3GW2A

Crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
RKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target MbR242E
rcsb
source organism Mycobacterium bovis
molecule tags Transcription regulator
molecule keywords Possible transcriptional regulatory arsR-family protein
total genus 28
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2009-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gw2A00
3H92A 3HRSA 2K7LA 2FEZA 1T39A 3E6CC 4R8HA 4PCQA 3PQJA 3HTSB 3DV8A 1V4RA 1XGOA 2KJBA 5D6EA 2L01A 3L7WA 5ILSA 1J5YA 1BI2A 4N0BA 3JSPA 4NB5A 4MTDA 5DD8A 2VBZA 2V1DA 3I71A 4CDGA 2BV6A 4AWXB 4A5MA 4CICA 2QLZA 3BY6A 3U2RA 2XRNA 2P6TA 3RDIA 2P5KA 4B8XA 5BOXA 2HOEA 2O3FA 1G4DA 2PJPA 5CLSA 2OZUA 2Q2EA 4BYYA 2OA4A 4OMZA 3V8KA 2QENA 2FSWA 2IVMA 3DKWA 4LD5A 1BI1A 4L18B 2XUBA 2IP2A 4JK1X 4KUMA 1R36A 2V9VA 3QPHA 3I64A 3RJPA 3ECOA 1SFXA 2G9WA 5H6RA 2DK8A 4I09A 5HDKA 2UWMA 5K5RA 2X0LA 3BJOA 3KLNA 2BYVE 3ULQB 4IXAA 2Q8KA 3ZMUA 5E1WA 5A2QZ 5JR3A 4EQQA 4A12A 1IXSB 2ACJA 2XKPA 5ICGA 2EV5A 2EB7A 1Z7UA 2FQ3A 5H20A 2HQNA 2O8XA 3GYHX 1XCVA 4HX7A 2FXAA 2STTA 2QQAA 2PN6A 3REOA 4G7ZF 1O3SA 3ROUA 1F9NA 1XGMA 1ZGAA 2XAGA 1EH7A 3C18A 4WXHA 1SD4A 1BN5A 2FNAA 1K7AA 3F3XA 3ZMDA 2A69F 4Q5SF 1I27A 4ESJA 4BNCA 2P4WA 4I0BA 1LVAA 3WTUC 3GFIA 2V1XA 2R7DA 4ESFA 4LFUA 4U0WA 1IN4A 1GXQA 1HXDA 1ZLJA 4ZH4F 1R1UA 4MQVA 5JI6A 1F4KA 4PZJA 3DFGA 3E6BA 4UVCA 3HSFA 4U0VA 5FO5A 5L3DA 4P9FA 4WF2A 3WTXC 2LF8A 3IWZA 3COAC 1KU7A 4EGYA 2Z33A 1NHAA 2G7UA 3LA7A 5H6QA 3V7RA 3EQLF 4Q4ZF 2RVCA 2O61A 2LSOA 1FZPB 4L9TA 2KIMA 3WGHA 4CZZA 1FY7A 2IRFG 4P96A 4ZZLA 3SZTA 3O2PE 4RAZA 3L9FA 4L5JA 2XVCA 1ZRCA 1B6AA 3EUHA 3QP5A 1RI7A 5D8LB 3N97A 4IJAA 4AD9A 1IRFA 3WTYC 2ISYA 1UHMA 4UVBA 3ZN0A 4OOIA 3DXJF 1XN7A 1FBSA 3RYRA 5JVTA 2W84A 3FM5A 5K5QA 1XMKA 1QO0D 1PP8F 4ZYEA 1AWCA 4KIBA 2ESHA 2DK5A 5K5OA 1XGNA 1R00A 4IHSA 1TNTA 5LRSA 1FNNA 3ECHA 2XKOA 2VONA 1BI3A 3SFZA 4MEXF 4M72A 2IW5A 4GCVA 1MZBA 1W7PB 3KETA 4Q48A 2FE3A 1XB4A 4U7BA 1XGSA 2PEXA 3M8EA 3HRTA 1TQPA 3HIFA 1MJ9A 1FLIA 4DNCA 4ZYGA 2K27A 2M1BA 3ZMTA 4DQ2A 2YX4A 4M73A 4CGZA 1REPC 4O6JA 2DTRA 4YFXF 3KP7A 3W6JB 3FWEA 1UCRA 1XSXA 2DLLA 1D8JA 2ZJ2A 3NRVA 1HSTA 2UXXA 5HOOA 3J80Z 3WTWC 3P9KA 5L3GA 2JRTA 3I54A 5F6FA 4LLNA 3QAHA 2A3SA 4OINF 5D8KB 1LQ1A 1MDMA 4KICA 1MD0A 1DP7P 2QBYB 1G6NA 4LG0B 1QNTA 3KP6A 1YG2A 1S29A 1DDNA 2RKHA 3LFKA 3RPUA 2JZYA 4P9UA 5JFRA 1CGPA 3ZQ7A 3PQKA 2OBPA 3I0TA 2Z99A 3FXRA 2R3SA 1T2KA 2DQRA 4A6DA 2O03A 3E5UA 3TKYA 2ZNYA 4HLXA 3K2ZA 4HW0A 2PI0A 5DV5A 1ON2A 4EJUA 1SFUA 2A6HF 3T8TA 3BDDA 4ETSA 3U1DA 3F8MA 4KDPA 4LK1F 5FD6A 1JHHA 3HHGA 3OOPA 4EM1A 4HDUA 2PG4A 3B73A 1R1TA 3P9IA 2V6CA 3T0YA 1IN6A 3FMSA 5HDGA 1U5TB 4A2UA 4L0YB 2MLKA 3TO6A 2VC1A 1IZ1A 5E8GA 3SQNA 1ZREA 3EDPA 2FMYA 4UHTA 3T5XA 5F64A 2VOOA 4OU0A 4ON0A 2E7WA 5DCFA 1LNWA 3R61A 4RGRA 3H3ZA 4LJZF 1KYWA 4A0ZA 2Z3YA 2TDXA 3ABTA 4ENJA 4UV8A 4HBLA 2LDUA 2O6GE 2A61A 4KMUX 1U78A 5HS9A 3QPTA 4MQ9F 1KYZA 1EH6A 4XSZF 2KIUA 4LGWA 3F8CA 4KMFA 3SXYA 4M9SA 3HOSA 2P5LC 4A5NA 3BROA 4BHPA 2Z9OA 4P55A 2NNNA 2DO7A 2EFQA 2FA5A 4KIFA 2MBFA 3LWFA 5FFXA 1SD5A 4N9IA 4RB2C 5LGUA 2Y75A 4XBFA 4HF1A 4G7OF 5ICFA 1LJ9A 3ISPA 2ZNZA 1MJAA 1KU3A 3CUOA 5E1ZB 1QQIA 3IRRA 2GAUA 5LLQA 3GXOA 3IRQA 2DPUA 3G73A 2XAHA 5BQTA 4YFNF 5TRDA 2XASA 1OMIA 1HKSA 2LNBA 2A5YB 1O3TA 2PMHA 3FF5A 1FP2A 4WWCA 3DQVC 2VE8A 2G7HA 4XLPF 5KVRA 4YIFA 4RB3C 2QQBA 4LMYA 1UB9A 2WV0A 3JSOA 4KFCA 5E18F 3GEZA 4M74A 1XSDA 2XIGA 2E7XA 1ONVA 2IA1A 1J59A 4G6DA 4IRIA 3CUQC 1IF1A 1ZG3A 5LRRA 1KA8A 4MTEA 4WK8F 2K4BA 2W57A 4HYEA 4UXNA 2L4MA 3IC7A 1V3FA 3M1EA 4UVAA 2E1CA 5JHUA 2NAZA 3CUQB 1U6GA 4BHCA 3QU3A 4M9XA 5IT9Z 4KT5C 2WC2A 4HAMA 3IHUA 5LGNA 4M9ZA 2NYXA 2QUFA 4PDKA 3BPVA 4KA4A 2RNJA 5DYMA 1DUXC 3J7AO 1IN7A 3DPLC 1T98A 2RV8A 3DPTA 1HBXG 3N4MA 2HQRA 4O3MA 3F6OA 4QLCU 1ZLKA 2JTVA 2BGCA 4G6QA 1L0OC 1WWXA 3HHHA 3K69A 3VODA 2XAJA 3AAFA 4RB1A 4BH9A 1QZZA 1TQIA 3KP4A 1FP1D 2M87A 3I59A 1ZYRF 3GZ5A 1LEAA 1SAXA 2M30A 1D8KA 3MCZA 5HS8A 1P4WA 1OKRA 1IN8A 2RDPA 3HOTA 3BP8A 1YIOA 2QWWA 4I98B 3CO7C 3MZHA 3ZMZA 3SHFA 4YFKF 1G3TA 2CSOA 4Z2YA 3HTUA 1R22A 4HDVA 1YLFA 2J5PA 1TQMA 3J81K 2RQPA 1TBXA 4Y17A 2H94A 1BIBA 2GZWA 2IJLA 2YSRA 4F7ZA 2UXNA 3QRFF 1USTA 3V7CA 1PUEE 1J0RA 3WE3A 2VN2A 4A6EA 4EMSA 3L00A 2R7FA 1RUOA 1LB2A 1S8NA 4IRGA 1T38A 1G3SA 1YW8A 1HKQA 3O3KA 1J9IA 2ISZA 1LDJA 1R1VA 2P7CB 5D4SA 2D1VA 1RNLA 2MA3A 1YS6A 2YU3A 1UFMA 4L9NA 2ZMEB 3WG9A 5HDNA 3V4GA 5DUKA 5DCMA 1DPUA 1I5ZA 3P9CA 3F6VA 2HEOA 3M9AA 2RC4A 3KZYA 2KIFA 4EJOA 4L5IA 3R0AA 2COMA 1HW1A 2BEOA 5FGMA 1EV7A 1R7JA 3HSEA 2VBWA 2H27A 2EV6A 3CUQA 2QM3A 2QQ9A 1R58A 1JHFA 3WGIA 1O3RA 1SMYF 4L9JA 2CWEA 3KCCA 2L02A 1L3LA 3QOPA 5HVQC 3L2CA 1Z05A 4I2OA 2VBXA 1B1BA 1S6LA 2CGPA 1QPMA 1TTYA 2QVOA 2MLGA 5J8FA 5DCMB 1E2XA 4KNYA 4OIPF 4O5VA 5CVUA 2PBIA 1J2XA 1BI0A 2DQLA 1B9NA 4ZYDA 2RN7A 1MJBA 1TW3A 4M71A 4HX4A 1SD7A 3V8JA 1HSJA 1HW5A 1B9MA 2F5CA 1BIAA 3KZZA 3LQQA 3KP5A 2P6SA 3I58A 4JBAA 3E5XA 1GVJA 2MH9A 4LLLA 1YO5C 3R6SA 4CXFA 2IPQX 3BJ6A 3G3ZA 1IN5A 2D2WA 1ON1A 5FLXK 4E70A 4WXCA 2Y48A 1W7PA 1K78B 4ASNA 1LDDA 1I1SA 4L0ZB 3LA3A 3GFJA 4UUVA 4S04A 2HTJA 3D0SA 3GW2A 2VC0A 1BJAA 1ZARA 2CFXA 1RZ4A 4HLYA 3HRMA 1WSUA 4G94A 1ZAOA 4G7HF 2DAOA 3KP3A 5E17F 2PQ8A 2ZCWA 3QU6A 5DEQA 3K9TA 3P7NA 1OYYA 5CVVA 3ZMSA 3CLOA 2F2EA 5BPDA 3TDUC 1TLHB 2CW0F 4RAYA 4GYGA 3J80K 3FZVA 2NNYA 2H6BA 4RS8A 5ILUA 3ZN1A 3V8LA 2ADUA 4QWQA 3ZPLA 4LK0F 2GIVA 2XV4S 4AVPA 2K4JA 4IPAA 1A04A 3ML6A 2GA2A 2FBIA 4NHJA 4OIQF 5HS7A 5ED4A 2OQRA 3NEUA 2VXZA 1BM9A 3TO7A 2P8TA 2K86A 1S3JA 1WKMA 2OQGA 3IKVA 2FRHA 4IVNA 4G8XA 1W5SA 4FHTA 5FB2A 1ZG1A 1CF7B 2OD5A 1QZYA 3E97A 2F5FA 2PMUA 3RIRA 3KFWX 4HV6A 1RUNA 5ICCA 4CO8A 2M5WA 1K6OA 2PLYA 2VT3A 4FX0A 3K0LA 4G9YA 4ENMA 3F21A 3RI4A 2FBHA 3I5UA 1MGTA 2GA1A 3VEPA 2HZTA 1P2FA 3WTSC 3F8NA 3CDHA 3OV8A 2W24A 1OR7A 5AIQA 2EJRA 2HYFA 4I7HA 1FYLA 2HS5A 2F5DA 2YPRA 4XLNF 4M6XA 5D4RA 1FBQA 5CJ9A 4GYIA 3WTZA 3R60A 5BPIA 2STWA 2J5OA 1WRJA 3GZ6A 1FC3A 4KN4X 1D5VA 3ELKA 2QBYA 1MKMA 2PFBA 3RYPA 1TNSA 2H6CA 4AIHA 4BXUA 1GHCA 1UHWA 3GLXA 1WQ2A 1XDSA 4PGGA 1KU9A 4RB0A 4FT8A 3EYYA 3TDZC 3F23A 1YFHA 4PGHA 2KJCA 2ZMEA 2ZXJA 1JXSA 3S2WA 1B59A 1B4AA 1KQ9A 2EFOA 2M8EA 2GXBA 3IKTA 1XSVA 4WCGA 4GXOA 1P4XA 4U88A 1K78A 2C6YA 2L54A 6PAXA 3DEUA 3F8BA 3BZ6A 2W85A 5E8IA 2MH2A 1FPQA 3PFIA 3QP6A 3TGNA 1HW2A 2B0LA 2FMLA 2QYOA 1IXCA 1Y0UA 1SFEA 4RGUA 2BBYA 3U9GA 1H9GA 3FMQA 5DUIA 2YX7A 4H0EA 4R1HA 1MDMB 1O3QA 3KEOA 1T6SA 1USSA 3EETA 5L3CA 1XDUA 1CF7A 4S05A 2ZFWA 3K1NA 2AXLA 4EJWA 3M8FA 5EEHA 3K1MA 3JAMK 1IAWA 1D3YA 4IRHA 3EYIA 1FX7A 3KP2A 5FLXZ 3O6BB 3I4PA 1IW7F 3MEXA 5CVRA 2Z5UA 2K02A 1Q1HA 2A68F 2GWRA 2HKXA 1RIOH 4LG0A 2P7VB 4XSXF 2A07F 2L3DA 3TOBA 3RTRA 3WTTC 1OPCA 2UZKA 4EM0B 4WXDA 4RGSA 2XGXA 2MC3A 1TW2A 2RGVA 1P92A 3F8FA 2DU9A 1K79A 2JPCA 2ZO4A 3L09A 1YS7A 2HWVA 2VBYA 3WE2A 2OAZA 2EWNA 3TO9A 2L4AA 2O0YA 4OIOF 2CYYA 2FBKA 3C7JA 4K2EA 2X4HA 1BOAA 1H9TA 3I59B 5FD5A 4HQEA 4CYDA 5KK1A 2HKOA 1IRGA 4HV5A 2BE5F 3K1PA 5D5WB 1XD7A 2GXGA 3JW4A 3FXUA 2ZKZA 2Q0OA 1QBJA 3F72A 4ZYHA 1G3WA 2NRAC 2FNPA 4HX8A 1XCBA 4A0YA 2W25A 1Z9CA 1C0WA 4M6YA 3LA2A 4LLGF 1FSHA 4MHGA 4FX4A 1ZRFA 1IXRC 1LDKB 2LF7A 5LHGA 3GO5A 3BOQA 4IHTA 2HFHA 3FX3A 3LAPA 5HLHA 2Y0MA 3T8RA 3Q5FA 1PDNC 3ZP5A 4EM2A 2DBBA 1KQ8A 1R5HA 1BBYA 3E6MA 2DI3A 3C1DA 4BQAA 1OYWA 3JTGA 1ODDA 1YYVA 3KLOA 3R4KA 5LHHA 2YR2A 1IUYA 2EFPA 5ICEA 2HYGD 1S7OA 2VODA 3VB2A 3RPQA 4MGRA 4N9HA 4HA8A 2CO5A 1PP7U 1XMAA 5D5VB 4BHBA 2DW4A 5LEKA 5LHIA 1ZRDA 4OIRF 1R23A 3Q9VA 1GXPA 1AOYA 1BC7C 1WI9A 3DF8A 2NS0A 2DPDA 3TOAA 3HYIA 2HTSA 2WWYA 1O7FA 3HSRA 1STZA 5AIPA 2DT5A 1Z1DA 1FSEA 5DD4A 5A2QK 3RKWA 2XAFA 2CG4A 3VFZA 4U0YA 2KKOA 3MQ0A 2WTEA 2HR3A 4D0PA 4I0AA 4ENNA 2JT1A 2D1HA 1E17A 2E1NA 2JSCA 3ERED 2EV0A 5AONA 1U2WA 2OZ6A 1SD6A 2IT0A 2FF4A 4CHUA 2EA2A 4B09A 1O7LA 1U3EM 1R5GA 1ZHFA 1ZN2A 3TQNA 5D6FA 1J75A 3C3WA 3ABUA 4KYWA 1FOKA 1ZH5A 4ZZDA 3E5QA 4UNOA 5L3EA 3V7SA 1FT9A 3MZYA 1W4MA 5D5UB 3KEQA 4TV7A 2DFIA 3HRUA 4BAYA 2ETHA 5J8CA 1G3YA 1Z6TA 2VOPA 2ELHA 3E3VA 4R79A 3I53A 3B02A 2CQKA 2H09A 3ZMVA 5L3BA 3WU1B 3D5LA 1OYIA 4I02A 2MD5A 1FWZA 3GFLA 4KIGA 4LB6B 1HQCA 3SZPA 3J81Z 4HQMA 5ILVA 4MNUA 4UV9A 3GUDA 1W5TA 4I01A 3MFKA 2KRFA 1P4AA 5CVJA 3GVAA 3NQOA 5CVIA 4EJTA 4IF4A 3FHZA 3RKXA 4GO1A 2HDCA 4HF2A 1J7KA 3HUGA 1F5TA 2A6EF 1U5TA 2QZ8A 1VTNC 2F5EA 2XHKA 4U7DA 4YG2F 1YW7A 4HF0A 5ERIA 4Y13A 2IA0A 4EJVA 3GFMA 3BPXA 3M7GA 4YIIA 1LEBA 4EGZA 1X3UA 3BWGA 2JPBA 2EFWA 2XROA 4P5OA 3GF2A 4AIJA 5IT9K 2AS5F 2VT2A 4MEYF 3FXQA 5HLGA 2HGCA 3IWFA 3KE2A 3MWMA 4WX9A 2D45A 4Y15A 3CJNA 3LAJA 2ZBKA 1P6RA 2FOKA 4ENKA 5LEJA 4LB5A 2EK5A 1U5TC 3JAMZ 1ZG5A 2V79A 1KQ0A 3MAJA 1FBUA 1ZGJA 1I1GA 3E6DA 1KGSA 5DDGA 3R0JA 4JQFA 4HZFA 2EFNA 4ESBA 5HLIA 2FU4A 3VOEA 1ULYA 1I6XA 3F22A 3Q9SA 3RKYA 4AIKA 1Z6RA 1S7AA 1FYKA 3WU0A 3LQRA 5FFZA 3WODF 4HOBA 5EEGA 5TJJA 3CTAA 2OU2A 4A0XA 5BS6A 1F1ZA 3CO6C 2M45A 4L9VA 2EA4A 2XAQA 1SMTA 4Q47A 2ESNA 1YQAA 1QGPA 2GQQA 1Z91A 4RGXA 3W6KB 4KN7X 1H0MA 4GGGA 5E1XA 5J6XA 3JTHA 1BC8C 3BJAA 3FMRA 5K1YA 3GX4X 3H3UA 1FYMA 1W7PD 3IL2A 3DP7A 2LKPA 1DPRA 2IA2A 4EV0A 5LBQA 5IT3A 3FM3A 5D5XB 3LSTA 3GWZA 4XRFA 5F1RA 3T1BA 4EVIA 1YW9A 5L3FA 4OMYA 3WTVC 2VE9A 5BMZA 4NQWA 1U8RA 1T0FA 5CYVA 1EH8A 5E20A 1O57A 2V1UA 1HKTA 1YTYA 1JGSA 2P5VA 5LGTA 3WGGA 1KU2A 1JE8A
chains in the Genus database with same CATH superfamily
3H92A 3HRSA 1OCTC 4YRVA 2K7LA 2FEZA 2HOTA 1T39A 3E6CC 4R8HA 1MSEC 4PCQA 3PQJA 1ZR2A 3HTSB 2GIZA 2NVXJ 2R7OA 3H5RA 3DV8A 1V4RA 2Y31A 1XGOA 1WJDA 4M3BA 4V2GA 5BNGA 1VQ8I 2KRCA 3HOZJ 2HXOA 1NG7A 2CJJA 2KJBA 5D6EA 2L01A 3ZR8X 4XKCA 3AKZA 3S32A 3L7WA 3PIPF 2HNHA 2X85A 4M3DA 5ILSA 1J5YA 2F4IA 4BJ5C 1Z67A 1BI2A 4A3JJ 1QU3A 4N0BA 3JSPA 4NB5A 4MTDA 5DD8A 1MBJA 2VBZA 5M3MJ 4QIWN 2V1DA 2L0KA 3I71A 4CDGA 1R6RA 2M34A 2BV6A 2ZSHB 2JUGA 4AWXB 4XMYA 4A5MA 4CICA 2QLZA 3BY6A 1EJ9A 4FISA 4XOPA 4Y3OA 2DOFA 1IRZA 2LRDA 1D0YA 2ECBA 3U2RA 2XRNA 4KITB 2CUFA 3H0GJ 3HOWJ 2P6TA 2DDBA 2R4GA 3RDIA 2P5KA 4PK4A 4JP0A 4B8XA 5BOXA 2HOEA 3JREA 2H8RA 1T0FC 2O3FA 1G4DA 2PJPA 2KHMA 5CLSA 4DW6A 2OZUA 2L9RA 1QPIA 3H9QA 1SFKA 1KONA 2Q2EA 4RAGA 4BYYA 2OA4A 4OMZA 3V8KA 2VASA 2QENA 5CQEA 3G1MA 2FSWA 2IVMA 2L5QA 3AFHA 3I4NJ 1Z7LA 3DKWA 4LD5A 1BI1A 1MNDA 4L18B 1ERDA 1X3ZB 2XUBA 4J00A 1OCCH 1BW5A 2FOWA 2IP2A 2RNGA 3H5AA 3J7ZI 3JRCA 4JK1X 4KUMA 1R36A 2V9VA 3QPHA 2M3AA 2BHZA 5DTDA 2VKHA 1YOVB 3BQZA 5M5WJ 4XLCA 4E7IA 3I64A 3RJPA 3ECOA 1SFXA 5J1RA 3PL8A 3OY9A 2GOMA 2G9WA 5IOYA 3ABKH 2HVQA 1QHGA 5H6RA 2DK8A 4I09A 1UELB 1MMAA 1JKOC 5HDKA 1JUSA 2UWMA 3VYSB 3WG7H 4PJMA 5K5RA 2R5ZA 3CF2A 4DYRA 2BY3A 2X0LA 3HBLA 3CDLA 2LK2A 3BJOA 4GDFA 1DGRM 3KLNA 2BYVE 3CCSI 3ULQB 4ZDLA 2IGKA 4IXAA 2Q8KA 3D5RC 3ZMUA 5E79C 5E1WA 2KPMA 2RREA 1Y39A 3A2KA 2OCEA 5A2QZ 5JR3A 1HOMA 4EQQA 4A12A 1IXSB 4F93B 2ACJA 2XKPA 5ICGA 2EV5A 2EB7A 1Z7UA 2FQ3A 5H20A 3G1OA 2HQNA 2O8XA 3GYHX 4LITA 1XCVA 4HX7A 3CCQI 2QSGX 2FXAA 1UZCA 3OL4A 2STTA 2QQAA 2PN6A 3NWSA 3REOA 4BE0A 1Y8RB 4G7ZF 1O3SA 2F5VA 1S72I 3ROUA 1F9NA 3L2QA 1YX3A 1XGMA 3KYDB 1ZGAA 2V1NA 2XAGA 1EH7A 3C18A 4WXHA 1SD4A 4XICA 1BN5A 3BTCA 1MSFC 2FNAA 2B63J 1K7AA 3F3XA 3ZMDA 2A69F 3OSFA 4IX7A 4Q5SF 4N4NB 1I27A 4ESJA 4BNCA 2P4WA 1BW6A 3TBIA 4I0BA 1LVAA 4CCMA 1PUFB 3HL2A 4IZZA 1ZK8A 3WTUC 4XKVA 2KL4A 1FMVA 3GFIA 2V1XA 4XLEA 2WAEA 4PSXA 2R7DA 2XPWA 4ESFA 4LFUA 1Z21A 3HPGA 4U0WA 2CQNA 1IN4A 1I3QJ 1GXQA 1HXDA 2FQ4A 1G59A 4E7LA 4PJNA 1ZLJA 4ZH4F 3CZ6A 1R1UA 4MQVA 5JI6A 3S1MJ 3F0CA 1F4KA 4PZJA 3CESA 3DFGA 3GTMJ 2V26A 3E6BA 4UVCA 2JVHA 2JJ7A 2X1EA 3HSFA 3QWLA 4U0VA 5FO5A 1NK2P 1ACIA 1WGXA 3LSPA 5L3DA 4P9FA 4WF2A 1XX5A 3WTXC 2LF8A 3IWZA 3CCRI 3FXMA 3COAC 1KU7A 5EZHA 4EGYA 2Z33A 2PX9A 5JVGF 1NHAA 2G7UA 3LA7A 5H6QA 3V7RA 2PJRB 4B3XA 5J1UA 3EQLF 4Q4ZF 5JHFA 2RVCA 2O61A 1W5CC 1NH3A 2LSOA 1FZPB 4BL0B 4L9TA 3BG7A 3KX2A 3QQAA 4C3IJ 2KIMA 3KPHA 3WGHA 1FY7A 4CZZA 3DBHB 3DEWA 3HDDA 2IRFG 1XPXA 1FIPA 4P96A 4ZZLA 2IS4A 3D1NI 3SZTA 1ZKGA 2DTZA 3O2PE 1X19A 4RAZA 1RKWA 3L9FA 3RSNA 4L5JA 1WJCA 3CC4I 4XOTA 2XVCA 1ZRCA 4DJAA 1HLVA 1B6AA 3EUHA 2VPRA 3QP5A 1RI7A 5D8LB 3H0DA 1N77A 1ZTRA 3N97A 4IJAA 4AD9A 1SANA 1IRFA 1R4MB 3WTYC 3OYJA 2ISYA 2CV1A 1UHMA 4UVBA 3LSKA 2M0CA 2KP6A 3W2VA 5F27A 2N8GA 5IP9J 3ZN0A 2DA2A 4OOIA 4JX6A 1SVMA 3DXJF 3I55I 3S15J 4XRSA 1XN7A 1FBSA 3RYRA 5JVTA 2W84A 4IEJA 5C44J 1FOYA 3DKYA 3FM5A 5K5QA 3MKYB 1XMKA 1QO0D 4Z6YA 2JA6J 1PP8F 2FX0A 1MBHA 1TP4A 3LSMA 4ZYEA 2JMWA 1AWCA 1TWHJ 3OMYA 4KIBA 2ESHA 2DMQA 2ELJA 1X1DA 2DK5A 5K5OA 3UKGA 2IGMA 2X9DA 1TWFJ 1XC5A 1XGNA 1XMXA 3ZXSA 4AC0A 2LD5A 1R00A 1R49A 2DA3A 4IHSA 1TNTA 4YIRX 5LRSA 4JX4A 1FNNA 3ECHA 2XKOA 3HOXJ 2VONA 1JUPA 3PSIA 2KRHA 1XG1A 1IRXA 2ZFUA 1YITI 3ZQIA 1OLTA 4V19K 1VQNI 2WAQN 1BI3A 2DFEA 2IW5A 4M72A 4GCVA 3SFZA 3K4NA 4MEXF 1MZBA 1W7PB 4PUSA 4EATA 2WA0A 3KETA 4Q48A 2FE3A 4A3LJ 1XB4A 4U7BA 1XGSA 2PEXA 3HKZN 1E3OC 3M8EA 1TWAJ 2DOEA 1O4XA 3HRTA 1TQPA 3ESWB 3HIFA 1YRNA 1MJ9A 3F9KA 5DS9A 2BXZA 1FLIA 3K4KA 4CZCA 4DNCA 1G2HA 4IQ4A 4ZYGA 2K27A 1P7JA 1ETQA 3OYKA 2M1BA 3ZMTA 4A3IJ 4LG3A 2CUJA 1ZELA 4DQ2A 4XRMA 4ZTFA 2YX4A 4B4CA 4M73A 4CGZA 2LH9A 1REPC 3ABLH 4O6JA 1VFCA 3B6AA 1EF4A 4XR6A 2DTRA 3M8JA 5GTHC 2KDOA 4YFXF 3KP7A 2MSYA 3W6JB 3FWEA 2BY0A 1MH4A 3HC7A 2KIQA 1UCRA 1X2MA 1XSXA 3EUAA 2DLLA 1D1AA 3OYEA 5CPRB 1D8JA 2AO9A 2EINH 2ZJ2A 2ZSIB 2CH0A 2DA1A 3NRVA 4GRIA 1HSTA 4BJTA 5GAEJ 2DT6A 2UXXA 2IS6A 5HOOA 3J80Z 3WTWC 2X51A 3P9KA 5L3GA 4I76A 4AU7A 2EILH 2JRTA 3IH4A 1IC8A 3I54A 5F6FA 3VPRA 2IS2A 1X4OA 2HPIA 4LLNA 3QAHA 5K7ZA 3LSIA 2EQRA 2UV1A 2A3SA 1IV6A 1IDYA 3WHCA 4OINF 5D8KB 1LQ1A 1MDMA 4KICA 2E1MC 1LKXA 1MD0A 2YS9A 1DP7P 2QBYB 2VJ4A 1G6NA 4KISA 5DM7F 1QNTA 3KP6A 4LG0B 1YG2A 3PFYA 3MMYB 1S29A 5J3LA 2QKLB 4S0HB 1DDNA 3HG9A 2RKHA 1APLC 3LFKA 3BR3A 5FKOA 2F4MB 3RPUA 2JZYA 4P9UA 3CCVI 4BQNA 5JFRA 1WH7A 1CGPA 2IAIA 3ZQ7A 3PQKA 3OR2C 2OBPA 2RAEA 3I0TA 2Z99A 3FXRA 2R3SA 4UUSA 1T2KA 2DXIA 2DQRA 3HEFA 2X48A 4A6DA 2O03A 2YUSA 3E5UA 3TP0A 4A93J 3TKYA 2IEKA 4NC6A 3FXKA 2ZNYA 3J7YJ 3CMYA 4ZDOA 4HLXA 1Y56A 3OSGA 3JCUC 3K2ZA 4HW0A 5KHDA 2PI0A 2AHQA 4A3BJ 5DV5A 1ON2A 4EJUA 1SFUA 2A6HF 2E1MB 2KZVA 3T8TA 3BDDA 4ANJA 2VKVA 4ETSA 4X6AJ 2E36A 3U1DA 2VQHA 3F8MA 3D5SC 2KISA 2WB1N 4KDPA 1W1WE 4LK1F 1YIJI 3A1YA 1POGA 5FD6A 4UB6C 1JHHA 3HHGA 2QEXI 2XC7A 2CV2A 5TISC 3LSRA 3OOPA 4HNVA 3L2UA 4EM1A 3BQYA 4RM2A 4HDUA 2PG4A 3B73A 2W1OA 1R1TA 3P9IA 2V6CA 3V42A 3T0YA 1IN6A 3FMSA 5HDGA 4J19A 1U5TB 4A2UA 2CUZA 2CQ7A 4L0YB 2MLKA 3TO6A 1A36A 2VC1A 2NS8A 4OAZA 4XQFA 1IZ1A 1S7EA 5E8GA 3SQNA 1ZREA 3K4MA 3EDPA 1IJWC 1V5FA 3J7AY 2FMYA 4UHTA 3T5XA 1MNEA 2HZDA 5F64A 1AKHB 3IV5A 2HQ5A 3PNYA 2F48A 3C2HA 2VOOA 4OU0A 4ON0A 2G0EA 1V5GA 2E7WA 4HPQA 1LNWA 2AXTC 5DCFA 3R61A 2DMNA 4RGRA 2COBA 3H3ZA 4LJZF 1KYWA 3CMAI 3I3LA 1OCOH 3SFIA 3JR9A 3OR1C 1U8BA 4A0ZA 2Z3YA 2TDXA 2AQEA 3ABTA 4ENJA 1CQTA 4UV8A 4M3EA 4BE1A 4HBLA 4HG2A 2LDUA 1JJ6C 2O6GE 2A61A 4KMUX 1U78A 1T8IA 3HGYA 5HS9A 3QPTA 4MQ9F 4FE7A 3PIOF 1KYZA 1WVRA 1QVUA 2I5UA 1EH6A 4XSZF 2KIUA 4LGWA 3F8CA 4KMFA 3S1QJ 5TGTA 3SXYA 3BG3A 4M9SA 1N25A 2L7ZA 5CQGA 3HOSA 3GLLA 2JSPA 3A03A 4CCKA 2P5LC 2RQQA 4A5NA 1VZ0A 2F4OB 3M3YJ 3BROA 4BHPA 1B8IB 2GOXB 2Z9OA 4P55A 2NNNA 4LIVA 2DO7A 2EFQA 2FA5A 2Y2ZA 2MBFA 3LWFA 4KIFA 5FFXA 1SD5A 4N9IA 4RB2C 5LGUA 2ZXIA 4UUTA 2Y75A 4XBFA 4HF1A 2HVSA 3S2DJ 2CUEA 4E7ZA 3JRGA 1Y1WJ 4G7OF 5ICFA 1LJ9A 1YJWI 3OIOA 3A02A 4NBQA 3ASNH 3ISPA 2ZNZA 1MJAA 2XGEA 3CP2A 3SEZA 1FTZA 3DWLE 1KU3A 2M9HA 3CUOA 5E1ZB 4FE4A 3JRBA 1QQIA 2Y9YA 3IRRA 2HU9A 2GAUA 5LLQA 3GXOA 1F36A 1IV8A 3IRQA 2DPUA 3Q0WA 3ZQFA 2R7SA 1MW7A 3G73A 2XAHA 5BQTA 1X3WB 4YFNF 5TRDA 2XASA 1OMIA 4NC7A 2DODA 1VQ5I 1HKSA 2LNBA 3CCEI 1QA6A 2A5YB 2BY1A 3GMEA 2K9LA 1O3TA 2PMHA 3WU2C 4XKWA 3FF5A 4FETA 3I56I 1FP2A 3G4SI 4WWCA 3DQVC 1SEUA 2VE8A 2O5RA 3ZRGA 3E1SA 2R7WA 1OISA 2G7HA 4DYCA 4XLPF 5KVRA 4YIFA 1ETXA 3FXOA 2ZJRF 3Q3SA 1GVDA 4RB3C 2QQBA 4LMYA 1UB9A 2EZLA 1LVKA 2WV0A 3JSOA 4KFCA 1V54H 2XF7A 5E18F 1SVLA 3GEZA 4M74A 1XSDA 2XIGA 2E7XA 3CF5F 3AL0C 1HF0A 1ONVA 3ASOH 3DU5A 1QHHD 2ZXHA 2IA1A 4W97A 2QF7A 1J59A 4G6DA 1WHUA 4IRIA 3CUQC 4BGDA 2JWTA 1IF1A 4B43A 1ZG3A 1FEXA 5LRRA 2ME6A 2AQFA 2NXNB 4XONA 3HB9A 4I99C 1ETVA 1KA8A 3A0HC 2O9LA 4MTEA 4WK8F 2K4BA 2W57A 4HYEA 4UXNA 3MKWB 1A35A 4RLFA 3OYMA 4BDZA 1A5JA 2MW8A 2L4MA 1TWGJ 3IC7A 1V3FA 3M1EA 4MIMA 4UVAA 3JRAA 5JHUA 1H88C 2E1CA 2VQCA 2NAZA 1ZQ3P 3B6CA 2F6CA 3CUQB 1U6GA 5E3LA 2NVQJ 3O8HA 4BHCA 5LD2C 4IHXA 3QU3A 1RC9A 4M9XA 3K10A 2E19A 5IT9Z 4KT5C 2WC2A 2XAUA 4HAMA 3CJQB 3IHUA 1MBKA 5LGNA 4M9ZA 4C30A 1FOWA 2NYXA 2QUFA 4PDKA 3BPVA 4A3KJ 4KA4A 1TWCJ 2XF6A 2R7UA 4QSHA 2RNJA 1J09A 5DYMA 1DUXC 3K70D 3G1LA 3OIPA 3J7AO 1IN7A 2Q2EB 3DPLC 4ABZA 5IYCJ 1T98A 2MD0A 5F08A 3S1RJ 1IGNA 2E1OA 2RV8A 2XRLA 1WI3A 3DPTA 1HBXG 3N4MA 5FROA 2IGNA 2HQRA 2VQGA 2OC6A 4O3MA 3F6OA 1I39A 2R5ZB 4QLCU 1ZLKA 2JTVA 3SYTA 2HDDA 2BGCA 4G6QA 1L0OC 2VJIA 1WWXA 2VLAA 3HHHA 1LE8A 3K69A 3VODA 2XAJA 2JVGA 2DA6A 3BTJA 2GLOA 4IOAF 3AAFA 4RB1A 2LY2A 2K9NA 4BH9A 1QZZA 3N05A 1TQIA 3KP4A 1FP1D 2A05A 1FIAA 2M87A 1ZYRF 3BZCA 3I59A 5KCMA 3GZ5A 2VPLA 1LEAA 1SAXA 1NTCA 1XTAA 2M30A 1D8KA 3MCZA 4KT6A 5F0CA 4M6VA 2IS1A 5HS8A 1P4WA 3LSGA 2QA4I 1OKRA 1IN8A 2RDPA 3HOTA 2EZHA 3BP8A 1YIOA 4UY8I 2BXYA 2QWWA 2MG4A 3GTJJ 1VQLI 3ZQCA 2M7BA 4I98B 3RCOA 3CO7C 3MZHA 2DA4A 1UAAA 3ZMZA 3SHFA 4YFKF 1OCRH 3M07A 4IKFA 3PJRA 1K4SA 1G3TA 1YX5A 3LSHA 4BY7J 1X1CA 1R9TJ 2CSOA 3BG9A 4A3MJ 4Z2YA 3ZQQA 3HTUA 2A5WA 3WHBA 1R22A 4HDVA 3G2BA 1YLFA 2J5PA 1TQMA 4XN3A 2Q1ZB 2M4KA 3J81K 2RQPA 1TBXA 4Y17A 1PYVA 2H94A 1BIBA 2GZWA 2IJLA 4JX5A 2YSRA 3S16J 3PNVA 2R7TA 4F7ZA 4G6TB 3MKLA 2UXNA 4ZDPA 4CH7A 3GTQJ 3QRFF 1USTA 1Z3YA 3V7CA 2L9VA 1PUEE 1J0RA 4RA2A 3WE3A 2VN2A 4A3EJ 3S3OA 1P7IA 2R7QA 1SFOJ 4DBRA 1VI0A 4A6EA 3PUFA 1G8XA 4EMSA 2W4SA 3W6VA 3HUGB 3L00A 2R7FA 4IOCF 1RUOA 1X1PA 1LB2A 1S8NA 2NOJB 4IRGA 1A6IA 1T38A 2R7ZJ 3H5NA 5IP6A 2WB1A 1XS9A 1G3SA 1YW8A 1HKQA 3O3KA 1J9IA 3HXLA 2ISZA 4DZPA 2VJJA 1LDJA 2L9NA 1R1VA 2P7CB 5D4SA 4XKBA 5M3FJ 1Q1VA 1YRNB 2D1VA 3FKJA 1RNLA 2MA3A 3DTEA 1YS6A 2YU3A 1UFMA 4L9NA 2MYSA 2OJED 2DA7A 3S17J 2DJIA 2ZMEB 3WG9A 2KLOA 3V4GA 5HDNA 5DUKA 5DCMA 5K7FA 1DPUA 1I5ZA 3P9CA 1JUMA 2FUG2 3F6VA 2HQAA 2HEOA 4C2TA 3M9AA 2RC4A 5F0HA 3KZYA 2KIFA 3HGGA 4E6KG 4EJOA 4L5IA 5J40A 3R0AA 1LFPA 1S5LC 3BR6A 2COMA 1HW1A 2Z16A 1BOBA 3RQ4A 1WJBA 3SEQA 4C2UA 2BEOA 5FGMA 5C4JJ 1EV7A 3FXJA 1R7JA 2GBYA 3HSEA 2VBWA 3LSJA 5EGOA 2H27A 2EV6A 3CUQA 2QM3A 4P1WA 2QQ9A 1R58A 2DMTA 4ZJZA 1PVEA 1JHFA 3WGIA 1O3RA 1SMYF 5FKKA 1RESA 4L9JA 2CWEA 4A69C 1K6YA 2MABA 3KCCA 2L02A 1L3LA 3HZJA 3QOPA 2WBMA 5HVQC 3CQZJ 3L2CA 1Z05A 4I2OA 2VBXA 1B1BA 1S6LA 1UJ8A 1ZGWA 2CU7A 2QSHX 2CGPA 1QPMA 2LOOA 2QCOA 4CUGA 1TTYA 4HNTA 3K4BA 2QVOA 2MLGA 5J8FA 4D7NA 5DCMB 1GDTA 3OS1A 1E2XA 2L2OA 3HM5A 4KNYA 1YJ9I 2HOSA 4OIPF 4O5VA 5CVUA 3PO2J 1UG2A 1X58A 2PBIA 2LBFB 1J2XA 3GTGJ 2WV1A 2DQLA 1BI0A 1B9NA 4ZYDA 4QPOA 2RN7A 1MJBA 1TW3A 4M71A 5J4YA 4HX4A 1SD7A 3V8JA 1HSJA 1HW5A 1B9MA 1GV2A 2F5CA 3M4OJ 1BIAA 2VIXA 2LREA 3KZZA 3LQQA 5GTIC 5IP7J 5GADJ 3KP5A 2P6SA 2E2JJ 3I58A 1K61A 4JBAA 5B1AH 3OYAA 3E5XA 2DMPA 3ERMA 5JLWA 2R7RA 1GVJA 2MH9A 4LLLA 1YO5C 1N75A 1TT5B 2PJRA 4KJZA 4I6ZA 4XK4A 3R6SA 4CXFA 2IPQX 2TCTA 3BJ6A 2LKXA 3S3NA 4RLQA 3G3ZA 2K9SA 1IN5A 1FTTA 2L7FP 3BTIA 3HPHA 3SDGA 2D2WA 1ON1A 2OUMA 5E3NA 5FLXK 4E70A 4WXCA 1E3PA 1LE8B 2Y48A 1W7PA 1K78B 4XLFA 4ASNA 1LDDA 2NS7A 1LPQA 4L0ZB 1I1SA 3LA3A 3GFJA 4UUVA 1VQ7I 1OFCX 4S04A 2HTJA 3D0SA 3GW2A 2VC0A 2QQ8A 3MVPA 1BJAA 1ZARA 4YEJA 3O8GA 4F92B 1P9QC 2CFXA 1RZ4A 2DMUA 4HLYA 3HRMA 4FQGA 1WSUA 4G94A 1ZAOA 4OAYA 4G7HF 4XLAA 2DAOA 3ZGKA 4RBOA 3KP3A 4DOZA 5E17F 2VI6A 2PQ8A 1IUFA 2ZCWA 3QU6A 1DU6A 5DEQA 4D7MA 2V4JC 3K9TA 1OYYA 2LTPA 3P7NA 1ITYA 4DBQA 3BCBA 1RR8C 3JRDA 3IUOA 3OYGA 5CVVA 3ZMSA 3CLOA 2EPFA 2F2EA 5BPDA 5FKMA 2I10A 4PJJA 3TDUC 4A3DJ 1NK3P 2BOLA 1TLHB 4M3FA 2CW0F 4RAYA 4GYGA 2K5CA 3J80K 3FZVA 4BEHB 1UMQA 2NNYA 5EZGA 2H6BA 3CDIA 1WPKA 4AIDA 4RS8A 1KZHA 5ILUA 3ZN1A 3V8LA 2ADUA 4QWQA 5H2FC 5CKTA 3ZPLA 2A6TA 4LK0F 1AU7A 1V5EA 2GIVA 2XV4S 4AVPA 2K4JA 4NUBA 1NG6A 1Z0XA 4IPAA 5FKNA 1A04A 4HSTA 3ML6A 4HSRA 4BBRJ 2GA2A 2VXDA 1UHSA 2OTJI 2FBIA 4NHJA 4OIQF 1D1BA 3RZOJ 5HS7A 3BG6A 5ED4A 2OQRA 3NEUA 2VXZA 3DU6A 1BM9A 4NDLA 3TO7A 2P8TA 5EYRA 2K86A 1S3JA 1WKMA 3NWTA 2HVRA 2OQGA 4B47A 3IKVA 3AG1H 2FRHA 1FOXA 1ETYA 4G8XA 4IVNA 4BEHA 1W5SA 2LY1A 4FHTA 5FB2A 1ZG1A 2O8KA 2R92J 1CF7B 2DFHA 4BACA 3KIOA 1TL8A 2OD5A 1QZYA 3RKQA 3E97A 3SJMA 3FIWA 2F5FA 2I8DA 2PMUA 3KFWX 3RIRA 3U1KA 3MKZA 4ZYAA 2M4GA 3A01A 1W36D 4HV6A 1RUNA 2PMZA 5ICCA 2L7MP 4CO8A 2M5WA 1VQ4I 1D0ZA 1K6OA 2JA5J 2PLYA 2VT3A 1OJLA 2L7KA 3LNQA 4IHWA 2IGOA 4FX0A 1WJEA 2R5YA 1WJFA 3K0LA 4G9YA 2CW7A 4ENMA 3F21A 5GPCA 3VWBA 1Z77A 4BY1J 3RI4A 2FBHA 3PUBA 2OCCH 3I5UA 4FASD 1MGTA 2GA1A 3VEPA 1I3AA 1AHDP 2HZTA 5K7HA 1P2FA 2MC4A 1MBGA 2VQLA 3WTSC 2R7XA 3F8NA 3CDHA 3OV8A 2W24A 3VDXA 2QGUA 3CC7I 1OR7A 4U87A 5AIQA 1AKHA 1V55H 3PNTA 3S2HJ 3K4LA 2EJRA 2HYFA 4I7HA 4XLHA 3FBIB 5E3OA 2K3PA 2HS5A 4II3A 1FYLA 2F5DA 2YPRA 4XLNF 4M6XA 5D4RA 4CYCB 1F43A 1FBQA 5CJ9A 2CV0A 3RQIA 2FD5A 4GYIA 3WTZA 3HKZA 1W0TA 3R60A 5BPIA 2STWA 1YE9A 1JKQC 2J5OA 1WRJA 5GP9A 3GZ6A 5EGOB 4BQQA 1U0JA 1FC3A 4KN4X 1D5VA 3ELKA 2QBYA 1MKMA 2LYCA 2PFBA 3RYPA 2CW8A 1TNSA 2H6CA 3IH3A 4AIHA 2K9QA 1GLNA 4B3AA 4BXUA 1GHCA 1UHWA 1X2NA 3OYFA 2ZMEC 3GLXA 3EUHC 2VKEA 1WQ2A 4AYBN 1XDSA 4PGGA 1KU9A 3CCMI 1RKTA 4RB0A 2LBFA 2WAFA 4FT8A 3EYYA 1BR1A 3TDZC 3QYFA 4BJ6C 3F23A 1YFHA 2E60A 4PGHA 2KJCA 4LIUA 1PJRA 2ZMEA 2V9KA 5KNLA 2BHYA 3OYDA 1X1AA 3GZNB 3LMMA 2ZXJA 3K2AA 3MN2A 5LFAA 1JXSA 1DGWY 3FKIJ 2HXIA 1D0XA 3S2WA 1B59A 1B4AA 4DIQA 3HOYJ 1KQ9A 2EFOA 2M8EA 4PSWA 2GXBA 1T33A 4D5CA 3IKTA 1XSVA 2K9MA 4CCOA 4WCGA 2Y30A 1LUJB 4CYCA 4GXOA 2CMPA 4MO7A 1P4XA 4U88A 4BXFA 1VQ9I 1K78A 2C6YA 4AM3A 2L54A 2VL8A 4RM3A 4L5EA 1WCMJ 6PAXA 3DEUA 4Y7NJ 3F8BA 4BQOA 3BZ6A 2W85A 3RZDJ 5IYBJ 5E8IA 2MH2A 1FPQA 1PUFA 2V6EA 1MBEA 3GCMA 3PFIA 2ME0A 3QP6A 3TGNA 4CCNA 3ZOBA 4DZJA 5KAFC 1HW2A 2B0LA 2FMLA 2QYOA 1IXCA 1Y0UA 1SFEA 4RGUA 3FK7A 5HNHA 2BBYA 3U9GA 5F04A 1H9GA 3FMQA 2E71A 3DPUA 2X6WA 4QTRA 4IO9F 3OS0A 1B72B 2X6OA 5DUIA 1HCRA 2YX7A 4GFBA 4H0EA 3BC8A 3K7AJ 4R1HA 1MDMB 1R4NB 1O3QA 3TW6A 1S9HA 1WJ5A 5GAGJ 3KEOA 1T6SA 1E3HA 1JI8A 1USSA 3EETA 3FXLA 5F0FA 1XDUA 5L3CA 3ONQA 4XIDA 1CF7A 2V7FA 2ZFWA 1ENHA 4S05A 3K1NA 2AXLA 4EJWA 3M8FA 5EEHA 4E7KA 3K1MA 3JAMK 2OV7A 1D1CA 1IAWA 1D3YA 3K70C 3BT9A 4HRIA 5GPAA 4IRHA 2R7VA 3EYIA 5GAHJ 3OYLA 1FX7A 4F91B 3L2VA 3KP2A 2LR8A 1DU0A 5FLXZ 3O6BB 3BR2A 4NNJA 4CCLA 3BCAA 3I4PA 1IW7F 4B44A 4FTHA 3MEXA 5CVRA 2Z5UA 3BG5A 3FHNA 2K3FA 5DM6F 3OYCA 1VQPI 3NARA 1VQOI 1WFXA 5E3MA 1GUUA 2K02A 5FRNA 1Q1HA 5EEAA 2A68F 2GWRA 2HKXA 5EG0B 1RIOH 4LG0A 3VYUB 2P7VB 2DYSH 4XSXF 2A07F 5EJCA 3EPZA 2L3DA 3TOBA 1GV5A 3Q0VA 3RTRA 1DP3A 3WTTC 1OPCA 2UZKA 4EM0B 1D5YA 3MD2A 4WXDA 4D1QA 4RGSA 1H89C 2XGXA 3IAM2 2MC3A 2NVUB 1TW2A 2RGVA 2K85A 4LOCA 1RETA 2JRMA 4A3CJ 1P92A 2DDAA 3F8FA 4RAFA 2DU9A 4DGWB 2PMZN 1K79A 2BVMA 3LL7A 2W82A 2JPCA 4C9YA 3JRFA 1Y0NA 2ZO4A 5HNFA 3GTPJ 3L09A 1YS7A 3HOVJ 3H3VK 2HWVA 3CP8A 4C2MJ 3VYTB 2YU9J 2VBYA 3WE2A 2OAZA 2EWNA 5B3SH 3TO9A 2L4AA 4QPQA 2O0YA 4NQWB 4OIOF 3ZQLA 2CYYA 2FBKA 3C7JA 4K2EA 2X4HA 1BOAA 4JOMA 1H9TA 2HDWA 3OYBA 3I59B 4II2A 2LG4A 5FD5A 3K4JA 1BR4A 2LY9A 4HQEA 3KYLA 3CCJI 4CYDA 3KZIC 5KK1A 1I6HJ 4V2FA 3VSLA 3H9JA 2HKOA 2ID3A 3GTLJ 4HV5A 1IRGA 2WY8Q 2BE5F 1MMNA 3K1PA 5D5WB 3FISA 1XD7A 5JLXA 3QYEA 2GXGA 1ZR4A 3JW4A 2H8WA 3FXUA 2ZKZA 3SZGA 3DBRB 4E7HA 2Q0OA 3CLQA 1QBJA 4D9JA 2KDZA 1WZ2A 1K4TA 3F72A 4ZTJA 1VQKI 1ETKA 4ZYHA 2BW3A 2E2IJ 3VSKA 1G3WA 1MIJA 4DYQA 2NRAC 1OQYA 2FNPA 4HX8A 1XCBA 4A0YA 1JT0A 2W25A 5C3EJ 1Z9CA 1EA3A 1C0WA 5C4XJ 4M6YA 1MMGA 3LA2A 2UUZA 1TC3C 2LP0A 3HOUJ 4LLGF 1FSHA 5KAIC 2GM4A 3E0JB 2LC2A 3OYHA 4MHGA 5IOZA 4FX4A 1ZRFA 4JYKA 3Q0UA 3DTIA 1IXRC 1LDKB 1YI2I 2FJ1A 2LF7A 2E2HJ 2EH3A 5LHGA 2X1CA 1TZLA 3GO5A 3VYRB 2W00A 3BOQA 2R0QC 1B72A 4IHTA 1ETWA 3L2WA 3I4MJ 2OPTA 2HFHA 3CCYA 1IDZA 3FX3A 3H9GA 2M2EA 3K6GA 4D5FA 2E35A 2ELKA 3DKXA 3L1PA 1HC8A 3LAPA 4UUSB 5HLHA 2IXSA 3G6EI 2Y0MA 1ORKA 3T8RA 3Q5FA 5HLTA 1PDNC 3ZP5A 4EM2A 2DBBA 1KQ8A 1R5HA 1BBYA 3OWTA 3TMOA 3E6MA 9ANTA 2DI3A 3C1DA 3I9V2 4BE2A 3BR5A 1LFUP 4BQAA 1OYWA 4BBSJ 3JTGA 1ODDA 2ICWG 3OYNA 2BY2A 1YYVA 3KLOA 3GTOJ 3JRHA 3R4KA 5LHHA 2YR2A 1IUYA 5EDNA 3OS2A 2TRTA 3CCUI 2EFPA 1WH5A 3W2WA 3BTLA 1SAUA 3FK6A 5ICEA 1BA5A 2HYGD 1S7OA 3L2RA 2VODA 3VB2A 3RPQA 1I50J 2KMUA 4BUPA 4MGRA 1GT0C 4N9HA 4A3GJ 2XSJC 4Y52J 4HA8A 2CO5A 3S93A 1PP7U 1XMAA 5D5VB 4MFDA 4BHBA 4BDYA 2DW4A 2EIMH 3NAUA 5LEKA 2DYRH 4XM3A 4E7SA 2LLKA 5LHIA 1ZRDA 2XDVA 4MLOA 3A01B 4OIRF 1R23A 3Q9VA 2W7NA 1GXPA 1AOYA 5M5YJ 1BC7C 3AG3H 4EEFG 2LMDA 1WI9A 3DF8A 2E34A 1IG7A 2NS0A 2DPDA 1A6QA 3TOAA 2NVTJ 3HYIA 4NC8A 4PFOA 2HTSA 3CC2I 2WWYA 1O7FA 3HSRA 1STZA 5AIPA 1VQMI 1QZEA 5EG0A 4J01A 4C3JJ 2DT5A 2H1KA 3QOEA 3GTKJ 4FCYA 4A3FJ 3ZQGA 2HYJA 2Z1DA 3ABMH 1Z1DA 3BZKA 2EZKA 1FSEA 2DJNA 2X6XA 5DD4A 3RKWA 5A2QK 1MNMC 2XAFA 2CG4A 3VFZA 1IO2A 4U0YA 2VKDA 2KKOA 4PJLA 3MQ0A 3P5JA 2WTEA 2HR3A 2M7AA 3C2BA 4D0PA 4XL9A 4I0AA 4ENNA 2ZXWH 2JT1A 4RMNA 4UB8C 5FRMA 2D1HA 1E17A 2BZTA 4X1EA 2E1NA 2JSCA 3IH2A 2KT0A 2K40A 3QODA 3ERED 1TT0A 3CMMA 2EV0A 4IHYA 3TW7A 2XB0X 5AONA 1U2WA 2X1DA 3OOUA 2OZ6A 5J4VA 1SD6A 2IT0A 2FF4A 2M8GX 4CHUA 2EIKH 4Y33A 2EA2A 4MFEA 4B09A 3K4CA 3FBNB 2DFFA 3DBLB 5FLMJ 1QVTA 1O7LA 3DLLF 1MMDA 3CJTB 2KFDA 1U3EM 1R5GA 1ZHFA 1ZN2A 3ZCOA 3PM1A 3TQNA 5D6FA 1J75A 1W36C 3C3WA 3ABUA 4XNFA 1R5ID 4KYWA 3PSFA 2VJ5A 3TL4X 1FOKA 2ECCA 4RDUA 3EUKL 1ZH5A 4ZZDA 3JRIA 3E5QA 1R71A 4UNOA 1A31A 2BVLA 5L3EA 5J47A 4BU2A 3BR1A 2ZJQF 2E5NA 2XF5A 3V7SA 4BKXA 5J1YA 4CCJA 2DA5A 1FT9A 3MZYA 1W4MA 4ZC3A 5D5UB 3KEQA 4TV7A 4XORA 4BS9A 2DFIA 3HRUA 2OF7A 2CQQA 2ZB9A 4BAYA 2WADA 2JN6A 2ETHA 1Y1VJ 5J8CA 2ID6A 1G3YA 3A0BC 1Z6TA 2VOPA 3S8PA 1T08B 1M1EB 2ELHA 5FKLA 3E3VA 3QPSA 4R79A 3I53A 1SC7A 2WAQA 2HOAA 3B02A 2CQKA 1JTYA 5IYDJ 2H09A 2NOGA 1ETOA 3ZMVA 1LFBA 2XSDC 2XPUA 5L3BA 1MBFA 2LKSA 1RRJA 3UR3C 1EKEA 4N4OB 3WU1B 4W1UA 3ZQHA 2JA2A 2XGDA 2GXAA 3D5LA 3DTKA 1OYIA 4X0GA 1JKPC 4I02A 4B1RA 2MD5A 1FWZA 3GFLA 4KIGA 3C2GA 4LB6B 1HQCA 3SZPA 1YHQI 2JK3A 4ITVA 3J81Z 3CJRB 3CD6I 4HQMA 2ZJPF 5ILVA 3IP4B 1MH3A 4HEA2 4MNUA 3OL3A 1N78A 4UV9A 2LFBA 2BW3B 3S14J 3GUDA 2D5VA 3AG4H 1W5TA 1OCPA 2EBIA 4I01A 3IAS2 4AVZA 3MFKA 2KRFA 3RPUD 3DEEA 2NVYJ 1P4AA 2M0MA 5CVJA 4IHVA 3GVAA 3NQOA 5B66C 5CVIA 4E7JA 4EJTA 2CRGA 3PO3J 4IF4A 1K83J 1YJNI 3FHZA 1T56A 2IBDA 2O7OA 3RKXA 4GO1A 2HDCA 4HF2A 2JA7J 1J7KA 1Y6IA 3HUGA 1X4PA 3H1CA 3SDBA 1F5TA 2A6EF 2MFZA 4XN0A 1U5TA 2DT7B 2QZ8A 2F5EA 1VTNC 2V9PA 3MZ8A 2XHKA 2XPVA 5M5XJ 4U7DA 5FLVA 4YG2F 1YW7A 4HF0A 5ERIA 4Y13A 1B8IA 1VF9A 1RR7A 2IA0A 4EJVA 3A4CA 1BJZA 3GFMA 3BPXA 2HI3A 3M7GA 4YELA 4YIIA 1LEBA 4EGZA 1X3UA 2EIJH 3AG2H 3BWGA 2EZIA 2JPBA 4HNUA 5FJ8J 2EFWA 2XB5A 3E7LA 2XROA 4P5OA 2KQRA 3GF2A 4G12A 4AIJA 4F52A 4F55A 2AS5F 2VT2A 1VQ6I 5IT9K 2P81A 4PFPA 2CQXA 1DQUA 3LOCA 2XGCA 1JJ8C 4MEYF 3FXQA 3DCFA 3HJEA 4AUXA 5HLGA 2Y0SN 2DCEA 2E5ZA 4AYBA 2HGCA 3IWFA 3KE2A 3MWMA 2B9SA 1H8AC 4WX9A 2Z2SB 1OCZH 4CA0A 2D45A 5EF6A 1U9NA 4Y15A 3CJNA 3LAJA 3KEYA 2ZBKA 1P6RA 2FOKA 2CFOA 2QSFX 2Y9ZA 4ENKA 2DN0A 5LEJA 4LB5A 2EK5A 1U5TC 3JAMZ 1FJLA 3BLYA 2MGQA 1ZG5A 2V79A 4BXXJ 1HDPA 1KQ0A 2QKMB 3MAJA 3QYBA 3LFUA 4PJ0C 1I1GA 1FBUA 1ZGJA 3E6DA 2X6YA 1KGSA 3FDYA 2JUCA 4F3QA 5DDGA 3R0JA 3OYIA 4JQFA 4HZFA 2EFNA 3H36A 2CS3A 1U9OA 5HLIA 4ESBA 2FU4A 3VOEA 3CMEI 4CSWA 2LVSA 3S3MA 3GBGA 1ULYA 3BR0A 1I6XA 3F22A 1RPWA 3Q9SA 1X1BA 3RKYA 4AIKA 3G71I 1Z6RA 2VUMJ 1S7AA 3QPLA 3DLAA 1FYKA 1JGGA 2JQ7A 3WU0A 4C3HJ 3W2AA 3LQRA 1JT6A 5FFZA 5F1JA 3WODF 4HOBA 3TP3A 5EEGA 5TJJA 3CTAA 3OIQA 1OR7C 2OU2A 4A0XA 5BS6A 1T95A 1F1ZA 4XRSG 2M45A 3CO6C 3S1NJ 2KZGA 4L9VA 2EA4A 2XAQA 1SMTA 4Q47A 2L9SA 2ESNA 4IQJA 1YQAA 1QGPA 2GQQA 3X2QH 1Z91A 2HPMA 4RGXA 2Y69H 3W6KB 4KN7X 1H0MA 4GGGA 5E1XA 5J6XA 1MMSA 4IL6C 3UNGC 2R93J 3JTHA 2DOAA 1BC8C 5HODA 3CCLI 3BJAA 2VB6A 5IPAA 2H1LA 2ZC2A 3FMRA 3W3CA 5K1YA 1FMWA 3GX4X 1WJAA 3H3UA 1FYMA 1W7PD 1Y8QB 1JKRC 3IL2A 3DP7A 2LKPA 1SVOA 1DPRA 1AA7A 1W0UA 1BL0A 2IA2A 2B7EA 4EV0A 5LBQA 5IT3A 1E0EA 1JTXA 1UG0A 3FM3A 3M1CA 5D5XB 3LSTA 3U21A 3GWZA 3AL0B 4XRFA 5F1RA 3KYCB 3T1BA 4EVIA 1YW9A 2JA8J 1QRYA 5L3FA 1HDDC 2P0WA 4OMYA 3WTVC 2VE9A 5BMZA 4H4KC 4B48A 4NQWA 1BR2A 1U8RA 4M3GA 2Y0SA 5B1BH 1T0FA 2OTLI 5CYVA 2W48A 1EH8A 3H35A 1Z3XA 2WY7Q 1VNDA 5B5EC 5IY5H 3TEDA 4OWRB 1O57A 5E20A 4E4HA 2V1UA 1HKTA 1YTYA 1JGSA 2P5VA 5LGTA 4Y4RA 3WGGA 2R5YB 1HA8A 1KU2A 1JE8A
chains in the Genus database with same CATH topology
3H92A 3HRSA 2K7LA 2FEZA 1T39A 3E6CC 4R8HA 4PCQA 3PQJA 3HTSB 3DV8A 1V4RA 1XGOA 2KJBA 5D6EA 2L01A 3L7WA 5ILSA 1J5YA 1BI2A 4N0BA 3JSPA 4NB5A 4MTDA 5DD8A 2VBZA 2V1DA 3I71A 4CDGA 2BV6A 4AWXB 4A5MA 4CICA 2QLZA 3BY6A 3U2RA 2XRNA 2P6TA 3RDIA 2P5KA 4B8XA 5BOXA 2HOEA 2O3FA 1G4DA 2PJPA 5CLSA 2OZUA 2Q2EA 4BYYA 2OA4A 4OMZA 3V8KA 2QENA 2FSWA 2IVMA 3DKWA 4LD5A 1BI1A 4L18B 2XUBA 2IP2A 4JK1X 4KUMA 1R36A 2V9VA 3QPHA 3I64A 3RJPA 3ECOA 1SFXA 2G9WA 5H6RA 2DK8A 4I09A 5HDKA 2UWMA 5K5RA 2X0LA 3BJOA 3KLNA 2BYVE 3ULQB 4IXAA 2Q8KA 3ZMUA 5E1WA 5A2QZ 5JR3A 4EQQA 4A12A 1IXSB 2ACJA 2XKPA 5ICGA 2EV5A 2EB7A 1Z7UA 2FQ3A 5H20A 2HQNA 2O8XA 3GYHX 1XCVA 4HX7A 2FXAA 2STTA 2QQAA 2PN6A 3REOA 4G7ZF 1O3SA 3ROUA 1F9NA 1XGMA 1ZGAA 2XAGA 1EH7A 3C18A 4WXHA 1SD4A 1BN5A 2FNAA 1K7AA 3F3XA 3ZMDA 2A69F 4Q5SF 1I27A 4ESJA 4BNCA 2P4WA 4I0BA 1LVAA 3WTUC 3GFIA 2V1XA 2R7DA 4ESFA 4LFUA 4U0WA 1IN4A 1GXQA 1HXDA 1ZLJA 4ZH4F 1R1UA 4MQVA 5JI6A 1F4KA 4PZJA 3DFGA 3E6BA 4UVCA 3HSFA 4U0VA 5FO5A 5L3DA 4P9FA 4WF2A 3WTXC 2LF8A 3IWZA 3COAC 1KU7A 4EGYA 2Z33A 1NHAA 2G7UA 3LA7A 5H6QA 3V7RA 3EQLF 4Q4ZF 2RVCA 2O61A 2LSOA 1FZPB 4L9TA 2KIMA 3WGHA 4CZZA 1FY7A 2IRFG 4P96A 4ZZLA 3SZTA 3O2PE 4RAZA 3L9FA 4L5JA 2XVCA 1ZRCA 1B6AA 3EUHA 3QP5A 1RI7A 5D8LB 3N97A 4IJAA 4AD9A 1IRFA 3WTYC 2ISYA 1UHMA 4UVBA 3ZN0A 4OOIA 3DXJF 1XN7A 1FBSA 3RYRA 5JVTA 2W84A 3FM5A 5K5QA 1XMKA 1QO0D 1PP8F 4ZYEA 1AWCA 4KIBA 2ESHA 2DK5A 5K5OA 1XGNA 1R00A 4IHSA 1TNTA 5LRSA 1FNNA 3ECHA 2XKOA 2VONA 1BI3A 3SFZA 4MEXF 4M72A 2IW5A 4GCVA 1MZBA 1W7PB 3KETA 4Q48A 2FE3A 1XB4A 4U7BA 1XGSA 2PEXA 3M8EA 3HRTA 1TQPA 3HIFA 1MJ9A 1FLIA 4DNCA 4ZYGA 2K27A 2M1BA 3ZMTA 4DQ2A 2YX4A 4M73A 4CGZA 1REPC 4O6JA 2DTRA 4YFXF 3KP7A 3W6JB 3FWEA 1UCRA 1XSXA 2DLLA 1D8JA 2ZJ2A 3NRVA 1HSTA 2UXXA 5HOOA 3J80Z 3WTWC 3P9KA 5L3GA 2JRTA 3I54A 5F6FA 4LLNA 3QAHA 2A3SA 4OINF 5D8KB 1LQ1A 1MDMA 4KICA 1MD0A 1DP7P 2QBYB 1G6NA 4LG0B 1QNTA 3KP6A 1YG2A 1S29A 1DDNA 2RKHA 3LFKA 3RPUA 2JZYA 4P9UA 5JFRA 1CGPA 3ZQ7A 3PQKA 2OBPA 3I0TA 2Z99A 3FXRA 2R3SA 1T2KA 2DQRA 4A6DA 2O03A 3E5UA 3TKYA 2ZNYA 4HLXA 3K2ZA 4HW0A 2PI0A 5DV5A 1ON2A 4EJUA 1SFUA 2A6HF 3T8TA 3BDDA 4ETSA 3U1DA 3F8MA 4KDPA 4LK1F 5FD6A 1JHHA 3HHGA 3OOPA 4EM1A 4HDUA 2PG4A 3B73A 1R1TA 3P9IA 2V6CA 3T0YA 1IN6A 3FMSA 5HDGA 1U5TB 4A2UA 4L0YB 2MLKA 3TO6A 2VC1A 1IZ1A 5E8GA 3SQNA 1ZREA 3EDPA 2FMYA 4UHTA 3T5XA 5F64A 2VOOA 4OU0A 4ON0A 2E7WA 5DCFA 1LNWA 3R61A 4RGRA 3H3ZA 4LJZF 1KYWA 4A0ZA 2Z3YA 2TDXA 3ABTA 4ENJA 4UV8A 4HBLA 2LDUA 2O6GE 2A61A 4KMUX 1U78A 5HS9A 3QPTA 4MQ9F 1KYZA 1EH6A 4XSZF 2KIUA 4LGWA 3F8CA 4KMFA 3SXYA 4M9SA 3HOSA 2P5LC 4A5NA 3BROA 4BHPA 2Z9OA 4P55A 2NNNA 2DO7A 2EFQA 2FA5A 4KIFA 2MBFA 3LWFA 5FFXA 1SD5A 4N9IA 4RB2C 5LGUA 2Y75A 4XBFA 4HF1A 4G7OF 5ICFA 1LJ9A 3ISPA 2ZNZA 1MJAA 1KU3A 3CUOA 5E1ZB 1QQIA 3IRRA 2GAUA 5LLQA 3GXOA 3IRQA 2DPUA 3G73A 2XAHA 5BQTA 4YFNF 5TRDA 2XASA 1OMIA 1HKSA 2LNBA 2A5YB 1O3TA 2PMHA 3FF5A 1FP2A 4WWCA 3DQVC 2VE8A 2G7HA 4XLPF 5KVRA 4YIFA 4RB3C 2QQBA 4LMYA 1UB9A 2WV0A 3JSOA 4KFCA 5E18F 3GEZA 4M74A 1XSDA 2XIGA 2E7XA 1ONVA 2IA1A 1J59A 4G6DA 4IRIA 3CUQC 1IF1A 1ZG3A 5LRRA 1KA8A 4MTEA 4WK8F 2K4BA 2W57A 4HYEA 4UXNA 2L4MA 3IC7A 1V3FA 3M1EA 4UVAA 2E1CA 5JHUA 2NAZA 3CUQB 1U6GA 4BHCA 3QU3A 4M9XA 5IT9Z 4KT5C 2WC2A 4HAMA 3IHUA 5LGNA 4M9ZA 2NYXA 2QUFA 4PDKA 3BPVA 4KA4A 2RNJA 5DYMA 1DUXC 3J7AO 1IN7A 3DPLC 1T98A 2RV8A 3DPTA 1HBXG 3N4MA 2HQRA 4O3MA 3F6OA 4QLCU 1ZLKA 2JTVA 2BGCA 4G6QA 1L0OC 1WWXA 3HHHA 3K69A 3VODA 2XAJA 3AAFA 4RB1A 4BH9A 1QZZA 1TQIA 3KP4A 1FP1D 2M87A 3I59A 1ZYRF 3GZ5A 1LEAA 1SAXA 2M30A 1D8KA 3MCZA 5HS8A 1P4WA 1OKRA 1IN8A 2RDPA 3HOTA 3BP8A 1YIOA 2QWWA 4I98B 3CO7C 3MZHA 3ZMZA 3SHFA 4YFKF 1G3TA 2CSOA 4Z2YA 3HTUA 1R22A 4HDVA 1YLFA 2J5PA 1TQMA 3J81K 2RQPA 1TBXA 4Y17A 2H94A 1BIBA 2GZWA 2IJLA 2YSRA 4F7ZA 2UXNA 3QRFF 1USTA 3V7CA 1PUEE 1J0RA 3WE3A 2VN2A 4A6EA 4EMSA 3L00A 2R7FA 1RUOA 1LB2A 1S8NA 4IRGA 1T38A 1G3SA 1YW8A 1HKQA 3O3KA 1J9IA 2ISZA 1LDJA 1R1VA 2P7CB 5D4SA 2D1VA 1RNLA 2MA3A 1YS6A 2YU3A 1UFMA 4L9NA 2ZMEB 3WG9A 5HDNA 3V4GA 5DUKA 5DCMA 1DPUA 1I5ZA 3P9CA 3F6VA 2HEOA 3M9AA 2RC4A 3KZYA 2KIFA 4EJOA 4L5IA 3R0AA 2COMA 1HW1A 2BEOA 5FGMA 1EV7A 1R7JA 3HSEA 2VBWA 2H27A 2EV6A 3CUQA 2QM3A 2QQ9A 1R58A 1JHFA 3WGIA 1O3RA 1SMYF 4L9JA 2CWEA 3KCCA 2L02A 1L3LA 3QOPA 5HVQC 3L2CA 1Z05A 4I2OA 2VBXA 1B1BA 1S6LA 2CGPA 1QPMA 1TTYA 2QVOA 2MLGA 5J8FA 5DCMB 1E2XA 4KNYA 4OIPF 4O5VA 5CVUA 2PBIA 1J2XA 1BI0A 2DQLA 1B9NA 4ZYDA 2RN7A 1MJBA 1TW3A 4M71A 4HX4A 1SD7A 3V8JA 1HSJA 1HW5A 1B9MA 2F5CA 1BIAA 3KZZA 3LQQA 3KP5A 2P6SA 3I58A 4JBAA 3E5XA 1GVJA 2MH9A 4LLLA 1YO5C 3R6SA 4CXFA 2IPQX 3BJ6A 3G3ZA 1IN5A 2D2WA 1ON1A 5FLXK 4E70A 4WXCA 2Y48A 1W7PA 1K78B 4ASNA 1LDDA 1I1SA 4L0ZB 3LA3A 3GFJA 4UUVA 4S04A 2HTJA 3D0SA 3GW2A 2VC0A 1BJAA 1ZARA 2CFXA 1RZ4A 4HLYA 3HRMA 1WSUA 4G94A 1ZAOA 4G7HF 2DAOA 3KP3A 5E17F 2PQ8A 2ZCWA 3QU6A 5DEQA 3K9TA 3P7NA 1OYYA 5CVVA 3ZMSA 3CLOA 2F2EA 5BPDA 3TDUC 1TLHB 2CW0F 4RAYA 4GYGA 3J80K 3FZVA 2NNYA 2H6BA 4RS8A 5ILUA 3ZN1A 3V8LA 2ADUA 4QWQA 3ZPLA 4LK0F 2GIVA 2XV4S 4AVPA 2K4JA 4IPAA 1A04A 3ML6A 2GA2A 2FBIA 4NHJA 4OIQF 5HS7A 5ED4A 2OQRA 3NEUA 2VXZA 1BM9A 3TO7A 2P8TA 2K86A 1S3JA 1WKMA 2OQGA 3IKVA 2FRHA 4IVNA 4G8XA 1W5SA 4FHTA 5FB2A 1ZG1A 1CF7B 2OD5A 1QZYA 3E97A 2F5FA 2PMUA 3RIRA 3KFWX 4HV6A 1RUNA 5ICCA 4CO8A 2M5WA 1K6OA 2PLYA 2VT3A 4FX0A 3K0LA 4G9YA 4ENMA 3F21A 3RI4A 2FBHA 3I5UA 1MGTA 2GA1A 3VEPA 2HZTA 1P2FA 3WTSC 3F8NA 3CDHA 3OV8A 2W24A 1OR7A 5AIQA 2EJRA 2HYFA 4I7HA 1FYLA 2HS5A 2F5DA 2YPRA 4XLNF 4M6XA 5D4RA 1FBQA 5CJ9A 4GYIA 3WTZA 3R60A 5BPIA 2STWA 2J5OA 1WRJA 3GZ6A 1FC3A 4KN4X 1D5VA 3ELKA 2QBYA 1MKMA 2PFBA 3RYPA 1TNSA 2H6CA 4AIHA 4BXUA 1GHCA 1UHWA 3GLXA 1WQ2A 1XDSA 4PGGA 1KU9A 4RB0A 4FT8A 3EYYA 3TDZC 3F23A 1YFHA 4PGHA 2KJCA 2ZMEA 2ZXJA 1JXSA 3S2WA 1B59A 1B4AA 1KQ9A 2EFOA 2M8EA 2GXBA 3IKTA 1XSVA 4WCGA 4GXOA 1P4XA 4U88A 1K78A 2C6YA 2L54A 6PAXA 3DEUA 3F8BA 3BZ6A 2W85A 5E8IA 2MH2A 1FPQA 3PFIA 3QP6A 3TGNA 1HW2A 2B0LA 2FMLA 2QYOA 1IXCA 1Y0UA 1SFEA 4RGUA 2BBYA 3U9GA 1H9GA 3FMQA 5DUIA 2YX7A 4H0EA 4R1HA 1MDMB 1O3QA 3KEOA 1T6SA 1USSA 3EETA 5L3CA 1XDUA 1CF7A 4S05A 2ZFWA 3K1NA 2AXLA 4EJWA 3M8FA 5EEHA 3K1MA 3JAMK 1IAWA 1D3YA 4IRHA 3EYIA 1FX7A 3KP2A 5FLXZ 3O6BB 3I4PA 1IW7F 3MEXA 5CVRA 2Z5UA 2K02A 1Q1HA 2A68F 2GWRA 2HKXA 1RIOH 4LG0A 2P7VB 4XSXF 2A07F 2L3DA 3TOBA 3RTRA 3WTTC 1OPCA 2UZKA 4EM0B 4WXDA 4RGSA 2XGXA 2MC3A 1TW2A 2RGVA 1P92A 3F8FA 2DU9A 1K79A 2JPCA 2ZO4A 3L09A 1YS7A 2HWVA 2VBYA 3WE2A 2OAZA 2EWNA 3TO9A 2L4AA 2O0YA 4OIOF 2CYYA 2FBKA 3C7JA 4K2EA 2X4HA 1BOAA 1H9TA 3I59B 5FD5A 4HQEA 4CYDA 5KK1A 2HKOA 1IRGA 4HV5A 2BE5F 3K1PA 5D5WB 1XD7A 2GXGA 3JW4A 3FXUA 2ZKZA 2Q0OA 1QBJA 3F72A 4ZYHA 1G3WA 2NRAC 2FNPA 4HX8A 1XCBA 4A0YA 2W25A 1Z9CA 1C0WA 4M6YA 3LA2A 4LLGF 1FSHA 4MHGA 4FX4A 1ZRFA 1IXRC 1LDKB 2LF7A 5LHGA 3GO5A 3BOQA 4IHTA 2HFHA 3FX3A 3LAPA 5HLHA 2Y0MA 3T8RA 3Q5FA 1PDNC 3ZP5A 4EM2A 2DBBA 1KQ8A 1R5HA 1BBYA 3E6MA 2DI3A 3C1DA 4BQAA 1OYWA 3JTGA 1ODDA 1YYVA 3KLOA 3R4KA 5LHHA 2YR2A 1IUYA 2EFPA 5ICEA 2HYGD 1S7OA 2VODA 3VB2A 3RPQA 4MGRA 4N9HA 4HA8A 2CO5A 1PP7U 1XMAA 5D5VB 4BHBA 2DW4A 5LEKA 5LHIA 1ZRDA 4OIRF 1R23A 3Q9VA 1GXPA 1AOYA 1BC7C 1WI9A 3DF8A 2NS0A 2DPDA 3TOAA 3HYIA 2HTSA 2WWYA 1O7FA 3HSRA 1STZA 5AIPA 2DT5A 1Z1DA 1FSEA 5DD4A 5A2QK 3RKWA 2XAFA 2CG4A 3VFZA 4U0YA 2KKOA 3MQ0A 2WTEA 2HR3A 4D0PA 4I0AA 4ENNA 2JT1A 2D1HA 1E17A 2E1NA 2JSCA 3ERED 2EV0A 5AONA 1U2WA 2OZ6A 1SD6A 2IT0A 2FF4A 4CHUA 2EA2A 4B09A 1O7LA 1U3EM 1R5GA 1ZHFA 1ZN2A 3TQNA 5D6FA 1J75A 3C3WA 3ABUA 4KYWA 1FOKA 1ZH5A 4ZZDA 3E5QA 4UNOA 5L3EA 3V7SA 1FT9A 3MZYA 1W4MA 5D5UB 3KEQA 4TV7A 2DFIA 3HRUA 4BAYA 2ETHA 5J8CA 1G3YA 1Z6TA 2VOPA 2ELHA 3E3VA 4R79A 3I53A 3B02A 2CQKA 2H09A 3ZMVA 5L3BA 3WU1B 3D5LA 1OYIA 4I02A 2MD5A 1FWZA 3GFLA 4KIGA 4LB6B 1HQCA 3SZPA 3J81Z 4HQMA 5ILVA 4MNUA 4UV9A 3GUDA 1W5TA 4I01A 3MFKA 2KRFA 1P4AA 5CVJA 3GVAA 3NQOA 5CVIA 4EJTA 4IF4A 3FHZA 3RKXA 4GO1A 2HDCA 4HF2A 1J7KA 3HUGA 1F5TA 2A6EF 1U5TA 2QZ8A 1VTNC 2F5EA 2XHKA 4U7DA 4YG2F 1YW7A 4HF0A 5ERIA 4Y13A 2IA0A 4EJVA 3GFMA 3BPXA 3M7GA 4YIIA 1LEBA 4EGZA 1X3UA 3BWGA 2JPBA 2EFWA 2XROA 4P5OA 3GF2A 4AIJA 5IT9K 2AS5F 2VT2A 4MEYF 3FXQA 5HLGA 2HGCA 3IWFA 3KE2A 3MWMA 4WX9A 2D45A 4Y15A 3CJNA 3LAJA 2ZBKA 1P6RA 2FOKA 4ENKA 5LEJA 4LB5A 2EK5A 1U5TC 3JAMZ 1ZG5A 2V79A 1KQ0A 3MAJA 1FBUA 1ZGJA 1I1GA 3E6DA 1KGSA 5DDGA 3R0JA 4JQFA 4HZFA 2EFNA 4ESBA 5HLIA 2FU4A 3VOEA 1ULYA 1I6XA 3F22A 3Q9SA 3RKYA 4AIKA 1Z6RA 1S7AA 1FYKA 3WU0A 3LQRA 5FFZA 3WODF 4HOBA 5EEGA 5TJJA 3CTAA 2OU2A 4A0XA 5BS6A 1F1ZA 3CO6C 2M45A 4L9VA 2EA4A 2XAQA 1SMTA 4Q47A 2ESNA 1YQAA 1QGPA 2GQQA 1Z91A 4RGXA 3W6KB 4KN7X 1H0MA 4GGGA 5E1XA 5J6XA 3JTHA 1BC8C 3BJAA 3FMRA 5K1YA 3GX4X 3H3UA 1FYMA 1W7PD 3IL2A 3DP7A 2LKPA 1DPRA 2IA2A 4EV0A 5LBQA 5IT3A 3FM3A 5D5XB 3LSTA 3GWZA 4XRFA 5F1RA 3T1BA 4EVIA 1YW9A 5L3FA 4OMYA 3WTVC 2VE9A 5BMZA 4NQWA 1U8RA 1T0FA 5CYVA 1EH8A 5E20A 1O57A 2V1UA 1HKTA 1YTYA 1JGSA 2P5VA 5LGTA 3WGGA 1KU2A 1JE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H92 A;  3HRS A;  2K7L A;  2FEZ A;  1T39 A;  3E6C C;  4R8H A;  4PCQ A;  3PQJ A;  3HTS B;  3DV8 A;  1V4R A;  1XGO A;  2KJB A;  5D6E A;  2L01 A;  3L7W A;  5ILS A;  1J5Y A;  1BI2 A;  4N0B A;  3JSP A;  4NB5 A;  4MTD A;  5DD8 A;  2VBZ A;  2V1D A;  3I71 A;  4CDG A;  2BV6 A;  4AWX B;  4A5M A;  4CIC A;  2QLZ A;  3BY6 A;  3U2R A;  2XRN A;  2P6T A;  3RDI A;  2P5K A;  4B8X A;  5BOX A;  2HOE A;  2O3F A;  1G4D A;  2PJP A;  5CLS A;  2OZU A;  2Q2E A;  4BYY A;  2OA4 A;  4OMZ A;  3V8K A;  2QEN A;  2FSW A;  2IVM A;  3DKW A;  4LD5 A;  1BI1 A;  4L18 B;  2XUB A;  2IP2 A;  4JK1 X;  4KUM A;  1R36 A;  2V9V A;  3QPH A;  3I64 A;  3RJP A;  3ECO A;  1SFX A;  2G9W A;  5H6R A;  2DK8 A;  4I09 A;  5HDK A;  2UWM A;  5K5R A;  2X0L A;  3BJO A;  3KLN A;  2BYV E;  3ULQ B;  4IXA A;  2Q8K A;  3ZMU A;  5E1W A;  5A2Q Z;  5JR3 A;  4EQQ A;  4A12 A;  1IXS B;  2ACJ A;  2XKP A;  5ICG A;  2EV5 A;  2EB7 A;  1Z7U A;  2FQ3 A;  5H20 A;  2HQN A;  2O8X A;  3GYH X;  1XCV A;  4HX7 A;  2FXA A;  2STT A;  2QQA A;  2PN6 A;  3REO A;  4G7Z F;  1O3S A;  3ROU A;  1F9N A;  1XGM A;  1ZGA A;  2XAG A;  1EH7 A;  3C18 A;  4WXH A;  1SD4 A;  1BN5 A;  2FNA A;  1K7A A;  3F3X A;  3ZMD A;  2A69 F;  4Q5S F;  1I27 A;  4ESJ A;  4BNC A;  2P4W A;  4I0B A;  1LVA A;  3WTU C;  3GFI A;  2V1X A;  2R7D A;  4ESF A;  4LFU A;  4U0W A;  1IN4 A;  1GXQ A;  1HXD A;  1ZLJ A;  4ZH4 F;  1R1U A;  4MQV A;  5JI6 A;  1F4K A;  4PZJ A;  3DFG A;  3E6B A;  4UVC A;  3HSF A;  4U0V A;  5FO5 A;  5L3D A;  4P9F A;  4WF2 A;  3WTX C;  2LF8 A;  3IWZ A;  3COA C;  1KU7 A;  4EGY A;  2Z33 A;  1NHA A;  2G7U A;  3LA7 A;  5H6Q A;  3V7R A;  3EQL F;  4Q4Z F;  2RVC A;  2O61 A;  2LSO A;  1FZP B;  4L9T A;  2KIM A;  3WGH A;  4CZZ A;  1FY7 A;  2IRF G;  4P96 A;  4ZZL A;  3SZT A;  3O2P E;  4RAZ A;  3L9F A;  4L5J A;  2XVC A;  1ZRC A;  1B6A A;  3EUH A;  3QP5 A;  1RI7 A;  5D8L B;  3N97 A;  4IJA A;  4AD9 A;  1IRF A;  3WTY C;  2ISY A;  1UHM A;  4UVB A;  3ZN0 A;  4OOI A;  3DXJ F;  1XN7 A;  1FBS A;  3RYR A;  5JVT A;  2W84 A;  3FM5 A;  5K5Q A;  1XMK A;  1QO0 D;  1PP8 F;  4ZYE A;  1AWC A;  4KIB A;  2ESH A;  2DK5 A;  5K5O A;  1XGN A;  1R00 A;  4IHS A;  1TNT A;  5LRS A;  1FNN A;  3ECH A;  2XKO A;  2VON A;  1BI3 A;  3SFZ A;  4MEX F;  4M72 A;  2IW5 A;  4GCV A;  1MZB A;  1W7P B;  3KET A;  4Q48 A;  2FE3 A;  1XB4 A;  4U7B A;  1XGS A;  2PEX A;  3M8E A;  3HRT A;  1TQP A;  3HIF A;  1MJ9 A;  1FLI A;  4DNC A;  4ZYG A;  2K27 A;  2M1B A;  3ZMT A;  4DQ2 A;  2YX4 A;  4M73 A;  4CGZ A;  1REP C;  4O6J A;  2DTR A;  4YFX F;  3KP7 A;  3W6J B;  3FWE A;  1UCR A;  1XSX A;  2DLL A;  1D8J A;  2ZJ2 A;  3NRV A;  1HST A;  2UXX A;  5HOO A;  3J80 Z;  3WTW C;  3P9K A;  5L3G A;  2JRT A;  3I54 A;  5F6F A;  4LLN A;  3QAH A;  2A3S A;  4OIN F;  5D8K B;  1LQ1 A;  1MDM A;  4KIC A;  1MD0 A;  1DP7 P;  2QBY B;  1G6N A;  4LG0 B;  1QNT A;  3KP6 A;  1YG2 A;  1S29 A;  1DDN A;  2RKH A;  3LFK A;  3RPU A;  2JZY A;  4P9U A;  5JFR A;  1CGP A;  3ZQ7 A;  3PQK A;  2OBP A;  3I0T A;  2Z99 A;  3FXR A;  2R3S A;  1T2K A;  2DQR A;  4A6D A;  2O03 A;  3E5U A;  3TKY A;  2ZNY A;  4HLX A;  3K2Z A;  4HW0 A;  2PI0 A;  5DV5 A;  1ON2 A;  4EJU A;  1SFU A;  2A6H F;  3T8T A;  3BDD A;  4ETS A;  3U1D A;  3F8M A;  4KDP A;  4LK1 F;  5FD6 A;  1JHH A;  3HHG A;  3OOP A;  4EM1 A;  4HDU A;  2PG4 A;  3B73 A;  1R1T A;  3P9I A;  2V6C A;  3T0Y A;  1IN6 A;  3FMS A;  5HDG A;  1U5T B;  4A2U A;  4L0Y B;  2MLK A;  3TO6 A;  2VC1 A;  1IZ1 A;  5E8G A;  3SQN A;  1ZRE A;  3EDP A;  2FMY A;  4UHT A;  3T5X A;  5F64 A;  2VOO A;  4OU0 A;  4ON0 A;  2E7W A;  5DCF A;  1LNW A;  3R61 A;  4RGR A;  3H3Z A;  4LJZ F;  1KYW A;  4A0Z A;  2Z3Y A;  2TDX A;  3ABT A;  4ENJ A;  4UV8 A;  4HBL A;  2LDU A;  2O6G E;  2A61 A;  4KMU X;  1U78 A;  5HS9 A;  3QPT A;  4MQ9 F;  1KYZ A;  1EH6 A;  4XSZ F;  2KIU A;  4LGW A;  3F8C A;  4KMF A;  3SXY A;  4M9S A;  3HOS A;  2P5L C;  4A5N A;  3BRO A;  4BHP A;  2Z9O A;  4P55 A;  2NNN A;  2DO7 A;  2EFQ A;  2FA5 A;  4KIF A;  2MBF A;  3LWF A;  5FFX A;  1SD5 A;  4N9I A;  4RB2 C;  5LGU A;  2Y75 A;  4XBF A;  4HF1 A;  4G7O F;  5ICF A;  1LJ9 A;  3ISP A;  2ZNZ A;  1MJA A;  1KU3 A;  3CUO A;  5E1Z B;  1QQI A;  3IRR A;  2GAU A;  5LLQ A;  3GXO A;  3IRQ A;  2DPU A;  3G73 A;  2XAH A;  5BQT A;  4YFN F;  5TRD A;  2XAS A;  1OMI A;  1HKS A;  2LNB A;  2A5Y B;  1O3T A;  2PMH A;  3FF5 A;  1FP2 A;  4WWC A;  3DQV C;  2VE8 A;  2G7H A;  4XLP F;  5KVR A;  4YIF A;  4RB3 C;  2QQB A;  4LMY A;  1UB9 A;  2WV0 A;  3JSO A;  4KFC A;  5E18 F;  3GEZ A;  4M74 A;  1XSD A;  2XIG A;  2E7X A;  1ONV A;  2IA1 A;  1J59 A;  4G6D A;  4IRI A;  3CUQ C;  1IF1 A;  1ZG3 A;  5LRR A;  1KA8 A;  4MTE A;  4WK8 F;  2K4B A;  2W57 A;  4HYE A;  4UXN A;  2L4M A;  3IC7 A;  1V3F A;  3M1E A;  4UVA A;  2E1C A;  5JHU A;  2NAZ A;  3CUQ B;  1U6G A;  4BHC A;  3QU3 A;  4M9X A;  5IT9 Z;  4KT5 C;  2WC2 A;  4HAM A;  3IHU A;  5LGN A;  4M9Z A;  2NYX A;  2QUF A;  4PDK A;  3BPV A;  4KA4 A;  2RNJ A;  5DYM A;  1DUX C;  3J7A O;  1IN7 A;  3DPL C;  1T98 A;  2RV8 A;  3DPT A;  1HBX G;  3N4M A;  2HQR A;  4O3M A;  3F6O A;  4QLC U;  1ZLK A;  2JTV A;  2BGC A;  4G6Q A;  1L0O C;  1WWX A;  3HHH A;  3K69 A;  3VOD A;  2XAJ A;  3AAF A;  4RB1 A;  4BH9 A;  1QZZ A;  1TQI A;  3KP4 A;  1FP1 D;  2M87 A;  3I59 A;  1ZYR F;  3GZ5 A;  1LEA A;  1SAX A;  2M30 A;  1D8K A;  3MCZ A;  5HS8 A;  1P4W A;  1OKR A;  1IN8 A;  2RDP A;  3HOT A;  3BP8 A;  1YIO A;  2QWW A;  4I98 B;  3CO7 C;  3MZH A;  3ZMZ A;  3SHF A;  4YFK F;  1G3T A;  2CSO A;  4Z2Y A;  3HTU A;  1R22 A;  4HDV A;  1YLF A;  2J5P A;  1TQM A;  3J81 K;  2RQP A;  1TBX A;  4Y17 A;  2H94 A;  1BIB A;  2GZW A;  2IJL A;  2YSR A;  4F7Z A;  2UXN A;  3QRF F;  1UST A;  3V7C A;  1PUE E;  1J0R A;  3WE3 A;  2VN2 A;  4A6E A;  4EMS A;  3L00 A;  2R7F A;  1RUO A;  1LB2 A;  1S8N A;  4IRG A;  1T38 A;  1G3S A;  1YW8 A;  1HKQ A;  3O3K A;  1J9I A;  2ISZ A;  1LDJ A;  1R1V A;  2P7C B;  5D4S A;  2D1V A;  1RNL A;  2MA3 A;  1YS6 A;  2YU3 A;  1UFM A;  4L9N A;  2ZME B;  3WG9 A;  5HDN A;  3V4G A;  5DUK A;  5DCM A;  1DPU A;  1I5Z A;  3P9C A;  3F6V A;  2HEO A;  3M9A A;  2RC4 A;  3KZY A;  2KIF A;  4EJO A;  4L5I A;  3R0A A;  2COM A;  1HW1 A;  2BEO A;  5FGM A;  1EV7 A;  1R7J A;  3HSE A;  2VBW A;  2H27 A;  2EV6 A;  3CUQ A;  2QM3 A;  2QQ9 A;  1R58 A;  1JHF A;  3WGI A;  1O3R A;  1SMY F;  4L9J A;  2CWE A;  3KCC A;  2L02 A;  1L3L A;  3QOP A;  5HVQ C;  3L2C A;  1Z05 A;  4I2O A;  2VBX A;  1B1B A;  1S6L A;  2CGP A;  1QPM A;  1TTY A;  2QVO A;  2MLG A;  5J8F A;  5DCM B;  1E2X A;  4KNY A;  4OIP F;  4O5V A;  5CVU A;  2PBI A;  1J2X A;  1BI0 A;  2DQL A;  1B9N A;  4ZYD A;  2RN7 A;  1MJB A;  1TW3 A;  4M71 A;  4HX4 A;  1SD7 A;  3V8J A;  1HSJ A;  1HW5 A;  1B9M A;  2F5C A;  1BIA A;  3KZZ A;  3LQQ A;  3KP5 A;  2P6S A;  3I58 A;  4JBA A;  3E5X A;  1GVJ A;  2MH9 A;  4LLL A;  1YO5 C;  3R6S A;  4CXF A;  2IPQ X;  3BJ6 A;  3G3Z A;  1IN5 A;  2D2W A;  1ON1 A;  5FLX K;  4E70 A;  4WXC A;  2Y48 A;  1W7P A;  1K78 B;  4ASN A;  1LDD A;  1I1S A;  4L0Z B;  3LA3 A;  3GFJ A;  4UUV A;  4S04 A;  2HTJ A;  3D0S A;  3GW2 A;  2VC0 A;  1BJA A;  1ZAR A;  2CFX A;  1RZ4 A;  4HLY A;  3HRM A;  1WSU A;  4G94 A;  1ZAO A;  4G7H F;  2DAO A;  3KP3 A;  5E17 F;  2PQ8 A;  2ZCW A;  3QU6 A;  5DEQ A;  3K9T A;  3P7N A;  1OYY A;  5CVV A;  3ZMS A;  3CLO A;  2F2E A;  5BPD A;  3TDU C;  1TLH B;  2CW0 F;  4RAY A;  4GYG A;  3J80 K;  3FZV A;  2NNY A;  2H6B A;  4RS8 A;  5ILU A;  3ZN1 A;  3V8L A;  2ADU A;  4QWQ A;  3ZPL A;  4LK0 F;  2GIV A;  2XV4 S;  4AVP A;  2K4J A;  4IPA A;  1A04 A;  3ML6 A;  2GA2 A;  2FBI A;  4NHJ A;  4OIQ F;  5HS7 A;  5ED4 A;  2OQR A;  3NEU A;  2VXZ A;  1BM9 A;  3TO7 A;  2P8T A;  2K86 A;  1S3J A;  1WKM A;  2OQG A;  3IKV A;  2FRH A;  4IVN A;  4G8X A;  1W5S A;  4FHT A;  5FB2 A;  1ZG1 A;  1CF7 B;  2OD5 A;  1QZY A;  3E97 A;  2F5F A;  2PMU A;  3RIR A;  3KFW X;  4HV6 A;  1RUN A;  5ICC A;  4CO8 A;  2M5W A;  1K6O A;  2PLY A;  2VT3 A;  4FX0 A;  3K0L A;  4G9Y A;  4ENM A;  3F21 A;  3RI4 A;  2FBH A;  3I5U A;  1MGT A;  2GA1 A;  3VEP A;  2HZT A;  1P2F A;  3WTS C;  3F8N A;  3CDH A;  3OV8 A;  2W24 A;  1OR7 A;  5AIQ A;  2EJR A;  2HYF A;  4I7H A;  1FYL A;  2HS5 A;  2F5D A;  2YPR A;  4XLN F;  4M6X A;  5D4R A;  1FBQ A;  5CJ9 A;  4GYI A;  3WTZ A;  3R60 A;  5BPI A;  2STW A;  2J5O A;  1WRJ A;  3GZ6 A;  1FC3 A;  4KN4 X;  1D5V A;  3ELK A;  2QBY A;  1MKM A;  2PFB A;  3RYP A;  1TNS A;  2H6C A;  4AIH A;  4BXU A;  1GHC A;  1UHW A;  3GLX A;  1WQ2 A;  1XDS A;  4PGG A;  1KU9 A;  4RB0 A;  4FT8 A;  3EYY A;  3TDZ C;  3F23 A;  1YFH A;  4PGH A;  2KJC A;  2ZME A;  2ZXJ A;  1JXS A;  3S2W A;  1B59 A;  1B4A A;  1KQ9 A;  2EFO A;  2M8E A;  2GXB A;  3IKT A;  1XSV A;  4WCG A;  4GXO A;  1P4X A;  4U88 A;  1K78 A;  2C6Y A;  2L54 A;  6PAX A;  3DEU A;  3F8B A;  3BZ6 A;  2W85 A;  5E8I A;  2MH2 A;  1FPQ A;  3PFI A;  3QP6 A;  3TGN A;  1HW2 A;  2B0L A;  2FML A;  2QYO A;  1IXC A;  1Y0U A;  1SFE A;  4RGU A;  2BBY A;  3U9G A;  1H9G A;  3FMQ A;  5DUI A;  2YX7 A;  4H0E A;  4R1H A;  1MDM B;  1O3Q A;  3KEO A;  1T6S A;  1USS A;  3EET A;  5L3C A;  1XDU A;  1CF7 A;  4S05 A;  2ZFW A;  3K1N A;  2AXL A;  4EJW A;  3M8F A;  5EEH A;  3K1M A;  3JAM K;  1IAW A;  1D3Y A;  4IRH A;  3EYI A;  1FX7 A;  3KP2 A;  5FLX Z;  3O6B B;  3I4P A;  1IW7 F;  3MEX A;  5CVR A;  2Z5U A;  2K02 A;  1Q1H A;  2A68 F;  2GWR A;  2HKX A;  1RIO H;  4LG0 A;  2P7V B;  4XSX F;  2A07 F;  2L3D A;  3TOB A;  3RTR A;  3WTT C;  1OPC A;  2UZK A;  4EM0 B;  4WXD A;  4RGS A;  2XGX A;  2MC3 A;  1TW2 A;  2RGV A;  1P92 A;  3F8F A;  2DU9 A;  1K79 A;  2JPC A;  2ZO4 A;  3L09 A;  1YS7 A;  2HWV A;  2VBY A;  3WE2 A;  2OAZ A;  2EWN A;  3TO9 A;  2L4A A;  2O0Y A;  4OIO F;  2CYY A;  2FBK A;  3C7J A;  4K2E A;  2X4H A;  1BOA A;  1H9T A;  3I59 B;  5FD5 A;  4HQE A;  4CYD A;  5KK1 A;  2HKO A;  1IRG A;  4HV5 A;  2BE5 F;  3K1P A;  5D5W B;  1XD7 A;  2GXG A;  3JW4 A;  3FXU A;  2ZKZ A;  2Q0O A;  1QBJ A;  3F72 A;  4ZYH A;  1G3W A;  2NRA C;  2FNP A;  4HX8 A;  1XCB A;  4A0Y A;  2W25 A;  1Z9C A;  1C0W A;  4M6Y A;  3LA2 A;  4LLG F;  1FSH A;  4MHG A;  4FX4 A;  1ZRF A;  1IXR C;  1LDK B;  2LF7 A;  5LHG A;  3GO5 A;  3BOQ A;  4IHT A;  2HFH A;  3FX3 A;  3LAP A;  5HLH A;  2Y0M A;  3T8R A;  3Q5F A;  1PDN C;  3ZP5 A;  4EM2 A;  2DBB A;  1KQ8 A;  1R5H A;  1BBY A;  3E6M A;  2DI3 A;  3C1D A;  4BQA A;  1OYW A;  3JTG A;  1ODD A;  1YYV A;  3KLO A;  3R4K A;  5LHH A;  2YR2 A;  1IUY A;  2EFP A;  5ICE A;  2HYG D;  1S7O A;  2VOD A;  3VB2 A;  3RPQ A;  4MGR A;  4N9H A;  4HA8 A;  2CO5 A;  1PP7 U;  1XMA A;  5D5V B;  4BHB A;  2DW4 A;  5LEK A;  5LHI A;  1ZRD A;  4OIR F;  1R23 A;  3Q9V A;  1GXP A;  1AOY A;  1BC7 C;  1WI9 A;  3DF8 A;  2NS0 A;  2DPD A;  3TOA A;  3HYI A;  2HTS A;  2WWY A;  1O7F A;  3HSR A;  1STZ A;  5AIP A;  2DT5 A;  1Z1D A;  1FSE A;  5DD4 A;  5A2Q K;  3RKW A;  2XAF A;  2CG4 A;  3VFZ A;  4U0Y A;  2KKO A;  3MQ0 A;  2WTE A;  2HR3 A;  4D0P A;  4I0A A;  4ENN A;  2JT1 A;  2D1H A;  1E17 A;  2E1N A;  2JSC A;  3ERE D;  2EV0 A;  5AON A;  1U2W A;  2OZ6 A;  1SD6 A;  2IT0 A;  2FF4 A;  4CHU A;  2EA2 A;  4B09 A;  1O7L A;  1U3E M;  1R5G A;  1ZHF A;  1ZN2 A;  3TQN A;  5D6F A;  1J75 A;  3C3W A;  3ABU A;  4KYW A;  1FOK A;  1ZH5 A;  4ZZD A;  3E5Q A;  4UNO A;  5L3E A;  3V7S A;  1FT9 A;  3MZY A;  1W4M A;  5D5U B;  3KEQ A;  4TV7 A;  2DFI A;  3HRU A;  4BAY A;  2ETH A;  5J8C A;  1G3Y A;  1Z6T A;  2VOP A;  2ELH A;  3E3V A;  4R79 A;  3I53 A;  3B02 A;  2CQK A;  2H09 A;  3ZMV A;  5L3B A;  3WU1 B;  3D5L A;  1OYI A;  4I02 A;  2MD5 A;  1FWZ A;  3GFL A;  4KIG A;  4LB6 B;  1HQC A;  3SZP A;  3J81 Z;  4HQM A;  5ILV A;  4MNU A;  4UV9 A;  3GUD A;  1W5T A;  4I01 A;  3MFK A;  2KRF A;  1P4A A;  5CVJ A;  3GVA A;  3NQO A;  5CVI A;  4EJT A;  4IF4 A;  3FHZ A;  3RKX A;  4GO1 A;  2HDC A;  4HF2 A;  1J7K A;  3HUG A;  1F5T A;  2A6E F;  1U5T A;  2QZ8 A;  1VTN C;  2F5E A;  2XHK A;  4U7D A;  4YG2 F;  1YW7 A;  4HF0 A;  5ERI A;  4Y13 A;  2IA0 A;  4EJV A;  3GFM A;  3BPX A;  3M7G A;  4YII A;  1LEB A;  4EGZ A;  1X3U A;  3BWG A;  2JPB A;  2EFW A;  2XRO A;  4P5O A;  3GF2 A;  4AIJ A;  5IT9 K;  2AS5 F;  2VT2 A;  4MEY F;  3FXQ A;  5HLG A;  2HGC A;  3IWF A;  3KE2 A;  3MWM A;  4WX9 A;  2D45 A;  4Y15 A;  3CJN A;  3LAJ A;  2ZBK A;  1P6R A;  2FOK A;  4ENK A;  5LEJ A;  4LB5 A;  2EK5 A;  1U5T C;  3JAM Z;  1ZG5 A;  2V79 A;  1KQ0 A;  3MAJ A;  1FBU A;  1ZGJ A;  1I1G A;  3E6D A;  1KGS A;  5DDG A;  3R0J A;  4JQF A;  4HZF A;  2EFN A;  4ESB A;  5HLI A;  2FU4 A;  3VOE A;  1ULY A;  1I6X A;  3F22 A;  3Q9S A;  3RKY A;  4AIK A;  1Z6R A;  1S7A A;  1FYK A;  3WU0 A;  3LQR A;  5FFZ A;  3WOD F;  4HOB A;  5EEG A;  5TJJ A;  3CTA A;  2OU2 A;  4A0X A;  5BS6 A;  1F1Z A;  3CO6 C;  2M45 A;  4L9V A;  2EA4 A;  2XAQ A;  1SMT A;  4Q47 A;  2ESN A;  1YQA A;  1QGP A;  2GQQ A;  1Z91 A;  4RGX A;  3W6K B;  4KN7 X;  1H0M A;  4GGG A;  5E1X A;  5J6X A;  3JTH A;  1BC8 C;  3BJA A;  3FMR A;  5K1Y A;  3GX4 X;  3H3U A;  1FYM A;  1W7P D;  3IL2 A;  3DP7 A;  2LKP A;  1DPR A;  2IA2 A;  4EV0 A;  5LBQ A;  5IT3 A;  3FM3 A;  5D5X B;  3LST A;  3GWZ A;  4XRF A;  5F1R A;  3T1B A;  4EVI A;  1YW9 A;  5L3F A;  4OMY A;  3WTV C;  2VE9 A;  5BMZ A;  4NQW A;  1U8R A;  1T0F A;  5CYV A;  1EH8 A;  5E20 A;  1O57 A;  2V1U A;  1HKT A;  1YTY A;  1JGS A;  2P5V A;  5LGT A;  3WGG A;  1KU2 A;  1JE8 A; 
#chains in the Genus database with same CATH topology
 3H92 A;  3HRS A;  1OCT C;  4YRV A;  2K7L A;  2FEZ A;  2HOT A;  1T39 A;  3E6C C;  4R8H A;  1MSE C;  4PCQ A;  3PQJ A;  1ZR2 A;  3HTS B;  2GIZ A;  2NVX J;  2R7O A;  3H5R A;  3DV8 A;  1V4R A;  2Y31 A;  1XGO A;  1WJD A;  4M3B A;  4V2G A;  5BNG A;  1VQ8 I;  2KRC A;  3HOZ J;  2HXO A;  1NG7 A;  2CJJ A;  2KJB A;  5D6E A;  2L01 A;  3ZR8 X;  4XKC A;  3AKZ A;  3S32 A;  3L7W A;  3PIP F;  2HNH A;  2X85 A;  4M3D A;  5ILS A;  1J5Y A;  2F4I A;  4BJ5 C;  1Z67 A;  1BI2 A;  4A3J J;  1QU3 A;  4N0B A;  3JSP A;  4NB5 A;  4MTD A;  5DD8 A;  1MBJ A;  2VBZ A;  5M3M J;  4QIW N;  2V1D A;  2L0K A;  3I71 A;  4CDG A;  1R6R A;  2M34 A;  2BV6 A;  2ZSH B;  2JUG A;  4AWX B;  4XMY A;  4A5M A;  4CIC A;  2QLZ A;  3BY6 A;  1EJ9 A;  4FIS A;  4XOP A;  4Y3O A;  2DOF A;  1IRZ A;  2LRD A;  1D0Y A;  2ECB A;  3U2R A;  2XRN A;  4KIT B;  2CUF A;  3H0G J;  3HOW J;  2P6T A;  2DDB A;  2R4G A;  3RDI A;  2P5K A;  4PK4 A;  4JP0 A;  4B8X A;  5BOX A;  2HOE A;  3JRE A;  2H8R A;  1T0F C;  2O3F A;  1G4D A;  2PJP A;  2KHM A;  5CLS A;  4DW6 A;  2OZU A;  2L9R A;  1QPI A;  3H9Q A;  1SFK A;  1KON A;  2Q2E A;  4RAG A;  4BYY A;  2OA4 A;  4OMZ A;  3V8K A;  2VAS A;  2QEN A;  5CQE A;  3G1M A;  2FSW A;  2IVM A;  2L5Q A;  3AFH A;  3I4N J;  1Z7L A;  3DKW A;  4LD5 A;  1BI1 A;  1MND A;  4L18 B;  1ERD A;  1X3Z B;  2XUB A;  4J00 A;  1OCC H;  1BW5 A;  2FOW A;  2IP2 A;  2RNG A;  3H5A A;  3J7Z I;  3JRC A;  4JK1 X;  4KUM A;  1R36 A;  2V9V A;  3QPH A;  2M3A A;  2BHZ A;  5DTD A;  2VKH A;  1YOV B;  3BQZ A;  5M5W J;  4XLC A;  4E7I A;  3I64 A;  3RJP A;  3ECO A;  1SFX A;  5J1R A;  3PL8 A;  3OY9 A;  2GOM A;  2G9W A;  5IOY A;  3ABK H;  2HVQ A;  1QHG A;  5H6R A;  2DK8 A;  4I09 A;  1UEL B;  1MMA A;  1JKO C;  5HDK A;  1JUS A;  2UWM A;  3VYS B;  3WG7 H;  4PJM A;  5K5R A;  2R5Z A;  3CF2 A;  4DYR A;  2BY3 A;  2X0L A;  3HBL A;  3CDL A;  2LK2 A;  3BJO A;  4GDF A;  1DGR M;  3KLN A;  2BYV E;  3CCS I;  3ULQ B;  4ZDL A;  2IGK A;  4IXA A;  2Q8K A;  3D5R C;  3ZMU A;  5E79 C;  5E1W A;  2KPM A;  2RRE A;  1Y39 A;  3A2K A;  2OCE A;  5A2Q Z;  5JR3 A;  1HOM A;  4EQQ A;  4A12 A;  1IXS B;  4F93 B;  2ACJ A;  2XKP A;  5ICG A;  2EV5 A;  2EB7 A;  1Z7U A;  2FQ3 A;  5H20 A;  3G1O A;  2HQN A;  2O8X A;  3GYH X;  4LIT A;  1XCV A;  4HX7 A;  3CCQ I;  2QSG X;  2FXA A;  1UZC A;  3OL4 A;  2STT A;  2QQA A;  2PN6 A;  3NWS A;  3REO A;  4BE0 A;  1Y8R B;  4G7Z F;  1O3S A;  2F5V A;  1S72 I;  3ROU A;  1F9N A;  3L2Q A;  1YX3 A;  1XGM A;  3KYD B;  1ZGA A;  2V1N A;  2XAG A;  1EH7 A;  3C18 A;  4WXH A;  1SD4 A;  4XIC A;  1BN5 A;  3BTC A;  1MSF C;  2FNA A;  2B63 J;  1K7A A;  3F3X A;  3ZMD A;  2A69 F;  3OSF A;  4IX7 A;  4Q5S F;  4N4N B;  1I27 A;  4ESJ A;  4BNC A;  2P4W A;  1BW6 A;  3TBI A;  4I0B A;  1LVA A;  4CCM A;  1PUF B;  3HL2 A;  4IZZ A;  1ZK8 A;  3WTU C;  4XKV A;  2KL4 A;  1FMV A;  3GFI A;  2V1X A;  4XLE A;  2WAE A;  4PSX A;  2R7D A;  2XPW A;  4ESF A;  4LFU A;  1Z21 A;  3HPG A;  4U0W A;  2CQN A;  1IN4 A;  1I3Q J;  1GXQ A;  1HXD A;  2FQ4 A;  1G59 A;  4E7L A;  4PJN A;  1ZLJ A;  4ZH4 F;  3CZ6 A;  1R1U A;  4MQV A;  5JI6 A;  3S1M J;  3F0C A;  1F4K A;  4PZJ A;  3CES A;  3DFG A;  3GTM J;  2V26 A;  3E6B A;  4UVC A;  2JVH A;  2JJ7 A;  2X1E A;  3HSF A;  3QWL A;  4U0V A;  5FO5 A;  1NK2 P;  1ACI A;  1WGX A;  3LSP A;  5L3D A;  4P9F A;  4WF2 A;  1XX5 A;  3WTX C;  2LF8 A;  3IWZ A;  3CCR I;  3FXM A;  3COA C;  1KU7 A;  5EZH A;  4EGY A;  2Z33 A;  2PX9 A;  5JVG F;  1NHA A;  2G7U A;  3LA7 A;  5H6Q A;  3V7R A;  2PJR B;  4B3X A;  5J1U A;  3EQL F;  4Q4Z F;  5JHF A;  2RVC A;  2O61 A;  1W5C C;  1NH3 A;  2LSO A;  1FZP B;  4BL0 B;  4L9T A;  3BG7 A;  3KX2 A;  3QQA A;  4C3I J;  2KIM A;  3KPH A;  3WGH A;  1FY7 A;  4CZZ A;  3DBH B;  3DEW A;  3HDD A;  2IRF G;  1XPX A;  1FIP A;  4P96 A;  4ZZL A;  2IS4 A;  3D1N I;  3SZT A;  1ZKG A;  2DTZ A;  3O2P E;  1X19 A;  4RAZ A;  1RKW A;  3L9F A;  3RSN A;  4L5J A;  1WJC A;  3CC4 I;  4XOT A;  2XVC A;  1ZRC A;  4DJA A;  1HLV A;  1B6A A;  3EUH A;  2VPR A;  3QP5 A;  1RI7 A;  5D8L B;  3H0D A;  1N77 A;  1ZTR A;  3N97 A;  4IJA A;  4AD9 A;  1SAN A;  1IRF A;  1R4M B;  3WTY C;  3OYJ A;  2ISY A;  2CV1 A;  1UHM A;  4UVB A;  3LSK A;  2M0C A;  2KP6 A;  3W2V A;  5F27 A;  2N8G A;  5IP9 J;  3ZN0 A;  2DA2 A;  4OOI A;  4JX6 A;  1SVM A;  3DXJ F;  3I55 I;  3S15 J;  4XRS A;  1XN7 A;  1FBS A;  3RYR A;  5JVT A;  2W84 A;  4IEJ A;  5C44 J;  1FOY A;  3DKY A;  3FM5 A;  5K5Q A;  3MKY B;  1XMK A;  1QO0 D;  4Z6Y A;  2JA6 J;  1PP8 F;  2FX0 A;  1MBH A;  1TP4 A;  3LSM A;  4ZYE A;  2JMW A;  1AWC A;  1TWH J;  3OMY A;  4KIB A;  2ESH A;  2DMQ A;  2ELJ A;  1X1D A;  2DK5 A;  5K5O A;  3UKG A;  2IGM A;  2X9D A;  1TWF J;  1XC5 A;  1XGN A;  1XMX A;  3ZXS A;  4AC0 A;  2LD5 A;  1R00 A;  1R49 A;  2DA3 A;  4IHS A;  1TNT A;  4YIR X;  5LRS A;  4JX4 A;  1FNN A;  3ECH A;  2XKO A;  3HOX J;  2VON A;  1JUP A;  3PSI A;  2KRH A;  1XG1 A;  1IRX A;  2ZFU A;  1YIT I;  3ZQI A;  1OLT A;  4V19 K;  1VQN I;  2WAQ N;  1BI3 A;  2DFE A;  2IW5 A;  4M72 A;  4GCV A;  3SFZ A;  3K4N A;  4MEX F;  1MZB A;  1W7P B;  4PUS A;  4EAT A;  2WA0 A;  3KET A;  4Q48 A;  2FE3 A;  4A3L J;  1XB4 A;  4U7B A;  1XGS A;  2PEX A;  3HKZ N;  1E3O C;  3M8E A;  1TWA J;  2DOE A;  1O4X A;  3HRT A;  1TQP A;  3ESW B;  3HIF A;  1YRN A;  1MJ9 A;  3F9K A;  5DS9 A;  2BXZ A;  1FLI A;  3K4K A;  4CZC A;  4DNC A;  1G2H A;  4IQ4 A;  4ZYG A;  2K27 A;  1P7J A;  1ETQ A;  3OYK A;  2M1B A;  3ZMT A;  4A3I J;  4LG3 A;  2CUJ A;  1ZEL A;  4DQ2 A;  4XRM A;  4ZTF A;  2YX4 A;  4B4C A;  4M73 A;  4CGZ A;  2LH9 A;  1REP C;  3ABL H;  4O6J A;  1VFC A;  3B6A A;  1EF4 A;  4XR6 A;  2DTR A;  3M8J A;  5GTH C;  2KDO A;  4YFX F;  3KP7 A;  2MSY A;  3W6J B;  3FWE A;  2BY0 A;  1MH4 A;  3HC7 A;  2KIQ A;  1UCR A;  1X2M A;  1XSX A;  3EUA A;  2DLL A;  1D1A A;  3OYE A;  5CPR B;  1D8J A;  2AO9 A;  2EIN H;  2ZJ2 A;  2ZSI B;  2CH0 A;  2DA1 A;  3NRV A;  4GRI A;  1HST A;  4BJT A;  5GAE J;  2DT6 A;  2UXX A;  2IS6 A;  5HOO A;  3J80 Z;  3WTW C;  2X51 A;  3P9K A;  5L3G A;  4I76 A;  4AU7 A;  2EIL H;  2JRT A;  3IH4 A;  1IC8 A;  3I54 A;  5F6F A;  3VPR A;  2IS2 A;  1X4O A;  2HPI A;  4LLN A;  3QAH A;  5K7Z A;  3LSI A;  2EQR A;  2UV1 A;  2A3S A;  1IV6 A;  1IDY A;  3WHC A;  4OIN F;  5D8K B;  1LQ1 A;  1MDM A;  4KIC A;  2E1M C;  1LKX A;  1MD0 A;  2YS9 A;  1DP7 P;  2QBY B;  2VJ4 A;  1G6N A;  4KIS A;  5DM7 F;  1QNT A;  3KP6 A;  4LG0 B;  1YG2 A;  3PFY A;  3MMY B;  1S29 A;  5J3L A;  2QKL B;  4S0H B;  1DDN A;  3HG9 A;  2RKH A;  1APL C;  3LFK A;  3BR3 A;  5FKO A;  2F4M B;  3RPU A;  2JZY A;  4P9U A;  3CCV I;  4BQN A;  5JFR A;  1WH7 A;  1CGP A;  2IAI A;  3ZQ7 A;  3PQK A;  3OR2 C;  2OBP A;  2RAE A;  3I0T A;  2Z99 A;  3FXR A;  2R3S A;  4UUS A;  1T2K A;  2DXI A;  2DQR A;  3HEF A;  2X48 A;  4A6D A;  2O03 A;  2YUS A;  3E5U A;  3TP0 A;  4A93 J;  3TKY A;  2IEK A;  4NC6 A;  3FXK A;  2ZNY A;  3J7Y J;  3CMY A;  4ZDO A;  4HLX A;  1Y56 A;  3OSG A;  3JCU C;  3K2Z A;  4HW0 A;  5KHD A;  2PI0 A;  2AHQ A;  4A3B J;  5DV5 A;  1ON2 A;  4EJU A;  1SFU A;  2A6H F;  2E1M B;  2KZV A;  3T8T A;  3BDD A;  4ANJ A;  2VKV A;  4ETS A;  4X6A J;  2E36 A;  3U1D A;  2VQH A;  3F8M A;  3D5S C;  2KIS A;  2WB1 N;  4KDP A;  1W1W E;  4LK1 F;  1YIJ I;  3A1Y A;  1POG A;  5FD6 A;  4UB6 C;  1JHH A;  3HHG A;  2QEX I;  2XC7 A;  2CV2 A;  5TIS C;  3LSR A;  3OOP A;  4HNV A;  3L2U A;  4EM1 A;  3BQY A;  4RM2 A;  4HDU A;  2PG4 A;  3B73 A;  2W1O A;  1R1T A;  3P9I A;  2V6C A;  3V42 A;  3T0Y A;  1IN6 A;  3FMS A;  5HDG A;  4J19 A;  1U5T B;  4A2U A;  2CUZ A;  2CQ7 A;  4L0Y B;  2MLK A;  3TO6 A;  1A36 A;  2VC1 A;  2NS8 A;  4OAZ A;  4XQF A;  1IZ1 A;  1S7E A;  5E8G A;  3SQN A;  1ZRE A;  3K4M A;  3EDP A;  1IJW C;  1V5F A;  3J7A Y;  2FMY A;  4UHT A;  3T5X A;  1MNE A;  2HZD A;  5F64 A;  1AKH B;  3IV5 A;  2HQ5 A;  3PNY A;  2F48 A;  3C2H A;  2VOO A;  4OU0 A;  4ON0 A;  2G0E A;  1V5G A;  2E7W A;  4HPQ A;  1LNW A;  2AXT C;  5DCF A;  3R61 A;  2DMN A;  4RGR A;  2COB A;  3H3Z A;  4LJZ F;  1KYW A;  3CMA I;  3I3L A;  1OCO H;  3SFI A;  3JR9 A;  3OR1 C;  1U8B A;  4A0Z A;  2Z3Y A;  2TDX A;  2AQE A;  3ABT A;  4ENJ A;  1CQT A;  4UV8 A;  4M3E A;  4BE1 A;  4HBL A;  4HG2 A;  2LDU A;  1JJ6 C;  2O6G E;  2A61 A;  4KMU X;  1U78 A;  1T8I A;  3HGY A;  5HS9 A;  3QPT A;  4MQ9 F;  4FE7 A;  3PIO F;  1KYZ A;  1WVR A;  1QVU A;  2I5U A;  1EH6 A;  4XSZ F;  2KIU A;  4LGW A;  3F8C A;  4KMF A;  3S1Q J;  5TGT A;  3SXY A;  3BG3 A;  4M9S A;  1N25 A;  2L7Z A;  5CQG A;  3HOS A;  3GLL A;  2JSP A;  3A03 A;  4CCK A;  2P5L C;  2RQQ A;  4A5N A;  1VZ0 A;  2F4O B;  3M3Y J;  3BRO A;  4BHP A;  1B8I B;  2GOX B;  2Z9O A;  4P55 A;  2NNN A;  4LIV A;  2DO7 A;  2EFQ A;  2FA5 A;  2Y2Z A;  2MBF A;  3LWF A;  4KIF A;  5FFX A;  1SD5 A;  4N9I A;  4RB2 C;  5LGU A;  2ZXI A;  4UUT A;  2Y75 A;  4XBF A;  4HF1 A;  2HVS A;  3S2D J;  2CUE A;  4E7Z A;  3JRG A;  1Y1W J;  4G7O F;  5ICF A;  1LJ9 A;  1YJW I;  3OIO A;  3A02 A;  4NBQ A;  3ASN H;  3ISP A;  2ZNZ A;  1MJA A;  2XGE A;  3CP2 A;  3SEZ A;  1FTZ A;  3DWL E;  1KU3 A;  2M9H A;  3CUO A;  5E1Z B;  4FE4 A;  3JRB A;  1QQI A;  2Y9Y A;  3IRR A;  2HU9 A;  2GAU A;  5LLQ A;  3GXO A;  1F36 A;  1IV8 A;  3IRQ A;  2DPU A;  3Q0W A;  3ZQF A;  2R7S A;  1MW7 A;  3G73 A;  2XAH A;  5BQT A;  1X3W B;  4YFN F;  5TRD A;  2XAS A;  1OMI A;  4NC7 A;  2DOD A;  1VQ5 I;  1HKS A;  2LNB A;  3CCE I;  1QA6 A;  2A5Y B;  2BY1 A;  3GME A;  2K9L A;  1O3T A;  2PMH A;  3WU2 C;  4XKW A;  3FF5 A;  4FET A;  3I56 I;  1FP2 A;  3G4S I;  4WWC A;  3DQV C;  1SEU A;  2VE8 A;  2O5R A;  3ZRG A;  3E1S A;  2R7W A;  1OIS A;  2G7H A;  4DYC A;  4XLP F;  5KVR A;  4YIF A;  1ETX A;  3FXO A;  2ZJR F;  3Q3S A;  1GVD A;  4RB3 C;  2QQB A;  4LMY A;  1UB9 A;  2EZL A;  1LVK A;  2WV0 A;  3JSO A;  4KFC A;  1V54 H;  2XF7 A;  5E18 F;  1SVL A;  3GEZ A;  4M74 A;  1XSD A;  2XIG A;  2E7X A;  3CF5 F;  3AL0 C;  1HF0 A;  1ONV A;  3ASO H;  3DU5 A;  1QHH D;  2ZXH A;  2IA1 A;  4W97 A;  2QF7 A;  1J59 A;  4G6D A;  1WHU A;  4IRI A;  3CUQ C;  4BGD A;  2JWT A;  1IF1 A;  4B43 A;  1ZG3 A;  1FEX A;  5LRR A;  2ME6 A;  2AQF A;  2NXN B;  4XON A;  3HB9 A;  4I99 C;  1ETV A;  1KA8 A;  3A0H C;  2O9L A;  4MTE A;  4WK8 F;  2K4B A;  2W57 A;  4HYE A;  4UXN A;  3MKW B;  1A35 A;  4RLF A;  3OYM A;  4BDZ A;  1A5J A;  2MW8 A;  2L4M A;  1TWG J;  3IC7 A;  1V3F A;  3M1E A;  4MIM A;  4UVA A;  3JRA A;  5JHU A;  1H88 C;  2E1C A;  2VQC A;  2NAZ A;  1ZQ3 P;  3B6C A;  2F6C A;  3CUQ B;  1U6G A;  5E3L A;  2NVQ J;  3O8H A;  4BHC A;  5LD2 C;  4IHX A;  3QU3 A;  1RC9 A;  4M9X A;  3K10 A;  2E19 A;  5IT9 Z;  4KT5 C;  2WC2 A;  2XAU A;  4HAM A;  3CJQ B;  3IHU A;  1MBK A;  5LGN A;  4M9Z A;  4C30 A;  1FOW A;  2NYX A;  2QUF A;  4PDK A;  3BPV A;  4A3K J;  4KA4 A;  1TWC J;  2XF6 A;  2R7U A;  4QSH A;  2RNJ A;  1J09 A;  5DYM A;  1DUX C;  3K70 D;  3G1L A;  3OIP A;  3J7A O;  1IN7 A;  2Q2E B;  3DPL C;  4ABZ A;  5IYC J;  1T98 A;  2MD0 A;  5F08 A;  3S1R J;  1IGN A;  2E1O A;  2RV8 A;  2XRL A;  1WI3 A;  3DPT A;  1HBX G;  3N4M A;  5FRO A;  2IGN A;  2HQR A;  2VQG A;  2OC6 A;  4O3M A;  3F6O A;  1I39 A;  2R5Z B;  4QLC U;  1ZLK A;  2JTV A;  3SYT A;  2HDD A;  2BGC A;  4G6Q A;  1L0O C;  2VJI A;  1WWX A;  2VLA A;  3HHH A;  1LE8 A;  3K69 A;  3VOD A;  2XAJ A;  2JVG A;  2DA6 A;  3BTJ A;  2GLO A;  4IOA F;  3AAF A;  4RB1 A;  2LY2 A;  2K9N A;  4BH9 A;  1QZZ A;  3N05 A;  1TQI A;  3KP4 A;  1FP1 D;  2A05 A;  1FIA A;  2M87 A;  1ZYR F;  3BZC A;  3I59 A;  5KCM A;  3GZ5 A;  2VPL A;  1LEA A;  1SAX A;  1NTC A;  1XTA A;  2M30 A;  1D8K A;  3MCZ A;  4KT6 A;  5F0C A;  4M6V A;  2IS1 A;  5HS8 A;  1P4W A;  3LSG A;  2QA4 I;  1OKR A;  1IN8 A;  2RDP A;  3HOT A;  2EZH A;  3BP8 A;  1YIO A;  4UY8 I;  2BXY A;  2QWW A;  2MG4 A;  3GTJ J;  1VQL I;  3ZQC A;  2M7B A;  4I98 B;  3RCO A;  3CO7 C;  3MZH A;  2DA4 A;  1UAA A;  3ZMZ A;  3SHF A;  4YFK F;  1OCR H;  3M07 A;  4IKF A;  3PJR A;  1K4S A;  1G3T A;  1YX5 A;  3LSH A;  4BY7 J;  1X1C A;  1R9T J;  2CSO A;  3BG9 A;  4A3M J;  4Z2Y A;  3ZQQ A;  3HTU A;  2A5W A;  3WHB A;  1R22 A;  4HDV A;  3G2B A;  1YLF A;  2J5P A;  1TQM A;  4XN3 A;  2Q1Z B;  2M4K A;  3J81 K;  2RQP A;  1TBX A;  4Y17 A;  1PYV A;  2H94 A;  1BIB A;  2GZW A;  2IJL A;  4JX5 A;  2YSR A;  3S16 J;  3PNV A;  2R7T A;  4F7Z A;  4G6T B;  3MKL A;  2UXN A;  4ZDP A;  4CH7 A;  3GTQ J;  3QRF F;  1UST A;  1Z3Y A;  3V7C A;  2L9V A;  1PUE E;  1J0R A;  4RA2 A;  3WE3 A;  2VN2 A;  4A3E J;  3S3O A;  1P7I A;  2R7Q A;  1SFO J;  4DBR A;  1VI0 A;  4A6E A;  3PUF A;  1G8X A;  4EMS A;  2W4S A;  3W6V A;  3HUG B;  3L00 A;  2R7F A;  4IOC F;  1RUO A;  1X1P A;  1LB2 A;  1S8N A;  2NOJ B;  4IRG A;  1A6I A;  1T38 A;  2R7Z J;  3H5N A;  5IP6 A;  2WB1 A;  1XS9 A;  1G3S A;  1YW8 A;  1HKQ A;  3O3K A;  1J9I A;  3HXL A;  2ISZ A;  4DZP A;  2VJJ A;  1LDJ A;  2L9N A;  1R1V A;  2P7C B;  5D4S A;  4XKB A;  5M3F J;  1Q1V A;  1YRN B;  2D1V A;  3FKJ A;  1RNL A;  2MA3 A;  3DTE A;  1YS6 A;  2YU3 A;  1UFM A;  4L9N A;  2MYS A;  2OJE D;  2DA7 A;  3S17 J;  2DJI A;  2ZME B;  3WG9 A;  2KLO A;  3V4G A;  5HDN A;  5DUK A;  5DCM A;  5K7F A;  1DPU A;  1I5Z A;  3P9C A;  1JUM A;  2FUG 2;  3F6V A;  2HQA A;  2HEO A;  4C2T A;  3M9A A;  2RC4 A;  5F0H A;  3KZY A;  2KIF A;  3HGG A;  4E6K G;  4EJO A;  4L5I A;  5J40 A;  3R0A A;  1LFP A;  1S5L C;  3BR6 A;  2COM A;  1HW1 A;  2Z16 A;  1BOB A;  3RQ4 A;  1WJB A;  3SEQ A;  4C2U A;  2BEO A;  5FGM A;  5C4J J;  1EV7 A;  3FXJ A;  1R7J A;  2GBY A;  3HSE A;  2VBW A;  3LSJ A;  5EGO A;  2H27 A;  2EV6 A;  3CUQ A;  2QM3 A;  4P1W A;  2QQ9 A;  1R58 A;  2DMT A;  4ZJZ A;  1PVE A;  1JHF A;  3WGI A;  1O3R A;  1SMY F;  5FKK A;  1RES A;  4L9J A;  2CWE A;  4A69 C;  1K6Y A;  2MAB A;  3KCC A;  2L02 A;  1L3L A;  3HZJ A;  3QOP A;  2WBM A;  5HVQ C;  3CQZ J;  3L2C A;  1Z05 A;  4I2O A;  2VBX A;  1B1B A;  1S6L A;  1UJ8 A;  1ZGW A;  2CU7 A;  2QSH X;  2CGP A;  1QPM A;  2LOO A;  2QCO A;  4CUG A;  1TTY A;  4HNT A;  3K4B A;  2QVO A;  2MLG A;  5J8F A;  4D7N A;  5DCM B;  1GDT A;  3OS1 A;  1E2X A;  2L2O A;  3HM5 A;  4KNY A;  1YJ9 I;  2HOS A;  4OIP F;  4O5V A;  5CVU A;  3PO2 J;  1UG2 A;  1X58 A;  2PBI A;  2LBF B;  1J2X A;  3GTG J;  2WV1 A;  2DQL A;  1BI0 A;  1B9N A;  4ZYD A;  4QPO A;  2RN7 A;  1MJB A;  1TW3 A;  4M71 A;  5J4Y A;  4HX4 A;  1SD7 A;  3V8J A;  1HSJ A;  1HW5 A;  1B9M A;  1GV2 A;  2F5C A;  3M4O J;  1BIA A;  2VIX A;  2LRE A;  3KZZ A;  3LQQ A;  5GTI C;  5IP7 J;  5GAD J;  3KP5 A;  2P6S A;  2E2J J;  3I58 A;  1K61 A;  4JBA A;  5B1A H;  3OYA A;  3E5X A;  2DMP A;  3ERM A;  5JLW A;  2R7R A;  1GVJ A;  2MH9 A;  4LLL A;  1YO5 C;  1N75 A;  1TT5 B;  2PJR A;  4KJZ A;  4I6Z A;  4XK4 A;  3R6S A;  4CXF A;  2IPQ X;  2TCT A;  3BJ6 A;  2LKX A;  3S3N A;  4RLQ A;  3G3Z A;  2K9S A;  1IN5 A;  1FTT A;  2L7F P;  3BTI A;  3HPH A;  3SDG A;  2D2W A;  1ON1 A;  2OUM A;  5E3N A;  5FLX K;  4E70 A;  4WXC A;  1E3P A;  1LE8 B;  2Y48 A;  1W7P A;  1K78 B;  4XLF A;  4ASN A;  1LDD A;  2NS7 A;  1LPQ A;  4L0Z B;  1I1S A;  3LA3 A;  3GFJ A;  4UUV A;  1VQ7 I;  1OFC X;  4S04 A;  2HTJ A;  3D0S A;  3GW2 A;  2VC0 A;  2QQ8 A;  3MVP A;  1BJA A;  1ZAR A;  4YEJ A;  3O8G A;  4F92 B;  1P9Q C;  2CFX A;  1RZ4 A;  2DMU A;  4HLY A;  3HRM A;  4FQG A;  1WSU A;  4G94 A;  1ZAO A;  4OAY A;  4G7H F;  4XLA A;  2DAO A;  3ZGK A;  4RBO A;  3KP3 A;  4DOZ A;  5E17 F;  2VI6 A;  2PQ8 A;  1IUF A;  2ZCW A;  3QU6 A;  1DU6 A;  5DEQ A;  4D7M A;  2V4J C;  3K9T A;  1OYY A;  2LTP A;  3P7N A;  1ITY A;  4DBQ A;  3BCB A;  1RR8 C;  3JRD A;  3IUO A;  3OYG A;  5CVV A;  3ZMS A;  3CLO A;  2EPF A;  2F2E A;  5BPD A;  5FKM A;  2I10 A;  4PJJ A;  3TDU C;  4A3D J;  1NK3 P;  2BOL A;  1TLH B;  4M3F A;  2CW0 F;  4RAY A;  4GYG A;  2K5C A;  3J80 K;  3FZV A;  4BEH B;  1UMQ A;  2NNY A;  5EZG A;  2H6B A;  3CDI A;  1WPK A;  4AID A;  4RS8 A;  1KZH A;  5ILU A;  3ZN1 A;  3V8L A;  2ADU A;  4QWQ A;  5H2F C;  5CKT A;  3ZPL A;  2A6T A;  4LK0 F;  1AU7 A;  1V5E A;  2GIV A;  2XV4 S;  4AVP A;  2K4J A;  4NUB A;  1NG6 A;  1Z0X A;  4IPA A;  5FKN A;  1A04 A;  4HST A;  3ML6 A;  4HSR A;  4BBR J;  2GA2 A;  2VXD A;  1UHS A;  2OTJ I;  2FBI A;  4NHJ A;  4OIQ F;  1D1B A;  3RZO J;  5HS7 A;  3BG6 A;  5ED4 A;  2OQR A;  3NEU A;  2VXZ A;  3DU6 A;  1BM9 A;  4NDL A;  3TO7 A;  2P8T A;  5EYR A;  2K86 A;  1S3J A;  1WKM A;  3NWT A;  2HVR A;  2OQG A;  4B47 A;  3IKV A;  3AG1 H;  2FRH A;  1FOX A;  1ETY A;  4G8X A;  4IVN A;  4BEH A;  1W5S A;  2LY1 A;  4FHT A;  5FB2 A;  1ZG1 A;  2O8K A;  2R92 J;  1CF7 B;  2DFH A;  4BAC A;  3KIO A;  1TL8 A;  2OD5 A;  1QZY A;  3RKQ A;  3E97 A;  3SJM A;  3FIW A;  2F5F A;  2I8D A;  2PMU A;  3KFW X;  3RIR A;  3U1K A;  3MKZ A;  4ZYA A;  2M4G A;  3A01 A;  1W36 D;  4HV6 A;  1RUN A;  2PMZ A;  5ICC A;  2L7M P;  4CO8 A;  2M5W A;  1VQ4 I;  1D0Z A;  1K6O A;  2JA5 J;  2PLY A;  2VT3 A;  1OJL A;  2L7K A;  3LNQ A;  4IHW A;  2IGO A;  4FX0 A;  1WJE A;  2R5Y A;  1WJF A;  3K0L A;  4G9Y A;  2CW7 A;  4ENM A;  3F21 A;  5GPC A;  3VWB A;  1Z77 A;  4BY1 J;  3RI4 A;  2FBH A;  3PUB A;  2OCC H;  3I5U A;  4FAS D;  1MGT A;  2GA1 A;  3VEP A;  1I3A A;  1AHD P;  2HZT A;  5K7H A;  1P2F A;  2MC4 A;  1MBG A;  2VQL A;  3WTS C;  2R7X A;  3F8N A;  3CDH A;  3OV8 A;  2W24 A;  3VDX A;  2QGU A;  3CC7 I;  1OR7 A;  4U87 A;  5AIQ A;  1AKH A;  1V55 H;  3PNT A;  3S2H J;  3K4L A;  2EJR A;  2HYF A;  4I7H A;  4XLH A;  3FBI B;  5E3O A;  2K3P A;  2HS5 A;  4II3 A;  1FYL A;  2F5D A;  2YPR A;  4XLN F;  4M6X A;  5D4R A;  4CYC B;  1F43 A;  1FBQ A;  5CJ9 A;  2CV0 A;  3RQI A;  2FD5 A;  4GYI A;  3WTZ A;  3HKZ A;  1W0T A;  3R60 A;  5BPI A;  2STW A;  1YE9 A;  1JKQ C;  2J5O A;  1WRJ A;  5GP9 A;  3GZ6 A;  5EGO B;  4BQQ A;  1U0J A;  1FC3 A;  4KN4 X;  1D5V A;  3ELK A;  2QBY A;  1MKM A;  2LYC A;  2PFB A;  3RYP A;  2CW8 A;  1TNS A;  2H6C A;  3IH3 A;  4AIH A;  2K9Q A;  1GLN A;  4B3A A;  4BXU A;  1GHC A;  1UHW A;  1X2N A;  3OYF A;  2ZME C;  3GLX A;  3EUH C;  2VKE A;  1WQ2 A;  4AYB N;  1XDS A;  4PGG A;  1KU9 A;  3CCM I;  1RKT A;  4RB0 A;  2LBF A;  2WAF A;  4FT8 A;  3EYY A;  1BR1 A;  3TDZ C;  3QYF A;  4BJ6 C;  3F23 A;  1YFH A;  2E60 A;  4PGH A;  2KJC A;  4LIU A;  1PJR A;  2ZME A;  2V9K A;  5KNL A;  2BHY A;  3OYD A;  1X1A A;  3GZN B;  3LMM A;  2ZXJ A;  3K2A A;  3MN2 A;  5LFA A;  1JXS A;  1DGW Y;  3FKI J;  2HXI A;  1D0X A;  3S2W A;  1B59 A;  1B4A A;  4DIQ A;  3HOY J;  1KQ9 A;  2EFO A;  2M8E A;  4PSW A;  2GXB A;  1T33 A;  4D5C A;  3IKT A;  1XSV A;  2K9M A;  4CCO A;  4WCG A;  2Y30 A;  1LUJ B;  4CYC A;  4GXO A;  2CMP A;  4MO7 A;  1P4X A;  4U88 A;  4BXF A;  1VQ9 I;  1K78 A;  2C6Y A;  4AM3 A;  2L54 A;  2VL8 A;  4RM3 A;  4L5E A;  1WCM J;  6PAX A;  3DEU A;  4Y7N J;  3F8B A;  4BQO A;  3BZ6 A;  2W85 A;  3RZD J;  5IYB J;  5E8I A;  2MH2 A;  1FPQ A;  1PUF A;  2V6E A;  1MBE A;  3GCM A;  3PFI A;  2ME0 A;  3QP6 A;  3TGN A;  4CCN A;  3ZOB A;  4DZJ A;  5KAF C;  1HW2 A;  2B0L A;  2FML A;  2QYO A;  1IXC A;  1Y0U A;  1SFE A;  4RGU A;  3FK7 A;  5HNH A;  2BBY A;  3U9G A;  5F04 A;  1H9G A;  3FMQ A;  2E71 A;  3DPU A;  2X6W A;  4QTR A;  4IO9 F;  3OS0 A;  1B72 B;  2X6O A;  5DUI A;  1HCR A;  2YX7 A;  4GFB A;  4H0E A;  3BC8 A;  3K7A J;  4R1H A;  1MDM B;  1R4N B;  1O3Q A;  3TW6 A;  1S9H A;  1WJ5 A;  5GAG J;  3KEO A;  1T6S A;  1E3H A;  1JI8 A;  1USS A;  3EET A;  3FXL A;  5F0F A;  1XDU A;  5L3C A;  3ONQ A;  4XID A;  1CF7 A;  2V7F A;  2ZFW A;  1ENH A;  4S05 A;  3K1N A;  2AXL A;  4EJW A;  3M8F A;  5EEH A;  4E7K A;  3K1M A;  3JAM K;  2OV7 A;  1D1C A;  1IAW A;  1D3Y A;  3K70 C;  3BT9 A;  4HRI A;  5GPA A;  4IRH A;  2R7V A;  3EYI A;  5GAH J;  3OYL A;  1FX7 A;  4F91 B;  3L2V A;  3KP2 A;  2LR8 A;  1DU0 A;  5FLX Z;  3O6B B;  3BR2 A;  4NNJ A;  4CCL A;  3BCA A;  3I4P A;  1IW7 F;  4B44 A;  4FTH A;  3MEX A;  5CVR A;  2Z5U A;  3BG5 A;  3FHN A;  2K3F A;  5DM6 F;  3OYC A;  1VQP I;  3NAR A;  1VQO I;  1WFX A;  5E3M A;  1GUU A;  2K02 A;  5FRN A;  1Q1H A;  5EEA A;  2A68 F;  2GWR A;  2HKX A;  5EG0 B;  1RIO H;  4LG0 A;  3VYU B;  2P7V B;  2DYS H;  4XSX F;  2A07 F;  5EJC A;  3EPZ A;  2L3D A;  3TOB A;  1GV5 A;  3Q0V A;  3RTR A;  1DP3 A;  3WTT C;  1OPC A;  2UZK A;  4EM0 B;  1D5Y A;  3MD2 A;  4WXD A;  4D1Q A;  4RGS A;  1H89 C;  2XGX A;  3IAM 2;  2MC3 A;  2NVU B;  1TW2 A;  2RGV A;  2K85 A;  4LOC A;  1RET A;  2JRM A;  4A3C J;  1P92 A;  2DDA A;  3F8F A;  4RAF A;  2DU9 A;  4DGW B;  2PMZ N;  1K79 A;  2BVM A;  3LL7 A;  2W82 A;  2JPC A;  4C9Y A;  3JRF A;  1Y0N A;  2ZO4 A;  5HNF A;  3GTP J;  3L09 A;  1YS7 A;  3HOV J;  3H3V K;  2HWV A;  3CP8 A;  4C2M J;  3VYT B;  2YU9 J;  2VBY A;  3WE2 A;  2OAZ A;  2EWN A;  5B3S H;  3TO9 A;  2L4A A;  4QPQ A;  2O0Y A;  4NQW B;  4OIO F;  3ZQL A;  2CYY A;  2FBK A;  3C7J A;  4K2E A;  2X4H A;  1BOA A;  4JOM A;  1H9T A;  2HDW A;  3OYB A;  3I59 B;  4II2 A;  2LG4 A;  5FD5 A;  3K4J A;  1BR4 A;  2LY9 A;  4HQE A;  3KYL A;  3CCJ I;  4CYD A;  3KZI C;  5KK1 A;  1I6H J;  4V2F A;  3VSL A;  3H9J A;  2HKO A;  2ID3 A;  3GTL J;  4HV5 A;  1IRG A;  2WY8 Q;  2BE5 F;  1MMN A;  3K1P A;  5D5W B;  3FIS A;  1XD7 A;  5JLX A;  3QYE A;  2GXG A;  1ZR4 A;  3JW4 A;  2H8W A;  3FXU A;  2ZKZ A;  3SZG A;  3DBR B;  4E7H A;  2Q0O A;  3CLQ A;  1QBJ A;  4D9J A;  2KDZ A;  1WZ2 A;  1K4T A;  3F72 A;  4ZTJ A;  1VQK I;  1ETK A;  4ZYH A;  2BW3 A;  2E2I J;  3VSK A;  1G3W A;  1MIJ A;  4DYQ A;  2NRA C;  1OQY A;  2FNP A;  4HX8 A;  1XCB A;  4A0Y A;  1JT0 A;  2W25 A;  5C3E J;  1Z9C A;  1EA3 A;  1C0W A;  5C4X J;  4M6Y A;  1MMG A;  3LA2 A;  2UUZ A;  1TC3 C;  2LP0 A;  3HOU J;  4LLG F;  1FSH A;  5KAI C;  2GM4 A;  3E0J B;  2LC2 A;  3OYH A;  4MHG A;  5IOZ A;  4FX4 A;  1ZRF A;  4JYK A;  3Q0U A;  3DTI A;  1IXR C;  1LDK B;  1YI2 I;  2FJ1 A;  2LF7 A;  2E2H J;  2EH3 A;  5LHG A;  2X1C A;  1TZL A;  3GO5 A;  3VYR B;  2W00 A;  3BOQ A;  2R0Q C;  1B72 A;  4IHT A;  1ETW A;  3L2W A;  3I4M J;  2OPT A;  2HFH A;  3CCY A;  1IDZ A;  3FX3 A;  3H9G A;  2M2E A;  3K6G A;  4D5F A;  2E35 A;  2ELK A;  3DKX A;  3L1P A;  1HC8 A;  3LAP A;  4UUS B;  5HLH A;  2IXS A;  3G6E I;  2Y0M A;  1ORK A;  3T8R A;  3Q5F A;  5HLT A;  1PDN C;  3ZP5 A;  4EM2 A;  2DBB A;  1KQ8 A;  1R5H A;  1BBY A;  3OWT A;  3TMO A;  3E6M A;  9ANT A;  2DI3 A;  3C1D A;  3I9V 2;  4BE2 A;  3BR5 A;  1LFU P;  4BQA A;  1OYW A;  4BBS J;  3JTG A;  1ODD A;  2ICW G;  3OYN A;  2BY2 A;  1YYV A;  3KLO A;  3GTO J;  3JRH A;  3R4K A;  5LHH A;  2YR2 A;  1IUY A;  5EDN A;  3OS2 A;  2TRT A;  3CCU I;  2EFP A;  1WH5 A;  3W2W A;  3BTL A;  1SAU A;  3FK6 A;  5ICE A;  1BA5 A;  2HYG D;  1S7O A;  3L2R A;  2VOD A;  3VB2 A;  3RPQ A;  1I50 J;  2KMU A;  4BUP A;  4MGR A;  1GT0 C;  4N9H A;  4A3G J;  2XSJ C;  4Y52 J;  4HA8 A;  2CO5 A;  3S93 A;  1PP7 U;  1XMA A;  5D5V B;  4MFD A;  4BHB A;  4BDY A;  2DW4 A;  2EIM H;  3NAU A;  5LEK A;  2DYR H;  4XM3 A;  4E7S A;  2LLK A;  5LHI A;  1ZRD A;  2XDV A;  4MLO A;  3A01 B;  4OIR F;  1R23 A;  3Q9V A;  2W7N A;  1GXP A;  1AOY A;  5M5Y J;  1BC7 C;  3AG3 H;  4EEF G;  2LMD A;  1WI9 A;  3DF8 A;  2E34 A;  1IG7 A;  2NS0 A;  2DPD A;  1A6Q A;  3TOA A;  2NVT J;  3HYI A;  4NC8 A;  4PFO A;  2HTS A;  3CC2 I;  2WWY A;  1O7F A;  3HSR A;  1STZ A;  5AIP A;  1VQM I;  1QZE A;  5EG0 A;  4J01 A;  4C3J J;  2DT5 A;  2H1K A;  3QOE A;  3GTK J;  4FCY A;  4A3F J;  3ZQG A;  2HYJ A;  2Z1D A;  3ABM H;  1Z1D A;  3BZK A;  2EZK A;  1FSE A;  2DJN A;  2X6X A;  5DD4 A;  3RKW A;  5A2Q K;  1MNM C;  2XAF A;  2CG4 A;  3VFZ A;  1IO2 A;  4U0Y A;  2VKD A;  2KKO A;  4PJL A;  3MQ0 A;  3P5J A;  2WTE A;  2HR3 A;  2M7A A;  3C2B A;  4D0P A;  4XL9 A;  4I0A A;  4ENN A;  2ZXW H;  2JT1 A;  4RMN A;  4UB8 C;  5FRM A;  2D1H A;  1E17 A;  2BZT A;  4X1E A;  2E1N A;  2JSC A;  3IH2 A;  2KT0 A;  2K40 A;  3QOD A;  3ERE D;  1TT0 A;  3CMM A;  2EV0 A;  4IHY A;  3TW7 A;  2XB0 X;  5AON A;  1U2W A;  2X1D A;  3OOU A;  2OZ6 A;  5J4V A;  1SD6 A;  2IT0 A;  2FF4 A;  2M8G X;  4CHU A;  2EIK H;  4Y33 A;  2EA2 A;  4MFE A;  4B09 A;  3K4C A;  3FBN B;  2DFF A;  3DBL B;  5FLM J;  1QVT A;  1O7L A;  3DLL F;  1MMD A;  3CJT B;  2KFD A;  1U3E M;  1R5G A;  1ZHF A;  1ZN2 A;  3ZCO A;  3PM1 A;  3TQN A;  5D6F A;  1J75 A;  1W36 C;  3C3W A;  3ABU A;  4XNF A;  1R5I D;  4KYW A;  3PSF A;  2VJ5 A;  3TL4 X;  1FOK A;  2ECC A;  4RDU A;  3EUK L;  1ZH5 A;  4ZZD A;  3JRI A;  3E5Q A;  1R71 A;  4UNO A;  1A31 A;  2BVL A;  5L3E A;  5J47 A;  4BU2 A;  3BR1 A;  2ZJQ F;  2E5N A;  2XF5 A;  3V7S A;  4BKX A;  5J1Y A;  4CCJ A;  2DA5 A;  1FT9 A;  3MZY A;  1W4M A;  4ZC3 A;  5D5U B;  3KEQ A;  4TV7 A;  4XOR A;  4BS9 A;  2DFI A;  3HRU A;  2OF7 A;  2CQQ A;  2ZB9 A;  4BAY A;  2WAD A;  2JN6 A;  2ETH A;  1Y1V J;  5J8C A;  2ID6 A;  1G3Y A;  3A0B C;  1Z6T A;  2VOP A;  3S8P A;  1T08 B;  1M1E B;  2ELH A;  5FKL A;  3E3V A;  3QPS A;  4R79 A;  3I53 A;  1SC7 A;  2WAQ A;  2HOA A;  3B02 A;  2CQK A;  1JTY A;  5IYD J;  2H09 A;  2NOG A;  1ETO A;  3ZMV A;  1LFB A;  2XSD C;  2XPU A;  5L3B A;  1MBF A;  2LKS A;  1RRJ A;  3UR3 C;  1EKE A;  4N4O B;  3WU1 B;  4W1U A;  3ZQH A;  2JA2 A;  2XGD A;  2GXA A;  3D5L A;  3DTK A;  1OYI A;  4X0G A;  1JKP C;  4I02 A;  4B1R A;  2MD5 A;  1FWZ A;  3GFL A;  4KIG A;  3C2G A;  4LB6 B;  1HQC A;  3SZP A;  1YHQ I;  2JK3 A;  4ITV A;  3J81 Z;  3CJR B;  3CD6 I;  4HQM A;  2ZJP F;  5ILV A;  3IP4 B;  1MH3 A;  4HEA 2;  4MNU A;  3OL3 A;  1N78 A;  4UV9 A;  2LFB A;  2BW3 B;  3S14 J;  3GUD A;  2D5V A;  3AG4 H;  1W5T A;  1OCP A;  2EBI A;  4I01 A;  3IAS 2;  4AVZ A;  3MFK A;  2KRF A;  3RPU D;  3DEE A;  2NVY J;  1P4A A;  2M0M A;  5CVJ A;  4IHV A;  3GVA A;  3NQO A;  5B66 C;  5CVI A;  4E7J A;  4EJT A;  2CRG A;  3PO3 J;  4IF4 A;  1K83 J;  1YJN I;  3FHZ A;  1T56 A;  2IBD A;  2O7O A;  3RKX A;  4GO1 A;  2HDC A;  4HF2 A;  2JA7 J;  1J7K A;  1Y6I A;  3HUG A;  1X4P A;  3H1C A;  3SDB A;  1F5T A;  2A6E F;  2MFZ A;  4XN0 A;  1U5T A;  2DT7 B;  2QZ8 A;  2F5E A;  1VTN C;  2V9P A;  3MZ8 A;  2XHK A;  2XPV A;  5M5X J;  4U7D A;  5FLV A;  4YG2 F;  1YW7 A;  4HF0 A;  5ERI A;  4Y13 A;  1B8I A;  1VF9 A;  1RR7 A;  2IA0 A;  4EJV A;  3A4C A;  1BJZ A;  3GFM A;  3BPX A;  2HI3 A;  3M7G A;  4YEL A;  4YII A;  1LEB A;  4EGZ A;  1X3U A;  2EIJ H;  3AG2 H;  3BWG A;  2EZI A;  2JPB A;  4HNU A;  5FJ8 J;  2EFW A;  2XB5 A;  3E7L A;  2XRO A;  4P5O A;  2KQR A;  3GF2 A;  4G12 A;  4AIJ A;  4F52 A;  4F55 A;  2AS5 F;  2VT2 A;  1VQ6 I;  5IT9 K;  2P81 A;  4PFP A;  2CQX A;  1DQU A;  3LOC A;  2XGC A;  1JJ8 C;  4MEY F;  3FXQ A;  3DCF A;  3HJE A;  4AUX A;  5HLG A;  2Y0S N;  2DCE A;  2E5Z A;  4AYB A;  2HGC A;  3IWF A;  3KE2 A;  3MWM A;  2B9S A;  1H8A C;  4WX9 A;  2Z2S B;  1OCZ H;  4CA0 A;  2D45 A;  5EF6 A;  1U9N A;  4Y15 A;  3CJN A;  3LAJ A;  3KEY A;  2ZBK A;  1P6R A;  2FOK A;  2CFO A;  2QSF X;  2Y9Z A;  4ENK A;  2DN0 A;  5LEJ A;  4LB5 A;  2EK5 A;  1U5T C;  3JAM Z;  1FJL A;  3BLY A;  2MGQ A;  1ZG5 A;  2V79 A;  4BXX J;  1HDP A;  1KQ0 A;  2QKM B;  3MAJ A;  3QYB A;  3LFU A;  4PJ0 C;  1I1G A;  1FBU A;  1ZGJ A;  3E6D A;  2X6Y A;  1KGS A;  3FDY A;  2JUC A;  4F3Q A;  5DDG A;  3R0J A;  3OYI A;  4JQF A;  4HZF A;  2EFN A;  3H36 A;  2CS3 A;  1U9O A;  5HLI A;  4ESB A;  2FU4 A;  3VOE A;  3CME I;  4CSW A;  2LVS A;  3S3M A;  3GBG A;  1ULY A;  3BR0 A;  1I6X A;  3F22 A;  1RPW A;  3Q9S A;  1X1B A;  3RKY A;  4AIK A;  3G71 I;  1Z6R A;  2VUM J;  1S7A A;  3QPL A;  3DLA A;  1FYK A;  1JGG A;  2JQ7 A;  3WU0 A;  4C3H J;  3W2A A;  3LQR A;  1JT6 A;  5FFZ A;  5F1J A;  3WOD F;  4HOB A;  3TP3 A;  5EEG A;  5TJJ A;  3CTA A;  3OIQ A;  1OR7 C;  2OU2 A;  4A0X A;  5BS6 A;  1T95 A;  1F1Z A;  4XRS G;  2M45 A;  3CO6 C;  3S1N J;  2KZG A;  4L9V A;  2EA4 A;  2XAQ A;  1SMT A;  4Q47 A;  2L9S A;  2ESN A;  4IQJ A;  1YQA A;  1QGP A;  2GQQ A;  3X2Q H;  1Z91 A;  2HPM A;  4RGX A;  2Y69 H;  3W6K B;  4KN7 X;  1H0M A;  4GGG A;  5E1X A;  5J6X A;  1MMS A;  4IL6 C;  3UNG C;  2R93 J;  3JTH A;  2DOA A;  1BC8 C;  5HOD A;  3CCL I;  3BJA A;  2VB6 A;  5IPA A;  2H1L A;  2ZC2 A;  3FMR A;  3W3C A;  5K1Y A;  1FMW A;  3GX4 X;  1WJA A;  3H3U A;  1FYM A;  1W7P D;  1Y8Q B;  1JKR C;  3IL2 A;  3DP7 A;  2LKP A;  1SVO A;  1DPR A;  1AA7 A;  1W0U A;  1BL0 A;  2IA2 A;  2B7E A;  4EV0 A;  5LBQ A;  5IT3 A;  1E0E A;  1JTX A;  1UG0 A;  3FM3 A;  3M1C A;  5D5X B;  3LST A;  3U21 A;  3GWZ A;  3AL0 B;  4XRF A;  5F1R A;  3KYC B;  3T1B A;  4EVI A;  1YW9 A;  2JA8 J;  1QRY A;  5L3F A;  1HDD C;  2P0W A;  4OMY A;  3WTV C;  2VE9 A;  5BMZ A;  4H4K C;  4B48 A;  4NQW A;  1BR2 A;  1U8R A;  4M3G A;  2Y0S A;  5B1B H;  1T0F A;  2OTL I;  5CYV A;  2W48 A;  1EH8 A;  3H35 A;  1Z3X A;  2WY7 Q;  1VND A;  5B5E C;  5IY5 H;  3TED A;  4OWR B;  1O57 A;  5E20 A;  4E4H A;  2V1U A;  1HKT A;  1YTY A;  1JGS A;  2P5V A;  5LGT A;  4Y4R A;  3WGG A;  2R5Y B;  1HA8 A;  1KU2 A;  1JE8 A; 
#chains in the Genus database with same CATH homology
 3H92 A;  3HRS A;  2K7L A;  2FEZ A;  1T39 A;  3E6C C;  4R8H A;  4PCQ A;  3PQJ A;  3HTS B;  3DV8 A;  1V4R A;  1XGO A;  2KJB A;  5D6E A;  2L01 A;  3L7W A;  5ILS A;  1J5Y A;  1BI2 A;  4N0B A;  3JSP A;  4NB5 A;  4MTD A;  5DD8 A;  2VBZ A;  2V1D A;  3I71 A;  4CDG A;  2BV6 A;  4AWX B;  4A5M A;  4CIC A;  2QLZ A;  3BY6 A;  3U2R A;  2XRN A;  2P6T A;  3RDI A;  2P5K A;  4B8X A;  5BOX A;  2HOE A;  2O3F A;  1G4D A;  2PJP A;  5CLS A;  2OZU A;  2Q2E A;  4BYY A;  2OA4 A;  4OMZ A;  3V8K A;  2QEN A;  2FSW A;  2IVM A;  3DKW A;  4LD5 A;  1BI1 A;  4L18 B;  2XUB A;  2IP2 A;  4JK1 X;  4KUM A;  1R36 A;  2V9V A;  3QPH A;  3I64 A;  3RJP A;  3ECO A;  1SFX A;  2G9W A;  5H6R A;  2DK8 A;  4I09 A;  5HDK A;  2UWM A;  5K5R A;  2X0L A;  3BJO A;  3KLN A;  2BYV E;  3ULQ B;  4IXA A;  2Q8K A;  3ZMU A;  5E1W A;  5A2Q Z;  5JR3 A;  4EQQ A;  4A12 A;  1IXS B;  2ACJ A;  2XKP A;  5ICG A;  2EV5 A;  2EB7 A;  1Z7U A;  2FQ3 A;  5H20 A;  2HQN A;  2O8X A;  3GYH X;  1XCV A;  4HX7 A;  2FXA A;  2STT A;  2QQA A;  2PN6 A;  3REO A;  4G7Z F;  1O3S A;  3ROU A;  1F9N A;  1XGM A;  1ZGA A;  2XAG A;  1EH7 A;  3C18 A;  4WXH A;  1SD4 A;  1BN5 A;  2FNA A;  1K7A A;  3F3X A;  3ZMD A;  2A69 F;  4Q5S F;  1I27 A;  4ESJ A;  4BNC A;  2P4W A;  4I0B A;  1LVA A;  3WTU C;  3GFI A;  2V1X A;  2R7D A;  4ESF A;  4LFU A;  4U0W A;  1IN4 A;  1GXQ A;  1HXD A;  1ZLJ A;  4ZH4 F;  1R1U A;  4MQV A;  5JI6 A;  1F4K A;  4PZJ A;  3DFG A;  3E6B A;  4UVC A;  3HSF A;  4U0V A;  5FO5 A;  5L3D A;  4P9F A;  4WF2 A;  3WTX C;  2LF8 A;  3IWZ A;  3COA C;  1KU7 A;  4EGY A;  2Z33 A;  1NHA A;  2G7U A;  3LA7 A;  5H6Q A;  3V7R A;  3EQL F;  4Q4Z F;  2RVC A;  2O61 A;  2LSO A;  1FZP B;  4L9T A;  2KIM A;  3WGH A;  4CZZ A;  1FY7 A;  2IRF G;  4P96 A;  4ZZL A;  3SZT A;  3O2P E;  4RAZ A;  3L9F A;  4L5J A;  2XVC A;  1ZRC A;  1B6A A;  3EUH A;  3QP5 A;  1RI7 A;  5D8L B;  3N97 A;  4IJA A;  4AD9 A;  1IRF A;  3WTY C;  2ISY A;  1UHM A;  4UVB A;  3ZN0 A;  4OOI A;  3DXJ F;  1XN7 A;  1FBS A;  3RYR A;  5JVT A;  2W84 A;  3FM5 A;  5K5Q A;  1XMK A;  1QO0 D;  1PP8 F;  4ZYE A;  1AWC A;  4KIB A;  2ESH A;  2DK5 A;  5K5O A;  1XGN A;  1R00 A;  4IHS A;  1TNT A;  5LRS A;  1FNN A;  3ECH A;  2XKO A;  2VON A;  1BI3 A;  3SFZ A;  4MEX F;  4M72 A;  2IW5 A;  4GCV A;  1MZB A;  1W7P B;  3KET A;  4Q48 A;  2FE3 A;  1XB4 A;  4U7B A;  1XGS A;  2PEX A;  3M8E A;  3HRT A;  1TQP A;  3HIF A;  1MJ9 A;  1FLI A;  4DNC A;  4ZYG A;  2K27 A;  2M1B A;  3ZMT A;  4DQ2 A;  2YX4 A;  4M73 A;  4CGZ A;  1REP C;  4O6J A;  2DTR A;  4YFX F;  3KP7 A;  3W6J B;  3FWE A;  1UCR A;  1XSX A;  2DLL A;  1D8J A;  2ZJ2 A;  3NRV A;  1HST A;  2UXX A;  5HOO A;  3J80 Z;  3WTW C;  3P9K A;  5L3G A;  2JRT A;  3I54 A;  5F6F A;  4LLN A;  3QAH A;  2A3S A;  4OIN F;  5D8K B;  1LQ1 A;  1MDM A;  4KIC A;  1MD0 A;  1DP7 P;  2QBY B;  1G6N A;  4LG0 B;  1QNT A;  3KP6 A;  1YG2 A;  1S29 A;  1DDN A;  2RKH A;  3LFK A;  3RPU A;  2JZY A;  4P9U A;  5JFR A;  1CGP A;  3ZQ7 A;  3PQK A;  2OBP A;  3I0T A;  2Z99 A;  3FXR A;  2R3S A;  1T2K A;  2DQR A;  4A6D A;  2O03 A;  3E5U A;  3TKY A;  2ZNY A;  4HLX A;  3K2Z A;  4HW0 A;  2PI0 A;  5DV5 A;  1ON2 A;  4EJU A;  1SFU A;  2A6H F;  3T8T A;  3BDD A;  4ETS A;  3U1D A;  3F8M A;  4KDP A;  4LK1 F;  5FD6 A;  1JHH A;  3HHG A;  3OOP A;  4EM1 A;  4HDU A;  2PG4 A;  3B73 A;  1R1T A;  3P9I A;  2V6C A;  3T0Y A;  1IN6 A;  3FMS A;  5HDG A;  1U5T B;  4A2U A;  4L0Y B;  2MLK A;  3TO6 A;  2VC1 A;  1IZ1 A;  5E8G A;  3SQN A;  1ZRE A;  3EDP A;  2FMY A;  4UHT A;  3T5X A;  5F64 A;  2VOO A;  4OU0 A;  4ON0 A;  2E7W A;  5DCF A;  1LNW A;  3R61 A;  4RGR A;  3H3Z A;  4LJZ F;  1KYW A;  4A0Z A;  2Z3Y A;  2TDX A;  3ABT A;  4ENJ A;  4UV8 A;  4HBL A;  2LDU A;  2O6G E;  2A61 A;  4KMU X;  1U78 A;  5HS9 A;  3QPT A;  4MQ9 F;  1KYZ A;  1EH6 A;  4XSZ F;  2KIU A;  4LGW A;  3F8C A;  4KMF A;  3SXY A;  4M9S A;  3HOS A;  2P5L C;  4A5N A;  3BRO A;  4BHP A;  2Z9O A;  4P55 A;  2NNN A;  2DO7 A;  2EFQ A;  2FA5 A;  4KIF A;  2MBF A;  3LWF A;  5FFX A;  1SD5 A;  4N9I A;  4RB2 C;  5LGU A;  2Y75 A;  4XBF A;  4HF1 A;  4G7O F;  5ICF A;  1LJ9 A;  3ISP A;  2ZNZ A;  1MJA A;  1KU3 A;  3CUO A;  5E1Z B;  1QQI A;  3IRR A;  2GAU A;  5LLQ A;  3GXO A;  3IRQ A;  2DPU A;  3G73 A;  2XAH A;  5BQT A;  4YFN F;  5TRD A;  2XAS A;  1OMI A;  1HKS A;  2LNB A;  2A5Y B;  1O3T A;  2PMH A;  3FF5 A;  1FP2 A;  4WWC A;  3DQV C;  2VE8 A;  2G7H A;  4XLP F;  5KVR A;  4YIF A;  4RB3 C;  2QQB A;  4LMY A;  1UB9 A;  2WV0 A;  3JSO A;  4KFC A;  5E18 F;  3GEZ A;  4M74 A;  1XSD A;  2XIG A;  2E7X A;  1ONV A;  2IA1 A;  1J59 A;  4G6D A;  4IRI A;  3CUQ C;  1IF1 A;  1ZG3 A;  5LRR A;  1KA8 A;  4MTE A;  4WK8 F;  2K4B A;  2W57 A;  4HYE A;  4UXN A;  2L4M A;  3IC7 A;  1V3F A;  3M1E A;  4UVA A;  2E1C A;  5JHU A;  2NAZ A;  3CUQ B;  1U6G A;  4BHC A;  3QU3 A;  4M9X A;  5IT9 Z;  4KT5 C;  2WC2 A;  4HAM A;  3IHU A;  5LGN A;  4M9Z A;  2NYX A;  2QUF A;  4PDK A;  3BPV A;  4KA4 A;  2RNJ A;  5DYM A;  1DUX C;  3J7A O;  1IN7 A;  3DPL C;  1T98 A;  2RV8 A;  3DPT A;  1HBX G;  3N4M A;  2HQR A;  4O3M A;  3F6O A;  4QLC U;  1ZLK A;  2JTV A;  2BGC A;  4G6Q A;  1L0O C;  1WWX A;  3HHH A;  3K69 A;  3VOD A;  2XAJ A;  3AAF A;  4RB1 A;  4BH9 A;  1QZZ A;  1TQI A;  3KP4 A;  1FP1 D;  2M87 A;  3I59 A;  1ZYR F;  3GZ5 A;  1LEA A;  1SAX A;  2M30 A;  1D8K A;  3MCZ A;  5HS8 A;  1P4W A;  1OKR A;  1IN8 A;  2RDP A;  3HOT A;  3BP8 A;  1YIO A;  2QWW A;  4I98 B;  3CO7 C;  3MZH A;  3ZMZ A;  3SHF A;  4YFK F;  1G3T A;  2CSO A;  4Z2Y A;  3HTU A;  1R22 A;  4HDV A;  1YLF A;  2J5P A;  1TQM A;  3J81 K;  2RQP A;  1TBX A;  4Y17 A;  2H94 A;  1BIB A;  2GZW A;  2IJL A;  2YSR A;  4F7Z A;  2UXN A;  3QRF F;  1UST A;  3V7C A;  1PUE E;  1J0R A;  3WE3 A;  2VN2 A;  4A6E A;  4EMS A;  3L00 A;  2R7F A;  1RUO A;  1LB2 A;  1S8N A;  4IRG A;  1T38 A;  1G3S A;  1YW8 A;  1HKQ A;  3O3K A;  1J9I A;  2ISZ A;  1LDJ A;  1R1V A;  2P7C B;  5D4S A;  2D1V A;  1RNL A;  2MA3 A;  1YS6 A;  2YU3 A;  1UFM A;  4L9N A;  2ZME B;  3WG9 A;  5HDN A;  3V4G A;  5DUK A;  5DCM A;  1DPU A;  1I5Z A;  3P9C A;  3F6V A;  2HEO A;  3M9A A;  2RC4 A;  3KZY A;  2KIF A;  4EJO A;  4L5I A;  3R0A A;  2COM A;  1HW1 A;  2BEO A;  5FGM A;  1EV7 A;  1R7J A;  3HSE A;  2VBW A;  2H27 A;  2EV6 A;  3CUQ A;  2QM3 A;  2QQ9 A;  1R58 A;  1JHF A;  3WGI A;  1O3R A;  1SMY F;  4L9J A;  2CWE A;  3KCC A;  2L02 A;  1L3L A;  3QOP A;  5HVQ C;  3L2C A;  1Z05 A;  4I2O A;  2VBX A;  1B1B A;  1S6L A;  2CGP A;  1QPM A;  1TTY A;  2QVO A;  2MLG A;  5J8F A;  5DCM B;  1E2X A;  4KNY A;  4OIP F;  4O5V A;  5CVU A;  2PBI A;  1J2X A;  1BI0 A;  2DQL A;  1B9N A;  4ZYD A;  2RN7 A;  1MJB A;  1TW3 A;  4M71 A;  4HX4 A;  1SD7 A;  3V8J A;  1HSJ A;  1HW5 A;  1B9M A;  2F5C A;  1BIA A;  3KZZ A;  3LQQ A;  3KP5 A;  2P6S A;  3I58 A;  4JBA A;  3E5X A;  1GVJ A;  2MH9 A;  4LLL A;  1YO5 C;  3R6S A;  4CXF A;  2IPQ X;  3BJ6 A;  3G3Z A;  1IN5 A;  2D2W A;  1ON1 A;  5FLX K;  4E70 A;  4WXC A;  2Y48 A;  1W7P A;  1K78 B;  4ASN A;  1LDD A;  1I1S A;  4L0Z B;  3LA3 A;  3GFJ A;  4UUV A;  4S04 A;  2HTJ A;  3D0S A;  3GW2 A;  2VC0 A;  1BJA A;  1ZAR A;  2CFX A;  1RZ4 A;  4HLY A;  3HRM A;  1WSU A;  4G94 A;  1ZAO A;  4G7H F;  2DAO A;  3KP3 A;  5E17 F;  2PQ8 A;  2ZCW A;  3QU6 A;  5DEQ A;  3K9T A;  3P7N A;  1OYY A;  5CVV A;  3ZMS A;  3CLO A;  2F2E A;  5BPD A;  3TDU C;  1TLH B;  2CW0 F;  4RAY A;  4GYG A;  3J80 K;  3FZV A;  2NNY A;  2H6B A;  4RS8 A;  5ILU A;  3ZN1 A;  3V8L A;  2ADU A;  4QWQ A;  3ZPL A;  4LK0 F;  2GIV A;  2XV4 S;  4AVP A;  2K4J A;  4IPA A;  1A04 A;  3ML6 A;  2GA2 A;  2FBI A;  4NHJ A;  4OIQ F;  5HS7 A;  5ED4 A;  2OQR A;  3NEU A;  2VXZ A;  1BM9 A;  3TO7 A;  2P8T A;  2K86 A;  1S3J A;  1WKM A;  2OQG A;  3IKV A;  2FRH A;  4IVN A;  4G8X A;  1W5S A;  4FHT A;  5FB2 A;  1ZG1 A;  1CF7 B;  2OD5 A;  1QZY A;  3E97 A;  2F5F A;  2PMU A;  3RIR A;  3KFW X;  4HV6 A;  1RUN A;  5ICC A;  4CO8 A;  2M5W A;  1K6O A;  2PLY A;  2VT3 A;  4FX0 A;  3K0L A;  4G9Y A;  4ENM A;  3F21 A;  3RI4 A;  2FBH A;  3I5U A;  1MGT A;  2GA1 A;  3VEP A;  2HZT A;  1P2F A;  3WTS C;  3F8N A;  3CDH A;  3OV8 A;  2W24 A;  1OR7 A;  5AIQ A;  2EJR A;  2HYF A;  4I7H A;  1FYL A;  2HS5 A;  2F5D A;  2YPR A;  4XLN F;  4M6X A;  5D4R A;  1FBQ A;  5CJ9 A;  4GYI A;  3WTZ A;  3R60 A;  5BPI A;  2STW A;  2J5O A;  1WRJ A;  3GZ6 A;  1FC3 A;  4KN4 X;  1D5V A;  3ELK A;  2QBY A;  1MKM A;  2PFB A;  3RYP A;  1TNS A;  2H6C A;  4AIH A;  4BXU A;  1GHC A;  1UHW A;  3GLX A;  1WQ2 A;  1XDS A;  4PGG A;  1KU9 A;  4RB0 A;  4FT8 A;  3EYY A;  3TDZ C;  3F23 A;  1YFH A;  4PGH A;  2KJC A;  2ZME A;  2ZXJ A;  1JXS A;  3S2W A;  1B59 A;  1B4A A;  1KQ9 A;  2EFO A;  2M8E A;  2GXB A;  3IKT A;  1XSV A;  4WCG A;  4GXO A;  1P4X A;  4U88 A;  1K78 A;  2C6Y A;  2L54 A;  6PAX A;  3DEU A;  3F8B A;  3BZ6 A;  2W85 A;  5E8I A;  2MH2 A;  1FPQ A;  3PFI A;  3QP6 A;  3TGN A;  1HW2 A;  2B0L A;  2FML A;  2QYO A;  1IXC A;  1Y0U A;  1SFE A;  4RGU A;  2BBY A;  3U9G A;  1H9G A;  3FMQ A;  5DUI A;  2YX7 A;  4H0E A;  4R1H A;  1MDM B;  1O3Q A;  3KEO A;  1T6S A;  1USS A;  3EET A;  5L3C A;  1XDU A;  1CF7 A;  4S05 A;  2ZFW A;  3K1N A;  2AXL A;  4EJW A;  3M8F A;  5EEH A;  3K1M A;  3JAM K;  1IAW A;  1D3Y A;  4IRH A;  3EYI A;  1FX7 A;  3KP2 A;  5FLX Z;  3O6B B;  3I4P A;  1IW7 F;  3MEX A;  5CVR A;  2Z5U A;  2K02 A;  1Q1H A;  2A68 F;  2GWR A;  2HKX A;  1RIO H;  4LG0 A;  2P7V B;  4XSX F;  2A07 F;  2L3D A;  3TOB A;  3RTR A;  3WTT C;  1OPC A;  2UZK A;  4EM0 B;  4WXD A;  4RGS A;  2XGX A;  2MC3 A;  1TW2 A;  2RGV A;  1P92 A;  3F8F A;  2DU9 A;  1K79 A;  2JPC A;  2ZO4 A;  3L09 A;  1YS7 A;  2HWV A;  2VBY A;  3WE2 A;  2OAZ A;  2EWN A;  3TO9 A;  2L4A A;  2O0Y A;  4OIO F;  2CYY A;  2FBK A;  3C7J A;  4K2E A;  2X4H A;  1BOA A;  1H9T A;  3I59 B;  5FD5 A;  4HQE A;  4CYD A;  5KK1 A;  2HKO A;  1IRG A;  4HV5 A;  2BE5 F;  3K1P A;  5D5W B;  1XD7 A;  2GXG A;  3JW4 A;  3FXU A;  2ZKZ A;  2Q0O A;  1QBJ A;  3F72 A;  4ZYH A;  1G3W A;  2NRA C;  2FNP A;  4HX8 A;  1XCB A;  4A0Y A;  2W25 A;  1Z9C A;  1C0W A;  4M6Y A;  3LA2 A;  4LLG F;  1FSH A;  4MHG A;  4FX4 A;  1ZRF A;  1IXR C;  1LDK B;  2LF7 A;  5LHG A;  3GO5 A;  3BOQ A;  4IHT A;  2HFH A;  3FX3 A;  3LAP A;  5HLH A;  2Y0M A;  3T8R A;  3Q5F A;  1PDN C;  3ZP5 A;  4EM2 A;  2DBB A;  1KQ8 A;  1R5H A;  1BBY A;  3E6M A;  2DI3 A;  3C1D A;  4BQA A;  1OYW A;  3JTG A;  1ODD A;  1YYV A;  3KLO A;  3R4K A;  5LHH A;  2YR2 A;  1IUY A;  2EFP A;  5ICE A;  2HYG D;  1S7O A;  2VOD A;  3VB2 A;  3RPQ A;  4MGR A;  4N9H A;  4HA8 A;  2CO5 A;  1PP7 U;  1XMA A;  5D5V B;  4BHB A;  2DW4 A;  5LEK A;  5LHI A;  1ZRD A;  4OIR F;  1R23 A;  3Q9V A;  1GXP A;  1AOY A;  1BC7 C;  1WI9 A;  3DF8 A;  2NS0 A;  2DPD A;  3TOA A;  3HYI A;  2HTS A;  2WWY A;  1O7F A;  3HSR A;  1STZ A;  5AIP A;  2DT5 A;  1Z1D A;  1FSE A;  5DD4 A;  5A2Q K;  3RKW A;  2XAF A;  2CG4 A;  3VFZ A;  4U0Y A;  2KKO A;  3MQ0 A;  2WTE A;  2HR3 A;  4D0P A;  4I0A A;  4ENN A;  2JT1 A;  2D1H A;  1E17 A;  2E1N A;  2JSC A;  3ERE D;  2EV0 A;  5AON A;  1U2W A;  2OZ6 A;  1SD6 A;  2IT0 A;  2FF4 A;  4CHU A;  2EA2 A;  4B09 A;  1O7L A;  1U3E M;  1R5G A;  1ZHF A;  1ZN2 A;  3TQN A;  5D6F A;  1J75 A;  3C3W A;  3ABU A;  4KYW A;  1FOK A;  1ZH5 A;  4ZZD A;  3E5Q A;  4UNO A;  5L3E A;  3V7S A;  1FT9 A;  3MZY A;  1W4M A;  5D5U B;  3KEQ A;  4TV7 A;  2DFI A;  3HRU A;  4BAY A;  2ETH A;  5J8C A;  1G3Y A;  1Z6T A;  2VOP A;  2ELH A;  3E3V A;  4R79 A;  3I53 A;  3B02 A;  2CQK A;  2H09 A;  3ZMV A;  5L3B A;  3WU1 B;  3D5L A;  1OYI A;  4I02 A;  2MD5 A;  1FWZ A;  3GFL A;  4KIG A;  4LB6 B;  1HQC A;  3SZP A;  3J81 Z;  4HQM A;  5ILV A;  4MNU A;  4UV9 A;  3GUD A;  1W5T A;  4I01 A;  3MFK A;  2KRF A;  1P4A A;  5CVJ A;  3GVA A;  3NQO A;  5CVI A;  4EJT A;  4IF4 A;  3FHZ A;  3RKX A;  4GO1 A;  2HDC A;  4HF2 A;  1J7K A;  3HUG A;  1F5T A;  2A6E F;  1U5T A;  2QZ8 A;  1VTN C;  2F5E A;  2XHK A;  4U7D A;  4YG2 F;  1YW7 A;  4HF0 A;  5ERI A;  4Y13 A;  2IA0 A;  4EJV A;  3GFM A;  3BPX A;  3M7G A;  4YII A;  1LEB A;  4EGZ A;  1X3U A;  3BWG A;  2JPB A;  2EFW A;  2XRO A;  4P5O A;  3GF2 A;  4AIJ A;  5IT9 K;  2AS5 F;  2VT2 A;  4MEY F;  3FXQ A;  5HLG A;  2HGC A;  3IWF A;  3KE2 A;  3MWM A;  4WX9 A;  2D45 A;  4Y15 A;  3CJN A;  3LAJ A;  2ZBK A;  1P6R A;  2FOK A;  4ENK A;  5LEJ A;  4LB5 A;  2EK5 A;  1U5T C;  3JAM Z;  1ZG5 A;  2V79 A;  1KQ0 A;  3MAJ A;  1FBU A;  1ZGJ A;  1I1G A;  3E6D A;  1KGS A;  5DDG A;  3R0J A;  4JQF A;  4HZF A;  2EFN A;  4ESB A;  5HLI A;  2FU4 A;  3VOE A;  1ULY A;  1I6X A;  3F22 A;  3Q9S A;  3RKY A;  4AIK A;  1Z6R A;  1S7A A;  1FYK A;  3WU0 A;  3LQR A;  5FFZ A;  3WOD F;  4HOB A;  5EEG A;  5TJJ A;  3CTA A;  2OU2 A;  4A0X A;  5BS6 A;  1F1Z A;  3CO6 C;  2M45 A;  4L9V A;  2EA4 A;  2XAQ A;  1SMT A;  4Q47 A;  2ESN A;  1YQA A;  1QGP A;  2GQQ A;  1Z91 A;  4RGX A;  3W6K B;  4KN7 X;  1H0M A;  4GGG A;  5E1X A;  5J6X A;  3JTH A;  1BC8 C;  3BJA A;  3FMR A;  5K1Y A;  3GX4 X;  3H3U A;  1FYM A;  1W7P D;  3IL2 A;  3DP7 A;  2LKP A;  1DPR A;  2IA2 A;  4EV0 A;  5LBQ A;  5IT3 A;  3FM3 A;  5D5X B;  3LST A;  3GWZ A;  4XRF A;  5F1R A;  3T1B A;  4EVI A;  1YW9 A;  5L3F A;  4OMY A;  3WTV C;  2VE9 A;  5BMZ A;  4NQW A;  1U8R A;  1T0F A;  5CYV A;  1EH8 A;  5E20 A;  1O57 A;  2V1U A;  1HKT A;  1YTY A;  1JGS A;  2P5V A;  5LGT A;  3WGG A;  1KU2 A;  1JE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...