3E02A 3NDYA 3HPFA 1UPMB 5RUBA 1Z32X 1EA9C 3S3GA 4E0CA 2I1OA 3JZUA 3JVAA 2R1LA 2Z2AA 4JIIX 2ZZ1A 1XUZA 3EX6A 3CLWA 3VNMA 2IPFA 2WMFA 1UIPA 2C91A 3DHDA 3UCCA 1M3UA 3WQEA 1S2WA 4GGHA 1RZMA 3LU2A 1VYSX 2ISSA 5EPDA 2WOQA 1DE5A 3REQB 1K9EA 3BLFA 2WYSA 4PFHA 3UWWA 3UVIA 2Q3RA 1RXOB 3VM5A 3IJ9A 3D3AA 1VJZA 4W8LA 5T9BG 2VOMA 2QPXA 1HQTA 5ECVA 3RUBL 3CAVA 1G4PA 1G01A 1ZLPA 2JE8A 2F6XA 5FF0A 2PDIA 3RM8A 3U0HA 2W6RA 3M5YA 2Y7FA 2QHAA 3UP8A 3LY0A 3G22A 4AFYA 1A4MA 2YL8A 4Y9NA 4AY7A 4U2YA 3QKZA 2V5BA 4P8XA 3VKBA 2PZNA 5E1QA 3R8RA 4V28A 1BWLA 1C93A 3VOFA 3RM4A 1QNQA 5D2YA 1A0CA 4JY9A 2QAFA 3AYTA 4MDPA 2G3IA 1CLXA 3MUY1 4TVCA 3LNMA 4GQRA 3DN5A 1TZZA 4TQTA 3CBWA 4X22A 1K8YA 1M6JA 2VQTA 3ZIZA 2C18A 4ADTA 1M7PA 4QE5A 1XKJA 2QJMA 2AGKA 1VCGA 1ZB5A 3CT7A 3SN1A 4UXDA 4GO9A 3VOHA 2WBGA 2PU1A 2WVVA 4FNQA 4RKAA 1B9BA 1VHCA 1JRBA 1N8FA 3ECQA 3GG0A 5AKQA 3MDWA 3WJZA 4KIRA 1RCXB 3M16A 4ENLA 1XQKA 1S2UA 3PJUA 3R2GA 2X42A 3TNBA 2YR1A 3W2NA 1N2VA 2P3EA 2FGZA 4PMYA 4ZOEA 1RJQA 4W89A 3II1A 3A12A 5I07A 3JRKA 4W4QA 4FOUA 4BZYA 3WL0A 1FWCC 3DG7A 3VZXA 1KCLA 1KCKA 4GH1A 5DBTA 1JF5A 2J9XA 2NWSA 1S1PA 4A8LA 4GLEA 2Q3OA 4NRRA 1OFPA 1SFJA 3KE0A 1WKDA 5HNUA 3WQ6A 2VEMA 4I3GA 4JYDA 1LRQA 1LWHA 5AHLA 2VFDA 3VUPA 3K46A 5KZEA 4Q8TA 2CHRA 1SFLA 1R38A 7TIMA 1PKMA 3QOMA 3BARA 1QR7A 4DEFA 4MGGA 2VC7A 4LXFA 4JYFA 1FCBA 1UBPC 1JNEA 4WD0A 1J2BA 1FKWA 3CUHA 3NEVA 4I5XA 1DIEA 5M1TA 2PBGA 1FH7A 4EPDC 4PUUA 1D3GA 2VKZG 2IKJA 4IIHA 3KDNA 1KWGA 4ZB0A 4GQ0A 3W7HA 2DU2A 4M0XA 1O5XA 3PNZA 2Y61A 1KKOA 4UC5A 2YOCA 1KCXA 3TA9A 3DYOA 3TN6A 1E6ZA 4O28A 4XVDA 7ODCA 4CNUA 4G6CA 4JD4A 2CWNA 2WVVB 1T0OA 1EHNA 2NQHA 1H63A 2OYLA 4BQ5A 4H4IA 2PB1A 3QY7A 2P1FA 1TREA 4XUYA 1UG6A 2TAAA 4M5PA 3OTRA 5JH2A 4M82A 3TN4A 1FBAA 1W8GA 3BJTA 4PMJA 4F0LA 4WQ6A 4YWSA 1VJIA 2H6RA 3OZOA 1FOBA 3WY1A 1GTEA 3AISA 1FCQA 2CLOA 1HUVA 4INFA 3GK0A 3QHMA 3KBNA 3AUOA 3E0LA 3CZJA 5G5IA 4V27A 1QPRA 1FXQA 3QOKA 2ZRWA 2VFHA 1HP4A 1N8WA 4Q8PA 3KOXA 4NX5A 4C60A 3MPGA 1WZAA 4BF7A 3CO8A 4LU0A 4WY0F 4B16A 3VKDA 2VGBA 1K03A 2ZX5A 4RNFA 4FNRA 2X16A 3G1AA 3VZZA 1KTBA 3WBWA 3F2BA 3NSMA 1WKFA 5CPQA 4ALDA 2CC0A 1DIOA 1WXYA 3W1PA 5KTLA 1CGYA 1QWGA 5HNNA 4JZ5A 3H8AA 1J93A 3DHUA 1WUEA 1BVNP 3PG8A 4Q4SA 3B0VC 3FYOA 1M65A 1LRTA 2DT2A 1JCTA 3L4VA 2PRLA 1E6QM 4G7FA 1NWUA 2DVUA 3TWBA 2INFA 2EKGA 1PV8A 4MJ4A 4XIAA 3KLKA 4Y8FA 5BW6A 2DZTA 2ZZ6A 3W7LA 5A8QA 1KM3A 4ZQPA 3W1MA 3WBXA 1JZ4A 2OT0A 4ORMA 5D04C 1R6WA 1AMYA 1WBJA 2QXWA 1TR9A 1K8XA 2GUYA 3PZOA 3BSGA 1XC4A 4M51A 1ZNNA 1LL7A 5AVHA 4ZVJA 2INZA 1U30A 5HWJA 2VHLA 3CT2A 4YTQA 2QJIA 1MW3A 3TYBA 2Q8LA 4N9BA 4UTHA 1M1BA 5EFFA 2BLEA 4C6IA 3W7GA 2VVNA 1ITXA 3SCNA 2G5WA 2VZTA 3R12A 1LOSA 1V02E 2J8GA 1DE6A 3COTA 2MANA 1LL4A 4H19A 2ISDA 3SZ8A 3G0SA 4O13A 1QRQA 3U48A 4UCGA 1A5OC 4GZIA 3W7CA 1XYMA 2BX7A 3LPGA 3ABXA 4WOQA 5HINA 3SGZA 4CQBA 4DJED 3FGCA 3UR2A 3PZGA 3DI1A 1AW2A 2VGFA 2FB2A 5AC5A 3Q67A 4O12A 3TW9A 1FRBA 2ZZ2A 2W5FA 3VIOA 1TVNA 4J40A 4ACZA 1EJVC 1UMYA 3G0UA 3FDKA 4UQCA 2EHHA 3KRUA 4DXVA 3PWGA 3CIVA 3L0KA 1F2JA 3EEGA 1M7OA 4QITA 5AHMA 3V75A 4I7VA 2FFIA 3TC6A 5I5RA 2OZ8A 4E8CA 3OZPA 2ZA3A 4XZIA 5D02A 3IJIA 3B9NA 4LTSA 1Q8AA 1S5MA 2PTYA 1PIFA 1W17A 2DDXA 1GYNA 3CQHA 1AFSA 1WDPA 1JULA 2E77A 2QMKA 4KMQA 3BJSA 1SYTA 4P8WA 2FYMA 3MJMA 3FA4A 1E4LA 3U57A 2EPLX 1OCNA 4I9MA 3QV7A 4IPLA 5XIMA 2W62A 5D03A 1F07A 3C0SA 5BRPA 4UQEA 5D9MA 1U1JA 4EXBA 1TJ1A 3UYCA 8CGTA 4ZOAA 2OLAA 2WAGA 3QV9A 1ZAJA 2ACSA 3UZZA 1KGUA 3FXYA 1EFZA 2CLEA 4FLSA 3WJWA 1NFBA 4XVEA 1PB0A 3FIGA 4Z1AA 4K3ZA 2DZXA 2QS8A 1Q7MA 3NCOA 4HHLA 2ZBTA 1JUKA 4P7QA 4O15A 1WZMA 5EU9A 3VNLA 1GKRA 3M41A 4TV6A 4XD5A 4DY1A 2BY0A 2QCEA 1FHVA 2BZNA 1RVGA 3FHQA 2IPGA 4OZOA 3B0YA 2FJKA 4QDMA 4YU1A 2A21A 1C8QA 5HWMA 1B1YA 4C7GA 4ZQNA 3VO0A 5AYBA 2VFGA 3BLIA 2B0MA 5C0QA 3ICJA 1M04A 3LERA 3OYZA 1K6AA 1QOQA 3SN0A 2ZUSA 2WZMA 5C70A 1JGMA 3DDMA 3TTQA 1PZ2A 3A64A 4A2SA 4UTMA 3GLCA 4YCOA 1JPIA 2D2OA 3O06A 4ZZ9A 3T2QA 3KUMA 3RU6A 4L1WA 4MY1A 3ARZA 3W2UA 4FIRA 1ZBCA 2FTPA 5EGRA 1QNSA 2Z4GA 1K1DA 3AHYA 3S83A 1M41A 1PTGA 2D23A 3UG5A 4HA3A 1CZ1A 9XIAA 3S2CA 2CERA 1KLZA 2KX9A 2ZE0A 4RXFA 4PUDA 4O0ZA 4K6AA 4LVAA 3UNDA 1DEDA 1E70M 2ZTJA 3U2OA 3PTKA 3U4FA 5LGZA 1ZCCA 4XTIA 3BAJA 4HD5A 3LCWA 1OC5A 4MDOA 3IIZA 3TQ0A 4P7LA 5BXSA 1A5MC 1MEHA 1X98A 1TCDA 1JZ3A 2YBTA 1VP5A 3DFNA 2V69A 1SZRA 2YXXA 3T0AA 1O5RA 3AIBA 5AB3A 2VL4A 1I2OA 3D0CA 1VCVA 5REQB 1LCOA 4Q4MA 4ZQCA 4XK2A 1W6TA 3NSNA 3VILA 3K4WA 4RE0A 1EWDA 4JDYA 3SUUA 1F74A 1CCWB 1QO5A 2NX1A 3TUUA 1H60A 2J4GA 4J4KA 1VRXA 4LUSA 2BDQA 1UW9A 2ZZ3A 2GK1A 4IQJA 4H00A 2E1DA 1I6NA 4ONVA 4E2VA 2D73A 3DH7A 1XSKA 5AZ0A 3TSBA 2V2HA 4W88A 4UTFA 2NSOA 4Z2GA 1ONWA 1UZ1A 3M0LA 1XDJA 3RPTA 1IZJA 1SSDA 4OJYA 2C1IA 1QDSA 4OE7A 1IWBA 3T08A 1DPMA 4N9DA 2PDWA 3WN6A 4HSHA 1P43A 2BGQA 3KBSA 3LRKA 4U2ZA 3WBAA 8RUCA 1LG1A 3KW3A 3PZQA 2W9MA 2PD9A 3CIWA 3W53A 1H62A 3GC4A 2G3NA 1K4GA 4MWAC 4RJEA 2WPBA 2WQDA 4KEVA 1W54A 4V1YA 1CW2A 3F5KA 3PG9A 3BPWA 3QR1A 1NH6A 3GW0A 2ZIDA 3OVQA 1LYXA 3CLMA 4S3AA 2BODX 2PC8A 4U5KA 1L8NA 2GVLA 5G2WA 3LSCA 3WG6A 3URQA 2VWTA 1H61A 3GVQA 2Z29A 5ABTA 2YYUA 4LAZA 3IARA 1I1XA 2WZTA 2TPSA 3S1UA 1R3TA 1SMAA 2ZWYA 5G1YA 1UIOA 1OFOA 5HA7A 1PTAA 4GHRA 5JMUA 1BF2A 4GJIA 1DWAM 2ZX8A 2CBVA 1H2JA 4KWUA 2O7QA 3NM1A 3TCSA 1HGWA 1JUEA 4HTYA 1IIGA 4CNSA 3VNDA 4I8DA 3SCPA 1QNVA 3V4BA 2NT0A 4GIEA 4UBPC 4QNWA 1P1XA 2QJNA 3WH9A 3HFYA 3KCLA 2OT1A 4GE8A 4KFNA 1GZGA 3K30A 1XIHA 3AC0A 3EPOA 1TFVA 4S3JA 1E4NA 1WZKA 1EGZA 1B2YA 1BTMA 5FEWA 4QFUA 3OLEA 3KOZA 4AD0A 1VZWA 1A53A 1Q65A 4B3KA 5MKGB 1CXFA 2OTDA 3MHUA 4AWUA 1CECA 4KGLA 2GYIA 4UOJA 3GB6A 1R3YA 4BK9A 3UA4A 1TTIA 3LRLA 2VVSA 3OHMB 1TO3A 4CEXC 7TAAA 1GG1A 1DQUA 2QCDB 3AMCA 3P8IA 4YTUA 3AJXA 1U33A 1RR2A 3TYUA 1GGOA 4AC7C 1IEWA 4MSSA 1YDNA 1O7AA 3K5XA 3Q94A 2CLMA 4FOKA 1TSIA 1J8VA 1X96A 1ZZMA 4Z2JA 1K7FA 2C71A 4E5TA 4EKJA 1VAHA 3H2AA 3CB8A 4QDPA 4L5ZA 4IJCA 2FIQA 1EL3A 4FXFA 3C2OA 4QNEA 1XHGA 4CU6A 3KL5A 3CH0A 1W1ZA 3NXFA 3L5AA 4QSHA 3QR3A 4JIRA 4PTVA 4GNVA 1OC7A 4IM4A 4O52A 3W1AA 3DFSA 3TEVA 3TTOA 2A3AA 3WJXA 2YZ5A 2EEXA 4C6FA 3HO8A 4E4UA 4C6MA 1XLMA 2GQ3A 4DF1A 3N14A 3V0TA 2H3DA 3WENA 2B7QA 1H3GA 1TPEA 2QGYA 2PI6A 3Q4DA 1JD9A 3C2EA 4XTDA 3EDJA 3NGFA 2YDQA 1JUBA 3AHTA 3PAOA 2XH0A 5A6AA 4XQ6A 4CNTA 1GVRA 5I3JA 2Q8ZA 4D8ZA 3WDPP 4IPJA 2D0HA 1OEPA 4MFEA 1H11A 5JBFA 1NELA 1QW9A 5LSMA 1WXJA 1QW7A 2CHOA 3USBA 2MNRA 3MU7A 3EMZA 2GGEA 4Q4QA 3DUGA 1EKOA 4HZ6A 1VFMA 2VRKA 5BMWA 3M0YA 2XISA 1QI4A 3VE7A 3R6IA 1Q6LA 5LXXA 4UR7A 4UQDA 2CZVA 3LCLA 2F7FA 1TV2A 5D09A 2OX1A 3EMQA 4PBGA 4HA1A 3KVMA 1XIFA 1WKEA 4UTLA 3SUSA 1FA2A 4URIA 2FKPA 1RV8A 1W3KA 3E2SA 4ACZB 5M17A 1IZKA 4N9CA 4V15A 1A5SA 3R94A 4AHOA 2VDGA 4MJZA 3T40A 5I03A 3MWAA 3S46A 2G4JA 2DJXA 4CEUC 3M5ZA 1CTNA 1ISYA 4PUMA 4ATWA 1JDFA 3WLJA 5A6TC 2ZWZA 1CGTA 5I0DA 1TR1A 4XAZA 4WRHA 3SJ3A 3CAWA 3WUFA 4TMCA 1PHWA 5HMFA 3UXAA 4DPPA 3CV1A 3OLGA 4ZTYA 5FL0A 5KZDA 2CLFA 3C0LA 3ARUA 1KBLA 1CI1A 5IFTA 2PUZA 4A22A 1NP2A 3CQIA 3BCDA 1UP3A 5CBJA 3NEHA 3M5VA 5HULA 2Z25A 1E6XM 6CGTA 5FKYA 2FH6A 3RAOA 1BQGA 1QPKA 3GNOA 4I6KA 1F4AA 1GVFA 1A47A 1S2VA 3ITTA 3DAQA 4MKNA 4ZXLA 3EX2A 1ISZA 3SCRA 2VRQA 3T07A 4JNMA 1P0KA 2BOEX 4RUBA 2UY3A 1V51A 3THCA 2Y8UA 1RP9A 1GEQA 4B9ZA 5HJYA 1GNXA 1I2PA 1QJWA 4LY4A 3CTLA 3DESA 2OWCA 1GZ1A 3BZGA 4HNVA 4M1BA 4AZ7A 1G6CA 3VGDA 2E68A 5EL1A 3MYOA 4TXEA 2PDPA 3B8TA 4EWJA 4WDXA 1BYDA 1PIIA 1K7EA 3A22A 5A8MA 1SU5A 1NDVA 1US3A 5I3IA 2BXVA 4PMNA 3VC6A 4OBRA 2OELA 1XINA 4CGTA 3DOPA 2FHBA 1Z8AA 1FUYA 1F8MA 4IISA 3HF3A 4L56A 1HJUA 4RV3A 2BY2A 3URBA 4D72A 5D8ZA 1FFRA 1IR2A 2DQWA 3HZ3A 2NUXA 1G4TA 2CLLA 3RU8X 4TO8A 3M47A 4NVTA 1WDSA 1OT2A 4LAOA 2ZUVA 3LCIA 3CC1A 4ZO7A 5LNRA 5HMDA 3WF1A 1RBOB 1W5OA 4XZMX 3BAIA 3LV5A 3G2GA 3TIMA 2YZRA 4HMCA 1W3NA 3N6JA 2J8TA 5I78A 2G50A 1MQPA 2PTZA 3I6RA 2WWDA 1B31A 2NQ5A 3M0VA 1E6PA 2FGBA 2GK1B 4OU1A 2YXOA 4OVXA 3W7DA 5LIXX 2WMIA 5SWUA 1G0CA 1A0DA 3ISIX 3OGSA 3P81A 1ITCA 4DX3A 4NXSA 4O11A 3PZTA 2YLAA 4XZ9A 1O6IA 4S2CA 3PWIA 4HP5A 3MY9A 4IH3A 4C6JA 3U2CA 1KKRA 2BOFX 2X40A 4OV9A 3B40A 4S3GA 4M80A 2JKPA 1IHIA 4JBRA 3I6TA 4N0RA 4IXHA 1ZFJA 3TN3A 5B80A 1EEPA 1IZCA 3MP5A 3UPMA 4C1NB 1HP5A 3WH6A 3WNMA 4N42A 4LUSB 4D1IA 3G8RA 4P5UA 1EEXA 5HATA 4M6VA 3EA2A 1NSJA 2A85A 4RDWA 4Q6XA 3WSUA 1QNOA 1DBTA 1GT8A 2OO6A 4WGHA 2BVTA 1TZ9A 3WF4A 1XISA 4NY2A 4C91A 4GGBA 1UR0A 1HVXA 3W71A 1OG0A 3SEPA 1VD6A 3NO1A 3TK7A 5IBXA 1AVAA 5LYRA 1O95A 3NA8A 5GQBA 3C5QA 1WBHA 1MDRA 1JXKA 2PF8A 4HCHA 1UA7A 3L2LA 3SDOA 4BCEA 3QSTA 4R33A 4AZ6A 4FLRA 3U2ZA 3CHVA 1M53A 1XGEA 1EF2A 1ZJBA 4AZCA 3ZXWA 4KQNA 5BROA 1XCWA 2V81A 3GU9A 1XLDA 3LCHA 5GJNA 1Z3NA 1IYXA 3EGJA 3CPRA 2A1YA 2WHLA 4RPQA 5I3HA 3W7EA 3G3MA 5AC8A 1D9EA 5TIMA 2CZEA 4B5SA 1UC5A 5CGTA 1VLWA 1CXHA 4FMVA 2G97A 4N4QA 3UXLA 1ZUAX 4JEQA 3D3FA 4XUGA 1AJZA 3HJZA 1RPXA 4BS0A 3M0ZA 3LSBA 5BOOA 3RMJA 2GGHA 3PUDA 3QHOA 4X0VA 2CCRA 1UA3A 2VCBA 4MZ8A 1HIZA 4DRSA 2I14A 4IXXA 3ITGA 2Y70A 3ZFHA 4PH6A 2DW6A 3C6CA 4IHCA 2GFTA 3QVQA 3F5JA 3TZNA 2F6UA 3N4AA 3QV6A 4J3ZA 1WNOA 3B8IA 1V6YA 2CU0A 4RW5A 4W7VA 1JCXA 3FLUA 4LANA 3DU0A 4AY8A 1LG2A 4LBRA 5DMMA 1KXTA 1V3MA 2XTKA 4W85A 3BSHA 3PFRA 4ZSTA 4C1NA 4Q8UA 2YDRA 1TMHA 2GJNA 3DGRA 3I3EA 3LQLA 4UNKA 1H4PA 4W7WA 5HQLA 1M68A 4NP7A 2V67A 4I9TA 3GVWA 3NZ1A 5LXEA 1ZCOA 3GNPA 4Q4RA 3KBJA 1C3FA 1MZHA 3WLTA 1XCXA 1XPYA 1IEVA 1JR1A 2HJPA 3JUGA 3S5NA 3IIPA 2C19A 2J7EA 3NZPA 2JGYA 1ICQA 2PRHA 4N6FA 3VUSA 3L5LA 1J12A 3L0NA 1SFTA 1FWDC 3AXKA 3NWRA 3OOQA 1KBBA 4JOMA 1KD0A 2PDQA 4NHVA 1VYRA 1MSSA 3LHZA 3DFQA 3EOLA 1VFUA 4P7NA 4AD5A 1GQNA 4I7WA 3Q45A 2OQLA 5DRCA 2P0OA 2YLLA 1FFQA 4QE4A 3QMTA 2W66A 2BHYA 3BG3A 1KFLA 1XWYA 3A3HA 3VNJA 3W23A 2ICSA 4CCCA 1ZP3A 4EX4A 2FHCA 4QGCA 2PGEA 3WUBA 5C8BB 4DBEA 2D3NA 1TVLA 4N7QA 3T1GA 1JDCA 5AYYA 1DWHM 4Y96A 1FHUA 1TWSA 7A3HA 4GXPA 4H7VA 3H70A 1BRLA 2R9RA 4EANA 2DIEA 1KXQA 1XH0A 4F40A 1XW8A 3I65A 3KVJA 4G5DA 3P93A 3GBEA 4LCRA 3HURA 1FX6A 3GQYA 3ZVHB 1EDQA 4ZQRA 3PS7A 4O14A 1TCMA 1CGWA 1LP6A 2XJ7A 4QSFA 3N3TA 1PJ9A 1MXSA 4D6JA 3RG6A 1LWIA 3N15A 3UGVA 4RV8A 1Q2SA 2RUSA 3N25A 1F8IA 4OGZA 2WKJA 2I57A 2XVPA 5LIKX 3RDKA 3WD0A 2G37A