3GW0A

Urod mutant g318r
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIRQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen decarboxylase
publication title Structural and kinetic characterization of mutant human uroporphyrinogen decarboxylases.
pubmed rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 124
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gw0A00
1R3SA 1R3RA 4L6OA 1U1HA 1XDJA 4EXQA 1UROA 2EJAA 3PPCA 1R3VA 4L61A 1U1UA 4QQUA 2NQ5A 4AY8A 1YPXA 3PPFA 1XR2A 3GVRA 4L6HA 3PPGA 1J93A 1T7LA 4AY7A 1R3WA 4L5ZA 1R3QA 3PPHA 4ZR8A 1JPHA 4L64A 3T0CA 4L65A 4WSHA 3GW3A 3L7RA 3GVVA 3GVQA 1XPGA 1U22A 4ZTYA 3BQ5A 1R3TA 1JPKA 2Q6ZA 4ZTXA 3GVWA 1R3YA 1JPIA 3CYVA 2INFA 3BQ6A 3RPDA 3GW0A 1U1JA 2Q71A
chains in the Genus database with same CATH superfamily
3HPSA 2V2CA 1BGGA 3SQLA 1BG9A 1GQNA 4B90A 1DHKA 3OQEA 4L6HA 3AIQA 1W5OA 1A50A 1QI0A 4LYPA 2WCSA 3MZNA 3ALFA 1F3TA 4AIBA 1BYAA 3LGGA 4H6RA 1ZB5A 1ME9A 3DECA 1ECQA 4AFYA 3F4DA 5REQA 1PV8A 2ZTJA 3IANA 4UXDA 2XM2A 3GIQA 3NIYA 2F84A 3QZEA 2A6LA 2WZTA 4HSOA 1F3WA 3LUTA 4HPGA 2WQDA 1KWGA 4HTYA 5FEZA 5JIWA 3T0DA 4FMVA 3TW9A 1EQPA 5I3DA 2WK2A 2VMFA 4UTIA 2BP1A 1CIUA 2A4AA 2C14A 3EDJA 4HNUA 2C16A 3UJSA 2ZYFA 3TYZA 4ERIA 3LBMA 3N12A 1IEQA 3TAOA 3LB0A 2P88A 2WSQA 1QOQA 2Y7FA 3O7UA 1ZFJA 1DKWA 1QAPA 5DT7A 3SW6A 2R94A 3LCFA 1HQTA 2BX7A 3AOFA 5AYXA 4Y8EA 1O5KA 3NQEA 4CNOA 2I14A 1FFRA 2EJAA 1DJNA 3THUA 3EDDA 1R9XA 2G4JA 1XW8A 2FZ9A 1Q4WA 3BLIA 3CH9A 2W63A 1W1VA 9RUBA 1RA0A 3S9IA 3LDVA 5HMEA 1XYZA 4J28A 2NT0A 4M3PA 1LRQA 4MJ2A 4C7FA 3WUBA 3NZGA 1W3LA 1E4MM 2O7SA 5D02A 5FAGA 3TC7A 5CBIA 4XG1A 4PB4A 2CLIA 2NXHA 1KV8A 3EX4A 1S5WA 3MYOA 4UTLA 1VCVA 4Q6XA 1SSDA 1DQUA 4UTWA 3R79A 3N73A 2A7PA 3EAUA 2P0IA 1JZ6A 1P1MA 5I00A 2XJ7A 3ICJA 1R86A 4NNAA 2WZHA 3IACA 2PGWA 3FS2A 5HK4A 8A3HA 1X38A 4EIVA 1HJQA 4GUGA 2NV2A 3W3OA 1MNSA 2JIWA 4XZNX 5EA9A 2YBTA 1QCWA 4FO4A 4XTIA 1ZJIA 1EJXC 1E0VA 3ABRA 3M5XA 4ZENA 2A3BA 4BQ2A 3W24A 2I9UA 1DIOA 4CNTA 3B9OA 4CN4A 1T99A 2R1KA 4ZOAA 2CKSA 3C8FA 4S3FA 5G1TA 5A8MA 4DIAA 1U2YA 3PK7A 4HHHA 1TE1A 3GNPA 1DJXA 2X8RA 4XAYA 3TEVA 2XUCA 4TX8A 2QUMA 2GSHA 3AFBA 1XD1A 1AW2A 3I7QA 4JHMA 4ZEPA 3W7RA 5AB3A 2HSAA 3W7HA 4M6QA 5A6LA 5CC5A 1SJDA 2D1ZA 2OU4A 3HQNA 3QSRA 1QI4A 4LUYA 2JF6A 3TCSA 1DIDA 3VVGA 3N34A 5I02A 4XZLX 3WLIA 4L61A 3NA8A 2DY3A 3MUZ1 4FB7A 4V27A 1IEWA 4GO8A 3KVKA 2DQXA 2PFHA 3VNDA 1TPH1 1YDNA 4JKKA 1T8XA 4UFIA 1KO0A 1DWGM 3CTLA 3LCWA 3IIXA 3MCOA 3ARVA 2FDSA 3FCPA 3AS3A 3N11A 2FPTA 1E55A 3KL5A 2BHUA 1UA7A 2VDIA 3M5ZA 1LYXA 1US2A 3DI0A 2F6KA 1GZJA 2I56A 1J2WA 3NGFA 1DWHM 4GUHA 4KGJA 3S0CA 2BGNE 3POCA 4X9YA 1C8VA 2B81A 4MF4A 4OU1A 2OKOA 4UQBA 4A21A 3MSGA 4JFTA 2VZOA 2VJXA 5BU9A 2C6QA 1PSCA 3GW3A 3ARWA 2WJEA 4A3UA 1Q6LA 5BRPA 1JL8A 4UOQA 4GUFA 4DWSB 2PGRA 1CGWA 2WVSA 3HPAA 5I3GA 3STEA 9XIMA 4HNVA 5E9XA 2ZA1A 1ENUA 2BV9A 3FAWA 2OQYA 1EKOA 1ONXA 4QAIA 3SCWA 3MI6A 1K9DA 3G0XA 3KVMA 2YW3A 3CH0A 3FN9A 2FVLA 3LZ3A 1H63A 3A3HA 1WDQA 4HJWA 2WHKA 3EWYA 5D38A 4AX6A 5LNUA 1F9CA 3Q37A 2DZVA 3T4WA 3LD5A 4TVUA 4J2MA 2HPIA 3QV9A 4E8GA 3G3MA 5A2BA 1Q63A 1O1HA 1SZGA 1NU5A 3H23A 4DQWA 3MA8A 4LUTB 2VD9A 4W86A 4PMUA 3GXPA 4IH3A 1Q6CA 3CUGA 3HGRA 4E8CA 4YLWA 4GYPA 4IL0A 1CX9A 1LWIA 3BE7A 1KNWA 3SY1A 1M03A 1BTCA 3AIBA 1NDVA 4QG6A 3RAOA 5FJJA 1KR0A 2VZVA 5BXSA 2GOKA 4C7GA 5BOEA 3T0TA 3WH9A 2AGTA 4WK9A 4DBWA 3UWUA 2GJNA 3M0LA 3G1AA 4IQEA 3WJZA 3CQ0A 2Q8LA 4CNSA 4LRTA 2W62A 3FKRA 1KKRA 3RUBL 1HJVA 2ZWZA 2DZXA 1AG1O 3QEZA 2VX7A 2PZ0A 2OQHA 1DQWA 1EIBA 3BURA 4PUDA 4QNEA 5T9BG 3VMNA 3REQB 1HTIA 3CQJA 2W9MA 3FXGA 1K77A 1VZWA 1Y0EA 1R9ZA 1GEQA 2INZA 3LRMA 4OT7A 3KBNA 1JDDA 3W1TA 3TV8A 1C9WA 2QVHA 3LBCA 1DTNA 4JDYA 2GDQA 4IX0A 5IHRA 2ZQ0A 5F4XA 3IK4A 3MO7A 4GQRA 4FLSA 3APYA 2ZX7A 4LQ1A 1LT8A 3V16A 5CPLA 3SRKA 3QGKC 5AYYA 3EXRA 3BL3A 2WCGA 4Q4PA 4KKXA 3DEQA 4FX6M 1FHVA 3GHTA 4NU7A 3FJLA 2RDTA 5A94A 1US3A 4Z42C 1LBFA 4L64A 3RILA 3N15A 4AW7A 3O8AA 1Z9AA 4CQBA 3NSXA 5L9FA 5L6UA 1C8XA 4DYEA 4H9ZA 1G0CA 1EOMA 4N9DA 1QFEA 4PSPA 1F2JA 4HPHA 1EC9A 2CKRA 4H9UA 2Q02A 2CZVA 4KRZA 4RV8A 3WBAA 2Y24A 1PKYA 4LY8A 4PBGA 3WY1A 2TMDA 2NWRA 3EWZA 4UR7A 3TROA 3ZR5A 1O94A 2B7OA 5IM51 4L7ZA 3VNMA 2F8QA 2J78A 4HIBA 3BGJA 1XL9A 4F0RA 1DORA 3BJFA 5HPOA 4AZBA 2WHLA 1B3XA 4XZWA 1FWTA 4PUNA 2ZA2A 4LWWA 2D3LA 4RPQA 2PA6A 3WBXA 2QT3A 1W5NA 1VCFA 1KTCA 3O6YX 3PBWA 1JPMA 1A80A 3CC1A 2WW5A 3E1F1 3K4DA 5LXEA 3MI2A 4QFUA 4P8UA 4J40A 2WM0A 2KAUC 5CQ1A 1LP6A 5FL1A 3HQOA 5KZMA 3H12A 2D24A 3RJXA 3W26A 5EFFA 2OX1A 3O07A 1UR3M 1VENA 4MZ1A 3CAVA 2OSWA 1ISVA 1U83A 3M7WA 3ABSA 4AWUA 2Y85A 4H9VA 2NVCA 1VLIA 4U33A 4MJ4A 2DEPA 2R1MA 5LXXA 1M41A 1WZMA 3WL0A 4E2BA 4HNCA 4AD0A 4S2BA 1J18A 4LVDA 2E9MA 3WIJA 3QLDA 3ZJ8A 5A8QA 1OIFA 2QXWA 1Q7ZA 2PWVA 4LRSA 4KERA 4E2OA 3MT1A 1AK5A 1M53A 1MEWA 1MVYA 4LBUA 3Q94A 4IZGA 3IPWA 3KCLA 2WWDA 4RDZA 3ZFHA 3TNOA 2PLKA 4NZ1A 4RW5A 1Q5MA 3T8QA 4HA1A 1BEUA 1G4SA 1A5SA 3KLLA 1TV5A 2Z1BA 4HMCA 4AX7A 4CCZA 4PUWA 1UWSA 1FWEC 4H01A 1FDYA 4NP7A 3NZQA 3G8EA 4DNHA 4ZOCA 3IVTA 4MLRA 1C92A 3NEHA 4NJIA 1J6PA 1SFJA 1AZ2A 1XRTA 2YDRA 3VKCA 3GHSA 4FI4A 4FNPA 4L1GA 3T07A 1RALA 2XYLA 3IAPA 3LLXA 1X8FA 1W1IE 3MB9A 4AD5A 3U0HA 1FVPA 1G5AA 4JCLA 4NZCA 2J9YA 1S1PA 4DZHA 1PKMA 2IXUA 1G01A 4CQCA 4GI9A 4XZBA 3R1ZA 2C3ZA 3RMJA 5FEXA 4A05A 1JNEA 4MNKA 2QPSA 3WDHA 4WOQA 3NFUA 1ZRQA 4IQDA 1VBGA 2BVWA 2CETA 2OSYA 2ZADA 1G69A 4M82A 4MY1A 2D0GA 2VKZG 4HSHA 2HVOA 1FCBA 4DXXA 4HK5A 3GUWA 3O6DA 4GVIA 4C1NB 4J7RA 4L6OA 1PTDA 3WJWA 5A6SA 2V30A 3P14A 5C0QA 4GOAA 1WZAA 1Q6FA 1JQXA 5FJOA 1T7LA 2X7WA 3AZSA 4N7QA 4NAEA 2NVAA 2Y6ZA 2QYGA 4U28A 3L7RA 1TPWA 2FHCA 2DH2A 2WMJA 2R24A 5F2IA 1E56A 3AIUA 4IX2A 1ADDA 2QPXA 2WZMA 3VUSA 3L0NA 3SUSA 2J47A 4HBKA 3GBDA 1XR2A 1DOSA 3UD6A 2I5IA 1F6KA 3H21A 2QGHA 1UD3A 4PTVA 1CENA 4NT0A 2OLHA 3QR1A 5ECVA 1JQVA 1BSIA 2AMXA 3KXQA 3ANUA 4PMVA 2WMIA 4O1EA 5HQMA 3VNIA 2HE5A 5CZJA 4UBPC 2CZEA 4CCDA 4XBJA 4W4QA 1L6SA 1TPDA 4M6UA 2NQ5A 1JZ7A 1PIFA 2Y88A 4JHZA 5JXQA 3QBUA 4OOZA 1VBRA 2ZUVA 3IUDA 1NM9A 3V0TA 4OBRA 2WPGA 3H2CA 3N14A 3SUWA 3ITXA 1J4EA 3MCMA 4W5ZA 3OVPA 1YIXA 2OEKA 3UP8A 3P0XA 1DP0A 2VRKA 5A6JA 2YDSA 1NQKA 2YBVA 3T55A 1TTJA 5CPTA 4HZ6A 1BSLA 4LC8A 2O9TA 2V3FA 7A3HA 3G0SA 2D73A 3GTFA 4HHMA 4FALA 1C91A 3UW6A 1XIHA 3W9ZA 1EO5A 3W1NA 3DYOA 1D8CA 3U9IA 2G95A 4AMCA 5G4HC 3FVDA 3WDPP 3RFAA 3PSVA 3S5NA 2ISWA 3KOZA 3VMOA 2CLPA 1IWBA 3UR2A 3WNNA 3MUY1 2Y62A 5HUPA 4GD0A 3RX2A 1V77A 3L4WA 4JPGA 1ZNNA 2QCGA 2W66A 2Y0FA 2ZXBA 3B8DA 3TQVA 5I09A 1GVQA 3W1QA 3OPSA 4J3XA 3IGXA 1Z32X 1TV3A 2GPTA 4A8LA 1QVBA 5FF2A 3UWWA 4LC6A 1BFNA 1R3TA 3PR2A 2BOGX 2J77A 2GQ9A 4ZO6A 3MC5A 4LYKA 4QE5A 4O19A 2D23A 4DNMA 1REQA 5AHNA 1M6JA 1TB3A 2PF8A 5H8PA 4DEFA 2PDLA 1HJUA 2JKPA 5TQLA 3NWRA 5U4NA 3VNJA 1GUVA 1KFKA 4LYRA 3ITCA 3CYVA 4H9XA 3TXZA 2NZLA 2C7FA 2VOMA 1KBIA 3TAKA 3AXKA 4BJHA 3OIXA 3VD7A 4MNJA 3CQIA 1TWIA 2O9OA 4RDWA 1JDFA 1M7OA 2ONEA 1PTAA 4ICMA 2IPWA 3H2OA 1BPLB 2OYLA 1EFZA 3WK3A 2R1NA 4UTKA 1DEDA 2XINA 6XIMA 1EZ2A 1VEPA 5CJ5A 3ONBA 3STCA 3OP2A 4UQEA 1BWVA 4C5ZA 4GX8A 3WF0A 4S3BA 2ZVRA 4JQ3A 4LOCA 3XINA 2OGYA 1FP9A 4LYQA 2G0WA 4I6KA 4DUVA 3NQVA 4JY8A 4DZAA 4E0CA 2VGBA 3CPGA 3I3EA 4IIFA 3VD5A 1JYNA 1DWJM 3VILA 4YCOA 3UGRA 1MRAA 4IP7A 2H3BA 4K8EA 3ZVHA 4ACZB 3DXIA 1KXVA 3C2OA 4NX0A 1EXPA 3EB4A 4IFKB 2NSOA 4NILA 2CESA 3W6LA 3BG3A 1FRBA 4YHGA 3HGSA 3QR3A 4LNCA 2EF9A 1V7AA 5M3WA 2J66A 1O12A 2FB2A 1EHAA 4D8ZA 4ES4A 1Q65A 2NQJA 2XHYA 3NL5A 2WMHA 4E4UA 4JBRA 3PHAA 4K39A 2UY5A 3BLEA 3MV01 2C18A 3EWXA 2HBVA 2JE8A 6XIAA 4FXRA 1E6RA 4N02A 1UD4A 1HN1A 2PWUA 4M1BA 3QMTA 3N2CA 7REQB 4KWUA 4L1WA 4L9YA 3UJ2A 4XB3A 4PR4A 3TN5A 3AXIA 4O12A 3ES8A 1UKSA 3TNBA 1UJPA 1E6XM 1XYBA 1I6NA 2X1UA 4RL3A 1XDLA 2PGFA 4S3JA 2QW5A 1XLHA 2PMQA 1VPXA 5JIPA 3SN1A 5DFAA 3FK4A 2HJPA 3ARTA 3M5YA 1OCQA 1W8GA 4Z2KA 3UR8A 2VR5A 3A4JA 4GH1A 5HA7A 1UD2A 1R30A 4X0NA 5DRCA 4BS0A 1K7XA 3RX4A 3BLKA 1BGAA 4ASTA 1JNDA 4LCRA 1H49A 4ORMA 4UOJA 4Z08A 1WKYA 1U1JA 1UR4A 3EEZA 5G2IA 3CL8A 1B0IA 1HKMA 1JCLA 2ISSA 3EXTA 5G2HA 2GQAA 3KCJA 2WKGA 1XBYA 3VE7A 5EL1A 5HPCA 3BGAA 3QZ6A 2TAAA 3CWOX 3CEUA 5HNTA 2FZDA 5BXRA 3CAWA 1TCDA 3GAKA 3N4FA 3PUDA 3CEPA 4UMAA 3BSGA 1RCOB 4QM1A 1NOUA 3O3RA 3T0AA 1M65A 4HPNA 5C6MA 3MUIA 2GK1A 2REQA 3J7HA 4DBSA 3CMFA 1RLCL 1XJBA 1PX8A 1YRRA 3G22A 1E9ZB 5CKSA 2Z28A 1P0KA 3MSDA 4PN2A 1UW9A 1LUCA 1UUOA 3UJEA 4Z2JA 1OHLA 4UNIA 1EF2A 3NGJA 3WDQA 4PMRA 3HU7A 3KWSA 3MKKA 9XIAA 4JGDA 5F2GA 2CITA 3W6MA 4JTSA 2PRLA 1IGWA 3G8RA 3IUIA 4JD4A 1GTEA 1BF2A 2VO5A 1WDDA 2WM1A 2E8YA 3S2LA 1OFAA 1OD0A 2FTYA 3SECA 4LAMA 4Z2LA 5ENLA 3ZIZA 2DSZA 4A4AA 4OZOA 2INFA 3MMTA 3R8RA 2ZZ2A 1JCMP 2JQXA 3M9YA 4PMNA 4MWAD 1MW2A 4WRHA 3Q58A 1UH4A 1X6LA 2WC7A 3F2DA 5XIAA 2WXDM 1OC7A 4U10A 1E3ZA 4CD5A 3ZWSA 1F6PA 5D2YA 1UUQA 5CPQA 2W91A 5D30A 3ANVA 2Y4SA 5C9UA 1B54A 3NPWA 4CNNA 2ZUUA 4QBXA 4JDBA 3S1VA 1M3UA 4ROQA 3C2EA 4OIFA 1XLDA 4UMBA 2BDQA 3AMCA 4R34A 2YW4A 4GWEA 1J11A 2VD8A 2V67A 5LIYX 1TO3A 4RE3A 2QV4A 1XIMA 3V3WA 1H1ZA 1GVEA 3S2MA 4JL1A 4J3TA 1ZJAA 2XIBA 4Q8TA 1SSGA 2G3IA 4IJCA 4CVUA 4RE4A 3NNTA 3JZEA 5I3JA 1P43A 2GGEA 3CUFA 2G3FA 1K8ZA 3FJ4A 3ZLHA 3P6LA 3CV2A 3KBSA 4QS5A 1S5TA 3G0UA 3TKFA 4ZBCA 4U3AA 5DX7A 1H09A 1ZQ5A 4K2SA 3O6AA 4PSRA 3N2OA 4YVPA 3W2LA 4OUEA 3CUZA 2DDXA 5H8MA 1H7OA 3RLUA 1JR1A 1YBQB 1Q7QA 4PRRA 2BSLA 1KA9F 2D0FA 4R9OA 4AWEA 1OCNA 4JEJA 1IT7A 2VFHA 4IFOA 5CSRA 5HXMA 2ATSA 1ECEA 5A8OA 1NF0A 5AYIA 1X8CA 1PUDA 1UBSA 2YXXA 4FXJA 3CTTA 4PTNA 1R7OA 1YKWA 1WZLA 2C0AA 3QPZA 4IJRA 4JKLA 2AOSA 3U2EA 2BFGA 3GIPA 2V63A 3VPLA 1THFD 1ZJBA 4DO4A 4I7WA 4OECA 3IJIA 4W93A 4JQAA 4LAUA 1F8IA 4MWAC 1DJGA 3H22A 2XH4A 3ZT5A 2PI6A 5D09A 4DAIA 4GZEA 3GKAA 3QW3A 4F0SA 1KFBA 5BW6A 4G1NA 1Q2SA 2RFGA 3CHVA 3B8IA 1OFEA 4JOMA 1QU4A 4NYYA 4Q4OA 1XSIA 1W3IA 5PTDA 4IMCA 4I9JA 4QISA 4XZ9A 8RUCA 1DQXA 3L5LA 1NARA 4P7NA 3ZLFA 4WJEA 3A4WA 3GK0A 1H5YA 3WDRA 1FCVA 1TG7A 3PUOA 4Y6GA 3BICA 1KWKA 4FIQA 3GG8A 1GGOA 3I7RA 1JYWA 2FGLA 4LU0A 1JCTA 3N4EA 4I7UA 4FOUA 3HMJG 1R7AA 2C1HA 4R33A 3RIKA 1OFBA 3TONA 3L5MA 3CV6A 1VFHA 2GFTA 1WQ5A 1GT8A 3QTPA 2WSRA 1GOXA 2WBKA 4NZ5A 3GKFA 3R0KA 5MF5A 2VX6A 3B8TA 1UH3A 1SR0A 3DDMA 3ZLGA 3C61A 2YB4A 2HISA 3L21A 3A4XA 2X7VA 4CNPA 1UOZA 3C86A 3GHRA 4MHBA 1EC8A 1EGZA 3AC0A 1EGMA 3B4UA 3IIVA 4WKFA 3WH6A 3W7NA 3IARA 1GPWA 4Q8WA 4E2VA 4G7FA 5HJLA 4INFA 1UA3A 1B57A 3TYAA 3LMYA 3SRHA 1B4KA 4RKAA 4B2DA 3GDTA 2ZUTA 3R13A 1H1NA 1RCQA 3JS3A 4AZ5A 1HKWA 3AS1A 2QAPA 4LAOA 3VNLA 5I24A 4JIQA 1GG1A 4V2XA 3FEQA 4JTCA 4O15A 3MDWA 3W70A 3VM7A 1RXOB 1CGVA 1ZBCA 5G1YA 4M7SA 2QF8A 1XISA 4Q32A 2DSWA 4MM1A 3GDBA 5AECA 4V1YA 1IWPA 2PU1A 3PZGA 3TZFA 2IPFA 1VD6A 3PPGA 5EYWA 1IGSA 3IK2A 4B5UA 3RPTA 1V51A 3WD1A 4CEXC 4NNCA 1CBGA 1UYQA 3WDJA 1OF6A 4LT9A 2R6OA 2ANUA 4QDMA 3PANA 4DAFA 4YTRA 3KX6A 1SQ7A 2R82A 2QGYA 4IXHA 1YADA 2A0NA 1D7FA 4QSHA 4HK7A 5DANA 1KV5A 4JTIA 1ONWA 1QATA 3ITVA 5I77A 1EUNA 1QNPA 5BCAA 4YIWA 2HPMA 5FF0A 3GXFA 1V6WA 3ZR4A 1XGDA 1XRVA 3CYJA 2XGBA 4TOQA 3B0UX 2GWGA 1DWAM 2CZFA 2VEMA 3ELFA 4M7TA 1R2RA 3T6CA 2HK0A 3V7PA 3JZUA 2DSVA 4QX4A 1ZAHA 1P0DA 3TK7A 3WD2A 4IWWA 4KRUA 4ZXOA 3S6DA 4CUCA 5AVNA 3VKKA 4GBDA 2C1IA 3DFSA 2E4TA 1WA3A 4K7VA 1H7RA 2QHAA 3HG3A 4MWAE 4M80A 2VR4A 3N13A 1ZBKA 3NZ1A 1WV2A 4UFJA 3GU1A 2VC6A 3OYXA 4H6KA 3R11A 1FWGC 4OBTA 2CYGA 3RLGA 3HG2A 4QAWA 1BAGA 3BXWA 2POTA 5HMDA 4EVZA 3NVDA 1F3EA 1BD0A 2GUYA 4JL2A 4PMZA 4J3WA 4DZ5A 1B9ZA 3IGUA 2RH9A 1VQTA 4K7YA 5E0CA 1GOMA 5DCBA 1CZ1A 5DELA 4AHOA 3GR4A 3BAKA 1UWAA 4GKTA 4CQ9A 6REQB 3P80A 3V36A 5CLWA 3VFCA 4UZSA 1O68A 1N55A 4UTFA 3M4HA 3TC6A 4UNLA 2VC9A 3WD0A 4RPPA 3E3HA 3TE9A 1OFRA 3A9BA 1MUMA 4MWAB 3NQ2A 3U2OA 3WK0A 1NEYA 2MANA 4O4VA 4KF1A 4RV3A 3OVGA 1DTUA 2ZZ4A 1J0HA 1JAKA 3AIEA 1DE6A 5EY5A 5GNZA 1PTGA 1XP3A 3LQLA 1RR2A 4HYRA 3TLLA 1E5JA 2ZCGA 2DVTA 1FP8A 3SCPA 2GDVA 4KEVA 1J93A 3GRIA 1WDSA 3V5OA 5EPDA 1B9BA 2BY1A 3OHIA 5XINA 2V2HA 1VP5A 4NZ4A 3LPOA 3O63A 4AVNA 1W91A 3BZJA 3EDEA 1TWWA 2GVLA 2Z2AA 3N4AA 4PCPA 3U57A 1HFBA 3BCFA 4QLLA 1SJAA 3WLNA 4EP8C 4EPEC 1PCKA 2EGZA 5FF3A 2QUUA 5JUVA 1TRDA 4DX3A 4C6BA 4S3EA 1OC6A 2I57A 3VC5A 2DT0A 4O57A 4AZ6A 4AZIA 4N2YA 1TX0A 3CM4A 3CQHA 1EA0A 3ARPA 4JQ1A 4W89A 5HR7A 1PAMA 1VFUA 2WO5A 4JIRA 3UCDA 3UJRA 4XKMA 1WXZA 2WNQA 3QKZA 1KGXA 2EKCA 4IOTA 4QJ4B 3VIJA 2B0MA 1L6GA 1B4EA 3NM3A 1ZSXA 3A6OA 1QPKA 2Q6ZA 1D3GA 4XZMX 4F8XA 4ZFCA 3AJ7A 1JYVA 1C7TA 5JH2A 3RITA 3O2LA 4TTUA 3ECQA 3EGJA 1KRBC 1WDWA 2EG8A 1T0OA 2AMGA 4TR9A 1UPMB 5I0DA 1TIMA 3NQ8A 4WDUA 1O66A 1H7NA 3WBYA 1A0EA 1TQJA 4GY1A 3WBWA 3E0FA 4PMXA 3VDHA 1WXJA 3AYVA 2J88A 1XX1A 3CZ8A 3ARUA 4LCQA 4JFUA 5LSMA 4O11A 2AL2A 3STPA 3QMRA 4BKNA 1TPB1 4BK9A 1XQKA 2QPUA 2PU0A 3R6IA 1QNVA 2PB1A 2PURA 1KM4A 2DJXA 1WCGA 4FF5A 1CECA 2NQLA 1E5NA 4D8LA 3RCNA 1GK8A 1QHPA 4O0KA 4DUOA 2OPJA 3NQMA 4PTDA 1MNZA 2ALRA 3I3BA 3HG5A 1PEZA 1UD5A 3QZAA 4ZTYA 1VFOA 5LNWA 5MKGA 3NQFA 1C7SA 1W1A1 4X61A 3OZYA 5AC4A 1W3HA 1QTWA 2PBOA 4ERGA 2J25A 4DJEC 4LH8A 2GL5A 4O1FA 2WPBA 3I6RA 3BANA 1KFCA 5FL0A 4G9PA 4AISA 3HPZA 4O1DA 4O13A 4WDWA 4OJYA 1VEOA 4PMOA 4JY9A 2WMGA 2HNHA 1O7AA 1WPCA 2FB3A 3KOYA 1E1EA 3VZZA 5FOOA 3WSUA 5CZSA 4P2VA 1AH3A 4AIEA 4PCSA 1RUSA 1K4HA 1XC4A 1U30A 2DIEA 2NSXA 1FWSA 3D0CA 3ZJ6A 5AN7A 3SEPA 3AYSA 1XPYA 1EYWA 5LIXX 4CU7A 3GXMA 3TR2A 3QYQA 1FWWA 4DJFD 2J7HA 2RGMA 3VIOA 4ATWA 4S2CA 4EPKA 4LS2A 3S5OA 1XBXA 1KC7A 3W7QA 2OWCA 4YJ5A 2OOGA 4Q3MA 3BPWA 3NL2A 4S3KA 1OX4A 3W71A 4EXAA 3QW4B 2J7BA 2NQZA 2QCDA 4GKLA 7PTDA 1VYSX 3VKAA 2XFFA 3WLSA 1V93A 4XKYB 3W7IA 5TF0A 3P84A 3MUAA 5LNSA 5HQEA 1QNSA 4MJZA 2Z2BA 3DHDA 3LENA 1TPFA 4KEUA 2E1WA 3C5QA 4AZHA 2WWCA 1WX0A 4E4FA 4GNVA 3SJNA 2PWEA 2VNCA 5CBBA 2A7RA 3PN8A 4PZVA 3RU8X 1PBGA 5TIMA 4F40A 3KP1A 2DJLA 3PZOA 1V3IA 2PTDA 4AD2A 4MPQA 1NOFA 2V38A 4RNFA 2VHLA 3WQPA 2YFNA 4D72A 2YL8A 3H7VA 3MJYA 3GVGA 3BG9A 1BVNP 3WJXA 3HTWA 1AQMA 4NYUA 3R10A 3P5ZA 2C91A 3BVJA 1YW1A 3NPXA 1A3HA 1TWDA 3S83A 1GQKA 4JTTA 1UC4A 4GH3A 4HT3A 1P4CA 3PZIA 3PPHA 5ABGA 3H4GA 4G5DA 1UZHA 2BTMA 4FSAA 1F7BA 4GIYA 4OE7A 5JMUA 4FA3A 2V5JA 2VURA 1BQCA 1XM3A 1S38A 3VO0A 4PUEA 1G4PA 2XZ7A 1ZZMA 2E7FA 3B8VA 4LS0A 1SZNA 2V8ZA 4QE1A 1UJQA 3H2FA 5D2VA 3ATZA 4L5ZA 4GHRA 4N6FA 1V8EA 2VFGA 4EK7A 2PDPA 3GC4A 1UR0A 3GFZA 3KEHA 5A95A 3EBVA 3THQA 5I03A 1XDJA 3TDFA 3IVUA 1C29A 2BLEA 1G7VA 1RCXB 3R4IA 4TIMA 4HU4A 4ZB0A 1LTDA 5FJTA 3NQ7A 1VB9A 3AHVA 1IWAA 4DJFC 1FWAC 3EMZA 3G1YA 3UNTA 2W3ZA 4C6PA 4ZQNA 1SO5A 4RW3A 1RBLA 2PTZA 2V2DA 1PZ0A 4UWMA 1QASA 5CPNA 3L4UA 4M29A 1ELSA 4ZQMA 3OTRA 1AW5A 2B7QA 3ALGA 4ZE4A 4H83A 3QV7A 2F7FA 3KOWA 4KCUA 4Q22A 1Y5WA 1RHCA 3WUEA 5A1AA 3B0VC 3NPVA 1A4MA 4MNMA 3T05A 3L2LA 3VYLA 4JN7A 2QMKA 3LS9A 4CU8A 2IKJA 4IIDA 3VZYA 3GUGA 3MI3A 2ZUMA 4UR8A 4ONVA 1ME8A 5FEWA 1JZ4A 1Q6EA 2VCCA 2X1SA 5M17A 1XCWA 1B30A 5CCZA 1NELA 2BHZA 2VVSA 4LUIA 1RVGA 3RGTA 1O60A 4WVXA 1IT8A 1P7TB 4Y9NA 3W6YA 4ZO7A 3WQWA 4JQ2A 3FXYA 2GSEA 1WOAA 5HMSA 4HYVA 3IJ8A 1UC5A 2F6UA 3CZJA 2KX9A 4KFPA 4D6CA 4LY4A 1SUXA 1RD6A 3C2RA 5AZ1A 4GISA 4P7LA 4IQLA 2VEKA 4HYWA 3UY8A 3SB0A 1W9BM 3HIJA 1P6CA 3ITOA 3SCRA 1QW8A 1C8QA 4KCWA 4Z0SA 2YB1A 3BCDA 3AWNA 4NY2A 4UTJA 3IWPA 4LUSA 2WVVA 5D04C 3H7UA 5FJPA 5EGRA 4HOZA 4M24A 2OGJA 2QCEA 3KVLA 3G1VA 3RM4A 3GH5A 2J8FA 3M5VA 2G8ZA 4JIPA 4LSBA 2OSXA 3A5VA 3ARRA 3BQ6A 2DU2A 4MUZA 1EJWC 3OZMA 3EA1A 2UY2A 4JTRA 1OM0A 5LGZA 1VHNA 2IKHA 3KM8A 3BG5A 2ICSA 1GYMA 1R2TA 1SZFA 3T40A 5I6SA 3NEVA 2A7NA 4TUFA 4Q4RA 2ZZ6A 1UH2A 1OYAA 2PD5A 3IRSA 3AO0A 5H1WA 3CV1A 1LWHA 2YIHA 1IF2A 3UPWA 2JK2A 1K8YA 2G97A 1TRIA 3VIMA 1X1OA 3WMSA 1U1UA 3L5AA 4Q8NA 2FGBA 4MDPA 2LLEA 3NR0A 4DLMA 3PWIA 3MMWA 2QF7A 1TZ9A 2ZWYA 3F4CA 4MFEA 1SO6A 2Y8KA 1FH7A 3T78A 1TMLA 3VGGA 1O1ZA 4FNQA 2VDHA 4ATDA 4JHOA 4F2BA 2Y7EA 5CBJA 4R7OA 2HQAA 1W31A 1EO7A 2QQ6A 2GVJA 3CIXA 1XLIA 1XD0A 2OCZA 2NW0A 3DHPA 5H2ZA 3TW6A 2OOFA 3ARZA 3ZS4A 2WAGA 4WCJA 4Y8FA 2J27A 4Z0JA 2OWXA 3PJUA 3C56A 4GQ0A 4Q4QA 3EA3A 3K1GA 2Z29A 4CLMA 5E09A 1MQPA 4ADSA 3F5KA 9CGTA 1LORA 4JAWA 5HWMA 1XBZA 5FAJA 1RK6A 2Y7DA 4MY9A 3R94A 5HWNA 3EX1A 4CGTA 2PDBA 3MO4A 4MVAA 4XWUA 3LOTA 3WMCA 3BDKA 4CD8A 1D3CA 1F73A 1S3HA 2QEZA 1DHPA 4ATLA 3FJNA 3RLHA 4EXQA 1T6MA 3OB8A 1EJTC 3MS8A 4X60A 2NXGA 1ZAJA 5HJYA 4HZ7A 1CGUA 1R8LA 4FNTA 4NXKA 5E6ZA 3FX4A 5FEPA 4LVAA 1YE4A 4HCDA 1K6WA 1HP4A 5HMFA 2DUXA 5I78A 2YCIX 3E0IA 4GCAA 1XLKA 4PRWA 1GKQA 3QTGA 1TPEA 4CNUA 1R2SA 4YMZA 3NDZA 3FOKA 3ERPA 1GG0A 5C71A 1E0XA 1UZDA 1A5MC 1P6WA 2WZEA 1AMYA 3K1DA 4XAGA 1A5BA 3L66A 1UROA 3F2CA 3EPMA 1GHSA 1U5VA 1HG3A 1XLGA 4IM4A 1VIWA 3N04A 5I5RA 4FIRA 1UR1A 1OK6A 1I1WA 2XZ9A 2DVUA 3LV5A 1RV8A 1UD6A 1XLFA 3FDGA 4Q4MA 1EP3A 1H3GA 4GACA 3PWGA 1G94A 2PODA 1PVNA 3KRZA 2BODX 3A3WA 2PDXA 2G4FA 1BTMA 3W86A 3T7VA 3MWAA 3T08A 3TZNA 2Z26A 3SI9A 3PTKA 2PDNA 3H54A 3WLOA 4EACA 2PDHA 1FWRA 5GQBA 3W07A 2P5NA 1GW9A 3CU2A 2V5KA 4AY7A 1TIWA 2DZUA 4K1WA 4XVDA 5D8WA 2GYIA 1ZCOA 3CIWA 3MUXA 3WG6A 2XGIA 3CB8A 4HK6A 1E51A 2GDUA 3WLPA 1FA2A 3B8SA 4JKMA 3TYEA 1H7WA 3SIZA 3CBWA 3LYEA 3QKEA 3RRXA 3DH7A 3KW3A 1Z42A 4DI9A 3NJ3A 3QC0A 4UCGA 1ODUA 4C6QA 4RZ5A 4ZQRA 3KRSA 5KINA 4AHQA 2HXUA 1G4EA 3EKLA 3MSYA 4G1KA 1QHZA 3TN6A 2EKGA 4U2ZA 4A3QA 1FDJA 2D2OA 2I5GA 3OLGA 3TMQA 4YS1A 3OU8A 4XAPA 4OHQA 3IEBA 4WEVX 7ENLA 5CJMA 3PZNA 3AMDA 2BHYA 4FXSA 3W2UA 1X39A 4D6HA 3PZUA 4C65A 1WNOA 4MAVA 4S23A 5AHIA 4QQ3A 5HATA 4IUGA 1A3XA 4PRTA 2G3JA 2CBUA 3Q2DA 3KCOA 4O50A 1VRDA 4O54A 1XF0A 1UKOA 3PULA 2P8CA 4HA3A 4NJGA 2FZ8A 4O0ZA 2BNJA 1Q2RA 4WZHA 2GGGA 2OT1A 4IF2A 3ITLA 3CT2A 4C6LA 3BW3A 1UQYA 1KM6A 2X0HA 4GXWA 4XBSA 2VQTA 3D3AA 3LCXA 2PCQA 4PL1A 2YA0A 1FHLA 3OGSA 4D6EA 3K46A 1AH0A 2NX3A 4GINA 1BQGA 1RP9A 4MWAA 2W5FA 2ACQA 3P5YA 2PWFA 3LHVA 1XSKA 1OT2A 2F38A 1F76A 1TMHA 3NCOA 1NFPA 1A5CA 1RVKA 1W56A 1TELA 2WSYA 1WO2A 5E70A 3C3NA 1CXHA 3DKLA 3VUPA 1H7PA 3KHJA 1MRQA 2ZZ1A 1H5VA 1EF3A 3SDOA 4LB3A 4GBUA 1ITCA 3EWDA 3MUCA 2BXYA 5D2XA 1SGJA 3AMLA 3HF3A 2YL9A 1M5WA 3QHNA 3RHGA 1A5AA 1V03A 3GLCA 4G2DA 3VOHA 2ZUNA 4JTKA 1R3YA 3HO8A 3KLKA 1X7FA 3NL6A 5KZEA 2WJDA 1J0YA 3GDLA 1G4TA 5TNVA 1R46A 4IP5A 2I16A 4NAEB 2INEA 4G6CA 3UA4A 3I7SA 2FIQA 4FF7A 3RF9A 3UWVA 4MB1A 1ZHAA 3HA1A 3RPDA 3V0UA 1WUFA 4I8DA 1J9YA 2OJPA 2FKPA 2IXVA 3QQWA 4M6PA 3S9YA 3G2GA 3TOYA 5AHMA 1O5XA 2XIMA 3W1MA 4L80A 5K4ZA 3OHMB 1WDRA 1QHOA 1YMYA 1Q8AA 4BI7A 2CEQA 3PWAA 1ZL1A 1W9UA 2FVMA 3U4AA 1XKYA 2J6VA 1XDMA 4QDPA 4XK2A 4AAJA 1KM5A 4E8DA 3PTDA 3C0LA 4L4MA 1F3XA 2J9XA 1U5HA 4ENLA 2Y5JA 4WDXA 2PE4A 1GPFA 1M01A 2TYSA 4NI3A 4Q8QA 3QSTA 2C19A 2CLEA 4LVBA 2V3GA 3ABZA 3AZTA 1JAEA 4HSNA 1DJIA 4OFCA 5KITA 3TTSA 2QS8A 1XYLA 2FMOA 3W01A 1XHGA 4FX8A 2E3ZA 1RA5A 1JDEA 2DVXA 1XFCA 3CQKA 1V0NA 3TTEA 3M0VA 3WBEA 5DRIA 3RNDA 3TYCA 5BWFA 4DPQA 3RR1A 4ADTA 1EDTA 2OLSA 1LBLA 3VOJA 4WY0B 1YDOA 4DYKA 4LVGA 1OSEA 1AVAA 1E4LA 3LI0A 5IXEA 1UP3A 1DJZA 5AC8A 1P48A 4HCLA 2AKMA 4O1AA 1PIIA 4LANA 3WENA 2QUTA 2PWHA 1VYRA 2PC8A 3FNDA 5CAKA 3O15A 4ZVJA 1OBAA 2UZ9A 4MG4A 4PA8A 1LF1A 4B4FA 3UFYA 2G37A 3W00A 1QO5A 1IXNA 5T26A 3WH8A 1ZP3A 3LEPA 4W8AA 2HZGA 2ZUSA 4MOZA 2GJPA 1XIBA 5IFTA 5K9CA 4MY8A 3VM5A 1MDRA 3JVAA 1Q8JA 4Y7EA 2DGAA 3ZZ1A 3T2PA 4Z1AA 4ZOEA 1PO9A 4O8AA 3ARQA 3M16A 3U5UA 3BAJA 4H7CA 3VI2A 4NJHA 1OFDA 4JZ5A 3OJGA 2QJJA 3LHZA 2J7DA 3ZXWA 1REQB 1U1HA 4ZMGA 3KZPA 1QDSA 1RPXA 2VUYA 1X97A 4FLOA 4UFLA 1DVJA 3WQ6A 5EMJA 1E4NA 3DBNA 1LOLA 3L65A 3UJFA 3S5SA 3QH2A 4HNOA 4IJBA 3ZJKA 2VFEA 4F79A 5A6BD 4XKYA 4HMNA 2PRMA 3SRDA 3ZSSA 2BGQA 4PYSA 1VBHA 4C6NA 3VOGA 3ES7A 1VFLA 3K30A 1V6VA 1W9DM 2P76A 1XYCA 4GYKA 1LQ0A 1GVSA 1KLZA 3ZJ7A 4ZQOA 4TV6A 5CG0A 3DUGA 1LL7A 2BY0A 1BWKA 3E74A 1ICSA 4GIRA 1RBOB 5KSWA 4TMBA 4GRSA 1ISYA 3C6CA 5CSSA 4A2RA 2VGFA 1KBLA 3KHDA 4B3KA 2Z0IA 3W82A 4EE9A 2HE8A 4DM1A 1R3SA 4ZXLA 2JGYA 4IXXA 3E0WA 2YYUA 1BHGA 4KFOA 2GWNA 2Z24A 4EPBC 3UZJA 4XSLA 1E6QM 1H2JA 1JFXA 1K9TA 3EMCA 4YYFA 3I3DA 3ZVHB 2CLMA 3A5FA 5A6AA 4JNMA 3GNRA 3AMKA 3E2QA 5A8PA 2HNEA 3SZ8A 4RDVA 1LWJA 4KCVA 3RO8A 1W8SA 4W88A 5HR6A 1Q7MA 1TV7A 2YKKA 2QIIA 4C60A 4B2DD 2W0UA 1XI3A 1EJRC 3MY9A 2C79A 1UD8A 2CZ5A 1I0DA 2P3ZA 4JTHA 3PP7A 3K8KA 3W2NA 2XWDA 3VGEA 1XIGA 2H9AB 5JBDA 1CXFA 3W2MA 3MP4A 2OLAA 3Q4DA 2WQPA 1CWYA 3QPYA 4ZSUA 3LSBA 3G18A 3AHZA 4KQNA 2BBFA 3I4EA 1FH9A 1TWZA 1UPPA 3ARYA 5FF4A 1XRFA 2YR1A 3S2CA 3OVRA 1Z44A 1V6YA 1KCKA 2ZOXA 2E9BA 4QROA 2V82A 1UOKA 3DFNA 4H00A 3WQGA 1XS2A 4LNYA 2XFRA 4U5IA 1CGTA 4JFWA 3VNYA 1KD0A 5K9XA 2XIJA 3ENLA 3IRDA 3W1LA 5H6HA 1WB0A 1QBAA 1CNVA 4AB4A 1QO2A 1E9IA 1EHNA 5FF7A 3K2GA 1G6CA 2HCVA 3W83A 4NVTA 3LPGA 2BASA 2NX1A 2Q3RA 3UR7A 1JXKA 4HHLA 1B3ZA 1TE6A 1K6AA 4BZYA 2ZDRA 1I2NA 3E9AA 4AC7C 5FSDC 2ZA3A 4UQCA 1RAKA 2QCMA 3SFWA 3R0DA 1KTBA 4A8IA 1E4IA 4IGSA 3HB9A 4K68A 4PUUA 4B5WA 3DFHA 3MHFA 1G1YA 4H6EA 1P7TA 2GGJA 2OODA 2PPGA 1L6FA 1RJQA 4B91A 3B04A 4IPNB 5HUOA 1GOIA 4TVDA 2RAGA 3R12A 3WFLA 4WIWA 5I7GA 3SO7A 1POJA 2FMNA 2GK1B 2REQB 5LIUX 3T0CA 1HT6A 1JFHA 4MDOA 4GE8A 2AAMA 1B3WA 2YOCA 5FJRA 1NH6A 4NI8A 1LUCB 2R91A 5D37A 3VDAA 4DJEA 2I5QA 2VX5A 2OWWA 3IJDA 3OGVA 2X30A 5GNYA 4Y9PA 3OLDA 1HGWA 2FZMA 3ZMRA 1OT1A 2WCAA 3TX9A 3JU2A 4DO5A 3P93A 2MUCA 4E3VA 3GG1A 2DW6A 3GXIA 1OGSA 1OVDA 2WANA 3DG6A 1KXHA 2W4XA 1POKA 5CPMA 4ICCX 4UB9A 3A21A 4YL2A 4WHBA 1H41A 4DI8A 4Z2HA 5D32A 8TIMA 3W23A 3GFXA 2JFEX 1QR7A 2P3EA 1I60A 2CCRA 3FGCA 4BEQA 4XD5A 1GVOA 4GG9A 3RLVA 3BUVA 4KWWA 2D2HA 3W7MA 1F74A 2QLYA 1XCFA 1JRBA 4C1KA 1FBAA 2O9PA 1BXBA 4G7EA 2J8GA 2Y70A 3GE7A 4GIAA 1GQLA 1JCJA 3TXVA 1TJPA 4Q4KA 3EOEA 1AMKA 4TX9A 3SM0A 3GYEA 1BG4A 2NT1A 5LHEA 1PE1A 2QCFA 3AWOA 1DYSA 1EUAA 2Z6JA 1PPIA 4PFMA 1UR2A 4HD5A 2EPLX 1FFQA 3IAQA 2YCJA 3NYZA 1H60A 2VGGA 4WGXA 3CB3A 4LS1A 3N6QA 3W53A 1ZALA 3W88A 1JF5A 1GOOA 3EDFA 3UXDA 3HN3A 1NY1A 3CMJA 5C2GA 1ML1A 2PDJA 5DQPA 1US0A 3BOXA 4LEQA 1JVNA 2Q09A 2ZX8A 2WZIA 3CZKA 1KCXA 4ZOBA 3N9RA 2XSAA 3PJTA 3KRUA 3E49A 1ZUAX 2JEQA 3RM9A 1J96A 1TWSA 4C1LA 1W2VA 2A3HA 2VX4A 4JTEA 4A3RA 3FHAA 1KBJA 3D3FA 2F6XA 4D6FA 4Q8VA 1MZHA 4L4OA 4I6VA 4DXKA 1DWFM 1MSSA 5KTLA 3QV6A 4NASA 4GABA 3CHCA 3M0KA 4R27A 4WLCA 3QC3A 1UMYA 1FWFC 2OR2A 1LQAA 4DBDA 2IQDA 3EOSA 3FV9A 5K7JA 3MSRA 2I1OA 3W73A 5IDZA 4QGCA 2D20A 1H11A 3QY8A 5JBEA 4QTGA 2W27A 3EX2A 4JTAA 3E02A 4H9TA 3U3HA 5EMLA 1MO0A 3LPFA 3O9NA 4GQQA 4HU3A 3I6EA 2CBJA 4DJFA 1J6OA 1PZ3A 3FA3A 1QK0A 4QITA 5KZ6A 3CASA 1OD8A 3UXAA 3WMLA 3P2VA 3WLMA 1QMLA 3MWCA 3WNMA 1L2QA 2IQTA 3HFTA 4BF7A 4JX5A 5ABFB 4AC1X 3OZOA 4F4RA 4QJ3B 3M0MA 4AF0A 2CHRA 1XLEA 4ZB2A 2PSNA 1G9HA 4DPPA 5HJXA 4ALDA 5D03A 4LGXA 1E0UA 2QR6A 1SPQA 1GONA 3WF4A 3NQAA 3V18A 1TA3A 2P8BA 4AWTA 4GNJA 5D9PA 2EXOA 2GOUA 4BI6A 3BV7A 5LA0A 3VCNA 4LUJA 3KTXA 3RN6A 4ZA0A 4XD4A 2OVLA 1I75A 1JJKA 1YTDA 4DELA 3OG2A 4DY1A 1KRAC 5G5IA 4DUWA 4Z2GA 5AY7A 1RJPA 3KS5A 3VGDA 3GAYA 1KGWA 3TC3A 1PHQA 2ZDSA 4RXFA 1LDCA 3EX6A 2CERA 2PWDA 4H8VA 3MMDA 4RE2A 2MNRA 3ITYA 1XCXA 3N3TA 3FFSA 3PZTA 4UUIA 3TJXA 3SCVA 3CGTA 1NIUA 1J8VA 4LALA 1LL6A 1ITQA 1VF8A 1IZCA 1KFLA 3B0YA 4IGMA 1NAL1 4S3DA 4F0LA 1UWUA 4URIA 4QQUA 4A35A 2IPJA 2WNZA 3ZVIA 2XVGA 3SQSA 2HS8A 4JX4A 5F2LA 4BCEA 2WSPA 4U31A 3WLQA 4CD4A 3LA4A 3IJ7A 3W1UA 1SFLA 2NUYA 2EG6A 3AHXA 1RP8A 3G24A 1JEZA 2JKAA 4J1OA 4QXIA 5DCDA 3AU2A 5A3HA 4IIGA 1LT7A 3CAKA 1QI2A 2C71A 1FWJC 4ZQPA 3APGA 3LMZA 4LCSA 3P60A 3R8HA 3TLQA 4RJEA 3KP0A 4KH2A 3GS6A 3WQCA 2IQ0A 1M9HA 1P5BA 3AJXA 3V5CA 3EB3A 4W8BA 2QUVA 2TPSA 4IUOA 2Z1KA 4QSFA 3FJ6A 1E6SM 3N25A 3EYPA 1TTIA 3ID7A 3U48A 3I65A 3DIPA 4GUIA 2Y8UA 1PWLA 1PKNA 1HKVA 2ZRXA 3DFQA 1TTQA 4TX6A 5FCZA 1E40A 4AIOA 2DW7A 4LB4A 3UYCA 5M1TA 1XYAA 4EF8A 3N2BA 3SR7A 2I17A 4UIOA 4H8NA 1BF6A 3L2IA 3VABA 3R25A 1QBBA 4KS0A 5DY2A 5BMWA 3VCRA 2ISFA 4K37A 5C7VA 2HDJA 4K1GA 3AHTA 4LEFA 1ITUA 4M5PA 1XIEA 1TVNA 4PTWA 1ZCCA 3CUIA 1QT1A 2O9RA 5ABEA 1WBJA 3VAVA 2O0TA 1KW1A 3SSZA 3B8WA 3H26A 4YVXA 1PDYA 3ISIX 3HGOA 5FSEC 4A2SA 1E6PA 3HM7A 5A69A 3WL1A 5DLCA 1BYDA 2F2HA 1V5XA 3NQDA 4DBUA 2XH2A 2WHJA 4GGHA 4RZ4A 1BXNA 3NSNA 3VNZA 3HG4A 5BNKA 4Q4SA 4N4QA 3N9SA 4A6GA 1DJHA 3WEOA 2VTFA 4I7VA 1YXCA 3VNKA 2YL5A 3W7DA 4O4WA 1HJWA 1AH4A 4ZE5A 4XUGA 1IYXA 1IT0A 1V4YA 1ZBWA 2WVTA 3R2GA 3WLTA 1OCBA 4UOZA 2ZXQA 3W72A 2QDDA 4RZ6A 5A6TC 3EEGA 1R3QA 3T4CA 2H6RA 3WLRA 1YDVA 1AJ2A 1IQ8A 5DBUA 1FWBC 3I6TA 4K6AA 3TVAA 4PBFA 1J79A 2J79A 4ZB5A 4L9ZA 4MB4A 4WY0A 5E0KA 2YBUA 2PUZA 1IR1A 2I9EA 5G2WA 4F48A 1AJZA 2G96A 3ABXA 5IRPA 2B7NA 2XSBA 1QNRA 2HMCA 3LPPA 1FWHC 3W1XA 3THDA 2PP3A 5DO8A 3UXIA 1AFSA 3MW7A 4J9JA 2XTKA 2QUNA 3BJSA 2IPGA 3H2MA 1ADOA 3G6LA 3E5PA 2VQUA 4M51A 4MPKA 2E09A 4POCA 3SJ3A 3MANA 2V68A 3H53A 4JNYA 1Z3NA 1PKLA 3PG8A 1ZP4A 1HVXA 1WXYA 2Z6IA 3U7BA 4YYCA 1TYGA 2IMRA 4P7RA 4X2PA 3PVFA 2VEIA 3GYCA 3QR0A 4U5KA 5DY3A 3UGVA 1UIOA 4D6JA 1QJWA 1I2RA 2UY3A 4Z1CA 3EOLA 4FNSA 2WNWA 1WKDA 3DFOA 2FYMA 3VOIA 3PSWA 2IKIA 4LX4A 1MMFA 3WJSA 1HXJA 1WP6A 1GKRA 3OBEA 1P6BA 5CEWA 2AGKA 4TMCA 2PTXA 3GR8A 3HV9A 4DWSD 3QVQA 8CGTA 3DU0A 6TIMA 4KRTA 3TP4A 1VJIA 1UUMA 2AL2B 1ISZA 4YTUA 1QWGA 4HMEA 2GJLA 4DRSA 1YPIA 3W7LA 5I3FA 4JYFA 4PMDA 4NKCA 1AL7A 4IT1A 4O1BA 3VD3A 2R1PA 5BOFA 1YLVA 1JD9A 3F4NA 4IQJA 3GM8A 1LLWA 1V3JA 3CUJA 3WFZA 1MUWA 1CB2A 3KOFA 4GQBA 3GTHA 1GVIA 4GC3A 3K5XA 1J0JA 2X0SA 3AROA 5MKGB 3IV3A 4C91A 4IGNA 3VKDA 3T81A 4ZO9A 2FZNA 2P0OA 4GVGA 1Y8BA 1KLYA 5EMMA 1M68A 4ROPA 2YGYA 2WC3A 3NQGA 2PDFA 5TBOA 2A85A 2ACSA 3R58A 5LNVA 3EZ4A 1QRQA 3AQUA 4V1XA 1NWTA 5LKYA 3RCYA 5C9WA 3V5FA 4ACYA 1EQCA 3T9PA 3LCLA 3R7MA 6ENLA 1YPFA 1VLWA 1R85A 2Q8XA 1UWIA 3WZ0E 3E38A 3KBVA 4OTKA 4IMAA 1Z89A 4MSSA 2HVMA 8XIMA 2DIJA 2PTYA 4ZL1A 4GCXA 3D46A 4Z17A 1HO1A 2WHMA 1LZOA 1Y65A 5FACA 3KZSA 4QLJA 1KBKA 2H9AA 3B03A 1KRMA 4MYXA 1OX4B 3GVRA 1SMAA 3ARXA 2QCDB 2RJGA 4DO6A 4WQ6A 3S1WA 1OJXA 1F4HA 3S4TA 1IZKA 2VCAA 4HZMA 5C70A 1JCNA 1X1ZA 1FHDA 3UZZA 4DXVA 1XBVA 4Y9MA 1J0ZA 2CLHA 1W3KA 4GGBA 2FDMA 2V5DA 3KUMA 3PBGA 2VRQA 4JQ4A 3T2QA 4NZFA 4AG0A 4DWSC 2A6NA 3GDRA 1R0MA 2BMBA 3BW4A 1KXTA 3CPUA 2GQ8A 3HPXA 4I5XA 2BB0A 5HAOA 3S8HA 3SCOA 3U6WA 3NZPA 3E2VA 1N8IA 5D4YA 3GDKA 1XIDA 4MADA 4RLIA 3JR2A 1Q45A 4RXGA 3L4YA 4V33A 2X41A 4R7WA 1EIXA 4XIAA 1HKKA 3I4KA 1H4PA 1JD7A 3NM1A 4CVWA 3DC8A 1TREA 1UZ1A 2YXOA 4W87A 1UKTA 3OIHA 1VRXA 3V35A 4P8XA 5BWAA 2E5BA 1BRLA 1MXDA 4MTVA 2V5CA 1HW6A 2QJGA 1J5TA 3FVMA 3VINA 4OQVA 3QPEA 2VI0A 3CPRA 3BJTA 2RUSA 1HJSA 1GW1A 3AYRA 3HQPA 1E72M 3GC2A 2C1GA 4FPSA 3F1QA 4B9YA 1SMDA 1ZGDA 3MKCA 4H8HA 5GPRA 1CEOA 3NQBA 5HANA 5D2WA 2X16A 5JBFA 4E4PA 3HQ1A 2FFCA 1TV4A 3LV6A 3M0YA 1GQIA 4HP5A 1KKOA 2ZBTA 4US6A 4JYDA 3DAQA 4HVXA 3V1HA 1VIZA 4J3ZA 2UV8G 4PGLA 3UQNA 6PTDA 2B31A 3WUFA 1IV8A 1BWLA 1YXDA 3AS2A 2EG7A 5T91A 4KEMA 1T8QA 2HK1A 2FLIA 4Y2WA 3STFA 2DSKA 4ZZ9A 1K3UA 4LF2A 3CUXA 4NXSA 3SCNA 5F1VA 2X05A 4F2TA 3N2TA 3N6HA 2CU0A 4M81A 3L4TA 1MXSA 4W5UA 1XIJA 1VPYA 3PTMA 3A23A 3FAXA 3SURA 3SGUA 1C9DA 2ATMA 3H2NA 4UTHA 4O10A 2Z1SA 3BMWA 3U8GA 4FP1A 1E0TA 4GA8A 1X1NA 4O0QA 4Q8MA 3WH5A 4DBEA 1GOQA 4UCFA 1Q13A 2A79A 1YTEA 2QNEA 4CN1A 5DMNA 2GVGA 1VC4A 1LG2A 4W7VA 4US5A 1TJ2A 2PLCA 3UU0A 2BVYA 3N17A 1JZ2A 3RR4A 1O5QA 3CHEA 3FKKA 2XVPA 5E93A 1FXQA 2QVNA 4O14A 4C6EA 1A5LC 3VTRA 1VBUA 4IPJA 1Y7VA 2ZX5A 3OA5A 3HGJA 4RNIA 3TA9A 1ISXA 3WLJA 3TQ0A 4OV4A 1RPKA 3PPFA 1XFBA 4HU0A 1ZLPA 3RJYA 2CLFA 3IUHA 3PZMA 3FEMA 4H4IA 3KBMA 4JFSA 3RCMA 1ISWA 1E9LA 4O8RA 4L6DA 4MZYA 4EAMA 1F4AA 3M47A 3SUVA 6A3HA 4LUSB 2WVVB 2NV9A 2CXGA 3K13A 2EPOA 2E77A 2PDMA 2YFOA 3IS4A 3LRKA 3QN3A 1MXGA 1NWRA 3ZOAA 1YQ2A 2X2YA 2O4MA 5CGMA 4E5TA 2NQHA 2YDAA 2PDIA 4IIBA 3LSCA 2G5WA 4UC5A 3VKJA 1W3NA 5EMYA 4F2UA 4RX0A 2CZDA 3T2OA 1GYLA 3BOFA 3UF9A 4GIEA 4LJ3A 1E6ZA 2Y61A 1EX1A 4OOUA 3RMEA 1EZWA 3O05A 2FVKA 4Z1YA 4DF0A 2HEJA 5DF0A 3E12A 1XRSA 4DLFA 3QQ1A 1JXJA 3JRKA 1UP2A 2TRSA 3WF3A 3UPMA 2VL4A 1I45A 4H9YA 4XQ6A 2ABBA 3S2JA 1GVRA 3UWQA 1IXPA 1W9PA 5AVHA 5DMYA 1FH8A 3LHYA 1EYEA 2FTWA 5AC5A 5CGQA 2D22A 3E96A 3AI0A 4YCPA 4LF1A 3G1HA 1R87A 5CC6A 5DXXA 1TFVA 3WCZA 4LVFA 3LM7A 3NDYA 1J01A 2VCBA 1TTPA 1OZMA 3M7SA 1FKWA 2VELA 3MMUA 4JTUA 3N19B 1AZ1A 1N2VA 3R43A 4I5RA 6ALDA 2PWGA 5A6BA 2ZXDA 2YLLA 4J3SA 3C4UA 5ABFA 1SM9A 2ISDA 1NFGA 5EBUA 1SO4A 1OYBA 3Q45A 2YZRA 4C6DA 3DX5A 4TU1A 2QDGA 1V6UA 1VEMA 5C2XA 3SSJA 2WNNA 1I4NA 2QCHA 4O52A 4AEEA 3WNOA 1MW0A 3L4VA 5E5CA 2ZC1A 3SGZA 1V08A 4G56A 5E0FA 3UCQA 3NQCA 1F61A 1R47A 2ACUA 4C6FA 1XH0A 3KAOA 3UWZA 3QOMA 4WXYA 4X22A 1J0KA 2RKXA 4KFNA 4PL2A 3TYBA 2TODA 5IHSA 4YN5A 2H3DA 3RU6A 4IIEA 2VYOA 4M6VA 3RDKA 4JTFA 2ZZ5A 4OBSA 2OKTA 3WNKA 1WBHA 3PB0A 4NRSA 1HNYA 3MP3A 3QOKA 1A0DA 1F8MA 1RH9A 1ESWA 3DENA 3HPFA 5C55A 4EKJA 3GG7A 2VP8A 2DFAA 1ZENA 2DZWA 4MUPA 1JGIA 3OO2A 3AUOA 2J7EA 2VWSA 3WD3A 1NVMA 3DCPA 4NX5A 2VEGA 3CHFA 3MU7A 4DHGA 4H2CA 4C7DA 2R9RA 1CW2A 1E9YB 1XWYA 2V9DA 3OA3A 3DYMA 5FESA 5F4SA 1J12A 3CUHA 3I68A 4FR1A 2NUWA 1W9VA 3NO5A 4AQLA 1V02E 3M6YA 4QIUA 2DH3A 1I1XA 1OX6A 3KTSA 1E1CA 1KCLA 1SR9A 2PCEA 2PTWA 4WSJA 3B4YA 5AFDA 3O06A 4GJJA 1H62A 1EWEA 4QG9A 2PC4A 2X2GA 4ZQCA 3MBFA 4QE4A 5E1QA 4FZIA 3PBUA 3PFRA 3GC5A 3GW0A 3W1PA 2ZRVA 2Z7GA 1VFFA 4REQA 4K36A 3GZAA 5I3IA 1BLIA 3LM3A 4S39A 4J4KA 2P50A 5BRQA 1A5OC 2NQ9A 2QJHA 3S1GA 2DQWA 5LYRA 3MBDA 2FZBA 2JF7A 3VOFA 4AZGA 3HBLA 4ICNA 3SY8A 1BYCA 3R0UA 1ITXA 2BVDA 3VCCA 1UR8A 1F5ZA 4WGHA 4A22A 3VX1A 1TVLA 4P5UA 4YXGA 1W1YA 4C6MA 3TSBA 4PEKA 1I8JA 2DORA 3A64A 4F0KA 4GMEA 4GYJA 1DV7A 2VGIA 4Z1DA 1W17A 3MQTA 4JTJA 2BY3A 4DF1A 3KOXA 4TTGA 4AYGA 4D6GA 2DT3A 3V4BA 1TZZA 1MUCA 3UNDA 3H2AA 1ME7A 4ECLA 3B8UA 1XLCA 2PBGA 3G1RA 1NF7A 2BXVA 2NUXA 3E2RA 4Q6JA 3UCCA 1SYTA 2RDXA 1EA9C 4MJMA 2Q71A 1FWCC 3D6NA 1O5RA 3KL0A 2VFFA 5AYZA 4UTTC 2ASHA 1CXKA 5LNRA 5CC7A 1JZ3A 3TIMA 4XAZA 1A0CA 2VDGA 4EXBA 2YL6A 3MVTA 4CD6A 2FTPA 3DFPA 1SJBA 3N2XA 4HN8A 2PDUA 3QFEA 1KM1A 2C0HA 1SFSA 2FPYA 5CLTA 1A3WA 2JKEA 2YLAA 1HKIA 1UCWA 2PP0A 3B0XA 1TZ7A 3OQ8A 3PY2A 4ZTXA 1UKPA 1PL9A 4QCEA 3IJ6A 1BXCA 2YZ5A 3PBVA 3LQGA 2DV0A 2X1IA 1GVFA 3KDNA 1T40A 3AALA 3ANYA 4N9CA 3IIZA 3LRLA 2PF0A 4IPIA 4FOJA 1LCOA 5TAOA 3BAWA 4PMJA 2VVNA 1YXYA 4MLJA 1YYAA 5IBXA 3QRHA 4DJED 4H04A 2PS2A 4DJDD 5C9RA 3K4WA 4JTDA 3TTOA 2DSUA 1Q85A 4JTLA 1W32A 4EWJA 3TQPA 4WUIA 3SCQA 3LHUA 4KW2A 2H90A 1BYBA 4GPNA 2XH7A 2G3MA 4KESA 4PEEA 3VKBA 3S1XA 3BLFA 2V6AA 2WBGA 3W74A 4E3TA 1CYGA 1S46A 3TSMA 5C7HA 3G77A 3AU6A 3BWWA 1KFJA 1JPKA 1PHWA 1PX4A 3OZPA 1VAHA 1JIBA 3QFWA 2V69A 5DN1A 3TFXA 1L8PA 3GWQA 4OUIA 4R9XA 2NLYA 3LY0A 1FHUA 1NQ6A 3EPOA 3CLMA 3T8LA 1KXQA 2PZNA 1L8NA 4PMYA 5CXPA 3DC0A 4LFYA 3FLUA 1KBBA 2V3DA 4W85A 4UR9A 2Q01A 1VYPX 1HP5A 2YA2A 4XBKA 1J10A 3IJ9A 4WX2A 5BRBA 4DB7A 1HVQA 2XPKA 2J74A 2CBIA 2ADAA 3P62A 2WKLA 4Q7BA 3RM8A 2CFFA 2VWTA 3SQMA 5FKYA 1R3RA 4NAFA 2XVKA 3EOOA 2XVLA 1V0KA 4TO8A 4WOZA 3GB6A 2Y8VA 3LXBA 2WKJA 4X63A 1GZ1A 1X96A 4FAMA 3LZ5A 3VX0A 1WDPA 4GK8A 2FQIA 1AQFA 4C6IA 6CGTA 3MPGA 5IDIA 2YDQA 2W6RA 4X9SA 1QWKA 4W8LA 4EF9A 4AUBA 1HF6A 2ZRZA 2IKGA 3WQFA 3DN5A 3GQYA 3NG3A 1G67A 3TWBA 1B3YA 4YTQA 3DG7A 5GJMA 4N0RA 3PJXA 1PX3A 1Q6RA 3EMQA 1JULA 2VC7A 1XGEA 5C2CA 2ALDA 4ORIA 4DJDC 3E6EA 3DHFA 3O0FA 1M1BA 1TPVA 4S3AA 2A21A 3USZA 2J75A 4S38A 3FDKA 4JIHA 2RGLA 3COTA 4QEHA 4LXFA 4H7ZA 3V75A 3Q67A 2CHOA 2BG5A 2EJ1A 1CT5A 1DL3A 3LGDA 3G3DA 4MNLA 1XLLA 2F2KA 4GXMA 1P0BA 5G4WA 2G3NA 5HNUA 1PWMA 2R8WA 2VOTA 3WX7A 3UA3A 3UG3A 4LBRA 2VR2A 3NOYA 4PUMA 1EJSC 2AL1A 2XN0A 1TVPA 1XYMA 3B9EA 1XUUA 1PZ2A 1ZU8A 3R5EA 2XM1A 3WQ4A 2QIWA 3AXHA 1RBAA 3ZT7A 3ITTA 3UWYA 3PTQA 2BS9A 4BF9A 4K8HA 3LTSA 4IP4A 1MFUA 2H8ZA 1OYCA 1HKJA 4H1ZA 4BA0A 1PS9A 1CDGA 3G6MA 1EOKA 5I3HA 1C8YA 1W0MA 4J3VA 4R53A 3IGSA 5EBAA 3B0PA 3TUUA 1JF6A 2XWEA 4EWND 4Y9OA 4H7VA 3LXCA 3PB2A 5G1MA 5U7SA 2O55A 2FH6A 3VGFA 5SWUA 1WAWA 8XIAA 2D0HA 3XIMA 4QS6A 2XFYA 3L23A 1CI1A 2C8NA 3BV4A 1RJRA 4MZ8A 2D2JA 2Y63A 1E43A 4QP0A 4AZCB 1C90A 2Y5SA 3UVIA 4HHPA 4ERAA 4B15A 4NF7A 4WDTA 1FX6A 2BXZA 4QHRA 1S1RA 2ZICA 2E5DA 2F9RA 1D7KA 4QLKA 1KM0A 3THCA 1EH9A 2EEXA 4PH6A 2DZTA 4O28A 5C9ZA 2B7PA 2YCEA 3W81A 3LCGA 2OO6A 3F7JA 1GYNA 4HQVA 4DN1A 2E6YA 1EJ7L 5HDRA 2JIEA 4B92A 2VM8A 4GXPA 4GNKB 3PFMA 4QNWA 1HL8A 1KGUA 4QR6A 2GUUA 1I9CB 4PTXA 3SUUA 3LCIA 1H7XA 3E0LA 5AYBA 1DIKA 4AY8A 4AWSA 1H61A 1OGGA 3P7YA 3L4ZA 1K4GA 1IXQA 4YTTA 4LTSA 1JPHA 3EX3A 4I5UA 2GZXA 3W27A 1LQ2A 1WZKA 3GTXA 4XD6A 2E6DA 4AD3A 1BKSA 5D9MA 3ZO9A 4GYFA 4G8TA 1D3HA 4LAKA 3T09A 4RK8A 1NFBA 1FCUA 3A3XA 1YE6A 2PP1A 2Z27A 7XIMA 3F4WA 1NWUA 3M0JA 1HZYA 1QPRA 4XAFA 3AIWA 4GFSA 1Q6GA 4IICA 3GIYA 3URBA 3UG8A 3URAA 4HZ8A 2YCKX 3SN4A 2QCNA 2PDKA 3O1NA 2HTMA 3WH7A 2IW0A 5D05A 1CB7B 4AXNA 1PJ9A 2XISA 3PAOA 3W84A 5LA1A 5C8BB 2Q8ZA 3GU2A 3NTYA 5DCEA 1GWJA 2YCLB 3CNYA 4EX4A 1C93A 1K1DA 6TAAA 4JTGA 3IJQA 1XV8A 4LV4A 2V81A 1E3XA 1K03A 3BAYA 4QJ1A 4HTBA 5BYWA 4O17A 1J5SA 2QDHA 4PB3A 2I7GA 5JVLA 2W92A 1EX5A 3RRAA 1TQXA 1S2AA 3QJAA 4IMGA 4Q8UA 4ZFMA 2WV8A 3PAJA 5BZAA 1W1PA 3BMXA 2VEPA 3C0QA 2VEFA 1WUEA 4JN6A 1YNQA 3G1SA 1W5PA 3OG3A 4DUXA 5KEZA 2VZUA 2Q3OA 4PFHA 1KRCC 1GORA 5AHEA 4BF5A 1I2PA 1GOKA 2BWGA 4ZGYA 2E67A 4PC8A 3EWUA 4B5TA 4HMDA 4FLQA 1GTHA 2OZTA 3H4WA 3T0BA 1QNOA 3QY7A 4RNHA 1X98A 4MFDA 4TQTA 4F0HA 3T1GA 4CCCA 4DWDA 1FQ0A 2O56A 1TSIA 3MDUA 2VXNA 4AD1A 4PCNA 3AIVA 5E6YA 1SZEA 2HBXA 1I0BA 3BMVA 1H50A 5BU6A 1Z7AA 1XH2A 3B40A 4B9ZA 3FA4A 4A8NA 4QDWA 4XO7A 3T44A 4L56A 1ZTVA 3WLLA 4B4HA 1PYFA 4XIMA 1JDAA 4LAZA 4UTMA 4EANA 1UWRA 3P0WA 1QPNA 2P53A 4JCMA 1H0IA 3LI1A 3FSUA 2AKZA 1Q4NX 4WF7A 4M56A 1GHRA 3SADA 3AS0A 3R89A 3FGCB 5XIMA 1XUZA 3PBMA 2PDWA 4RDYA 2XIOA 3NVTA 2BGSA 4AU0A 3DBPA 5IOBA 1QOXA 3M41A 2W79A 2ZE3A 2ZZ7A 4UNKA 1FKXA 3MCNA 4G7EB 2X1RA 1RK5A 4F9JA 1FTXA 1DJWA 1B1YA 4P7OA 1XYFA 3M0ZA 3N18A 4D6IA 1XSJA 2O92A 1LOQA 2EAWA 3TTYA 3GFYA 1OQFA 1QW9A 1JCYA 3ZT6A 3LG3A 3H8AA 3PJWA 3WNPA 2CLOA 4A8RA 4MB5A 1O4UA 2XGZA 4CCEA 4DWSA 3VMPA 1UWTA 2WJFA 1P0NA 3WQVA 3FIGA 4IFRA 4H8UA 5B7YA 5HBFA 4YHEA 3FY1A 2X0YA 3C0SA 4KMQA 4WSKA 4BWLC 3L2MA 2WMKA 3C52A 3UETA 3ABOA 2ZUWA 1JZ5A 4GZJA 3LTPA 1Y5VA 3GVWA 3NO3A 4RE0A 3PF3A 1F05A 2GSJA 3NQ6A 4C6CA 4UMCA 5A8GA 2BOFX 1W2PA 1GJWA 4FNRA 1QOPA 3PM6A 3GD6A 1VPQA 3C3UA 1JUEA 3WQ8A 4IG2B 1HIZA 7TIMA 3KBWA 1NDWA 4LUTA 5T9CE 3VXGA 2EPKX 4WY0F 4Y9AA 2OZ8A 2YJQA 4TXEA 4J3UA 2DZAA 2CHNA 4XD3A 1VHCA 1AD4A 5EU9A 4OKDA 4FS9A 3S9ZA 4R5EA 3A22A 1YDYA 5LZLA 5TD4A 1V79A 3WEMA 4DO7A 2FPVA 3AIRA 5CZTA 3FA5A 4FR6A 4QJ5B 4LBSA 1EGVA 4V28A 3B9DA 2RDUA 1ZBVA 2VC5A 3O16A 3LLDA 2ZTKA 4J35A 1VCGA 4U3CA 2ZRUA 1P1XA 1K8CA 3TJLA 5BROA 1A47A 3NZRA 2Z4GA 3W87A 1V0LA 5F1UA 2ZE0A 1AD1A 4BQ4A 2PDQA 5DT5A 3REQA 2VUNA 3CZLA 3NO1A 4A3YA 3CXOA 4KWVA 2IS7A 3INPA 1RQHA 3QV8A 2J7GA 1LBMA 1OB0A 1K8XA 3O0KA 4AF0B 2EPHA 4C90A 3QGVA 3BC9A 3IV8A 4D6DA 1XIFA 1RQEA 3FYYA 1VFSA 3S6OA 2UBPC 1C3FA 3AXXA 1KTNA 4AMAA 2RDWA 4MYAA 4LW7A 2QCLA 4JXCA 3WNLA 3GTIA 1QK2A 3KBJA 5K4XA 3VDCA 1TA3B 2E40A 4I9AA 3H70A 3WQDA 4FNUA 1TUFA 3DYPA 5A6KA 5A8NA 5MHBA 3GVQA 1A53A 3ONCA 2X42A 1F07A 2J9ZA 4HN4A 1NOWA 3S1UA 1V02A 5M03A 3IVSA 3M6DA 1MEHA 1LM1A 1RY0A 3TFCA 3UVAA 1QPQA 3S3GA 4B5VA 3QLLA 1HL2A 1S5VA 4UQDA 2XN2A 1T41A 4P61A 4KCTA 3VK5A 4OGZA 5A5WA 1LROA 3AMGA 2D69A 1MQRA 1UP0A 4F0MA 3BSHA 1TR9A 3S5ZA 3V0SA 2BOEX 2Z1WA 2E5CA 1SVDA 3DFTA 1V6TA 4ZODA 2BY2A 2AAAA 5A2CA 3EKZA 3ZM8A 2JEPA 4L1XA 2Z25A 4YPJA 1W1B1 4D9PA 3BLPX 1U5JA 1PYMA 4GVHA 4L4PA 1DJYA 2A5HA 4B5SA 4PCFA 2XN1A 5D9NA 4KIRA 4GJ1A 5F4WA 2VFDA 7ODCA 5AHFA 1OC5A 4U4MA 3ATYA 5CZKA 3FYOA 4A3HA 2HROA 1K02A 1UKQA 3RX3A 4AY1A 1W3TA 3TOPA 4F66A 4HCHA 4NJJA 1NJJA 1UWQA 4B3ZA 1D2KA 4HJFA 4F9DA 1DPMA 3TW7A 3EA2A 3CLWA 3W76A 2QJIA 5GVJA 3CS2A 3TR9A 1B2YA 3W22A 5ABHA 3FW6A 5FJUA 1R38A 1Z69A 1Q6OA 1KQYA 2W61A 1AQ0A 1EXBA 4UTUA 3WQ5A 5C54A 3P67A 3KFTA 1IEXA 1E6NA 4D8AA 1DXIA 3W1AA 5I3KA 3NPUA 3TN3A 2FJUB 1KM3A 3UYIA 1TJRA 2PGEA 3TMLA 1PZ1A 2HWGA 3NYDA 5F7UA 2SFPA 3W7OA 2YA1A 3GH7A 2FJKA 3BTNA 3CL6A 4H41A 4WKHA 5KMYA 3GXDA 1IXOA 4WJXA 3CZEA 1VKFA 1PXGA 1WKFA 3WK1A 1ONRA 3P3BA 3URQA 1QUMA 2OELA 4XX6A 7CGTA 3GO2A 2DP3A 4OWGA 2YYTA 3BARA 2GUBA 5DEZA 3U5YA 2FHBA 1MWOA 2WB5A 1EL3A 1H1YA 1U22A 3TN4A 4HPJA 3ZYZA 5H91A 4CU6A 3H6OA 4JEQA 3HFYA 3UBPC 2NWSA 1HGYA 4E2DA 5D33A 1WKEA 2XG9A 3WQOA 1EC7A 1VFMA 1RZMA 1XIIA 2B4GA 4MAZA 4O53A 3K8MA 4UQ9A 5C5YA 1DIEA 5FA5A 1TPUA 1FWNA 2V0TA 2XSXA 1IIHA 1JDCA 4Y90A 5B7ZA 3W29A 3LN3A 3C2FA 3B9NA 3M46A 3W28A 1OX5A 4PE8A 5D9OA 4HPXA 3STGA 3CO8A 3VU2A 4IPLA 4HOXA 2QZRA 5CZ0A 4XTDA 1SZRA 2WJZA 1AJ0A 3WDIA 1XLJA 4M1RA 4S3GA 4QEEA 4US5D 3WELA 2A3LA 1KB3A 1XC6A 4FEZA 3G5EA 1NP2A 2JGQA 2D3NA 3CJPA 1DWIM 1S39A 2ZX6A 3HURA 4PB5A 3BH4A 4L65A 4AXKA 4XZIA 3DI1A 3PBYA 3CWNA 4U2YA 2J7CA 4XO6A 3M0XA 3CHDA 3UR5A 4C1NA 1B31A 4UZUA 4MIMA 2GQ3A 3OVQA 1IIGA 1B90A 1NP0A 1W1ZA 1S2VA 3GNXA 5A2AA 2E68A 5K3VA 1IEIA 3BLOA 3M07A 3BZGA 1QI3A 3GZ3A 4KIEA 2R14A 4IMEA 4JIIX 4L4LA 4NUWA 5KZDA 3HMCA 4CQDA 1NSJA 1CCWB 4EOUA 5T8GA 1EDGA 2ZZ3A 1YNYA 4QCFA 3GDMA 4CQAA 3VC6A 3EWWA 2NV1A 1CXEA 2POZA 3TYDA 3C0JA 2ABAA 2E6AA 4NHVA 4UFHA 1SJCA 4F3HA 2A2IA 2WC4A 5EB8A 3BGGA 2OT0A 4UQAA 3LTYA 3QMSA 3MYPA 1K9FA 4FK9A 3TTQA 3AYTA 3G1XA 5A6MA 4FOKA 3W7EA 1AODA 4PUKA 1EP1A 1OF8A 1W3JA 2ESCA 3OEXA 3POHA 3GG0A 3WF2A 3L12A 3ITGA 3WK2A 2XFWA 4C5YA 2YSWA 3LERA 1E71M 3W37A 1RY8A 3AUJA 3MP5A 3MVIA 4IMFA 2WSKA 4N4PA 1Z48A 4O1CA 5CSUA 5CPOA 5DBTA 3KE0A 3U2CA 4MKVA 2DPEA 4TV5A 4UTWC 4WKAA 2CPUA 2XIIA 5CPSA 2Z1XA 4FXFA 4PTMA 4NNBA 4E6MA 1V0MA 4W7WA 1AW1A 4NL1A 1UHVA 1D8WA 2J62A 3B97A 3CZGA 1MW1A 1W9XA 2DUZA 2OFJA 1ONEA 2CIPA 3UT0A 1ODZA 4RNJA 3LK6A 3RPMA 2GJXB 3M0IA 1DJQA 4GLEA 2DIKA 4W7UA 3BW2A 2WYSA 3OBAA 1RLDA 3EWCA 1DBTA 4MGGA 4UTTA 2P1FA 1GVYA 1GJPA 1LJYA 1S2CA 3Q65A 2CNCA 2VT0A 4AZCA 2R1LA 1K7EA 3W25A 4JICA 1CLXA 2L5HA 1UBPC 2OQLA 4ML4A 4YWSA 3CK5A 3D47A 4M8UA 1DXFA 1CGYA 3W02A 2XDFA 2HRWA 1BVWA 1YHTA 3P82A 3B06A 3SBFA 3TWAA 1S3TC 4ZO8A 3W2JA 1H0GA 3APTA 2OYMA 3W7PA 2EO7A 3UG5A 4CQ8A 3TJIA 2E25A 3ZSTA 2WOQA 1G7UA 1SFTA 1Z8AA 3EKGA 1GEHA 3DGRA 4D1IA 3UZXA 3KL3A 4B5XA 5AC7A 1TJ1A 5J8LA 3WD4A 4V15A 1OFQA 2A3CA 1UQZA 2GVEA 3BK0A 5I07A 1J2BA 1AUSL 2FHFA 2NXIA 1IEVA 3VZXA 3SY5A 1V3LA 5I2UA 3SN0A 2NLIA 3NURA 4CN6A 3GY1A 3IGHX 1OINA 3EOUA 1N8FA 4HU8A 3N2MA 3UERA 1XLMA 1X7IA 3H24A 5HULA 2PRHA 1E70M 4K3ZA 3CIVA 2ACRA 1CGXA 5LGXA 3WMBA 1OCJA 3AICA 3JUGA 3TH6A 3GXNA 3UXLA 3VIHA 4TVCA 4JIEA 3GU9A 1UG6A 5HNNA 4JN8A 1H51A 3P8JA 3WF1A 3U4FA 2Z7KA 1L0PA 1E15A 1L2UA 4YNGA 2YXGA 1TX2A 1X6NA 3CV7A 4NG3A 1ALDA 5BXTA 1TUXA 1TV2A 3FSTA 2CLKA 4MKSA 2OTDA 2VZSA 1M04A 5CSYA 4P8VA 3ZQ9A 3PNZA 1GZGA 1VS1A 2YCLA 3E5BA 2G50A 3H55A 1TR1A 4Q7NA 4GY7A 2DUAA 4ACZA 3SCSA 4DM2A 5K2ZA 3AZRA 4IFKA 4GI8A 3QHMA 5DMLA 1VR6A 3KRBA 2QULA 4GX9A 2XVNA 4MMWA 1NDZA 4WJ8A 5REQB 2CXEA 3TA6A 1UZ4A 3HOJA 3PZQA 4BEUA 3L4XA 3URNA 3L68A 4NRRA 3NXLA 4HNTA 1CXIA 3O6CA 3PS7A 3PG9A 3U2ZA 1BRLB 4IIHA 4DVOA 3DFYA 1TV8A 2J4GA 7REQA 2FFIA 1I2QA 3PZVA 1K9EA 1S2TA 2GLKA 3EB2A 3LCHA 3EXSA 1EWDA 4W9TA 3K4AA 1E73M 4GYPC 3M44A 5EMKA 2RHGA 4N6EA 3FHQA 1FOBA 3ABQA 4BY3A 4HA4A 3W0KA 5JU6A 1XXXA 1FWIC 4GVFA 3AAMA 1A4LA 3GNDA 3BSMA 1JI1A 1GCYA 4N9EA 4PODA 2XIQA 2YPIA 1A49A 1T5AA 3CO4A 3QF0A 1I2OA 4GFIA 1OWQA 4H2HA 3VA8A 4DJDA 4WR3A 1E1FA 4JFVA 1S2UA 3N3MA 2X1TA 5M2FX 1MQQA 1CTNA 4AIUA 3LX9A 4DYJA 3YPIA 1UIPA 4GQGA 3UXKA 2BZNA 1MDLA 1M7JA 3BO9A 4RCXA 3UZ5A 3ORWA 3C2VA 1O95A 1N8WA 1QW7A 4HOWA 1FDZA 1ZY9A 2ISVA 5CJNA 1WYIA 2E0PA 1V3KA 1QPOA 4P8WA 4CD7A 4K38A 3MZ2A 3PUEA 4X0VA 3S6TA 1LRTA 3UG4A 2V5LA 4ILSA 3WLHA 3TCEA 2X09A 5CG7A 2PDGA 1CLKA 1YNPA 3AXMA 1EP2A 2HV5A 3W38A 1UR9A 3P61A 2FGZA 2JBMA 3XISA 3II1A 3GHUA 4AVOA 1MI3A 3HV8A 1Z6KA 2E8ZA 1SU5A 1SW7A 4R7JA 4BHYA 4ML9A 3A4AA 1UB3A 3CAQA 3LGEA 4FX7A 1OY0A 4HNLA 2EHHA 1M7XA 1RSCA 2AQOA 3A9IA 3SFKA 5CAHA 5CH9A 3C8NA 3PUGA 3PPCA 1AL8A 3I10A 2VENA 5EKYA 2GVYA 4AEOA 2ON3A 3GVVA 5FI8A 4NQ1A 4NZJA 2CW6A 4M19A 3WLKX 2J24A 3H2EA 2PAJA 4R85A 2PDYA 4D2JA 3MHUA 1ZAIA 3UESA 4HNNA 5RUBA 3DG3A 4M0XA 3GTNA 3RK8A 3QXBA 1W54A 2HXTA 5AC6A 3IIOA 1W5QA 5M5DA 4KWOA 2Y1HA 3KWXA 1OK4A 1VJSA 1XH1A 4ADUA 3THAA 4IG2A 3MKVA 1HL9A 1ICPA 3UEQA 1Q6QA 5D2TA 1JGMA 3VDBA 1XINA 3F4VA 3N1AA 4JS3A 2OX4A 4IISA 3ME3A 3IIPA 4OV9A 4PULA 4H6QA 5H8UA 5B80A 1NWSA 1XQLA 2EPNA 5LIWX 1VH7A 2A1YA 2VFIA 3QGAC 4H9MA 2NX9A 2GGIA 2PD9A 1TKKA 1YX1A 1EPXA 3T42A 1XLBA 3MTWA 2DZPA 3G1FA 1CXLA 4HGXA 4UFMA 5I79A 1S5MA 4HB7A 1FUYA 1V3HA 2ZX9A 4XZHA 5J04A 1XG3A 3NL3A 2H8XA 4Z1BA 3VGHA 5J5RA 1VBJA 2E28A 1CLVA 3MHGA 5IBXC 2W67A 5HINA 1KFEA 1YBQA 2C15A 2WVUA 5AKQA 3UZYA 3GSMA 3WQEA 3VD4A 3BOLA 2DT2A 5DMMA 3VD9A 2J7FA 3EWBX 5JQ9A 3HJZA 2QKFA 1GQJA 1FY6A 5BXPA 4GI4A 3VIPA 5FJIA 1JPIA 1AQHA 1E0WA 1OG6A 4XSMA 4XUYA 3WN6A 2QMJA 1HO4A 1KR1A 4RR4A 2ZC8A 3A24A 2PLJA 3A13A 1D9EA 1LLOA 4C6OA 1EPVA 1R3WA 2C13A 3IJLA 3SCTA 1IZJA 4S1FA 3ZR6A 2RJHA 4H3DA 3LNPA 2WMFA 1KQZA 4ZCWA 5FD0A 3W75A 3W7JA 2CC0A 3BCJA 1FCQA 2QJMA 4N42A 3UZWA 2XU2A 3W85A 4KGLA 4BQ5A 2Z1VA 4NSBA 1XGZA 4I8YA 3W7KA 3UPBA 4RZBA 4WD0A 4CEUC