3GW2A

Crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
RKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulatory arsR-family protein
publication title Northeast Structural Genomics Consortium Target MbR242E
rcsb
source organism Mycobacterium bovis
molecule tags Transcription regulator
total genus 28
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2009-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gw2A00
3I58A 1MJAA 3R6SA 3KP2A 5D4SA 2NNYA 2PLYA 4HLYA 2HTSA 3O6BB 2Q0OA 2RNJA 2XGXA 1T6SA 5LBQA 3RKYA 2ZJ2A 3F22A 3ROUA 4TV7A 4KA4A 4JK1X 4AWXB 1WWXA 2K4JA 2XKPA 4N9IA 3HRMA 4A5NA 1RUNA 5EEGA 1U6GA 1FZPB 2P5KA 1HSJA 4NHJA 2X4HA 3HHGA 2HQRA 4RB1A 1Z6RA 3DV8A 4G6DA 4MEXF 3TQNA 4NQWA 4LG0B 3J7AO 1U5TB 4PDKA 3EYYA 4GXOA 4M9ZA 3ZMZA 2W57A 1K78A 2PMUA 3I54A 4HX8A 1DPUA 1W4MA 3QP6A 4QWQA 1YLFA 1T38A 2OBPA 2O6GE 1ZLJA 2JTVA 2FF4A 1HW2A 4L9VA 3EETA 5AONA 1JGSA 2FEZA 1AWCA 3G73A 1ZRDA 2A3SA 1HKSA 1OR7A 3IC7A 1YTYA 2RQPA 2BE5F 1MDMA 2FRHA 5E20A 1B6AA 3JW4A 3NRVA 5DV5A 5ICGA 2XVCA 4GYGA 1R7JA 1K7AA 3ZN1A 4A5MA 3I5UA 3FF5A 3HSEA 3I53A 4L9NA 4HW0A 4AIHA 2LNBA 3WTYC 3KP7A 2MLGA 3T8TA 4EJWA 3FMQA 2VOPA 2QQ9A 1KQ0A 1ZYRF 1LDKB 4CDGA 1D8JA 4M74A 3QPHA 3VODA 3GFMA 4BHBA 2A6EF 2CQKA 3LFKA 4M9XA 2QENA 1YS6A 4P96A 3MAJA 1XN7A 5DCFA 1W5SA 1EH7A 3H3UA 4MHGA 2RV8A 3WGGA 3ZPLA 1KA8A 2OA4A 3M8FA 5K5RA 1ZG3A 3KEOA 1ZHFA 5AIPA 2DPUA 1D5VA 2M8EA 3QU6A 2O03A 4RGSA 4CO8A 1FP2A 1TQMA 1ON1A 4XRFA 1DPRA 1FLIA 5HLHA 1K6OA 3B73A 1SMTA 3Q9VA 3F8CA 3KLOA 2EFOA 1O7LA 2DT5A 4FX4A 1ZH5A 5LGTA 2UWMA 3QRFF 2GXBA 1YW7A 3DFGA 3ERED 4CZZA 1NHAA 2YR2A 2IW5A 4BH9A 3B02A 2RVCA 2DK8A 3FXRA 5DD4A 5FFZA 4M6XA 3EDPA 4IVNA 4M71A 5ICFA 4UVBA 4JBAA 2M5WA 1B9NA 4I01A 3BPXA 2A5YB 2Y48A 4B8XA 1BI3A 1L0OC 1XMAA 1WI9A 4ENJA 3KE2A 4HX7A 3DF8A 1XDSA 1S7OA 1QZZA 1UB9A 1XSXA 3N97A 2IVMA 1FWZA 4G6QA 5JFRA 4MGRA 3PFIA 3TGNA 2FA5A 1U78A 4H0EA 1HKQA 2D2WA 3T5XA 2EJRA 3SFZA 3VB2A 2H09A 2LSOA 2E1CA 2E1NA 2XUBA 3Q5FA 1XCBA 2J5OA 2QQBA 4L0YB 3HSFA 2FBHA 4OIQF 2JT1A 4I0BA 4Y17A 4IRHA 4S04A 1QQIA 3IWFA 1R36A 2VT2A 2WC2A 1SD6A 4EGZA 1Q1HA 3J81K 5DCMB 3FM5A 2QBYA 2GA2A 2E7WA 5ILVA 1I5ZA 3F8MA 3N4MA 4ZYHA 1BBYA 2PEXA 3GW2A 5CVVA 1FYLA 4RB0A 2HGCA 3F6OA 4IRIA 2NYXA 3K2ZA 5HDGA 1FBQA 3M8EA 2GQQA 4EJUA 2XIGA 2EV0A 5CVJA 5JHUA 2EFQA 5E17F 4BHPA 3GO5A 2K02A 4HDVA 1TW3A 5HS9A 4R79A 3J80Z 4WX9A 2UXNA 5E1XA 3SHFA 1VTNC 3EQLF 3KP5A 1BM9A 3I59B 2VBZA 3E5XA 1KU2A 1ZLKA 1P6RA 3KZYA 3WTVC 2YPRA 2J5PA 2HOEA 2Q2EA 2Z99A 2LF7A 1V3FA 3E3VA 5CVIA 2P5VA 2K27A 5LRSA 2C6YA 2F5DA 2HYFA 3C1DA 5D8KB 4G7HF 1T2KA 4PCQA 3F72A 2CWEA 1S29A 1ZG1A 1Z6TA 4CHUA 2ZMEA 3GFIA 5L3DA 3I71A 1GXPA 4UV9A 4XLNF 2RN7A 4HBLA 3BY6A 4LGWA 1IN4A 1ULYA 3MZYA 3SZTA 2W85A 3QU3A 3TO7A 1IAWA 3IL2A 2EFNA 5CJ9A 5DUIA 1WRJA 4EGYA 1SMYF 4I2OA 3CUOA 3L7WA 3JSOA 1B59A 3MZHA 2IA2A 3ISPA 1DDNA 2KKOA 4KUMA 4UNOA 2QZ8A 1HKTA 2A61A 5J8FA 1OYWA 5D6FA 1S3JA 3CDHA 5L3BA 4OINF 1J59A 1ZRFA 2L4AA 3ECHA 4YFKF 2STTA 4U0VA 5ILUA 2IT0A 3P9CA 2HWVA 2Z9OA 4L9JA 4CXFA 4LB5A 1LJ9A 4IHSA 1BIBA 1LVAA 1MZBA 2VXZA 2HKXA 2EFPA 5A2QK 5BOXA 3K1PA 2EA4A 4FHTA 1ZG5A 1XCVA 3GZ5A 4R1HA 4A6DA 1ZARA 3DEUA 2ESHA 2RDPA 1JE8A 4OMYA 1H0MA 2LKPA 1CF7B 1FSEA 3VOEA 4U88A 4KIFA 2VODA 3R60A 1G3TA 5HDKA 3PQJA 2MH2A 1I1GA 3V8LA 3QP5A 2EFWA 3G3ZA 1LDDA 2XAJA 1MJ9A 2Y0MA 4Q5SF 1RIOH 5D5XB 4AVPA 3E6MA 1FSHA 1JHFA 2QWWA 1O7FA 3IWZA 5DDGA 2FMLA 5HDNA 1FBSA 1FX7A 1OMIA 3KP6A 1IW7F 4A2UA 5J8CA 1ZRCA 3RIRA 4EMSA 3K1NA 3PQKA 5L3EA 2M45A 4Y13A 4HYEA 1XGSA 5JR3A 2QLZA 5D8LB 2FU4A 4WXDA 1J7KA 4CYDA 3L2CA 2ISZA 1JXSA 3EYIA 1ONVA 5EEHA 5K5QA 2IRFG 5CVRA 1HQCA 5KVRA 1DUXC 4LLNA 3FMSA 1P92A 2KJBA 4ESJA 3F8NA 1SFEA 3K1MA 3GFJA 2O3FA 3RDIA 3GLXA 3CLOA 4YG2F 2H27A 1O3RA 1LEBA 3CUQA 1R1TA 3CJNA 2DQRA 5DUKA 2G9WA 4ZZDA 3Q9SA 3ECOA 1U2WA 3O2PE 1UHMA 5D6EA 2STWA 1LNWA 4HOBA 1MJBA 4CGZA 4G7OF 2P7VB 4LLLA 1AOYA 2NRAC 4M6YA 1Y0UA 3BDDA 4KMUX 2HR3A 3HIFA 4P9FA 4G94A 1MGTA 1G3YA 3J81Z 4LFUA 1YYVA 2A68F 1F1ZA 2VBXA 1YW8A 4HV6A 4P5OA 1IF1A 4ESBA 3ABTA 3IRRA 3GFLA 1ZGJA 2BEOA 4EM1A 5L3GA 4R8HA 2PJPA 1T39A 4BXUA 4BQAA 1U3EM 1J75A 4AIJA 4A6EA 2EV6A 3V8JA 2HKOA 3RYRA 3E6CC 2RC4A 1KYZA 2LDUA 3TO6A 5FB2A 1B4AA 5ICCA 4KFCA 4D0PA 4K2EA 5FD6A 5TJJA 2L02A 4A0ZA 2R3SA 2FE3A 2BV6A 4XLPF 4OIOF 1QBJA 5IT9K 2MH9A 2ETHA 3JSPA 5LGNA 1O3QA 2K4BA 4MQ9F 1R58A 2W84A 1YQAA 3BP8A 3H3ZA 3BWGA 5HS8A 2FQ3A 1PDNC 1R22A 3NEUA 4BAYA 2HFHA 5D4RA 4N0BA 5FGMA 3CO6C 4RB3C 2ZFWA 1IN5A 1OPCA 1W7PA 2AXLA 3F6VA 2ZNZA 3ZMDA 5FLXK 4I98B 3WODF 2CW0F 1G3WA 2XKOA 5LEKA 5F1RA 1SFXA 1K78B 4ZYDA 5BMZA 2JZYA 5TRDA 1PP7U 2L3DA 2XAQA 3I4PA 4O3MA 1YO5C 4GYIA 1J0RA 3GF2A 2RKHA 2UXXA 2O0YA 2PBIA 3E5QA 2V6CA 1HSTA 1IRGA 1BC7C 2MC3A 1IRFA 1UCRA 3JTHA 1XSDA 2GIVA 2GWRA 3DKWA 1MDMB 4GO1A 3GUDA 2KIFA 1TLHB 2G7HA 2GZWA 3TKYA 5D5UB 1ON2A 1FT9A 4IHTA 2XAFA 4MTDA 4Z2YA 4ENMA 1Z9CA 4UUVA 5ILSA 4BHCA 4EJTA 1EH8A 3RI4A 5H6QA 3RKXA 1P4AA 2CG4A 2IPQX 3HSRA 1EV7A 1P4WA 3C18A 3CO7C 3K69A 3KLNA 4IJAA 2QM3A 3WTSC 3CUQC 4S05A 3WTWC 4I7HA 3K9TA 2A6HF 4KN7X 5A2QZ 1C0WA 4OIPF 3M1EA 2O61A 2FSWA 1H9TA 1XGMA 3F8BA 2WWYA 3GYHX 2L54A 3DPTA 4RS8A 3WG9A 1LQ1A 5DEQA 4NB5A 4IXAA 5E8GA 1HXDA 2P6TA 1PP8F 4JQFA 2DU9A 4RGRA 2Q8KA 3P9IA 3L00A 1RUOA 4UHTA 5BS6A 2VN2A 3V7CA 4OMZA 4ON0A 4P55A 3QAHA 1REPC 1BI1A 3BROA 3P9KA 2VOOA 1GHCA 1JHHA 1YIOA 2H6BA 3HUGA 5LHGA 3R0JA 2H6CA 4ZYEA 3BOQA 2HYGD 5K1YA 2EB7A 2PI0A 1ODDA 1RI7A 3W6KB 3M7GA 3D0SA 1D8KA 3LA7A 1S7AA 2HDCA 2CYYA 3WTUC 3FZVA 3EUHA 4O5VA 2FXAA 2DO7A 3E6DA 3BPVA 4EVIA 3QPTA 1ZREA 4UVCA 3RPUA 3DXJF 1FOKA 3KZZA 4EV0A 2VE9A 5BQTA 2IA0A 3TDUC 2BGCA 2PFBA 3I0TA 1XSVA 4HAMA 4KNYA 3ZMTA 4N9HA 4UV8A 1KGSA 3DPLC 4WCGA 4LG0A 1TBXA 1U5TA 4U7DA 4WWCA 2OAZA 1E2XA 3ZP5A 5LHHA 1XB4A 4ZYGA 4ZH4F 3U1DA 3WTXC 5BPIA 2DFIA 3V7RA 2V1XA 2OZ6A 5CLSA 2DK5A 3TOBA 1IN8A 4HQMA 3RYPA 2NAZA 3GWZA 3W6JB 5JVTA 3DP7A 1J5YA 1MD0A 3GEZA 3ZN0A 1FY7A 5IT3A 1Z91A 4IF4A 4LJZF 2F5FA 3MWMA 4AIKA 2PN6A 3RPQA 1UHWA 2QBYB 3ELKA 3IKTA 2XROA 4XSXF 1T0FA 4I02A 4O6JA 1FP1D 2FBIA 2DBBA 1KU3A 1F9NA 2CFXA 4EJOA 3BJAA 5H20A 4HA8A 5FD5A 1L3LA 3VEPA 5L3FA 5D5WB 4M72A 2QUFA 3R0AA 4Q47A 1USSA 1TNSA 3T1BA 4XBFA 3ZMUA 4GGGA 2Y75A 1TQPA 3HRSA 3R4KA 2JPCA 1FYKA 4RB2C 3LSTA 2Z3YA 1O3TA 1MKMA 3L09A 4HF0A 1R1VA 2DAOA 1KQ9A 1HW1A 2O8XA 1STZA 3FHZA 5HLGA 3R61A 1HW5A 5IT9Z 4LMYA 1V4RA 2XAHA 4OOIA 1F5TA 2FNAA 3TOAA 3O3KA 2ADUA 5LLQA 3WU0A 3LA3A 2XASA 2G7UA 4HQEA 4IRGA 4AD9A 3F3XA 4LK1F 2QVOA 4EJVA 4WK8F 3MCZA 2F5EA 3ZQ7A 4FT8A 2HEOA 1SAXA 4YIFA 2OU2A 5D5VB 1TQIA 3T0YA 3LAJA 2CGPA 2D1VA 2DTRA 2COMA 2V9VA 5AIQA 2ZMEB 5FLXZ 2ACJA 3HHHA 3I64A 4HV5A 3ULQB 2ZKZA 3IRQA 4YIIA 1CGPA 3SXYA 2YX7A 4U0WA 4LK0F 1BN5A 4XSZF 5K5OA 4DQ2A 1G6NA 2L01A 1O3SA 2QQAA 2PQ8A 2DW4A 1XD7A 3K0LA 1FYMA 2OQRA 1K79A 1FNNA 1IZ1A 4MQVA 4YFNF 1DP7P 2OQGA 2VE8A 1R5GA 2XHKA 2F2EA 3OV8A 2GXGA 3U9GA 4KT5C 3HOTA 2ESNA 2L4MA 3E6BA 4KDPA 3JAMK 1QZYA 1B9MA 2IJLA 2A69F 3MEXA 5F64A 1U5TC 4ETSA 1QPMA 4OIRF 3MQ0A 1LB2A 2ELHA 2XV4S 3IHUA 3LAPA 2GA1A 5DCMA 2M87A 1OKRA 1XGNA 4UVAA 3TDZC 4OU0A 1USTA 1D3YA 4U0YA 4E70A 1S8NA 3WTTC 3QOPA 5KK1A 1QO0D 3FX3A 5LGUA 1RZ4A 2K7LA 2MBFA 5E8IA 2RGVA 2PG4A 4L5IA 2VBWA 4PGHA 2E7XA 1YS7A 4A0XA 2VT3A 5LHIA 3GX4X 3S2WA 4M73A 3KCCA 5E1ZB 3I59A 3JTGA 1FC3A 3ZMSA 4KICA 3BJOA 1R23A 1XDUA 2Z5UA 3HRTA 2DLLA 4MTEA 2ZCWA 3WE3A 4KMFA 2FMYA 1BI0A 2F5CA 1SD7A 3FXUA 1SD5A 1LDJA 2HTJA 1R00A 1S6LA 4MEYF 2KIMA 5FFXA 4ENNA 4B09A 2A07F 3P7NA 2HZTA 2BBYA 2DQLA 5ED4A 1PUEE 2FOKA 5L3CA 2VC0A 5E18F 4F7ZA 4L0ZB 3CUQB 2ZBKA 4LD5A 1WSUA 5ERIA 2M1BA 3WTZA 3H92A 1W5TA 4KYWA 1KYWA 4L9TA 2BYVE 2ZNYA 3GVAA 4EM0B 1IXCA 4IPAA 2FNPA 3GZ6A 2ZO4A 3GXOA 1SD4A 2IP2A 4WXHA 4G9YA 1P2FA 2FBKA 1FPQA 5ICEA 3HOSA 1WQ2A 1G4DA 1H9GA 3WE2A 1EH6A 2VONA 4Q48A 1Z7UA 3FMRA 3F21A 5LRRA 4M9SA 2V1UA 3HTUA 1IN6A 1P4XA 1ZAOA 1G3SA 4L5JA 2P7CB 5DYMA 4KIBA 3V4GA 1J2XA 3OOPA 2VC1A 4Q4ZF 2VBYA 3HYIA 5H6RA 3V7SA 4MNUA 4HZFA 1FBUA 1X3UA 3KEQA 2P5LC 4BYYA 1I1SA 3SQNA 2EK5A 4DNCA 2MLKA 2KIUA 1GVJA 4KN4X 3AAFA 2DPDA 5J6XA 1IUYA 3FWEA 3BJ6A 2D45A 5F6FA 4YFXF 1GXQA 3RTRA 1TW2A 2EA2A 2JRTA 3D5LA 1T98A 2HQNA 2D1HA 1QNTA 3KFWX 1YFHA 5CVUA 5CYVA 1CF7A 5DD8A 4HX4A 3TO9A 2ISYA 1W7PD 1QGPA 2NS0A 3WU1B 2R7FA 3C3WA 3ABUA 3M9AA 4U7BA 3C7JA 1BC8C 4WXCA 2OZUA 2OD5A 2P6SA 2CSOA 1HBXG 2LF8A 4ASNA 4L18B 1I6XA 2H94A 1ZGAA 5HOOA 6PAXA 1E17A 4HLXA 2JSCA 4Y15A 3WGIA 2YSRA 2R7DA 3REOA 3FXQA 4ENKA 1W7PB 3RKWA 2B0LA 1RNLA 3ZMVA 1B1BA 2V1DA 2P4WA 2IA1A 3KP4A 3LQRA 5JI6A 3F8FA 2W24A 2M30A 2JPBA 3E5UA 2KJCA 4UXNA 1J9IA 3LQQA 1F4KA 2XRNA 4PGGA 3COAC 4G8XA 1TNTA 3BZ6A 2TDXA 5FO5A 1XMKA 3HRUA 4HF1A 5E1WA 3VFZA 4CICA 5HLIA 1IXRC 4BNCA 2PMHA 4G7ZF 1WKMA 2EV5A 4RAYA 1A04A 1YW9A 1UFMA 5HVQC 4WF2A 1Z05A 1KQ8A 3U2RA 2AS5F 1U8RA 3E97A 2MD5A 2YU3A 4EM2A 1OYIA 2P8TA 2X0LA 3F23A 4P9UA 4I0AA 1I27A 2QYOA 1Z1DA 3LWFA 3SZPA 3CTAA 4RGXA 4FX0A 3DQVC 2UZKA 3ML6A 3JAMZ 4I09A 1XGOA 2K86A 1SFUA 4A0YA 2YX4A 1BOAA 1BJAA 1LEAA 4LB6B 2XAGA 4KIGA 2DI3A 3LA2A 4HDUA 4A12A 4RGUA 1R5HA 2NNNA 2CO5A 1ZN2A 2V79A 1KU7A 5HS7A 3IKVA 2MA3A 3NQOA 2ZXJA 1IXSB 4ESFA 4LLGF 4QLCU 4ZZLA 2HS5A 3L9FA 2W25A 2Z33A 1KU9A 3T8RA 3V8KA 4RAZA 4EQQA 3HTSB 5LEJA 3FM3A 4GCVA 3KP3A 1YG2A 3RJPA 2KRFA 2WTEA 1IN7A 3MFKA 1R1UA 1TTYA 2GAUA 5BPDA 1BIAA 3KETA 4PZJA 4HF2A 1O57A 2EWNA 2WV0A 3J80K 1OYYA 3WGHA 1BI2A
chains in the Genus database with same CATH superfamily
5IPAA 3I58A 1MJAA 3R6SA 3KP2A 3LOCA 5D4SA 2PX9A 1GV2A 2NNYA 2PLYA 4HEA2 4HLYA 2HTSA 3O6BB 4ZTJA 1H88C 3AKZA 2Q0OA 2RNJA 2XGXA 1T6SA 2Y9YA 5F04A 1X4OA 5LBQA 4UB6C 3RKYA 3S93A 2ZJ2A 3F22A 2K5CA 2DT7B 5KAIC 4F91B 1TP4A 2ZJRF 3ROUA 3RSNA 4TV7A 3ASNH 4KA4A 2NXNB 3HXLA 4JK1X 4PJLA 4AWXB 3J7AY 1WWXA 2K4JA 3LFUA 3SDBA 1YX5A 2XKPA 3SDGA 4N9IA 3HRMA 4M3DA 2DDBA 1BW5A 3DBHB 4BU2A 4BS9A 1D5YA 4AM3A 1MMDA 3PNYA 4ANJA 4A3GJ 4A5NA 3VDXA 1RUNA 5EEGA 1U6GA 3BTIA 1Y8RB 1FZPB 5FJ8J 1X1BA 2P5KA 2R7QA 3CCEI 3ASOH 4D1QA 1HSJA 4NHJA 2DMTA 2L2OA 2X4HA 2A5WA 3HHGA 2HQRA 1M1EB 1WH5A 3BCBA 4RB1A 4IKFA 1Z6RA 3MKYB 1FTZA 3DV8A 4G6DA 4MEXF 3TQNA 1RKWA 4NQWA 2L7MP 2XGEA 4LG0B 3J7AO 1U5TB 4PDKA 5BNGA 3Q0WA 4XLEA 3EYYA 1OFCX 4GXOA 4M9ZA 2W57A 2X1CA 3OR2C 3ZMZA 1WPKA 4EEFG 1X58A 3CJQB 1K78A 1TWAJ 2PMUA 2O8KA 3I54A 4HX8A 3PIOF 3O8HA 1DPUA 1W4MA 3QP6A 4QWQA 4HNTA 1YLFA 1T56A 4XNFA 4II2A 4BJ6C 4XKCA 1IGNA 4Y52J 1IDZA 4HSRA 4RAGA 4XRSG 3G1MA 1T38A 2OBPA 3H35A 2O6GE 4XIDA 1ZELA 1ZLJA 2JTVA 2FF4A 1HW2A 4DBRA 4KT6A 2Y0SA 4L9VA 3GTOJ 3EETA 4J00A 5AONA 1JKOC 1JGSA 2FEZA 2R5ZA 3G73A 1AWCA 1ZRDA 3JRAA 2A3SA 1HKSA 1OR7A 3IC7A 1GT0C 1FTTA 1YTYA 2RQPA 4PJMA 2BE5F 1MDMA 1G2HA 3BG7A 2CUJA 1V5EA 2FRHA 5E20A 4XM3A 5FKMA 3GBGA 1VQNI 3L2RA 1B6AA 1UAAA 3JW4A 3CCRI 2JVGA 1QHGA 2EZLA 3NRVA 5DV5A 5ICGA 3IAS2 2XVCA 4GYGA 1P9QC 1R7JA 2E71A 4J19A 1K7AA 2PJRB 1SC7A 3ZN1A 4A5MA 3I5UA 3BG9A 3FF5A 5IOZA 2PMZN 2M7BA 3HSEA 4BJ5C 3E0JB 3I53A 4L9NA 4HW0A 2LBFA 1VQ9I 4AIHA 2DTZA 2LNBA 3Q0UA 4CCLA 2BY2A 3WTYC 3KP7A 2MLGA 1BL0A 3T8TA 4EJWA 3FMQA 3KYDB 2ECCA 5FLMJ 2VOPA 1MBFA 2QQ9A 1KQ0A 3ZOBA 1ZYRF 1LDKB 2QSGX 4UUTA 4CDGA 4M3BA 3B6AA 1D8JA 3DCFA 2MG4A 4M74A 3QPHA 3QWLA 2I10A 3H0DA 2EZHA 2JRMA 1OCRH 3GFMA 3VODA 4BHBA 3KYCB 2E2HJ 2A6EF 2HDWA 2CQKA 3LFKA 4BBSJ 2E2JJ 1XS9A 2DN0A 1X1DA 1E3PA 4M9XA 2KL4A 2QENA 1YS6A 4P96A 1SFOJ 2CQ7A 3MAJA 1JGGA 1XN7A 4F52A 1OQYA 1KONA 5DCFA 1W5SA 4DJAA 1EH7A 2VQGA 3HGYA 3H3UA 4MHGA 2RV8A 3K10A 1R4MB 3WGGA 2MABA 3FDYA 3IH2A 2BY1A 1QU3A 3ZPLA 2LD5A 2RQQA 1E0EA 1P7IA 1KA8A 2OA4A 3M8FA 5K5RA 1ZG3A 1BR2A 3KEOA 1ZHFA 5AIPA 2NVXJ 2DPUA 1D5VA 3GZNB 1ETXA 2M8EA 3QU6A 2O03A 3PM1A 4RGSA 3OY9A 3CP8A 3FXKA 4CO8A 3AG3H 3M1CA 2H8RA 1FP2A 5TGTA 1ZR4A 1TQMA 1ON1A 4XRFA 1DPRA 3TEDA 1FLIA 1RPWA 2BHYA 5HLHA 1K6OA 4Z6YA 3B73A 1E3HA 1SMTA 2BW3A 3Q9VA 3F8CA 3S15J 3KLOA 3CMEI 2EFOA 1O7LA 2DT5A 4FX4A 2RNGA 1ZH5A 3OMYA 5LGTA 2UWMA 3QRFF 2GXBA 1YW7A 5M5XJ 3DFGA 3ERED 4NC6A 3CCQI 5EZGA 3QODA 2OJED 3NWSA 4CZZA 1NHAA 5EF6A 2YR2A 1MW7A 2IW5A 3DTIA 1LE8B 3B02A 4BH9A 2RVCA 3CCUI 2DK8A 3I56I 2JA2A 3FXRA 1XC5A 3KYLA 5DD4A 3ZCOA 5FFZA 4M6XA 3EDPA 4IVNA 4M71A 5ICFA 4ABZA 1RKTA 1VQ8I 2DXIA 4X1EA 4C3HJ 4UVBA 2DJIA 3JCUC 4JBAA 2M5WA 1B9NA 4I01A 4CCJA 3BPXA 2A5YB 5B3SH 4W97A 4B3AA 3B6CA 2Y48A 4B8XA 1BI3A 1B72A 3OIOA 1L0OC 3UKGA 4DYQA 2EIMH 3OYMA 1HLVA 1XMAA 2WAFA 4F55A 1WI9A 3ZQQA 4ENJA 3KE2A 4HX7A 3DF8A 1XDSA 1S7OA 3A4CA 1QZZA 1UB9A 1XSXA 3BR2A 3LSIA 4A3IJ 3N97A 4PJNA 2IVMA 3TP3A 4E7LA 3HOWJ 3C2GA 5GTIC 3VWBA 3A02A 1FWZA 4G6QA 5JFRA 1FEXA 4MGRA 3PFIA 3TGNA 3GTJJ 5F0CA 1B8IA 2FA5A 3K4LA 1BR4A 1U78A 4H0EA 1HKQA 4JP0A 3H9GA 1TT5B 2D2WA 3T5XA 2EJRA 3SFZA 1JJ8C 4LIUA 3VB2A 2HQAA 4CCMA 2H09A 2LSOA 2JMWA 2E1CA 4C2UA 2E1NA 1OCCH 2XUBA 3Q5FA 1AU7A 2G0EA 4CUGA 1XCBA 3QOEA 2KISA 2J5OA 2WB1N 5J1YA 3CP2A 2QQBA 3G4SI 3W2AA 4L0YB 3HSFA 2FBHA 4OIQF 3PSIA 2ZJPF 3CCJI 2JT1A 4I0BA 4Y17A 4IRHA 4ZYAA 4S04A 5JLXA 1QQIA 3IWFA 1DQUA 1R36A 2VT2A 2WC2A 1SD6A 4EGZA 1Q1HA 2FJ1A 3J81K 2CV2A 2UV1A 5DCMB 3FM5A 4D7MA 3PSFA 2QBYA 2GA2A 3ERMA 2IS4A 5IOYA 2E7WA 1MMGA 2R7OA 1D1BA 5ILVA 1I5ZA 4BE2A 3F8MA 3ESWB 2L5QA 4ZYHA 1BBYA 4IEJA 3N4MA 1W36D 2PEXA 2KP6A 2MFZA 3GW2A 3RQIA 3HL2A 3W6VA 5CVVA 1FYLA 4RB0A 3DLLF 4BGDA 2HGCA 3JRCA 3F6OA 1OR7C 2X6XA 4W1UA 1ITYA 1JUSA 4IRIA 2M7AA 2NYXA 3K2ZA 5HDGA 3DTKA 1FBQA 3M8EA 2X6WA 3DU6A 2M4KA 2NVQJ 2GQQA 5M5YJ 4EJUA 3CCYA 2XIGA 2EV0A 5CVJA 5JHUA 1BA5A 2EFQA 2EPFA 5E17F 4BHPA 1SFKA 3GO5A 3BTCA 2K02A 4HDVA 2GOXB 5E3OA 3SZGA 1NH3A 5CQGA 1TW3A 3OYAA 3PNTA 3A1YA 3BR5A 2X6YA 5HS9A 1Q1VA 4R79A 3LL7A 4WX9A 2UXNA 3J80Z 4CSWA 5E1XA 4KJZA 2KZGA 2EH3A 3SHFA 4B4CA 1VTNC 2IS6A 3EQLF 3KP5A 3OYKA 2MC4A 1BM9A 3I59B 2VBZA 2QCOA 2B7EA 1IDYA 3E5XA 2HXOA 2VJIA 1KU2A 3GTLJ 1ZLKA 4RM3A 1TT0A 2NVYJ 1P6RA 4RM2A 4BQNA 3GLLA 3KZYA 3WTVC 2YPRA 2J5PA 1IRXA 2HOEA 3F0CA 1U8BA 2Q2EA 2Z99A 2LF7A 3H1CA 2LRDA 4OAYA 4FE4A 1V3FA 3E3VA 5CVIA 2P5VA 1I3QJ 2K27A 5LRSA 2C6YA 3FKJA 3S1QJ 2F5DA 2HYFA 3C1DA 3RKQA 5D8KB 3TW6A 3X2QH 4G7HF 1T2KA 4PCQA 1GDTA 3F72A 1W1WE 2CWEA 3K4BA 1S29A 2VASA 1ZG1A 3M8JA 4DYCA 3DEWA 1Z6TA 2WAQN 2VIXA 5K7ZA 4CHUA 2ZMEA 3GFIA 3S2HJ 1GLNA 3OYLA 5L3DA 2HDDA 1HA8A 2HVQA 3I71A 2HOTA 1H89C 3J7YJ 1GXPA 4UV9A 4XLNF 2RN7A 4HBLA 3DU5A 4M3EA 2KLOA 2AXTC 3LSRA 3GTKJ 3BY6A 4LGWA 1IN4A 1K6YA 1ULYA 1WJEA 2DYRH 3MZYA 3SZTA 2W85A 3QU3A 3TO7A 1IAWA 1AKHB 2CMPA 3IL2A 2EFNA 5CJ9A 5DUIA 1WRJA 4EGYA 1SMYF 1NG6A 3H9QA 4I2OA 3CUOA 3L7WA 4I6ZA 4QSHA 3K2AA 3JSOA 1B59A 3MZHA 4IHWA 2IA2A 3ISPA 2VPLA 2Z1DA 3VYTB 2OC6A 5HNHA 3JRIA 1Y8QB 5JHFA 4DBQA 3IH3A 1DDNA 2EIKH 2KKOA 4KUMA 1V54H 1I3AA 3RZDJ 2QZ8A 4UNOA 1LPQA 2R5YB 1QZEA 3LMMA 2A61A 1HKTA 2FX0A 2KRHA 5J8FA 1X3ZB 1OYWA 5D6FA 1ZQ3P 1S3JA 3CDHA 5L3BA 2AHQA 4RDUA 4OINF 1J59A 1ZRFA 2NS7A 2L4AA 3ECHA 2ID6A 3BQYA 4YFKF 2DFHA 2STTA 2BXYA 4U0VA 5ILUA 2IT0A 3P9CA 2HWVA 1ZGWA 4UUSB 4D5CA 5C44J 1K4SA 2Z9OA 2VJJA 1UG2A 4HPQA 4L9JA 4FCYA 2JK3A 4CXFA 2DA1A 1ERDA 4LB5A 1LJ9A 1MNMC 4IHSA 1BIBA 1LVAA 4BBRJ 1MZBA 1YRNA 5EG0A 4XMYA 2DOFA 2VXZA 1X2NA 1RESA 4CA0A 3BR1A 3Q0VA 2HKXA 2EFPA 1LFBA 5A2QK 5BOXA 3K1PA 2R7ZJ 2LG4A 3SEQA 2EA4A 4FHTA 4UY8I 1ZG5A 1XCVA 3GZ5A 4R1HA 4A6DA 1ZARA 3DEUA 4C2TA 2ESHA 2RDPA 1JE8A 4OMYA 5KAFC 4QPQA 3CCMI 1H0MA 5EYRA 5F08A 1HOMA 2LKPA 1CF7B 1FSEA 3VOEA 1MBKA 4U88A 4KIFA 2OTJI 2VODA 4IO9F 3R60A 1FJLA 3I3LA 1G3TA 5E3LA 4CCNA 4JX6A 1S5LC 3PQJA 5HDKA 3ZRGA 2MH2A 3HOVJ 4IHYA 1I1GA 3KEYA 3V8LA 2OUMA 3QP5A 2EFWA 3G3ZA 1U9NA 3W3CA 1LDDA 2EBIA 2XAJA 4BJTA 1POGA 1MJ9A 3BR3A 2Y0MA 1S9HA 3FHNA 4Q5SF 1RIOH 5D5XB 4AVPA 2X1EA 3E6MA 3RCOA 1FSHA 1JHFA 3H9JA 2E36A 3D1NI 3SFIA 2QWWA 4BE0A 3ZQIA 3H0GJ 2Y31A 2HYJA 1N77A 2X1DA 4XN0A 1O7FA 4IX7A 2ZB9A 3OSGA 3IWZA 3CD6I 3VSLA 2AO9A 4EATA 5DDGA 3MKLA 2FMLA 3HJEA 3HB9A 5HDNA 3LSHA 4BKXA 1FBSA 1FX7A 2YUSA 1OMIA 3KP6A 1IW7F 2VUMJ 1D0YA 3TL4X 3DLAA 4A2UA 5J8CA 1ZRCA 3H36A 4E4HA 4BY7J 3RIRA 4EMSA 3K1NA 2PMZA 3PQKA 5L3EA 2M45A 3OSFA 4Y13A 1MMAA 4HYEA 1XGSA 1BW6A 5JR3A 1I50J 4CCOA 2QLZA 5D8LB 2X6OA 2FU4A 3VSKA 4WXDA 1K4TA 1J7KA 4CYDA 3L2CA 2ISZA 1PUFA 1N78A 4M6VA 3EYIA 5KHDA 1MBJA 1JXSA 2CJJA 3FXMA 4A69C 2BVMA 1ONVA 2CRGA 3JR9A 1VQ4I 2CS3A 2HOSA 2Y69H 5EEHA 5F27A 4ZTFA 1TC3C 5K5QA 1W0TA 2IRFG 3K4JA 2ELJA 3CZ6A 5CVRA 1HQCA 1MMSA 5KVRA 1DUXC 4LLNA 3FMSA 1P92A 3G6EI 2KJBA 4ESJA 3K4MA 3GCMA 2E2IJ 3F8NA 1SFEA 3K1MA 3OIPA 3GFJA 2O3FA 2RAEA 3GLXA 3RDIA 3CLOA 4YG2F 3PO2J 2H27A 1O3RA 1LEBA 3CUQA 1R1TA 3CJNA 1YJWI 2DQRA 5DUKA 2G9WA 4XK4A 4A3CJ 3BR0A 1RR8C 1FOXA 2HNHA 1ETYA 4ZZDA 3BCAA 3Q9SA 5B66C 3ECOA 1U2WA 3LSMA 3O2PE 1UHMA 4AIDA 5D6EA 2STWA 3TW7A 1LNWA 4HOBA 1MJBA 3A01B 1TWFJ 3K70C 4CGZA 1SVLA 2W00A 3EUHC 4G7OF 3CQZJ 4DOZA 2E35A 2P7VB 3I55I 3OYJA 1D0XA 2ZMEC 5FKNA 4LLLA 3HKZN 1AOYA 3V42A 2CW8A 1Y6IA 2NRAC 4M6YA 1Y0UA 2R7WA 1IG7A 3HOZJ 2XAUA 1V5FA 3BDDA 2LYCA 4KMUX 1YHQI 2HR3A 3HIFA 2KHMA 3MVPA 4GRIA 4P9FA 4G94A 3JREA 1MGTA 1G3YA 1EF4A 3J81Z 5EGOA 1JTYA 4LFUA 1YYVA 2A68F 5K7FA 2LVSA 1F1ZA 4DGWB 3CCLI 2VBXA 1YW8A 4HV6A 1ZKGA 4P5OA 1IF1A 4ESBA 5J4YA 2JA5J 3ABTA 4KITB 3S2DJ 2IS1A 3IRRA 2LC2A 2JUCA 3GFLA 1WFXA 2W4SA 3NAUA 3L1PA 4CZCA 1ZGJA 2BEOA 4EM1A 3L2UA 5L3GA 4R8HA 4MFDA 3A0BC 2PJPA 3L2WA 2LLKA 1T39A 1VQ6I 4BXUA 1NK2P 4BQAA 3IAM2 2YU9J 4D7NA 3DKXA 3W2WA 1U3EM 2ZJQF 1J75A 2IXSA 4AIJA 1QVUA 2V26A 4A6EA 2EV6A 3V8JA 4IOAF 2XF6A 5J40A 1MSEC 2HKOA 3RYRA 3E6CC 2RC4A 1VQLI 2WY7Q 2I8DA 3M07A 1KYZA 2LDUA 3TO6A 5FB2A 1B4AA 5ICCA 3CLQA 4KFCA 4RA2A 4D0PA 4K2EA 5FD6A 2JJ7A 5TJJA 2OF7A 2L02A 4A0ZA 3H5RA 2R3SA 1J09A 2FE3A 4YEJA 3OS0A 2BV6A 2L9SA 3KZIC 2EZIA 4XLPF 2KRCA 2VLAA 1JKPC 4OIOF 5EGOB 3UR3C 1X3WB 1QBJA 5IT9K 2MH9A 2ETHA 3JSPA 5LGNA 1O3QA 2JVHA 2K4BA 2ICWG 4MQ9F 2GOMA 1R58A 5IP9J 2W84A 3BT9A 1YQAA 1A6IA 2XB5A 3BP8A 4XR6A 2QF7A 3KX2A 5J47A 3H3ZA 3BWGA 2ME0A 5HS8A 4FETA 2FQ3A 4BEHA 2X85A 1PDNC 2B63J 2L7KA 3OIQA 1R22A 2LY1A 3NEUA 2WB1A 4BAYA 3TBIA 5HNFA 2HFHA 2XSDC 2O9LA 4BQOA 4HNUA 5B1BH 5D4RA 2FOWA 3BTJA 4N0BA 2IS2A 1WH7A 4HRIA 1JT0A 2JQ7A 4MIMA 5FGMA 3S3OA 4XORA 1VZ0A 3CO6C 4RB3C 2ZFWA 5FRMA 1IN5A 1OPCA 1EJ9A 1W7PA 3ZQGA 2AXLA 1NG7A 2OCCH 3PIPF 2LKXA 3CESA 3EPZA 3M4OJ 3PUBA 3F6VA 2ZNZA 3ZMDA 5FLXK 4I98B 4NQWB 2ZSHB 3WODF 2CW0F 1G3WA 2E60A 2XKOA 5LEKA 1A35A 5F1RA 2X48A 1IO2A 1SFXA 3OYBA 1K78B 1IC8A 1YIJI 1R5ID 4ZYDA 5BMZA 2JA7J 2JZYA 1TZLA 5TRDA 4ZDLA 1WJ5A 1PP7U 2L3DA 3HG9A 2XAQA 4PFOA 2E1OA 2BOLA 3I4PA 3AL0C 2ZXWH 4O3MA 1YO5C 2Y2ZA 4GYIA 1J0RA 3GF2A 2RKHA 2UXXA 2O0YA 2PBIA 3OYCA 4M3GA 3E5QA 2V6CA 1HSTA 1IV8A 3EUKL 2ZSIB 2LFBA 2HU9A 1BC7C 1IRGA 1IUFA 5J1UA 2MC3A 1NK3P 1VQPI 1IRFA 2R5ZB 3HOUJ 1UCRA 3JTHA 1XSDA 2GIVA 2GWRA 2L7FP 2DOEA 1WHUA 2DMNA 2KPMA 3DKWA 1MDMB 4GO1A 1MH3A 3SYTA 4XLFA 3GUDA 2KIFA 2DMUA 1TLHB 2G7HA 2GZWA 3TKYA 3JRFA 5D5UB 1ON2A 1FT9A 4AC0A 3NARA 5KNLA 5FKLA 1MH4A 2XAFA 4IHTA 4MTDA 4Z2YA 4E7JA 3ZGKA 4ENMA 2XPUA 1WJDA 3ZQLA 1Z9CA 4UUVA 5FKOA 1OCOH 3AG1H 4RLQA 5KCMA 4Y4RA 5ILSA 4BHCA 2LBFB 4EJTA 2HPIA 4C9YA 1S72I 1EH8A 1ORKA 5H6QA 3RKXA 5IYCJ 1P4AA 3RI4A 1UMQA 2QGUA 2CG4A 2IPQX 3HSRA 1EV7A 4XICA 1P4WA 3ZR8X 3C18A 1Z3XA 4YELA 3K69A 3CO7C 3KLNA 1RR7A 4IJAA 2QM3A 3WTSC 1IRZA 2E5NA 3PUFA 4JYKA 2A05A 3CUQC 4S05A 3SJMA 1FIPA 2HPMA 2XSJC 4CYCA 3WTWC 4ZJZA 4I7HA 3WHBA 3K9TA 2A6HF 3Q3SA 3IP4B 4KN7X 5A2QZ 1C0WA 4OIPF 3DBLB 3M1EA 2O61A 1PVEA 1I39A 2HXIA 3BG5A 2FSWA 4I99C 2ECBA 1H9TA 2VQLA 2WAQA 2HOAA 1XGMA 3F8BA 3OL4A 2OCEA 2GLOA 2WWYA 2DA7A 3MD2A 3GYHX 1TWHJ 2L54A 3DPTA 2VPRA 3IV5A 4RS8A 3WG9A 2HZDA 1LQ1A 1ACIA 5DEQA 2BXZA 1FMWA 4NB5A 4PFPA 3K6GA 3JRDA 1N25A 2DA2A 4Y3OA 2KMUA 2P0WA 4IXAA 4IQJA 2V6EA 3AG2H 2WAEA 4PUSA 5E8GA 1HXDA 4BE1A 2P6TA 3ABMH 4JQFA 2EIJH 2BZTA 4E7KA 2DU9A 1PP8F 3E7LA 4RGRA 4LOCA 2Q8KA 2E1MC 3P9IA 2ZXHA 3L00A 1RUOA 2NS8A 2MGQA 4UHTA 5BS6A 2VN2A 3V7CA 4X6AJ 2M3AA 4OMZA 4ON0A 2R7SA 4P55A 3QAHA 2XRLA 1REPC 2LH9A 3OYGA 2R92J 4BDYA 2Z16A 1VQKI 2HI3A 3OYIA 1BI1A 3BROA 3P9KA 2VOOA 3BZKA 2R7VA 1GHCA 1JHHA 1HC8A 1YIOA 2H6BA 3HUGA 5B5EC 2BW3B 1R6RA 5LHGA 2DJNA 3BLYA 4BXXJ 2BHZA 3R0JA 1Z3YA 4DIQA 2H6CA 5K7HA 4ZYEA 3BOQA 2D5VA 2HYGD 5K1YA 1XG1A 1K61A 4GDFA 2JA8J 2EB7A 1I6HJ 1OCZH 1GVDA 1X1PA 2DA5A 2DFEA 2Y30A 3PO3J 2KQRA 2PI0A 3QPLA 1ODDA 1RI7A 3CC2I 4V2FA 4C30A 3VYRB 3M7GA 3W6KB 2VQHA 3D0SA 5DTDA 1D8KA 3LA7A 1S7AA 2HDCA 5C4XJ 2CYYA 3WTUC 1WZ2A 4NNJA 2LY2A 3P5JA 3FZVA 5JLWA 3EUHA 4O5VA 3H5AA 3BC8A 4RLFA 3VYSB 2FXAA 4NBQA 2DO7A 3E6DA 3BPVA 5GPCA 4NDLA 4EVIA 2ZC2A 1FMVA 3QPTA 2W48A 1ZREA 4UVCA 3RPUA 4XRSA 2CV1A 3DXJF 1ZTRA 1D1CA 3G2BA 4P1WA 1FOKA 3KZZA 2LKSA 4EV0A 2VE9A 5BQTA 1B72B 2IA0A 5TISC 5GAHJ 1Y1WJ 1UELB 2L7ZA 3TDUC 2K9LA 3CMYA 2BGCA 2PFBA 3I0TA 1E3OC 1MMNA 5LD2C 2TRTA 1XSVA 3HC7A 4HAMA 4KNYA 4B44A 1APLC 3S14J 3ZMTA 4N9HA 4UV8A 3PNVA 1X1AA 1KGSA 2E19A 3DPLC 4WCGA 4LG0A 1TBXA 1U5TA 4U7DA 3O8GA 4WWCA 2MW8A 2OAZA 1TWCJ 1E2XA 2V9PA 3ZP5A 4FISA 3G1OA 2VXDA 5LHHA 3F9KA 1XB4A 2BY3A 4XL9A 4LG3A 1B8IB 4ZYGA 3ABKH 4DW6A 4ZH4F 2DCEA 3U1DA 4Y7NJ 1R71A 4XOPA 3WTXC 4B43A 2LY9A 2DA4A 4C2MJ 5JVGF 5BPIA 2DFIA 4B3XA 5M3MJ 5C3EJ 3DEEA 3CMAI 3V7RA 2V1XA 4QTRA 1SEUA 2OZ6A 2LOOA 5E79C 5CLSA 2DK5A 3TOBA 4CCKA 2Z2SB 1IN8A 4HQMA 3RYPA 4XKBA 1JTXA 2NAZA 3GWZA 3W6JB 2FD5A 5JVTA 1Z21A 2H1LA 2DT6A 4NC8A 3DP7A 1J5YA 1MD0A 3GEZA 3ZN0A 4ITVA 1FY7A 5IT3A 1Z91A 2M9HA 3G71I 4IF4A 4LJZF 2M4GA 1ETOA 5E3MA 1XMXA 1IJWC 2F5FA 3MWMA 2PJRA 2PN6A 3JRBA 3NWTA 3RPQA 4AIKA 1UHWA 2QBYB 3ELKA 4NC7A 4BXFA 3IKTA 2XROA 4XSXF 2KT0A 1LUJB 1T0FA 4I02A 3LSPA 2TCTA 4O6JA 1FP1D 2FBIA 2DBBA 2VJ5A 3HM5A 1XPXA 2JSPA 1MBHA 1KU3A 4GFBA 1Z7LA 4A3LJ 1F9NA 2IBDA 4HNVA 2CFXA 3S32A 4EJOA 4A3BJ 3BJAA 5H20A 5EEAA 1QHHD 4HA8A 5FD5A 1W0UA 1JUMA 2LREA 2XPVA 5F1JA 4MFEA 1L3LA 3VEPA 3BTLA 5L3FA 5D5WB 4M72A 2NVTJ 2EILH 2QUFA 3MZ8A 3R0AA 4Q47A 3JRHA 2DA6A 1USSA 1TNSA 1LVKA 3T1BA 3S8PA 1NTCA 4XBFA 4XONA 3ZMUA 1TWGJ 4GGGA 2Y75A 1TQPA 3HRSA 3R4KA 2JPCA 4B47A 1FYKA 3K4NA 4RB2C 3FKIJ 3LSTA 5J4VA 2GBYA 1G8XA 2WBMA 2Z3YA 4G6TB 3J7ZI 1O3TA 3BR6A 2XDVA 1MKMA 3L09A 2JN6A 2R7RA 4HF0A 1R1VA 1XX5A 2DAOA 1KQ9A 3FXOA 2FQ4A 1HW1A 2O8XA 1STZA 3HGGA 3FHZA 5HLGA 3R61A 1HW5A 4JOMA 4AVZA 5IT9Z 1YJNI 2M2EA 4LMYA 1V4RA 3H5NA 2XAHA 2N8GA 1V5GA 4OOIA 4AYBN 1F5TA 2FNAA 3QQAA 3TOAA 2QEXI 3O3KA 3OS2A 1D0ZA 1JKQC 2ADUA 5LLQA 1F36A 3WU0A 3LA3A 2XASA 4D9JA 2G7UA 4HQEA 3HEFA 2Q2EB 3KIOA 4IRGA 4AD9A 3F3XA 4L5EA 2ELKA 1O4XA 4LK1F 3S17J 4IQ4A 2QVOA 4EJVA 4G12A 5IYBJ 4WK8F 3MCZA 2F5EA 3ZQ7A 4FT8A 3HKZA 2HEOA 1SAXA 4YIFA 2OU2A 5D5VB 4PSXA 2IGMA 2ID3A 1TQIA 1X19A 3T0YA 1VI0A 4MLOA 1LFUP 3LAJA 4E7IA 3MKZA 4UB8C 2CGPA 4A3JJ 3ABLH 2D1VA 2VKDA 2DTRA 3OYDA 2COMA 5EJCA 2K9SA 2V9VA 3VPRA 3S1MJ 5J1RA 1X1CA 1CQTA 5AIQA 1G59A 2ZMEB 1LE8A 2L0KA 5FLXZ 2ACJA 3HHHA 9ANTA 3I64A 1T08B 5GPAA 4HV5A 3ULQB 4V19K 1R9TJ 1F43A 1FIAA 1GUUA 2O5RA 2ZKZA 3ZQHA 5H2FC 1U0JA 3RZOJ 2CUZA 3IRQA 3GMEA 4YIIA 1CGPA 3SXYA 2YX7A 4U0WA 2DFFA 4LK0F 1BN5A 4XSZF 5K5OA 4DQ2A 1G6NA 2L01A 4A3MJ 1O3SA 1JT6A 2PQ8A 1MIJA 2QQAA 2DW4A 2V4JC 1XD7A 1U9OA 3K0LA 1QRYA 2F48A 1MBGA 1Z77A 5IY5H 1FYMA 1WJAA 2DOAA 2OQRA 1DGRM 1K79A 1FNNA 1IZ1A 2KDOA 4MQVA 2F4IA 4YFNF 2DYSH 1UHSA 3QPSA 1DP7P 1A31A 3OYNA 1T95A 2OQGA 2VE8A 2ZFUA 4E6KG 2I5UA 1R5GA 2XHKA 2F2EA 3DKYA 3OV8A 2IAIA 4PSWA 2NOJB 4PJJA 2GXGA 3TP0A 4XLCA 2XC7A 1UJ8A 1A6QA 3U9GA 2VB6A 4I76A 4KT5C 3K7AJ 1SANA 3HOTA 3C2BA 3FBNB 2E34A 5IP6A 2ESNA 2L4MA 3E6BA 4KDPA 3JAMK 1QZYA 1X4PA 2K40A 1B9MA 3HBLA 2R7UA 2IJLA 4IHXA 4HG2A 2A69F 3MEXA 5F64A 2P81A 5F0HA 4RBOA 1R49A 1U5TC 4DYRA 4ETSA 3I4NJ 1QPMA 4OIRF 3MQ0A 4C3JJ 1LB2A 2ELHA 5GAEJ 2XV4S 1YRNB 3IHUA 5EG0B 1LFPA 1QPIA 3K4CA 1X2MA 3LAPA 2GA1A 5DCMA 3A0HC 4XQFA 5CQEA 4IL6C 2M87A 1OKRA 1XGNA 2KIQA 4UVAA 5GTHC 3TDZC 1ETVA 4OU0A 1MSFC 3BG3A 2QQ8A 1USTA 1D3YA 2XPWA 4DZJA 4U0YA 4E70A 1ZR2A 3CCVI 1UZCA 2K3FA 1S8NA 1FOYA 3WTTC 3PJRA 3QOPA 3DBRB 2W7NA 5KK1A 2LK2A 5DS9A 1Z67A 2M34A 3G1LA 4C3IJ 1BOBA 3C2HA 4N4OB 1QO0D 3FX3A 1A36A 3HDDA 5LGUA 2QA4I 2B9SA 1WCMJ 1SAUA 2L9VA 1RZ4A 3CDLA 1R4NB 4XLAA 1YOVB 2R0QC 2K7LA 2MBFA 4A93J 2Y0SN 1MNEA 5E8IA 4XKVA 2F6CA 2RGVA 2PG4A 4L5IA 2VBWA 4PGHA 2E7XA 4NUBA 4BDZA 2EINH 3WG7H 1VQMI 1H8AC 3D5SC 1MNDA 2CH0A 3QYFA 1YS7A 1T0FC 2LR8A 1YI2I 2K85A 1ETWA 4A0XA 2WA0A 2VT3A 5LHIA 1WJFA 3GX4X 3S2WA 4DZPA 4M73A 3KCCA 1JI8A 5E1ZB 2Y9ZA 2VKVA 3AL0B 5GADJ 3I59A 3LSGA 3JTGA 1FC3A 2DDAA 3ZMSA 3DWLE 4KICA 5CKTA 2WV1A 3BJOA 5M5WJ 1GV5A 1YE9A 1R23A 1XDUA 2Z5UA 3HRTA 2DLLA 1AHDP 4MTEA 2ZCWA 1TL8A 1ETKA 4IHVA 3WE3A 4JX4A 5HLTA 1ENHA 3FK7A 5FLVA 4KMFA 1MBEA 2FMYA 3FXLA 3EUAA 4BY1J 1BI0A 2F5CA 1SD7A 2R7TA 2V7FA 3FXUA 4JX5A 1SD5A 1BR1A 5EZHA 2CQNA 1LDJA 2EQRA 2HTJA 2A6TA 4XKWA 1PUFB 5GP9A 1R00A 1S6LA 2E5ZA 2IGOA 4MEYF 2KIMA 3H3VK 5FFXA 1OLTA 4ENNA 5EDNA 4B09A 4FASD 1QVTA 2A07F 3P7NA 2CQQA 2L9NA 1PJRA 1KZHA 2HZTA 3CF2A 2BBYA 2W1OA 2DQLA 2R93J 3U1KA 2OPTA 5IYDJ 5ED4A 3D5RC 1PUEE 2M0MA 4F3QA 2FOKA 3AG4H 5L3CA 2VC0A 5E18F 4F7ZA 4L0ZB 3CUQB 2ZBKA 3HPHA 4LD5A 2VKHA 2RREA 3HOXJ 1WSUA 5ERIA 2M1BA 2H8WA 3WTZA 4A3EJ 3RQ4A 3H92A 2XGCA 4XN3A 4F92B 1W5TA 4OWRB 3ZQCA 1AKHA 4KYWA 1KYWA 4L9TA 2FUG2 2BYVE 1OJLA 2ZNYA 3GVAA 4EM0B 1IXCA 4IPAA 2DODA 2MSYA 4RMNA 4BACA 3M3YJ 2FNPA 3GZ6A 2ZO4A 3GXOA 1SD4A 3OS1A 2IP2A 4WXHA 4G9YA 2LTPA 4XRMA 1P2FA 5B1AH 2OV7A 1QA6A 2FBKA 2CUFA 1FPQA 5ICEA 3HOSA 3FISA 1VQ7I 2CQXA 1WQ2A 1G4DA 1H9GA 3CJRB 4RAFA 1AA7A 3WE2A 1EH6A 2VONA 2CU7A 4Q48A 4KISA 2CFOA 1Z7UA 3GTQJ 5C4JJ 3FMRA 2KZVA 3F21A 5LRRA 2E1MB 2R5YA 4M9SA 4OAZA 2V1UA 3HTUA 2L9RA 1IN6A 2F4OB 1P4XA 4YRVA 1ZAOA 1G3SA 4L5JA 3BZCA 5DYMA 2WADA 1YITI 2P7CB 4KIBA 3V4GA 5J3LA 2VL8A 3OR1C 3ZXSA 1J2XA 3OOPA 3W2VA 1RC9A 3FXJA 2VC1A 4Q4ZF 1D1AA 1DP3A 2COBA 4B48A 5FROA 2VBYA 3HYIA 1WVRA 5H6RA 2NVUB 3V7SA 4UUSA 2H1KA 4QPOA 2QSHX 1K83J 2KFDA 4M3FA 4MNUA 3OYHA 4HZFA 2K3PA 5IP7J 1FBUA 3MN2A 1X3UA 1PYVA 3KEQA 2YS9A 2P5LC 1UG0A 4BYYA 1WI3A 1I1SA 5CPRB 3SQNA 1T8IA 2Q1ZB 2EK5A 4DNCA 3N05A 2MLKA 2QKMB 3JRGA 2KIUA 1GVJA 4KN4X 2DMQA 3AAFA 2DPDA 5J6XA 2WY8Q 2GM4A 1IUYA 3FWEA 3LNQA 3BJ6A 2D45A 5F6FA 3SEZA 3U21A 3IH4A 3ZQFA 4YFXF 3CC4I 2UUZA 2XB0X 3CCSI 1GXQA 4A3FJ 3RTRA 1TW2A 2EA2A 2JRTA 3D5LA 4X0GA 1T98A 2HQNA 2D1HA 1QNTA 3KFWX 1YFHA 5CVUA 5CYVA 1CF7A 3QYBA 5DD8A 4HX4A 2DMPA 2CW7A 3TO9A 2R4GA 3CMMA 2ZXIA 2ISYA 1W7PD 2K9MA 4Y33A 2QSFX 3LSJA 3HOYJ 3I9V2 1QGPA 2NS0A 3WU1B 3CC7I 2IGNA 1IV6A 2R7FA 1HF0A 3C3WA 3ABUA 4YIRX 3M9AA 4U7BA 3C7JA 1BC8C 3S3NA 4WXCA 2OZUA 2OD5A 2P6SA 2CSOA 1WJCA 2OTLI 3DTEA 1HBXG 2LF8A 4XLHA 4ASNA 1LKXA 4L18B 1VQOI 4BEHB 4BUPA 1I6XA 4V2GA 4A3DJ 1OISA 2H94A 4S0HB 3S3MA 1ZGAA 2F4MB 5HOOA 6PAXA 1E17A 4HLXA 2JSCA 4Y15A 2VQCA 3WU2C 1SVMA 3KPHA 4ZDOA 2IEKA 3FK6A 3WGIA 1Y1VJ 1EA3A 4A3KJ 2YSRA 3UNGC 2R7DA 3REOA 2NOGA 3FXQA 4ENKA 3OOUA 4FQGA 1W7PB 3RKWA 2BY0A 1ZK8A 1Y39A 1WGXA 5FKKA 2B0LA 1RNLA 3GTMJ 3ZMVA 2O7OA 1B1BA 2V1DA 4AU7A 3DPUA 5E3NA 2P4WA 3ONQA 2IA1A 5HODA 4QIWN 3FIWA 3KP4A 2VI6A 3PL8A 3LQRA 5JI6A 1DU0A 3F8FA 1HDDC 2W24A 2CV0A 2F5VA 2M30A 1Y0NA 2JPBA 3E5UA 4HSTA 2KJCA 1BJZA 4UXNA 4ZDPA 1YX3A 2LMDA 3LSKA 1W36C 1XTAA 3GTGJ 1J9IA 3LQQA 3VYUB 2CUEA 1F4KA 1DGWY 2XRNA 4PGGA 3COAC 4G8XA 1TNTA 2K9NA 4MO7A 1EKEA 3BZ6A 1HDPA 3HPGA 2TDXA 4B1RA 3TMOA 5FO5A 4U87A 1XMKA 3HRUA 4HF1A 5E1WA 2QKLB 3VFZA 4CICA 2AQEA 3A2KA 2X9DA 2ME6A 3WHCA 5HLIA 2GIZA 1IXRC 4BNCA 2PMHA 4G7ZF 1WKMA 2EV5A 4RAYA 1A04A 1YW9A 4BQQA 1UFMA 4AUXA 1VNDA 2MYSA 3MMYB 5HVQC 2GXAA 2HVRA 4N4NB 4WF2A 1Z05A 1KQ8A 1JUPA 1Y56A 4IZZA 3OL3A 3I4MJ 2XF5A 4II3A 3U2RA 2AS5F 1JKRC 1U8RA 2HQ5A 3E97A 3QYEA 2MD5A 2YU3A 4EM2A 1RRJA 1OYIA 5DM7F 2JA6J 2EZKA 4H4KC 3S1RJ 2P8TA 2LP0A 3BQZA 2X0LA 4E7ZA 4FE7A 3F23A 3HZJA 4FTHA 3GTPJ 2X51A 2VKEA 4P9UA 4I0AA 4AYBA 3A01A 1I27A 2QYOA 2XF7A 4PK4A 1WJBA 1FOWA 1Z1DA 3LWFA 2M0CA 3CTAA 3SZPA 4E7SA 2IGKA 1OCTC 2VJ4A 2DA3A 4RGXA 4IOCF 4FX0A 3DQVC 3BG6A 3PFYA 2UZKA 3ML6A 3JAMZ 4I09A 1YJ9I 1DU6A 3CJTB 1XGOA 2K86A 5F0FA 1V55H 1SFUA 4A0YA 3L2QA 2YX4A 4D5FA 1BOAA 1S7EA 1BJAA 1LEAA 4LB6B 3IUOA 1VFCA 2XAGA 4KIGA 5GAGJ 2DI3A 3LA2A 4HDUA 4A12A 4CYCB 1VF9A 3S16J 1JJ6C 3L2VA 3K4KA 3OYFA 4RGUA 3S1NJ 1R5HA 1HCRA 2NNNA 3MKWB 3A03A 2V9KA 1ZN2A 2CO5A 3OYEA 3CDIA 1A5JA 2V79A 1KU7A 2JUGA 5HS7A 3IKVA 2MA3A 4LITA 3NQOA 2XGDA 2ZXJA 1IXSB 1T33A 4LLGF 4ESFA 4QLCU 4ZZLA 5M3FJ 2AQFA 2HS5A 3FBIB 2K9QA 4BL0B 4E7HA 2W82A 2M8GX 3L9FA 2W25A 2Z33A 1VQ5I 3AFHA 1KU9A 3T8RA 3OWTA 4PJ0C 3V8KA 3CF5F 1OCPA 4XOTA 4RAZA 4EQQA 3HTSB 1ETQA 5LEJA 3FM3A 4GCVA 4F93B 3KP3A 1YG2A 3RJPA 2KRFA 2WTEA 1IN7A 1P7JA 4LIVA 3MFKA 1R1UA 2MD0A 1TTYA 1SVOA 1RETA 2GAUA 5BPDA 1BIAA 3K70D 1N75A 3E1SA 3KETA 4PZJA 4HF2A 4J01A 2R7XA 2HVSA 1O57A 5DM6F 5FRNA 5LFAA 2EWNA 4ZC3A 2WV0A 3J80K 2KDZA 2BVLA 3HUGB 1W5CC 3RPUD 1OYYA 3WGHA 1Z0XA 2JWTA 1BI2A 4CH7A 2V1NA
chains in the Genus database with same CATH topology
3I58A 1MJAA 3R6SA 3KP2A 5D4SA 2NNYA 2PLYA 4HLYA 2HTSA 3O6BB 2Q0OA 2RNJA 2XGXA 1T6SA 5LBQA 3RKYA 2ZJ2A 3F22A 3ROUA 4TV7A 4KA4A 4JK1X 4AWXB 1WWXA 2K4JA 2XKPA 4N9IA 3HRMA 4A5NA 1RUNA 5EEGA 1U6GA 1FZPB 2P5KA 1HSJA 4NHJA 2X4HA 3HHGA 2HQRA 4RB1A 1Z6RA 3DV8A 4G6DA 4MEXF 3TQNA 4NQWA 4LG0B 3J7AO 1U5TB 4PDKA 3EYYA 4GXOA 4M9ZA 3ZMZA 2W57A 1K78A 2PMUA 3I54A 4HX8A 1DPUA 1W4MA 3QP6A 4QWQA 1YLFA 1T38A 2OBPA 2O6GE 1ZLJA 2JTVA 2FF4A 1HW2A 4L9VA 3EETA 5AONA 1JGSA 2FEZA 1AWCA 3G73A 1ZRDA 2A3SA 1HKSA 1OR7A 3IC7A 1YTYA 2RQPA 2BE5F 1MDMA 2FRHA 5E20A 1B6AA 3JW4A 3NRVA 5DV5A 5ICGA 2XVCA 4GYGA 1R7JA 1K7AA 3ZN1A 4A5MA 3I5UA 3FF5A 3HSEA 3I53A 4L9NA 4HW0A 4AIHA 2LNBA 3WTYC 3KP7A 2MLGA 3T8TA 4EJWA 3FMQA 2VOPA 2QQ9A 1KQ0A 1ZYRF 1LDKB 4CDGA 1D8JA 4M74A 3QPHA 3VODA 3GFMA 4BHBA 2A6EF 2CQKA 3LFKA 4M9XA 2QENA 1YS6A 4P96A 3MAJA 1XN7A 5DCFA 1W5SA 1EH7A 3H3UA 4MHGA 2RV8A 3WGGA 3ZPLA 1KA8A 2OA4A 3M8FA 5K5RA 1ZG3A 3KEOA 1ZHFA 5AIPA 2DPUA 1D5VA 2M8EA 3QU6A 2O03A 4RGSA 4CO8A 1FP2A 1TQMA 1ON1A 4XRFA 1DPRA 1FLIA 5HLHA 1K6OA 3B73A 1SMTA 3Q9VA 3F8CA 3KLOA 2EFOA 1O7LA 2DT5A 4FX4A 1ZH5A 5LGTA 2UWMA 3QRFF 2GXBA 1YW7A 3DFGA 3ERED 4CZZA 1NHAA 2YR2A 2IW5A 4BH9A 3B02A 2RVCA 2DK8A 3FXRA 5DD4A 5FFZA 4M6XA 3EDPA 4IVNA 4M71A 5ICFA 4UVBA 4JBAA 2M5WA 1B9NA 4I01A 3BPXA 2A5YB 2Y48A 4B8XA 1BI3A 1L0OC 1XMAA 1WI9A 4ENJA 3KE2A 4HX7A 3DF8A 1XDSA 1S7OA 1QZZA 1UB9A 1XSXA 3N97A 2IVMA 1FWZA 4G6QA 5JFRA 4MGRA 3PFIA 3TGNA 2FA5A 1U78A 4H0EA 1HKQA 2D2WA 3T5XA 2EJRA 3SFZA 3VB2A 2H09A 2LSOA 2E1CA 2E1NA 2XUBA 3Q5FA 1XCBA 2J5OA 2QQBA 4L0YB 3HSFA 2FBHA 4OIQF 2JT1A 4I0BA 4Y17A 4IRHA 4S04A 1QQIA 3IWFA 1R36A 2VT2A 2WC2A 1SD6A 4EGZA 1Q1HA 3J81K 5DCMB 3FM5A 2QBYA 2GA2A 2E7WA 5ILVA 1I5ZA 3F8MA 3N4MA 4ZYHA 1BBYA 2PEXA 3GW2A 5CVVA 1FYLA 4RB0A 2HGCA 3F6OA 4IRIA 2NYXA 3K2ZA 5HDGA 1FBQA 3M8EA 2GQQA 4EJUA 2XIGA 2EV0A 5CVJA 5JHUA 2EFQA 5E17F 4BHPA 3GO5A 2K02A 4HDVA 1TW3A 5HS9A 4R79A 3J80Z 4WX9A 2UXNA 5E1XA 3SHFA 1VTNC 3EQLF 3KP5A 1BM9A 3I59B 2VBZA 3E5XA 1KU2A 1ZLKA 1P6RA 3KZYA 3WTVC 2YPRA 2J5PA 2HOEA 2Q2EA 2Z99A 2LF7A 1V3FA 3E3VA 5CVIA 2P5VA 2K27A 5LRSA 2C6YA 2F5DA 2HYFA 3C1DA 5D8KB 4G7HF 1T2KA 4PCQA 3F72A 2CWEA 1S29A 1ZG1A 1Z6TA 4CHUA 2ZMEA 3GFIA 5L3DA 3I71A 1GXPA 4UV9A 4XLNF 2RN7A 4HBLA 3BY6A 4LGWA 1IN4A 1ULYA 3MZYA 3SZTA 2W85A 3QU3A 3TO7A 1IAWA 3IL2A 2EFNA 5CJ9A 5DUIA 1WRJA 4EGYA 1SMYF 4I2OA 3CUOA 3L7WA 3JSOA 1B59A 3MZHA 2IA2A 3ISPA 1DDNA 2KKOA 4KUMA 4UNOA 2QZ8A 1HKTA 2A61A 5J8FA 1OYWA 5D6FA 1S3JA 3CDHA 5L3BA 4OINF 1J59A 1ZRFA 2L4AA 3ECHA 4YFKF 2STTA 4U0VA 5ILUA 2IT0A 3P9CA 2HWVA 2Z9OA 4L9JA 4CXFA 4LB5A 1LJ9A 4IHSA 1BIBA 1LVAA 1MZBA 2VXZA 2HKXA 2EFPA 5A2QK 5BOXA 3K1PA 2EA4A 4FHTA 1ZG5A 1XCVA 3GZ5A 4R1HA 4A6DA 1ZARA 3DEUA 2ESHA 2RDPA 1JE8A 4OMYA 1H0MA 2LKPA 1CF7B 1FSEA 3VOEA 4U88A 4KIFA 2VODA 3R60A 1G3TA 5HDKA 3PQJA 2MH2A 1I1GA 3V8LA 3QP5A 2EFWA 3G3ZA 1LDDA 2XAJA 1MJ9A 2Y0MA 4Q5SF 1RIOH 5D5XB 4AVPA 3E6MA 1FSHA 1JHFA 2QWWA 1O7FA 3IWZA 5DDGA 2FMLA 5HDNA 1FBSA 1FX7A 1OMIA 3KP6A 1IW7F 4A2UA 5J8CA 1ZRCA 3RIRA 4EMSA 3K1NA 3PQKA 5L3EA 2M45A 4Y13A 4HYEA 1XGSA 5JR3A 2QLZA 5D8LB 2FU4A 4WXDA 1J7KA 4CYDA 3L2CA 2ISZA 1JXSA 3EYIA 1ONVA 5EEHA 5K5QA 2IRFG 5CVRA 1HQCA 5KVRA 1DUXC 4LLNA 3FMSA 1P92A 2KJBA 4ESJA 3F8NA 1SFEA 3K1MA 3GFJA 2O3FA 3RDIA 3GLXA 3CLOA 4YG2F 2H27A 1O3RA 1LEBA 3CUQA 1R1TA 3CJNA 2DQRA 5DUKA 2G9WA 4ZZDA 3Q9SA 3ECOA 1U2WA 3O2PE 1UHMA 5D6EA 2STWA 1LNWA 4HOBA 1MJBA 4CGZA 4G7OF 2P7VB 4LLLA 1AOYA 2NRAC 4M6YA 1Y0UA 3BDDA 4KMUX 2HR3A 3HIFA 4P9FA 4G94A 1MGTA 1G3YA 3J81Z 4LFUA 1YYVA 2A68F 1F1ZA 2VBXA 1YW8A 4HV6A 4P5OA 1IF1A 4ESBA 3ABTA 3IRRA 3GFLA 1ZGJA 2BEOA 4EM1A 5L3GA 4R8HA 2PJPA 1T39A 4BXUA 4BQAA 1U3EM 1J75A 4AIJA 4A6EA 2EV6A 3V8JA 2HKOA 3RYRA 3E6CC 2RC4A 1KYZA 2LDUA 3TO6A 5FB2A 1B4AA 5ICCA 4KFCA 4D0PA 4K2EA 5FD6A 5TJJA 2L02A 4A0ZA 2R3SA 2FE3A 2BV6A 4XLPF 4OIOF 1QBJA 5IT9K 2MH9A 2ETHA 3JSPA 5LGNA 1O3QA 2K4BA 4MQ9F 1R58A 2W84A 1YQAA 3BP8A 3H3ZA 3BWGA 5HS8A 2FQ3A 1PDNC 1R22A 3NEUA 4BAYA 2HFHA 5D4RA 4N0BA 5FGMA 3CO6C 4RB3C 2ZFWA 1IN5A 1OPCA 1W7PA 2AXLA 3F6VA 2ZNZA 3ZMDA 5FLXK 4I98B 3WODF 2CW0F 1G3WA 2XKOA 5LEKA 5F1RA 1SFXA 1K78B 4ZYDA 5BMZA 2JZYA 5TRDA 1PP7U 2L3DA 2XAQA 3I4PA 4O3MA 1YO5C 4GYIA 1J0RA 3GF2A 2RKHA 2UXXA 2O0YA 2PBIA 3E5QA 2V6CA 1HSTA 1IRGA 1BC7C 2MC3A 1IRFA 1UCRA 3JTHA 1XSDA 2GIVA 2GWRA 3DKWA 1MDMB 4GO1A 3GUDA 2KIFA 1TLHB 2G7HA 2GZWA 3TKYA 5D5UB 1ON2A 1FT9A 4IHTA 2XAFA 4MTDA 4Z2YA 4ENMA 1Z9CA 4UUVA 5ILSA 4BHCA 4EJTA 1EH8A 3RI4A 5H6QA 3RKXA 1P4AA 2CG4A 2IPQX 3HSRA 1EV7A 1P4WA 3C18A 3CO7C 3K69A 3KLNA 4IJAA 2QM3A 3WTSC 3CUQC 4S05A 3WTWC 4I7HA 3K9TA 2A6HF 4KN7X 5A2QZ 1C0WA 4OIPF 3M1EA 2O61A 2FSWA 1H9TA 1XGMA 3F8BA 2WWYA 3GYHX 2L54A 3DPTA 4RS8A 3WG9A 1LQ1A 5DEQA 4NB5A 4IXAA 5E8GA 1HXDA 2P6TA 1PP8F 4JQFA 2DU9A 4RGRA 2Q8KA 3P9IA 3L00A 1RUOA 4UHTA 5BS6A 2VN2A 3V7CA 4OMZA 4ON0A 4P55A 3QAHA 1REPC 1BI1A 3BROA 3P9KA 2VOOA 1GHCA 1JHHA 1YIOA 2H6BA 3HUGA 5LHGA 3R0JA 2H6CA 4ZYEA 3BOQA 2HYGD 5K1YA 2EB7A 2PI0A 1ODDA 1RI7A 3W6KB 3M7GA 3D0SA 1D8KA 3LA7A 1S7AA 2HDCA 2CYYA 3WTUC 3FZVA 3EUHA 4O5VA 2FXAA 2DO7A 3E6DA 3BPVA 4EVIA 3QPTA 1ZREA 4UVCA 3RPUA 3DXJF 1FOKA 3KZZA 4EV0A 2VE9A 5BQTA 2IA0A 3TDUC 2BGCA 2PFBA 3I0TA 1XSVA 4HAMA 4KNYA 3ZMTA 4N9HA 4UV8A 1KGSA 3DPLC 4WCGA 4LG0A 1TBXA 1U5TA 4U7DA 4WWCA 2OAZA 1E2XA 3ZP5A 5LHHA 1XB4A 4ZYGA 4ZH4F 3U1DA 3WTXC 5BPIA 2DFIA 3V7RA 2V1XA 2OZ6A 5CLSA 2DK5A 3TOBA 1IN8A 4HQMA 3RYPA 2NAZA 3GWZA 3W6JB 5JVTA 3DP7A 1J5YA 1MD0A 3GEZA 3ZN0A 1FY7A 5IT3A 1Z91A 4IF4A 4LJZF 2F5FA 3MWMA 4AIKA 2PN6A 3RPQA 1UHWA 2QBYB 3ELKA 3IKTA 2XROA 4XSXF 1T0FA 4I02A 4O6JA 1FP1D 2FBIA 2DBBA 1KU3A 1F9NA 2CFXA 4EJOA 3BJAA 5H20A 4HA8A 5FD5A 1L3LA 3VEPA 5L3FA 5D5WB 4M72A 2QUFA 3R0AA 4Q47A 1USSA 1TNSA 3T1BA 4XBFA 3ZMUA 4GGGA 2Y75A 1TQPA 3HRSA 3R4KA 2JPCA 1FYKA 4RB2C 3LSTA 2Z3YA 1O3TA 1MKMA 3L09A 4HF0A 1R1VA 2DAOA 1KQ9A 1HW1A 2O8XA 1STZA 3FHZA 5HLGA 3R61A 1HW5A 5IT9Z 4LMYA 1V4RA 2XAHA 4OOIA 1F5TA 2FNAA 3TOAA 3O3KA 2ADUA 5LLQA 3WU0A 3LA3A 2XASA 2G7UA 4HQEA 4IRGA 4AD9A 3F3XA 4LK1F 2QVOA 4EJVA 4WK8F 3MCZA 2F5EA 3ZQ7A 4FT8A 2HEOA 1SAXA 4YIFA 2OU2A 5D5VB 1TQIA 3T0YA 3LAJA 2CGPA 2D1VA 2DTRA 2COMA 2V9VA 5AIQA 2ZMEB 5FLXZ 2ACJA 3HHHA 3I64A 4HV5A 3ULQB 2ZKZA 3IRQA 4YIIA 1CGPA 3SXYA 2YX7A 4U0WA 4LK0F 1BN5A 4XSZF 5K5OA 4DQ2A 1G6NA 2L01A 1O3SA 2QQAA 2PQ8A 2DW4A 1XD7A 3K0LA 1FYMA 2OQRA 1K79A 1FNNA 1IZ1A 4MQVA 4YFNF 1DP7P 2OQGA 2VE8A 1R5GA 2XHKA 2F2EA 3OV8A 2GXGA 3U9GA 4KT5C 3HOTA 2ESNA 2L4MA 3E6BA 4KDPA 3JAMK 1QZYA 1B9MA 2IJLA 2A69F 3MEXA 5F64A 1U5TC 4ETSA 1QPMA 4OIRF 3MQ0A 1LB2A 2ELHA 2XV4S 3IHUA 3LAPA 2GA1A 5DCMA 2M87A 1OKRA 1XGNA 4UVAA 3TDZC 4OU0A 1USTA 1D3YA 4U0YA 4E70A 1S8NA 3WTTC 3QOPA 5KK1A 1QO0D 3FX3A 5LGUA 1RZ4A 2K7LA 2MBFA 5E8IA 2RGVA 2PG4A 4L5IA 2VBWA 4PGHA 2E7XA 1YS7A 4A0XA 2VT3A 5LHIA 3GX4X 3S2WA 4M73A 3KCCA 5E1ZB 3I59A 3JTGA 1FC3A 3ZMSA 4KICA 3BJOA 1R23A 1XDUA 2Z5UA 3HRTA 2DLLA 4MTEA 2ZCWA 3WE3A 4KMFA 2FMYA 1BI0A 2F5CA 1SD7A 3FXUA 1SD5A 1LDJA 2HTJA 1R00A 1S6LA 4MEYF 2KIMA 5FFXA 4ENNA 4B09A 2A07F 3P7NA 2HZTA 2BBYA 2DQLA 5ED4A 1PUEE 2FOKA 5L3CA 2VC0A 5E18F 4F7ZA 4L0ZB 3CUQB 2ZBKA 4LD5A 1WSUA 5ERIA 2M1BA 3WTZA 3H92A 1W5TA 4KYWA 1KYWA 4L9TA 2BYVE 2ZNYA 3GVAA 4EM0B 1IXCA 4IPAA 2FNPA 3GZ6A 2ZO4A 3GXOA 1SD4A 2IP2A 4WXHA 4G9YA 1P2FA 2FBKA 1FPQA 5ICEA 3HOSA 1WQ2A 1G4DA 1H9GA 3WE2A 1EH6A 2VONA 4Q48A 1Z7UA 3FMRA 3F21A 5LRRA 4M9SA 2V1UA 3HTUA 1IN6A 1P4XA 1ZAOA 1G3SA 4L5JA 2P7CB 5DYMA 4KIBA 3V4GA 1J2XA 3OOPA 2VC1A 4Q4ZF 2VBYA 3HYIA 5H6RA 3V7SA 4MNUA 4HZFA 1FBUA 1X3UA 3KEQA 2P5LC 4BYYA 1I1SA 3SQNA 2EK5A 4DNCA 2MLKA 2KIUA 1GVJA 4KN4X 3AAFA 2DPDA 5J6XA 1IUYA 3FWEA 3BJ6A 2D45A 5F6FA 4YFXF 1GXQA 3RTRA 1TW2A 2EA2A 2JRTA 3D5LA 1T98A 2HQNA 2D1HA 1QNTA 3KFWX 1YFHA 5CVUA 5CYVA 1CF7A 5DD8A 4HX4A 3TO9A 2ISYA 1W7PD 1QGPA 2NS0A 3WU1B 2R7FA 3C3WA 3ABUA 3M9AA 4U7BA 3C7JA 1BC8C 4WXCA 2OZUA 2OD5A 2P6SA 2CSOA 1HBXG 2LF8A 4ASNA 4L18B 1I6XA 2H94A 1ZGAA 5HOOA 6PAXA 1E17A 4HLXA 2JSCA 4Y15A 3WGIA 2YSRA 2R7DA 3REOA 3FXQA 4ENKA 1W7PB 3RKWA 2B0LA 1RNLA 3ZMVA 1B1BA 2V1DA 2P4WA 2IA1A 3KP4A 3LQRA 5JI6A 3F8FA 2W24A 2M30A 2JPBA 3E5UA 2KJCA 4UXNA 1J9IA 3LQQA 1F4KA 2XRNA 4PGGA 3COAC 4G8XA 1TNTA 3BZ6A 2TDXA 5FO5A 1XMKA 3HRUA 4HF1A 5E1WA 3VFZA 4CICA 5HLIA 1IXRC 4BNCA 2PMHA 4G7ZF 1WKMA 2EV5A 4RAYA 1A04A 1YW9A 1UFMA 5HVQC 4WF2A 1Z05A 1KQ8A 3U2RA 2AS5F 1U8RA 3E97A 2MD5A 2YU3A 4EM2A 1OYIA 2P8TA 2X0LA 3F23A 4P9UA 4I0AA 1I27A 2QYOA 1Z1DA 3LWFA 3SZPA 3CTAA 4RGXA 4FX0A 3DQVC 2UZKA 3ML6A 3JAMZ 4I09A 1XGOA 2K86A 1SFUA 4A0YA 2YX4A 1BOAA 1BJAA 1LEAA 4LB6B 2XAGA 4KIGA 2DI3A 3LA2A 4HDUA 4A12A 4RGUA 1R5HA 2NNNA 2CO5A 1ZN2A 2V79A 1KU7A 5HS7A 3IKVA 2MA3A 3NQOA 2ZXJA 1IXSB 4ESFA 4LLGF 4QLCU 4ZZLA 2HS5A 3L9FA 2W25A 2Z33A 1KU9A 3T8RA 3V8KA 4RAZA 4EQQA 3HTSB 5LEJA 3FM3A 4GCVA 3KP3A 1YG2A 3RJPA 2KRFA 2WTEA 1IN7A 3MFKA 1R1UA 1TTYA 2GAUA 5BPDA 1BIAA 3KETA 4PZJA 4HF2A 1O57A 2EWNA 2WV0A 3J80K 1OYYA 3WGHA 1BI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I58 A;  1MJA A;  3R6S A;  3KP2 A;  5D4S A;  2NNY A;  2PLY A;  4HLY A;  2HTS A;  3O6B B;  2Q0O A;  2RNJ A;  2XGX A;  1T6S A;  5LBQ A;  3RKY A;  2ZJ2 A;  3F22 A;  3ROU A;  4TV7 A;  4KA4 A;  4JK1 X;  4AWX B;  1WWX A;  2K4J A;  2XKP A;  4N9I A;  3HRM A;  4A5N A;  1RUN A;  5EEG A;  1U6G A;  1FZP B;  2P5K A;  1HSJ A;  4NHJ A;  2X4H A;  3HHG A;  2HQR A;  4RB1 A;  1Z6R A;  3DV8 A;  4G6D A;  4MEX F;  3TQN A;  4NQW A;  4LG0 B;  3J7A O;  1U5T B;  4PDK A;  3EYY A;  4GXO A;  4M9Z A;  3ZMZ A;  2W57 A;  1K78 A;  2PMU A;  3I54 A;  4HX8 A;  1DPU A;  1W4M A;  3QP6 A;  4QWQ A;  1YLF A;  1T38 A;  2OBP A;  2O6G E;  1ZLJ A;  2JTV A;  2FF4 A;  1HW2 A;  4L9V A;  3EET A;  5AON A;  1JGS A;  2FEZ A;  1AWC A;  3G73 A;  1ZRD A;  2A3S A;  1HKS A;  1OR7 A;  3IC7 A;  1YTY A;  2RQP A;  2BE5 F;  1MDM A;  2FRH A;  5E20 A;  1B6A A;  3JW4 A;  3NRV A;  5DV5 A;  5ICG A;  2XVC A;  4GYG A;  1R7J A;  1K7A A;  3ZN1 A;  4A5M A;  3I5U A;  3FF5 A;  3HSE A;  3I53 A;  4L9N A;  4HW0 A;  4AIH A;  2LNB A;  3WTY C;  3KP7 A;  2MLG A;  3T8T A;  4EJW A;  3FMQ A;  2VOP A;  2QQ9 A;  1KQ0 A;  1ZYR F;  1LDK B;  4CDG A;  1D8J A;  4M74 A;  3QPH A;  3VOD A;  3GFM A;  4BHB A;  2A6E F;  2CQK A;  3LFK A;  4M9X A;  2QEN A;  1YS6 A;  4P96 A;  3MAJ A;  1XN7 A;  5DCF A;  1W5S A;  1EH7 A;  3H3U A;  4MHG A;  2RV8 A;  3WGG A;  3ZPL A;  1KA8 A;  2OA4 A;  3M8F A;  5K5R A;  1ZG3 A;  3KEO A;  1ZHF A;  5AIP A;  2DPU A;  1D5V A;  2M8E A;  3QU6 A;  2O03 A;  4RGS A;  4CO8 A;  1FP2 A;  1TQM A;  1ON1 A;  4XRF A;  1DPR A;  1FLI A;  5HLH A;  1K6O A;  3B73 A;  1SMT A;  3Q9V A;  3F8C A;  3KLO A;  2EFO A;  1O7L A;  2DT5 A;  4FX4 A;  1ZH5 A;  5LGT A;  2UWM A;  3QRF F;  2GXB A;  1YW7 A;  3DFG A;  3ERE D;  4CZZ A;  1NHA A;  2YR2 A;  2IW5 A;  4BH9 A;  3B02 A;  2RVC A;  2DK8 A;  3FXR A;  5DD4 A;  5FFZ A;  4M6X A;  3EDP A;  4IVN A;  4M71 A;  5ICF A;  4UVB A;  4JBA A;  2M5W A;  1B9N A;  4I01 A;  3BPX A;  2A5Y B;  2Y48 A;  4B8X A;  1BI3 A;  1L0O C;  1XMA A;  1WI9 A;  4ENJ A;  3KE2 A;  4HX7 A;  3DF8 A;  1XDS A;  1S7O A;  1QZZ A;  1UB9 A;  1XSX A;  3N97 A;  2IVM A;  1FWZ A;  4G6Q A;  5JFR A;  4MGR A;  3PFI A;  3TGN A;  2FA5 A;  1U78 A;  4H0E A;  1HKQ A;  2D2W A;  3T5X A;  2EJR A;  3SFZ A;  3VB2 A;  2H09 A;  2LSO A;  2E1C A;  2E1N A;  2XUB A;  3Q5F A;  1XCB A;  2J5O A;  2QQB A;  4L0Y B;  3HSF A;  2FBH A;  4OIQ F;  2JT1 A;  4I0B A;  4Y17 A;  4IRH A;  4S04 A;  1QQI A;  3IWF A;  1R36 A;  2VT2 A;  2WC2 A;  1SD6 A;  4EGZ A;  1Q1H A;  3J81 K;  5DCM B;  3FM5 A;  2QBY A;  2GA2 A;  2E7W A;  5ILV A;  1I5Z A;  3F8M A;  3N4M A;  4ZYH A;  1BBY A;  2PEX A;  3GW2 A;  5CVV A;  1FYL A;  4RB0 A;  2HGC A;  3F6O A;  4IRI A;  2NYX A;  3K2Z A;  5HDG A;  1FBQ A;  3M8E A;  2GQQ A;  4EJU A;  2XIG A;  2EV0 A;  5CVJ A;  5JHU A;  2EFQ A;  5E17 F;  4BHP A;  3GO5 A;  2K02 A;  4HDV A;  1TW3 A;  5HS9 A;  4R79 A;  3J80 Z;  4WX9 A;  2UXN A;  5E1X A;  3SHF A;  1VTN C;  3EQL F;  3KP5 A;  1BM9 A;  3I59 B;  2VBZ A;  3E5X A;  1KU2 A;  1ZLK A;  1P6R A;  3KZY A;  3WTV C;  2YPR A;  2J5P A;  2HOE A;  2Q2E A;  2Z99 A;  2LF7 A;  1V3F A;  3E3V A;  5CVI A;  2P5V A;  2K27 A;  5LRS A;  2C6Y A;  2F5D A;  2HYF A;  3C1D A;  5D8K B;  4G7H F;  1T2K A;  4PCQ A;  3F72 A;  2CWE A;  1S29 A;  1ZG1 A;  1Z6T A;  4CHU A;  2ZME A;  3GFI A;  5L3D A;  3I71 A;  1GXP A;  4UV9 A;  4XLN F;  2RN7 A;  4HBL A;  3BY6 A;  4LGW A;  1IN4 A;  1ULY A;  3MZY A;  3SZT A;  2W85 A;  3QU3 A;  3TO7 A;  1IAW A;  3IL2 A;  2EFN A;  5CJ9 A;  5DUI A;  1WRJ A;  4EGY A;  1SMY F;  4I2O A;  3CUO A;  3L7W A;  3JSO A;  1B59 A;  3MZH A;  2IA2 A;  3ISP A;  1DDN A;  2KKO A;  4KUM A;  4UNO A;  2QZ8 A;  1HKT A;  2A61 A;  5J8F A;  1OYW A;  5D6F A;  1S3J A;  3CDH A;  5L3B A;  4OIN F;  1J59 A;  1ZRF A;  2L4A A;  3ECH A;  4YFK F;  2STT A;  4U0V A;  5ILU A;  2IT0 A;  3P9C A;  2HWV A;  2Z9O A;  4L9J A;  4CXF A;  4LB5 A;  1LJ9 A;  4IHS A;  1BIB A;  1LVA A;  1MZB A;  2VXZ A;  2HKX A;  2EFP A;  5A2Q K;  5BOX A;  3K1P A;  2EA4 A;  4FHT A;  1ZG5 A;  1XCV A;  3GZ5 A;  4R1H A;  4A6D A;  1ZAR A;  3DEU A;  2ESH A;  2RDP A;  1JE8 A;  4OMY A;  1H0M A;  2LKP A;  1CF7 B;  1FSE A;  3VOE A;  4U88 A;  4KIF A;  2VOD A;  3R60 A;  1G3T A;  5HDK A;  3PQJ A;  2MH2 A;  1I1G A;  3V8L A;  3QP5 A;  2EFW A;  3G3Z A;  1LDD A;  2XAJ A;  1MJ9 A;  2Y0M A;  4Q5S F;  1RIO H;  5D5X B;  4AVP A;  3E6M A;  1FSH A;  1JHF A;  2QWW A;  1O7F A;  3IWZ A;  5DDG A;  2FML A;  5HDN A;  1FBS A;  1FX7 A;  1OMI A;  3KP6 A;  1IW7 F;  4A2U A;  5J8C A;  1ZRC A;  3RIR A;  4EMS A;  3K1N A;  3PQK A;  5L3E A;  2M45 A;  4Y13 A;  4HYE A;  1XGS A;  5JR3 A;  2QLZ A;  5D8L B;  2FU4 A;  4WXD A;  1J7K A;  4CYD A;  3L2C A;  2ISZ A;  1JXS A;  3EYI A;  1ONV A;  5EEH A;  5K5Q A;  2IRF G;  5CVR A;  1HQC A;  5KVR A;  1DUX C;  4LLN A;  3FMS A;  1P92 A;  2KJB A;  4ESJ A;  3F8N A;  1SFE A;  3K1M A;  3GFJ A;  2O3F A;  3RDI A;  3GLX A;  3CLO A;  4YG2 F;  2H27 A;  1O3R A;  1LEB A;  3CUQ A;  1R1T A;  3CJN A;  2DQR A;  5DUK A;  2G9W A;  4ZZD A;  3Q9S A;  3ECO A;  1U2W A;  3O2P E;  1UHM A;  5D6E A;  2STW A;  1LNW A;  4HOB A;  1MJB A;  4CGZ A;  4G7O F;  2P7V B;  4LLL A;  1AOY A;  2NRA C;  4M6Y A;  1Y0U A;  3BDD A;  4KMU X;  2HR3 A;  3HIF A;  4P9F A;  4G94 A;  1MGT A;  1G3Y A;  3J81 Z;  4LFU A;  1YYV A;  2A68 F;  1F1Z A;  2VBX A;  1YW8 A;  4HV6 A;  4P5O A;  1IF1 A;  4ESB A;  3ABT A;  3IRR A;  3GFL A;  1ZGJ A;  2BEO A;  4EM1 A;  5L3G A;  4R8H A;  2PJP A;  1T39 A;  4BXU A;  4BQA A;  1U3E M;  1J75 A;  4AIJ A;  4A6E A;  2EV6 A;  3V8J A;  2HKO A;  3RYR A;  3E6C C;  2RC4 A;  1KYZ A;  2LDU A;  3TO6 A;  5FB2 A;  1B4A A;  5ICC A;  4KFC A;  4D0P A;  4K2E A;  5FD6 A;  5TJJ A;  2L02 A;  4A0Z A;  2R3S A;  2FE3 A;  2BV6 A;  4XLP F;  4OIO F;  1QBJ A;  5IT9 K;  2MH9 A;  2ETH A;  3JSP A;  5LGN A;  1O3Q A;  2K4B A;  4MQ9 F;  1R58 A;  2W84 A;  1YQA A;  3BP8 A;  3H3Z A;  3BWG A;  5HS8 A;  2FQ3 A;  1PDN C;  1R22 A;  3NEU A;  4BAY A;  2HFH A;  5D4R A;  4N0B A;  5FGM A;  3CO6 C;  4RB3 C;  2ZFW A;  1IN5 A;  1OPC A;  1W7P A;  2AXL A;  3F6V A;  2ZNZ A;  3ZMD A;  5FLX K;  4I98 B;  3WOD F;  2CW0 F;  1G3W A;  2XKO A;  5LEK A;  5F1R A;  1SFX A;  1K78 B;  4ZYD A;  5BMZ A;  2JZY A;  5TRD A;  1PP7 U;  2L3D A;  2XAQ A;  3I4P A;  4O3M A;  1YO5 C;  4GYI A;  1J0R A;  3GF2 A;  2RKH A;  2UXX A;  2O0Y A;  2PBI A;  3E5Q A;  2V6C A;  1HST A;  1IRG A;  1BC7 C;  2MC3 A;  1IRF A;  1UCR A;  3JTH A;  1XSD A;  2GIV A;  2GWR A;  3DKW A;  1MDM B;  4GO1 A;  3GUD A;  2KIF A;  1TLH B;  2G7H A;  2GZW A;  3TKY A;  5D5U B;  1ON2 A;  1FT9 A;  4IHT A;  2XAF A;  4MTD A;  4Z2Y A;  4ENM A;  1Z9C A;  4UUV A;  5ILS A;  4BHC A;  4EJT A;  1EH8 A;  3RI4 A;  5H6Q A;  3RKX A;  1P4A A;  2CG4 A;  2IPQ X;  3HSR A;  1EV7 A;  1P4W A;  3C18 A;  3CO7 C;  3K69 A;  3KLN A;  4IJA A;  2QM3 A;  3WTS C;  3CUQ C;  4S05 A;  3WTW C;  4I7H A;  3K9T A;  2A6H F;  4KN7 X;  5A2Q Z;  1C0W A;  4OIP F;  3M1E A;  2O61 A;  2FSW A;  1H9T A;  1XGM A;  3F8B A;  2WWY A;  3GYH X;  2L54 A;  3DPT A;  4RS8 A;  3WG9 A;  1LQ1 A;  5DEQ A;  4NB5 A;  4IXA A;  5E8G A;  1HXD A;  2P6T A;  1PP8 F;  4JQF A;  2DU9 A;  4RGR A;  2Q8K A;  3P9I A;  3L00 A;  1RUO A;  4UHT A;  5BS6 A;  2VN2 A;  3V7C A;  4OMZ A;  4ON0 A;  4P55 A;  3QAH A;  1REP C;  1BI1 A;  3BRO A;  3P9K A;  2VOO A;  1GHC A;  1JHH A;  1YIO A;  2H6B A;  3HUG A;  5LHG A;  3R0J A;  2H6C A;  4ZYE A;  3BOQ A;  2HYG D;  5K1Y A;  2EB7 A;  2PI0 A;  1ODD A;  1RI7 A;  3W6K B;  3M7G A;  3D0S A;  1D8K A;  3LA7 A;  1S7A A;  2HDC A;  2CYY A;  3WTU C;  3FZV A;  3EUH A;  4O5V A;  2FXA A;  2DO7 A;  3E6D A;  3BPV A;  4EVI A;  3QPT A;  1ZRE A;  4UVC A;  3RPU A;  3DXJ F;  1FOK A;  3KZZ A;  4EV0 A;  2VE9 A;  5BQT A;  2IA0 A;  3TDU C;  2BGC A;  2PFB A;  3I0T A;  1XSV A;  4HAM A;  4KNY A;  3ZMT A;  4N9H A;  4UV8 A;  1KGS A;  3DPL C;  4WCG A;  4LG0 A;  1TBX A;  1U5T A;  4U7D A;  4WWC A;  2OAZ A;  1E2X A;  3ZP5 A;  5LHH A;  1XB4 A;  4ZYG A;  4ZH4 F;  3U1D A;  3WTX C;  5BPI A;  2DFI A;  3V7R A;  2V1X A;  2OZ6 A;  5CLS A;  2DK5 A;  3TOB A;  1IN8 A;  4HQM A;  3RYP A;  2NAZ A;  3GWZ A;  3W6J B;  5JVT A;  3DP7 A;  1J5Y A;  1MD0 A;  3GEZ A;  3ZN0 A;  1FY7 A;  5IT3 A;  1Z91 A;  4IF4 A;  4LJZ F;  2F5F A;  3MWM A;  4AIK A;  2PN6 A;  3RPQ A;  1UHW A;  2QBY B;  3ELK A;  3IKT A;  2XRO A;  4XSX F;  1T0F A;  4I02 A;  4O6J A;  1FP1 D;  2FBI A;  2DBB A;  1KU3 A;  1F9N A;  2CFX A;  4EJO A;  3BJA A;  5H20 A;  4HA8 A;  5FD5 A;  1L3L A;  3VEP A;  5L3F A;  5D5W B;  4M72 A;  2QUF A;  3R0A A;  4Q47 A;  1USS A;  1TNS A;  3T1B A;  4XBF A;  3ZMU A;  4GGG A;  2Y75 A;  1TQP A;  3HRS A;  3R4K A;  2JPC A;  1FYK A;  4RB2 C;  3LST A;  2Z3Y A;  1O3T A;  1MKM A;  3L09 A;  4HF0 A;  1R1V A;  2DAO A;  1KQ9 A;  1HW1 A;  2O8X A;  1STZ A;  3FHZ A;  5HLG A;  3R61 A;  1HW5 A;  5IT9 Z;  4LMY A;  1V4R A;  2XAH A;  4OOI A;  1F5T A;  2FNA A;  3TOA A;  3O3K A;  2ADU A;  5LLQ A;  3WU0 A;  3LA3 A;  2XAS A;  2G7U A;  4HQE A;  4IRG A;  4AD9 A;  3F3X A;  4LK1 F;  2QVO A;  4EJV A;  4WK8 F;  3MCZ A;  2F5E A;  3ZQ7 A;  4FT8 A;  2HEO A;  1SAX A;  4YIF A;  2OU2 A;  5D5V B;  1TQI A;  3T0Y A;  3LAJ A;  2CGP A;  2D1V A;  2DTR A;  2COM A;  2V9V A;  5AIQ A;  2ZME B;  5FLX Z;  2ACJ A;  3HHH A;  3I64 A;  4HV5 A;  3ULQ B;  2ZKZ A;  3IRQ A;  4YII A;  1CGP A;  3SXY A;  2YX7 A;  4U0W A;  4LK0 F;  1BN5 A;  4XSZ F;  5K5O A;  4DQ2 A;  1G6N A;  2L01 A;  1O3S A;  2QQA A;  2PQ8 A;  2DW4 A;  1XD7 A;  3K0L A;  1FYM A;  2OQR A;  1K79 A;  1FNN A;  1IZ1 A;  4MQV A;  4YFN F;  1DP7 P;  2OQG A;  2VE8 A;  1R5G A;  2XHK A;  2F2E A;  3OV8 A;  2GXG A;  3U9G A;  4KT5 C;  3HOT A;  2ESN A;  2L4M A;  3E6B A;  4KDP A;  3JAM K;  1QZY A;  1B9M A;  2IJL A;  2A69 F;  3MEX A;  5F64 A;  1U5T C;  4ETS A;  1QPM A;  4OIR F;  3MQ0 A;  1LB2 A;  2ELH A;  2XV4 S;  3IHU A;  3LAP A;  2GA1 A;  5DCM A;  2M87 A;  1OKR A;  1XGN A;  4UVA A;  3TDZ C;  4OU0 A;  1UST A;  1D3Y A;  4U0Y A;  4E70 A;  1S8N A;  3WTT C;  3QOP A;  5KK1 A;  1QO0 D;  3FX3 A;  5LGU A;  1RZ4 A;  2K7L A;  2MBF A;  5E8I A;  2RGV A;  2PG4 A;  4L5I A;  2VBW A;  4PGH A;  2E7X A;  1YS7 A;  4A0X A;  2VT3 A;  5LHI A;  3GX4 X;  3S2W A;  4M73 A;  3KCC A;  5E1Z B;  3I59 A;  3JTG A;  1FC3 A;  3ZMS A;  4KIC A;  3BJO A;  1R23 A;  1XDU A;  2Z5U A;  3HRT A;  2DLL A;  4MTE A;  2ZCW A;  3WE3 A;  4KMF A;  2FMY A;  1BI0 A;  2F5C A;  1SD7 A;  3FXU A;  1SD5 A;  1LDJ A;  2HTJ A;  1R00 A;  1S6L A;  4MEY F;  2KIM A;  5FFX A;  4ENN A;  4B09 A;  2A07 F;  3P7N A;  2HZT A;  2BBY A;  2DQL A;  5ED4 A;  1PUE E;  2FOK A;  5L3C A;  2VC0 A;  5E18 F;  4F7Z A;  4L0Z B;  3CUQ B;  2ZBK A;  4LD5 A;  1WSU A;  5ERI A;  2M1B A;  3WTZ A;  3H92 A;  1W5T A;  4KYW A;  1KYW A;  4L9T A;  2BYV E;  2ZNY A;  3GVA A;  4EM0 B;  1IXC A;  4IPA A;  2FNP A;  3GZ6 A;  2ZO4 A;  3GXO A;  1SD4 A;  2IP2 A;  4WXH A;  4G9Y A;  1P2F A;  2FBK A;  1FPQ A;  5ICE A;  3HOS A;  1WQ2 A;  1G4D A;  1H9G A;  3WE2 A;  1EH6 A;  2VON A;  4Q48 A;  1Z7U A;  3FMR A;  3F21 A;  5LRR A;  4M9S A;  2V1U A;  3HTU A;  1IN6 A;  1P4X A;  1ZAO A;  1G3S A;  4L5J A;  2P7C B;  5DYM A;  4KIB A;  3V4G A;  1J2X A;  3OOP A;  2VC1 A;  4Q4Z F;  2VBY A;  3HYI A;  5H6R A;  3V7S A;  4MNU A;  4HZF A;  1FBU A;  1X3U A;  3KEQ A;  2P5L C;  4BYY A;  1I1S A;  3SQN A;  2EK5 A;  4DNC A;  2MLK A;  2KIU A;  1GVJ A;  4KN4 X;  3AAF A;  2DPD A;  5J6X A;  1IUY A;  3FWE A;  3BJ6 A;  2D45 A;  5F6F A;  4YFX F;  1GXQ A;  3RTR A;  1TW2 A;  2EA2 A;  2JRT A;  3D5L A;  1T98 A;  2HQN A;  2D1H A;  1QNT A;  3KFW X;  1YFH A;  5CVU A;  5CYV A;  1CF7 A;  5DD8 A;  4HX4 A;  3TO9 A;  2ISY A;  1W7P D;  1QGP A;  2NS0 A;  3WU1 B;  2R7F A;  3C3W A;  3ABU A;  3M9A A;  4U7B A;  3C7J A;  1BC8 C;  4WXC A;  2OZU A;  2OD5 A;  2P6S A;  2CSO A;  1HBX G;  2LF8 A;  4ASN A;  4L18 B;  1I6X A;  2H94 A;  1ZGA A;  5HOO A;  6PAX A;  1E17 A;  4HLX A;  2JSC A;  4Y15 A;  3WGI A;  2YSR A;  2R7D A;  3REO A;  3FXQ A;  4ENK A;  1W7P B;  3RKW A;  2B0L A;  1RNL A;  3ZMV A;  1B1B A;  2V1D A;  2P4W A;  2IA1 A;  3KP4 A;  3LQR A;  5JI6 A;  3F8F A;  2W24 A;  2M30 A;  2JPB A;  3E5U A;  2KJC A;  4UXN A;  1J9I A;  3LQQ A;  1F4K A;  2XRN A;  4PGG A;  3COA C;  4G8X A;  1TNT A;  3BZ6 A;  2TDX A;  5FO5 A;  1XMK A;  3HRU A;  4HF1 A;  5E1W A;  3VFZ A;  4CIC A;  5HLI A;  1IXR C;  4BNC A;  2PMH A;  4G7Z F;  1WKM A;  2EV5 A;  4RAY A;  1A04 A;  1YW9 A;  1UFM A;  5HVQ C;  4WF2 A;  1Z05 A;  1KQ8 A;  3U2R A;  2AS5 F;  1U8R A;  3E97 A;  2MD5 A;  2YU3 A;  4EM2 A;  1OYI A;  2P8T A;  2X0L A;  3F23 A;  4P9U A;  4I0A A;  1I27 A;  2QYO A;  1Z1D A;  3LWF A;  3SZP A;  3CTA A;  4RGX A;  4FX0 A;  3DQV C;  2UZK A;  3ML6 A;  3JAM Z;  4I09 A;  1XGO A;  2K86 A;  1SFU A;  4A0Y A;  2YX4 A;  1BOA A;  1BJA A;  1LEA A;  4LB6 B;  2XAG A;  4KIG A;  2DI3 A;  3LA2 A;  4HDU A;  4A12 A;  4RGU A;  1R5H A;  2NNN A;  2CO5 A;  1ZN2 A;  2V79 A;  1KU7 A;  5HS7 A;  3IKV A;  2MA3 A;  3NQO A;  2ZXJ A;  1IXS B;  4ESF A;  4LLG F;  4QLC U;  4ZZL A;  2HS5 A;  3L9F A;  2W25 A;  2Z33 A;  1KU9 A;  3T8R A;  3V8K A;  4RAZ A;  4EQQ A;  3HTS B;  5LEJ A;  3FM3 A;  4GCV A;  3KP3 A;  1YG2 A;  3RJP A;  2KRF A;  2WTE A;  1IN7 A;  3MFK A;  1R1U A;  1TTY A;  2GAU A;  5BPD A;  1BIA A;  3KET A;  4PZJ A;  4HF2 A;  1O57 A;  2EWN A;  2WV0 A;  3J80 K;  1OYY A;  3WGH A;  1BI2 A; 
#chains in the Genus database with same CATH topology
 5IPA A;  3I58 A;  1MJA A;  3R6S A;  3KP2 A;  3LOC A;  5D4S A;  2PX9 A;  1GV2 A;  2NNY A;  2PLY A;  4HEA 2;  4HLY A;  2HTS A;  3O6B B;  4ZTJ A;  1H88 C;  3AKZ A;  2Q0O A;  2RNJ A;  2XGX A;  1T6S A;  2Y9Y A;  5F04 A;  1X4O A;  5LBQ A;  4UB6 C;  3RKY A;  3S93 A;  2ZJ2 A;  3F22 A;  2K5C A;  2DT7 B;  5KAI C;  4F91 B;  1TP4 A;  2ZJR F;  3ROU A;  3RSN A;  4TV7 A;  3ASN H;  4KA4 A;  2NXN B;  3HXL A;  4JK1 X;  4PJL A;  4AWX B;  3J7A Y;  1WWX A;  2K4J A;  3LFU A;  3SDB A;  1YX5 A;  2XKP A;  3SDG A;  4N9I A;  3HRM A;  4M3D A;  2DDB A;  1BW5 A;  3DBH B;  4BU2 A;  4BS9 A;  1D5Y A;  4AM3 A;  1MMD A;  3PNY A;  4ANJ A;  4A3G J;  4A5N A;  3VDX A;  1RUN A;  5EEG A;  1U6G A;  3BTI A;  1Y8R B;  1FZP B;  5FJ8 J;  1X1B A;  2P5K A;  2R7Q A;  3CCE I;  3ASO H;  4D1Q A;  1HSJ A;  4NHJ A;  2DMT A;  2L2O A;  2X4H A;  2A5W A;  3HHG A;  2HQR A;  1M1E B;  1WH5 A;  3BCB A;  4RB1 A;  4IKF A;  1Z6R A;  3MKY B;  1FTZ A;  3DV8 A;  4G6D A;  4MEX F;  3TQN A;  1RKW A;  4NQW A;  2L7M P;  2XGE A;  4LG0 B;  3J7A O;  1U5T B;  4PDK A;  5BNG A;  3Q0W A;  4XLE A;  3EYY A;  1OFC X;  4GXO A;  4M9Z A;  2W57 A;  2X1C A;  3OR2 C;  3ZMZ A;  1WPK A;  4EEF G;  1X58 A;  3CJQ B;  1K78 A;  1TWA J;  2PMU A;  2O8K A;  3I54 A;  4HX8 A;  3PIO F;  3O8H A;  1DPU A;  1W4M A;  3QP6 A;  4QWQ A;  4HNT A;  1YLF A;  1T56 A;  4XNF A;  4II2 A;  4BJ6 C;  4XKC A;  1IGN A;  4Y52 J;  1IDZ A;  4HSR A;  4RAG A;  4XRS G;  3G1M A;  1T38 A;  2OBP A;  3H35 A;  2O6G E;  4XID A;  1ZEL A;  1ZLJ A;  2JTV A;  2FF4 A;  1HW2 A;  4DBR A;  4KT6 A;  2Y0S A;  4L9V A;  3GTO J;  3EET A;  4J00 A;  5AON A;  1JKO C;  1JGS A;  2FEZ A;  2R5Z A;  3G73 A;  1AWC A;  1ZRD A;  3JRA A;  2A3S A;  1HKS A;  1OR7 A;  3IC7 A;  1GT0 C;  1FTT A;  1YTY A;  2RQP A;  4PJM A;  2BE5 F;  1MDM A;  1G2H A;  3BG7 A;  2CUJ A;  1V5E A;  2FRH A;  5E20 A;  4XM3 A;  5FKM A;  3GBG A;  1VQN I;  3L2R A;  1B6A A;  1UAA A;  3JW4 A;  3CCR I;  2JVG A;  1QHG A;  2EZL A;  3NRV A;  5DV5 A;  5ICG A;  3IAS 2;  2XVC A;  4GYG A;  1P9Q C;  1R7J A;  2E71 A;  4J19 A;  1K7A A;  2PJR B;  1SC7 A;  3ZN1 A;  4A5M A;  3I5U A;  3BG9 A;  3FF5 A;  5IOZ A;  2PMZ N;  2M7B A;  3HSE A;  4BJ5 C;  3E0J B;  3I53 A;  4L9N A;  4HW0 A;  2LBF A;  1VQ9 I;  4AIH A;  2DTZ A;  2LNB A;  3Q0U A;  4CCL A;  2BY2 A;  3WTY C;  3KP7 A;  2MLG A;  1BL0 A;  3T8T A;  4EJW A;  3FMQ A;  3KYD B;  2ECC A;  5FLM J;  2VOP A;  1MBF A;  2QQ9 A;  1KQ0 A;  3ZOB A;  1ZYR F;  1LDK B;  2QSG X;  4UUT A;  4CDG A;  4M3B A;  3B6A A;  1D8J A;  3DCF A;  2MG4 A;  4M74 A;  3QPH A;  3QWL A;  2I10 A;  3H0D A;  2EZH A;  2JRM A;  1OCR H;  3GFM A;  3VOD A;  4BHB A;  3KYC B;  2E2H J;  2A6E F;  2HDW A;  2CQK A;  3LFK A;  4BBS J;  2E2J J;  1XS9 A;  2DN0 A;  1X1D A;  1E3P A;  4M9X A;  2KL4 A;  2QEN A;  1YS6 A;  4P96 A;  1SFO J;  2CQ7 A;  3MAJ A;  1JGG A;  1XN7 A;  4F52 A;  1OQY A;  1KON A;  5DCF A;  1W5S A;  4DJA A;  1EH7 A;  2VQG A;  3HGY A;  3H3U A;  4MHG A;  2RV8 A;  3K10 A;  1R4M B;  3WGG A;  2MAB A;  3FDY A;  3IH2 A;  2BY1 A;  1QU3 A;  3ZPL A;  2LD5 A;  2RQQ A;  1E0E A;  1P7I A;  1KA8 A;  2OA4 A;  3M8F A;  5K5R A;  1ZG3 A;  1BR2 A;  3KEO A;  1ZHF A;  5AIP A;  2NVX J;  2DPU A;  1D5V A;  3GZN B;  1ETX A;  2M8E A;  3QU6 A;  2O03 A;  3PM1 A;  4RGS A;  3OY9 A;  3CP8 A;  3FXK A;  4CO8 A;  3AG3 H;  3M1C A;  2H8R A;  1FP2 A;  5TGT A;  1ZR4 A;  1TQM A;  1ON1 A;  4XRF A;  1DPR A;  3TED A;  1FLI A;  1RPW A;  2BHY A;  5HLH A;  1K6O A;  4Z6Y A;  3B73 A;  1E3H A;  1SMT A;  2BW3 A;  3Q9V A;  3F8C A;  3S15 J;  3KLO A;  3CME I;  2EFO A;  1O7L A;  2DT5 A;  4FX4 A;  2RNG A;  1ZH5 A;  3OMY A;  5LGT A;  2UWM A;  3QRF F;  2GXB A;  1YW7 A;  5M5X J;  3DFG A;  3ERE D;  4NC6 A;  3CCQ I;  5EZG A;  3QOD A;  2OJE D;  3NWS A;  4CZZ A;  1NHA A;  5EF6 A;  2YR2 A;  1MW7 A;  2IW5 A;  3DTI A;  1LE8 B;  3B02 A;  4BH9 A;  2RVC A;  3CCU I;  2DK8 A;  3I56 I;  2JA2 A;  3FXR A;  1XC5 A;  3KYL A;  5DD4 A;  3ZCO A;  5FFZ A;  4M6X A;  3EDP A;  4IVN A;  4M71 A;  5ICF A;  4ABZ A;  1RKT A;  1VQ8 I;  2DXI A;  4X1E A;  4C3H J;  4UVB A;  2DJI A;  3JCU C;  4JBA A;  2M5W A;  1B9N A;  4I01 A;  4CCJ A;  3BPX A;  2A5Y B;  5B3S H;  4W97 A;  4B3A A;  3B6C A;  2Y48 A;  4B8X A;  1BI3 A;  1B72 A;  3OIO A;  1L0O C;  3UKG A;  4DYQ A;  2EIM H;  3OYM A;  1HLV A;  1XMA A;  2WAF A;  4F55 A;  1WI9 A;  3ZQQ A;  4ENJ A;  3KE2 A;  4HX7 A;  3DF8 A;  1XDS A;  1S7O A;  3A4C A;  1QZZ A;  1UB9 A;  1XSX A;  3BR2 A;  3LSI A;  4A3I J;  3N97 A;  4PJN A;  2IVM A;  3TP3 A;  4E7L A;  3HOW J;  3C2G A;  5GTI C;  3VWB A;  3A02 A;  1FWZ A;  4G6Q A;  5JFR A;  1FEX A;  4MGR A;  3PFI A;  3TGN A;  3GTJ J;  5F0C A;  1B8I A;  2FA5 A;  3K4L A;  1BR4 A;  1U78 A;  4H0E A;  1HKQ A;  4JP0 A;  3H9G A;  1TT5 B;  2D2W A;  3T5X A;  2EJR A;  3SFZ A;  1JJ8 C;  4LIU A;  3VB2 A;  2HQA A;  4CCM A;  2H09 A;  2LSO A;  2JMW A;  2E1C A;  4C2U A;  2E1N A;  1OCC H;  2XUB A;  3Q5F A;  1AU7 A;  2G0E A;  4CUG A;  1XCB A;  3QOE A;  2KIS A;  2J5O A;  2WB1 N;  5J1Y A;  3CP2 A;  2QQB A;  3G4S I;  3W2A A;  4L0Y B;  3HSF A;  2FBH A;  4OIQ F;  3PSI A;  2ZJP F;  3CCJ I;  2JT1 A;  4I0B A;  4Y17 A;  4IRH A;  4ZYA A;  4S04 A;  5JLX A;  1QQI A;  3IWF A;  1DQU A;  1R36 A;  2VT2 A;  2WC2 A;  1SD6 A;  4EGZ A;  1Q1H A;  2FJ1 A;  3J81 K;  2CV2 A;  2UV1 A;  5DCM B;  3FM5 A;  4D7M A;  3PSF A;  2QBY A;  2GA2 A;  3ERM A;  2IS4 A;  5IOY A;  2E7W A;  1MMG A;  2R7O A;  1D1B A;  5ILV A;  1I5Z A;  4BE2 A;  3F8M A;  3ESW B;  2L5Q A;  4ZYH A;  1BBY A;  4IEJ A;  3N4M A;  1W36 D;  2PEX A;  2KP6 A;  2MFZ A;  3GW2 A;  3RQI A;  3HL2 A;  3W6V A;  5CVV A;  1FYL A;  4RB0 A;  3DLL F;  4BGD A;  2HGC A;  3JRC A;  3F6O A;  1OR7 C;  2X6X A;  4W1U A;  1ITY A;  1JUS A;  4IRI A;  2M7A A;  2NYX A;  3K2Z A;  5HDG A;  3DTK A;  1FBQ A;  3M8E A;  2X6W A;  3DU6 A;  2M4K A;  2NVQ J;  2GQQ A;  5M5Y J;  4EJU A;  3CCY A;  2XIG A;  2EV0 A;  5CVJ A;  5JHU A;  1BA5 A;  2EFQ A;  2EPF A;  5E17 F;  4BHP A;  1SFK A;  3GO5 A;  3BTC A;  2K02 A;  4HDV A;  2GOX B;  5E3O A;  3SZG A;  1NH3 A;  5CQG A;  1TW3 A;  3OYA A;  3PNT A;  3A1Y A;  3BR5 A;  2X6Y A;  5HS9 A;  1Q1V A;  4R79 A;  3LL7 A;  4WX9 A;  2UXN A;  3J80 Z;  4CSW A;  5E1X A;  4KJZ A;  2KZG A;  2EH3 A;  3SHF A;  4B4C A;  1VTN C;  2IS6 A;  3EQL F;  3KP5 A;  3OYK A;  2MC4 A;  1BM9 A;  3I59 B;  2VBZ A;  2QCO A;  2B7E A;  1IDY A;  3E5X A;  2HXO A;  2VJI A;  1KU2 A;  3GTL J;  1ZLK A;  4RM3 A;  1TT0 A;  2NVY J;  1P6R A;  4RM2 A;  4BQN A;  3GLL A;  3KZY A;  3WTV C;  2YPR A;  2J5P A;  1IRX A;  2HOE A;  3F0C A;  1U8B A;  2Q2E A;  2Z99 A;  2LF7 A;  3H1C A;  2LRD A;  4OAY A;  4FE4 A;  1V3F A;  3E3V A;  5CVI A;  2P5V A;  1I3Q J;  2K27 A;  5LRS A;  2C6Y A;  3FKJ A;  3S1Q J;  2F5D A;  2HYF A;  3C1D A;  3RKQ A;  5D8K B;  3TW6 A;  3X2Q H;  4G7H F;  1T2K A;  4PCQ A;  1GDT A;  3F72 A;  1W1W E;  2CWE A;  3K4B A;  1S29 A;  2VAS A;  1ZG1 A;  3M8J A;  4DYC A;  3DEW A;  1Z6T A;  2WAQ N;  2VIX A;  5K7Z A;  4CHU A;  2ZME A;  3GFI A;  3S2H J;  1GLN A;  3OYL A;  5L3D A;  2HDD A;  1HA8 A;  2HVQ A;  3I71 A;  2HOT A;  1H89 C;  3J7Y J;  1GXP A;  4UV9 A;  4XLN F;  2RN7 A;  4HBL A;  3DU5 A;  4M3E A;  2KLO A;  2AXT C;  3LSR A;  3GTK J;  3BY6 A;  4LGW A;  1IN4 A;  1K6Y A;  1ULY A;  1WJE A;  2DYR H;  3MZY A;  3SZT A;  2W85 A;  3QU3 A;  3TO7 A;  1IAW A;  1AKH B;  2CMP A;  3IL2 A;  2EFN A;  5CJ9 A;  5DUI A;  1WRJ A;  4EGY A;  1SMY F;  1NG6 A;  3H9Q A;  4I2O A;  3CUO A;  3L7W A;  4I6Z A;  4QSH A;  3K2A A;  3JSO A;  1B59 A;  3MZH A;  4IHW A;  2IA2 A;  3ISP A;  2VPL A;  2Z1D A;  3VYT B;  2OC6 A;  5HNH A;  3JRI A;  1Y8Q B;  5JHF A;  4DBQ A;  3IH3 A;  1DDN A;  2EIK H;  2KKO A;  4KUM A;  1V54 H;  1I3A A;  3RZD J;  2QZ8 A;  4UNO A;  1LPQ A;  2R5Y B;  1QZE A;  3LMM A;  2A61 A;  1HKT A;  2FX0 A;  2KRH A;  5J8F A;  1X3Z B;  1OYW A;  5D6F A;  1ZQ3 P;  1S3J A;  3CDH A;  5L3B A;  2AHQ A;  4RDU A;  4OIN F;  1J59 A;  1ZRF A;  2NS7 A;  2L4A A;  3ECH A;  2ID6 A;  3BQY A;  4YFK F;  2DFH A;  2STT A;  2BXY A;  4U0V A;  5ILU A;  2IT0 A;  3P9C A;  2HWV A;  1ZGW A;  4UUS B;  4D5C A;  5C44 J;  1K4S A;  2Z9O A;  2VJJ A;  1UG2 A;  4HPQ A;  4L9J A;  4FCY A;  2JK3 A;  4CXF A;  2DA1 A;  1ERD A;  4LB5 A;  1LJ9 A;  1MNM C;  4IHS A;  1BIB A;  1LVA A;  4BBR J;  1MZB A;  1YRN A;  5EG0 A;  4XMY A;  2DOF A;  2VXZ A;  1X2N A;  1RES A;  4CA0 A;  3BR1 A;  3Q0V A;  2HKX A;  2EFP A;  1LFB A;  5A2Q K;  5BOX A;  3K1P A;  2R7Z J;  2LG4 A;  3SEQ A;  2EA4 A;  4FHT A;  4UY8 I;  1ZG5 A;  1XCV A;  3GZ5 A;  4R1H A;  4A6D A;  1ZAR A;  3DEU A;  4C2T A;  2ESH A;  2RDP A;  1JE8 A;  4OMY A;  5KAF C;  4QPQ A;  3CCM I;  1H0M A;  5EYR A;  5F08 A;  1HOM A;  2LKP A;  1CF7 B;  1FSE A;  3VOE A;  1MBK A;  4U88 A;  4KIF A;  2OTJ I;  2VOD A;  4IO9 F;  3R60 A;  1FJL A;  3I3L A;  1G3T A;  5E3L A;  4CCN A;  4JX6 A;  1S5L C;  3PQJ A;  5HDK A;  3ZRG A;  2MH2 A;  3HOV J;  4IHY A;  1I1G A;  3KEY A;  3V8L A;  2OUM A;  3QP5 A;  2EFW A;  3G3Z A;  1U9N A;  3W3C A;  1LDD A;  2EBI A;  2XAJ A;  4BJT A;  1POG A;  1MJ9 A;  3BR3 A;  2Y0M A;  1S9H A;  3FHN A;  4Q5S F;  1RIO H;  5D5X B;  4AVP A;  2X1E A;  3E6M A;  3RCO A;  1FSH A;  1JHF A;  3H9J A;  2E36 A;  3D1N I;  3SFI A;  2QWW A;  4BE0 A;  3ZQI A;  3H0G J;  2Y31 A;  2HYJ A;  1N77 A;  2X1D A;  4XN0 A;  1O7F A;  4IX7 A;  2ZB9 A;  3OSG A;  3IWZ A;  3CD6 I;  3VSL A;  2AO9 A;  4EAT A;  5DDG A;  3MKL A;  2FML A;  3HJE A;  3HB9 A;  5HDN A;  3LSH A;  4BKX A;  1FBS A;  1FX7 A;  2YUS A;  1OMI A;  3KP6 A;  1IW7 F;  2VUM J;  1D0Y A;  3TL4 X;  3DLA A;  4A2U A;  5J8C A;  1ZRC A;  3H36 A;  4E4H A;  4BY7 J;  3RIR A;  4EMS A;  3K1N A;  2PMZ A;  3PQK A;  5L3E A;  2M45 A;  3OSF A;  4Y13 A;  1MMA A;  4HYE A;  1XGS A;  1BW6 A;  5JR3 A;  1I50 J;  4CCO A;  2QLZ A;  5D8L B;  2X6O A;  2FU4 A;  3VSK A;  4WXD A;  1K4T A;  1J7K A;  4CYD A;  3L2C A;  2ISZ A;  1PUF A;  1N78 A;  4M6V A;  3EYI A;  5KHD A;  1MBJ A;  1JXS A;  2CJJ A;  3FXM A;  4A69 C;  2BVM A;  1ONV A;  2CRG A;  3JR9 A;  1VQ4 I;  2CS3 A;  2HOS A;  2Y69 H;  5EEH A;  5F27 A;  4ZTF A;  1TC3 C;  5K5Q A;  1W0T A;  2IRF G;  3K4J A;  2ELJ A;  3CZ6 A;  5CVR A;  1HQC A;  1MMS A;  5KVR A;  1DUX C;  4LLN A;  3FMS A;  1P92 A;  3G6E I;  2KJB A;  4ESJ A;  3K4M A;  3GCM A;  2E2I J;  3F8N A;  1SFE A;  3K1M A;  3OIP A;  3GFJ A;  2O3F A;  2RAE A;  3GLX A;  3RDI A;  3CLO A;  4YG2 F;  3PO2 J;  2H27 A;  1O3R A;  1LEB A;  3CUQ A;  1R1T A;  3CJN A;  1YJW I;  2DQR A;  5DUK A;  2G9W A;  4XK4 A;  4A3C J;  3BR0 A;  1RR8 C;  1FOX A;  2HNH A;  1ETY A;  4ZZD A;  3BCA A;  3Q9S A;  5B66 C;  3ECO A;  1U2W A;  3LSM A;  3O2P E;  1UHM A;  4AID A;  5D6E A;  2STW A;  3TW7 A;  1LNW A;  4HOB A;  1MJB A;  3A01 B;  1TWF J;  3K70 C;  4CGZ A;  1SVL A;  2W00 A;  3EUH C;  4G7O F;  3CQZ J;  4DOZ A;  2E35 A;  2P7V B;  3I55 I;  3OYJ A;  1D0X A;  2ZME C;  5FKN A;  4LLL A;  3HKZ N;  1AOY A;  3V42 A;  2CW8 A;  1Y6I A;  2NRA C;  4M6Y A;  1Y0U A;  2R7W A;  1IG7 A;  3HOZ J;  2XAU A;  1V5F A;  3BDD A;  2LYC A;  4KMU X;  1YHQ I;  2HR3 A;  3HIF A;  2KHM A;  3MVP A;  4GRI A;  4P9F A;  4G94 A;  3JRE A;  1MGT A;  1G3Y A;  1EF4 A;  3J81 Z;  5EGO A;  1JTY A;  4LFU A;  1YYV A;  2A68 F;  5K7F A;  2LVS A;  1F1Z A;  4DGW B;  3CCL I;  2VBX A;  1YW8 A;  4HV6 A;  1ZKG A;  4P5O A;  1IF1 A;  4ESB A;  5J4Y A;  2JA5 J;  3ABT A;  4KIT B;  3S2D J;  2IS1 A;  3IRR A;  2LC2 A;  2JUC A;  3GFL A;  1WFX A;  2W4S A;  3NAU A;  3L1P A;  4CZC A;  1ZGJ A;  2BEO A;  4EM1 A;  3L2U A;  5L3G A;  4R8H A;  4MFD A;  3A0B C;  2PJP A;  3L2W A;  2LLK A;  1T39 A;  1VQ6 I;  4BXU A;  1NK2 P;  4BQA A;  3IAM 2;  2YU9 J;  4D7N A;  3DKX A;  3W2W A;  1U3E M;  2ZJQ F;  1J75 A;  2IXS A;  4AIJ A;  1QVU A;  2V26 A;  4A6E A;  2EV6 A;  3V8J A;  4IOA F;  2XF6 A;  5J40 A;  1MSE C;  2HKO A;  3RYR A;  3E6C C;  2RC4 A;  1VQL I;  2WY7 Q;  2I8D A;  3M07 A;  1KYZ A;  2LDU A;  3TO6 A;  5FB2 A;  1B4A A;  5ICC A;  3CLQ A;  4KFC A;  4RA2 A;  4D0P A;  4K2E A;  5FD6 A;  2JJ7 A;  5TJJ A;  2OF7 A;  2L02 A;  4A0Z A;  3H5R A;  2R3S A;  1J09 A;  2FE3 A;  4YEJ A;  3OS0 A;  2BV6 A;  2L9S A;  3KZI C;  2EZI A;  4XLP F;  2KRC A;  2VLA A;  1JKP C;  4OIO F;  5EGO B;  3UR3 C;  1X3W B;  1QBJ A;  5IT9 K;  2MH9 A;  2ETH A;  3JSP A;  5LGN A;  1O3Q A;  2JVH A;  2K4B A;  2ICW G;  4MQ9 F;  2GOM A;  1R58 A;  5IP9 J;  2W84 A;  3BT9 A;  1YQA A;  1A6I A;  2XB5 A;  3BP8 A;  4XR6 A;  2QF7 A;  3KX2 A;  5J47 A;  3H3Z A;  3BWG A;  2ME0 A;  5HS8 A;  4FET A;  2FQ3 A;  4BEH A;  2X85 A;  1PDN C;  2B63 J;  2L7K A;  3OIQ A;  1R22 A;  2LY1 A;  3NEU A;  2WB1 A;  4BAY A;  3TBI A;  5HNF A;  2HFH A;  2XSD C;  2O9L A;  4BQO A;  4HNU A;  5B1B H;  5D4R A;  2FOW A;  3BTJ A;  4N0B A;  2IS2 A;  1WH7 A;  4HRI A;  1JT0 A;  2JQ7 A;  4MIM A;  5FGM A;  3S3O A;  4XOR A;  1VZ0 A;  3CO6 C;  4RB3 C;  2ZFW A;  5FRM A;  1IN5 A;  1OPC A;  1EJ9 A;  1W7P A;  3ZQG A;  2AXL A;  1NG7 A;  2OCC H;  3PIP F;  2LKX A;  3CES A;  3EPZ A;  3M4O J;  3PUB A;  3F6V A;  2ZNZ A;  3ZMD A;  5FLX K;  4I98 B;  4NQW B;  2ZSH B;  3WOD F;  2CW0 F;  1G3W A;  2E60 A;  2XKO A;  5LEK A;  1A35 A;  5F1R A;  2X48 A;  1IO2 A;  1SFX A;  3OYB A;  1K78 B;  1IC8 A;  1YIJ I;  1R5I D;  4ZYD A;  5BMZ A;  2JA7 J;  2JZY A;  1TZL A;  5TRD A;  4ZDL A;  1WJ5 A;  1PP7 U;  2L3D A;  3HG9 A;  2XAQ A;  4PFO A;  2E1O A;  2BOL A;  3I4P A;  3AL0 C;  2ZXW H;  4O3M A;  1YO5 C;  2Y2Z A;  4GYI A;  1J0R A;  3GF2 A;  2RKH A;  2UXX A;  2O0Y A;  2PBI A;  3OYC A;  4M3G A;  3E5Q A;  2V6C A;  1HST A;  1IV8 A;  3EUK L;  2ZSI B;  2LFB A;  2HU9 A;  1BC7 C;  1IRG A;  1IUF A;  5J1U A;  2MC3 A;  1NK3 P;  1VQP I;  1IRF A;  2R5Z B;  3HOU J;  1UCR A;  3JTH A;  1XSD A;  2GIV A;  2GWR A;  2L7F P;  2DOE A;  1WHU A;  2DMN A;  2KPM A;  3DKW A;  1MDM B;  4GO1 A;  1MH3 A;  3SYT A;  4XLF A;  3GUD A;  2KIF A;  2DMU A;  1TLH B;  2G7H A;  2GZW A;  3TKY A;  3JRF A;  5D5U B;  1ON2 A;  1FT9 A;  4AC0 A;  3NAR A;  5KNL A;  5FKL A;  1MH4 A;  2XAF A;  4IHT A;  4MTD A;  4Z2Y A;  4E7J A;  3ZGK A;  4ENM A;  2XPU A;  1WJD A;  3ZQL A;  1Z9C A;  4UUV A;  5FKO A;  1OCO H;  3AG1 H;  4RLQ A;  5KCM A;  4Y4R A;  5ILS A;  4BHC A;  2LBF B;  4EJT A;  2HPI A;  4C9Y A;  1S72 I;  1EH8 A;  1ORK A;  5H6Q A;  3RKX A;  5IYC J;  1P4A A;  3RI4 A;  1UMQ A;  2QGU A;  2CG4 A;  2IPQ X;  3HSR A;  1EV7 A;  4XIC A;  1P4W A;  3ZR8 X;  3C18 A;  1Z3X A;  4YEL A;  3K69 A;  3CO7 C;  3KLN A;  1RR7 A;  4IJA A;  2QM3 A;  3WTS C;  1IRZ A;  2E5N A;  3PUF A;  4JYK A;  2A05 A;  3CUQ C;  4S05 A;  3SJM A;  1FIP A;  2HPM A;  2XSJ C;  4CYC A;  3WTW C;  4ZJZ A;  4I7H A;  3WHB A;  3K9T A;  2A6H F;  3Q3S A;  3IP4 B;  4KN7 X;  5A2Q Z;  1C0W A;  4OIP F;  3DBL B;  3M1E A;  2O61 A;  1PVE A;  1I39 A;  2HXI A;  3BG5 A;  2FSW A;  4I99 C;  2ECB A;  1H9T A;  2VQL A;  2WAQ A;  2HOA A;  1XGM A;  3F8B A;  3OL4 A;  2OCE A;  2GLO A;  2WWY A;  2DA7 A;  3MD2 A;  3GYH X;  1TWH J;  2L54 A;  3DPT A;  2VPR A;  3IV5 A;  4RS8 A;  3WG9 A;  2HZD A;  1LQ1 A;  1ACI A;  5DEQ A;  2BXZ A;  1FMW A;  4NB5 A;  4PFP A;  3K6G A;  3JRD A;  1N25 A;  2DA2 A;  4Y3O A;  2KMU A;  2P0W A;  4IXA A;  4IQJ A;  2V6E A;  3AG2 H;  2WAE A;  4PUS A;  5E8G A;  1HXD A;  4BE1 A;  2P6T A;  3ABM H;  4JQF A;  2EIJ H;  2BZT A;  4E7K A;  2DU9 A;  1PP8 F;  3E7L A;  4RGR A;  4LOC A;  2Q8K A;  2E1M C;  3P9I A;  2ZXH A;  3L00 A;  1RUO A;  2NS8 A;  2MGQ A;  4UHT A;  5BS6 A;  2VN2 A;  3V7C A;  4X6A J;  2M3A A;  4OMZ A;  4ON0 A;  2R7S A;  4P55 A;  3QAH A;  2XRL A;  1REP C;  2LH9 A;  3OYG A;  2R92 J;  4BDY A;  2Z16 A;  1VQK I;  2HI3 A;  3OYI A;  1BI1 A;  3BRO A;  3P9K A;  2VOO A;  3BZK A;  2R7V A;  1GHC A;  1JHH A;  1HC8 A;  1YIO A;  2H6B A;  3HUG A;  5B5E C;  2BW3 B;  1R6R A;  5LHG A;  2DJN A;  3BLY A;  4BXX J;  2BHZ A;  3R0J A;  1Z3Y A;  4DIQ A;  2H6C A;  5K7H A;  4ZYE A;  3BOQ A;  2D5V A;  2HYG D;  5K1Y A;  1XG1 A;  1K61 A;  4GDF A;  2JA8 J;  2EB7 A;  1I6H J;  1OCZ H;  1GVD A;  1X1P A;  2DA5 A;  2DFE A;  2Y30 A;  3PO3 J;  2KQR A;  2PI0 A;  3QPL A;  1ODD A;  1RI7 A;  3CC2 I;  4V2F A;  4C30 A;  3VYR B;  3M7G A;  3W6K B;  2VQH A;  3D0S A;  5DTD A;  1D8K A;  3LA7 A;  1S7A A;  2HDC A;  5C4X J;  2CYY A;  3WTU C;  1WZ2 A;  4NNJ A;  2LY2 A;  3P5J A;  3FZV A;  5JLW A;  3EUH A;  4O5V A;  3H5A A;  3BC8 A;  4RLF A;  3VYS B;  2FXA A;  4NBQ A;  2DO7 A;  3E6D A;  3BPV A;  5GPC A;  4NDL A;  4EVI A;  2ZC2 A;  1FMV A;  3QPT A;  2W48 A;  1ZRE A;  4UVC A;  3RPU A;  4XRS A;  2CV1 A;  3DXJ F;  1ZTR A;  1D1C A;  3G2B A;  4P1W A;  1FOK A;  3KZZ A;  2LKS A;  4EV0 A;  2VE9 A;  5BQT A;  1B72 B;  2IA0 A;  5TIS C;  5GAH J;  1Y1W J;  1UEL B;  2L7Z A;  3TDU C;  2K9L A;  3CMY A;  2BGC A;  2PFB A;  3I0T A;  1E3O C;  1MMN A;  5LD2 C;  2TRT A;  1XSV A;  3HC7 A;  4HAM A;  4KNY A;  4B44 A;  1APL C;  3S14 J;  3ZMT A;  4N9H A;  4UV8 A;  3PNV A;  1X1A A;  1KGS A;  2E19 A;  3DPL C;  4WCG A;  4LG0 A;  1TBX A;  1U5T A;  4U7D A;  3O8G A;  4WWC A;  2MW8 A;  2OAZ A;  1TWC J;  1E2X A;  2V9P A;  3ZP5 A;  4FIS A;  3G1O A;  2VXD A;  5LHH A;  3F9K A;  1XB4 A;  2BY3 A;  4XL9 A;  4LG3 A;  1B8I B;  4ZYG A;  3ABK H;  4DW6 A;  4ZH4 F;  2DCE A;  3U1D A;  4Y7N J;  1R71 A;  4XOP A;  3WTX C;  4B43 A;  2LY9 A;  2DA4 A;  4C2M J;  5JVG F;  5BPI A;  2DFI A;  4B3X A;  5M3M J;  5C3E J;  3DEE A;  3CMA I;  3V7R A;  2V1X A;  4QTR A;  1SEU A;  2OZ6 A;  2LOO A;  5E79 C;  5CLS A;  2DK5 A;  3TOB A;  4CCK A;  2Z2S B;  1IN8 A;  4HQM A;  3RYP A;  4XKB A;  1JTX A;  2NAZ A;  3GWZ A;  3W6J B;  2FD5 A;  5JVT A;  1Z21 A;  2H1L A;  2DT6 A;  4NC8 A;  3DP7 A;  1J5Y A;  1MD0 A;  3GEZ A;  3ZN0 A;  4ITV A;  1FY7 A;  5IT3 A;  1Z91 A;  2M9H A;  3G71 I;  4IF4 A;  4LJZ F;  2M4G A;  1ETO A;  5E3M A;  1XMX A;  1IJW C;  2F5F A;  3MWM A;  2PJR A;  2PN6 A;  3JRB A;  3NWT A;  3RPQ A;  4AIK A;  1UHW A;  2QBY B;  3ELK A;  4NC7 A;  4BXF A;  3IKT A;  2XRO A;  4XSX F;  2KT0 A;  1LUJ B;  1T0F A;  4I02 A;  3LSP A;  2TCT A;  4O6J A;  1FP1 D;  2FBI A;  2DBB A;  2VJ5 A;  3HM5 A;  1XPX A;  2JSP A;  1MBH A;  1KU3 A;  4GFB A;  1Z7L A;  4A3L J;  1F9N A;  2IBD A;  4HNV A;  2CFX A;  3S32 A;  4EJO A;  4A3B J;  3BJA A;  5H20 A;  5EEA A;  1QHH D;  4HA8 A;  5FD5 A;  1W0U A;  1JUM A;  2LRE A;  2XPV A;  5F1J A;  4MFE A;  1L3L A;  3VEP A;  3BTL A;  5L3F A;  5D5W B;  4M72 A;  2NVT J;  2EIL H;  2QUF A;  3MZ8 A;  3R0A A;  4Q47 A;  3JRH A;  2DA6 A;  1USS A;  1TNS A;  1LVK A;  3T1B A;  3S8P A;  1NTC A;  4XBF A;  4XON A;  3ZMU A;  1TWG J;  4GGG A;  2Y75 A;  1TQP A;  3HRS A;  3R4K A;  2JPC A;  4B47 A;  1FYK A;  3K4N A;  4RB2 C;  3FKI J;  3LST A;  5J4V A;  2GBY A;  1G8X A;  2WBM A;  2Z3Y A;  4G6T B;  3J7Z I;  1O3T A;  3BR6 A;  2XDV A;  1MKM A;  3L09 A;  2JN6 A;  2R7R A;  4HF0 A;  1R1V A;  1XX5 A;  2DAO A;  1KQ9 A;  3FXO A;  2FQ4 A;  1HW1 A;  2O8X A;  1STZ A;  3HGG A;  3FHZ A;  5HLG A;  3R61 A;  1HW5 A;  4JOM A;  4AVZ A;  5IT9 Z;  1YJN I;  2M2E A;  4LMY A;  1V4R A;  3H5N A;  2XAH A;  2N8G A;  1V5G A;  4OOI A;  4AYB N;  1F5T A;  2FNA A;  3QQA A;  3TOA A;  2QEX I;  3O3K A;  3OS2 A;  1D0Z A;  1JKQ C;  2ADU A;  5LLQ A;  1F36 A;  3WU0 A;  3LA3 A;  2XAS A;  4D9J A;  2G7U A;  4HQE A;  3HEF A;  2Q2E B;  3KIO A;  4IRG A;  4AD9 A;  3F3X A;  4L5E A;  2ELK A;  1O4X A;  4LK1 F;  3S17 J;  4IQ4 A;  2QVO A;  4EJV A;  4G12 A;  5IYB J;  4WK8 F;  3MCZ A;  2F5E A;  3ZQ7 A;  4FT8 A;  3HKZ A;  2HEO A;  1SAX A;  4YIF A;  2OU2 A;  5D5V B;  4PSX A;  2IGM A;  2ID3 A;  1TQI A;  1X19 A;  3T0Y A;  1VI0 A;  4MLO A;  1LFU P;  3LAJ A;  4E7I A;  3MKZ A;  4UB8 C;  2CGP A;  4A3J J;  3ABL H;  2D1V A;  2VKD A;  2DTR A;  3OYD A;  2COM A;  5EJC A;  2K9S A;  2V9V A;  3VPR A;  3S1M J;  5J1R A;  1X1C A;  1CQT A;  5AIQ A;  1G59 A;  2ZME B;  1LE8 A;  2L0K A;  5FLX Z;  2ACJ A;  3HHH A;  9ANT A;  3I64 A;  1T08 B;  5GPA A;  4HV5 A;  3ULQ B;  4V19 K;  1R9T J;  1F43 A;  1FIA A;  1GUU A;  2O5R A;  2ZKZ A;  3ZQH A;  5H2F C;  1U0J A;  3RZO J;  2CUZ A;  3IRQ A;  3GME A;  4YII A;  1CGP A;  3SXY A;  2YX7 A;  4U0W A;  2DFF A;  4LK0 F;  1BN5 A;  4XSZ F;  5K5O A;  4DQ2 A;  1G6N A;  2L01 A;  4A3M J;  1O3S A;  1JT6 A;  2PQ8 A;  1MIJ A;  2QQA A;  2DW4 A;  2V4J C;  1XD7 A;  1U9O A;  3K0L A;  1QRY A;  2F48 A;  1MBG A;  1Z77 A;  5IY5 H;  1FYM A;  1WJA A;  2DOA A;  2OQR A;  1DGR M;  1K79 A;  1FNN A;  1IZ1 A;  2KDO A;  4MQV A;  2F4I A;  4YFN F;  2DYS H;  1UHS A;  3QPS A;  1DP7 P;  1A31 A;  3OYN A;  1T95 A;  2OQG A;  2VE8 A;  2ZFU A;  4E6K G;  2I5U A;  1R5G A;  2XHK A;  2F2E A;  3DKY A;  3OV8 A;  2IAI A;  4PSW A;  2NOJ B;  4PJJ A;  2GXG A;  3TP0 A;  4XLC A;  2XC7 A;  1UJ8 A;  1A6Q A;  3U9G A;  2VB6 A;  4I76 A;  4KT5 C;  3K7A J;  1SAN A;  3HOT A;  3C2B A;  3FBN B;  2E34 A;  5IP6 A;  2ESN A;  2L4M A;  3E6B A;  4KDP A;  3JAM K;  1QZY A;  1X4P A;  2K40 A;  1B9M A;  3HBL A;  2R7U A;  2IJL A;  4IHX A;  4HG2 A;  2A69 F;  3MEX A;  5F64 A;  2P81 A;  5F0H A;  4RBO A;  1R49 A;  1U5T C;  4DYR A;  4ETS A;  3I4N J;  1QPM A;  4OIR F;  3MQ0 A;  4C3J J;  1LB2 A;  2ELH A;  5GAE J;  2XV4 S;  1YRN B;  3IHU A;  5EG0 B;  1LFP A;  1QPI A;  3K4C A;  1X2M A;  3LAP A;  2GA1 A;  5DCM A;  3A0H C;  4XQF A;  5CQE A;  4IL6 C;  2M87 A;  1OKR A;  1XGN A;  2KIQ A;  4UVA A;  5GTH C;  3TDZ C;  1ETV A;  4OU0 A;  1MSF C;  3BG3 A;  2QQ8 A;  1UST A;  1D3Y A;  2XPW A;  4DZJ A;  4U0Y A;  4E70 A;  1ZR2 A;  3CCV I;  1UZC A;  2K3F A;  1S8N A;  1FOY A;  3WTT C;  3PJR A;  3QOP A;  3DBR B;  2W7N A;  5KK1 A;  2LK2 A;  5DS9 A;  1Z67 A;  2M34 A;  3G1L A;  4C3I J;  1BOB A;  3C2H A;  4N4O B;  1QO0 D;  3FX3 A;  1A36 A;  3HDD A;  5LGU A;  2QA4 I;  2B9S A;  1WCM J;  1SAU A;  2L9V A;  1RZ4 A;  3CDL A;  1R4N B;  4XLA A;  1YOV B;  2R0Q C;  2K7L A;  2MBF A;  4A93 J;  2Y0S N;  1MNE A;  5E8I A;  4XKV A;  2F6C A;  2RGV A;  2PG4 A;  4L5I A;  2VBW A;  4PGH A;  2E7X A;  4NUB A;  4BDZ A;  2EIN H;  3WG7 H;  1VQM I;  1H8A C;  3D5S C;  1MND A;  2CH0 A;  3QYF A;  1YS7 A;  1T0F C;  2LR8 A;  1YI2 I;  2K85 A;  1ETW A;  4A0X A;  2WA0 A;  2VT3 A;  5LHI A;  1WJF A;  3GX4 X;  3S2W A;  4DZP A;  4M73 A;  3KCC A;  1JI8 A;  5E1Z B;  2Y9Z A;  2VKV A;  3AL0 B;  5GAD J;  3I59 A;  3LSG A;  3JTG A;  1FC3 A;  2DDA A;  3ZMS A;  3DWL E;  4KIC A;  5CKT A;  2WV1 A;  3BJO A;  5M5W J;  1GV5 A;  1YE9 A;  1R23 A;  1XDU A;  2Z5U A;  3HRT A;  2DLL A;  1AHD P;  4MTE A;  2ZCW A;  1TL8 A;  1ETK A;  4IHV A;  3WE3 A;  4JX4 A;  5HLT A;  1ENH A;  3FK7 A;  5FLV A;  4KMF A;  1MBE A;  2FMY A;  3FXL A;  3EUA A;  4BY1 J;  1BI0 A;  2F5C A;  1SD7 A;  2R7T A;  2V7F A;  3FXU A;  4JX5 A;  1SD5 A;  1BR1 A;  5EZH A;  2CQN A;  1LDJ A;  2EQR A;  2HTJ A;  2A6T A;  4XKW A;  1PUF B;  5GP9 A;  1R00 A;  1S6L A;  2E5Z A;  2IGO A;  4MEY F;  2KIM A;  3H3V K;  5FFX A;  1OLT A;  4ENN A;  5EDN A;  4B09 A;  4FAS D;  1QVT A;  2A07 F;  3P7N A;  2CQQ A;  2L9N A;  1PJR A;  1KZH A;  2HZT A;  3CF2 A;  2BBY A;  2W1O A;  2DQL A;  2R93 J;  3U1K A;  2OPT A;  5IYD J;  5ED4 A;  3D5R C;  1PUE E;  2M0M A;  4F3Q A;  2FOK A;  3AG4 H;  5L3C A;  2VC0 A;  5E18 F;  4F7Z A;  4L0Z B;  3CUQ B;  2ZBK A;  3HPH A;  4LD5 A;  2VKH A;  2RRE A;  3HOX J;  1WSU A;  5ERI A;  2M1B A;  2H8W A;  3WTZ A;  4A3E J;  3RQ4 A;  3H92 A;  2XGC A;  4XN3 A;  4F92 B;  1W5T A;  4OWR B;  3ZQC A;  1AKH A;  4KYW A;  1KYW A;  4L9T A;  2FUG 2;  2BYV E;  1OJL A;  2ZNY A;  3GVA A;  4EM0 B;  1IXC A;  4IPA A;  2DOD A;  2MSY A;  4RMN A;  4BAC A;  3M3Y J;  2FNP A;  3GZ6 A;  2ZO4 A;  3GXO A;  1SD4 A;  3OS1 A;  2IP2 A;  4WXH A;  4G9Y A;  2LTP A;  4XRM A;  1P2F A;  5B1A H;  2OV7 A;  1QA6 A;  2FBK A;  2CUF A;  1FPQ A;  5ICE A;  3HOS A;  3FIS A;  1VQ7 I;  2CQX A;  1WQ2 A;  1G4D A;  1H9G A;  3CJR B;  4RAF A;  1AA7 A;  3WE2 A;  1EH6 A;  2VON A;  2CU7 A;  4Q48 A;  4KIS A;  2CFO A;  1Z7U A;  3GTQ J;  5C4J J;  3FMR A;  2KZV A;  3F21 A;  5LRR A;  2E1M B;  2R5Y A;  4M9S A;  4OAZ A;  2V1U A;  3HTU A;  2L9R A;  1IN6 A;  2F4O B;  1P4X A;  4YRV A;  1ZAO A;  1G3S A;  4L5J A;  3BZC A;  5DYM A;  2WAD A;  1YIT I;  2P7C B;  4KIB A;  3V4G A;  5J3L A;  2VL8 A;  3OR1 C;  3ZXS A;  1J2X A;  3OOP A;  3W2V A;  1RC9 A;  3FXJ A;  2VC1 A;  4Q4Z F;  1D1A A;  1DP3 A;  2COB A;  4B48 A;  5FRO A;  2VBY A;  3HYI A;  1WVR A;  5H6R A;  2NVU B;  3V7S A;  4UUS A;  2H1K A;  4QPO A;  2QSH X;  1K83 J;  2KFD A;  4M3F A;  4MNU A;  3OYH A;  4HZF A;  2K3P A;  5IP7 J;  1FBU A;  3MN2 A;  1X3U A;  1PYV A;  3KEQ A;  2YS9 A;  2P5L C;  1UG0 A;  4BYY A;  1WI3 A;  1I1S A;  5CPR B;  3SQN A;  1T8I A;  2Q1Z B;  2EK5 A;  4DNC A;  3N05 A;  2MLK A;  2QKM B;  3JRG A;  2KIU A;  1GVJ A;  4KN4 X;  2DMQ A;  3AAF A;  2DPD A;  5J6X A;  2WY8 Q;  2GM4 A;  1IUY A;  3FWE A;  3LNQ A;  3BJ6 A;  2D45 A;  5F6F A;  3SEZ A;  3U21 A;  3IH4 A;  3ZQF A;  4YFX F;  3CC4 I;  2UUZ A;  2XB0 X;  3CCS I;  1GXQ A;  4A3F J;  3RTR A;  1TW2 A;  2EA2 A;  2JRT A;  3D5L A;  4X0G A;  1T98 A;  2HQN A;  2D1H A;  1QNT A;  3KFW X;  1YFH A;  5CVU A;  5CYV A;  1CF7 A;  3QYB A;  5DD8 A;  4HX4 A;  2DMP A;  2CW7 A;  3TO9 A;  2R4G A;  3CMM A;  2ZXI A;  2ISY A;  1W7P D;  2K9M A;  4Y33 A;  2QSF X;  3LSJ A;  3HOY J;  3I9V 2;  1QGP A;  2NS0 A;  3WU1 B;  3CC7 I;  2IGN A;  1IV6 A;  2R7F A;  1HF0 A;  3C3W A;  3ABU A;  4YIR X;  3M9A A;  4U7B A;  3C7J A;  1BC8 C;  3S3N A;  4WXC A;  2OZU A;  2OD5 A;  2P6S A;  2CSO A;  1WJC A;  2OTL I;  3DTE A;  1HBX G;  2LF8 A;  4XLH A;  4ASN A;  1LKX A;  4L18 B;  1VQO I;  4BEH B;  4BUP A;  1I6X A;  4V2G A;  4A3D J;  1OIS A;  2H94 A;  4S0H B;  3S3M A;  1ZGA A;  2F4M B;  5HOO A;  6PAX A;  1E17 A;  4HLX A;  2JSC A;  4Y15 A;  2VQC A;  3WU2 C;  1SVM A;  3KPH A;  4ZDO A;  2IEK A;  3FK6 A;  3WGI A;  1Y1V J;  1EA3 A;  4A3K J;  2YSR A;  3UNG C;  2R7D A;  3REO A;  2NOG A;  3FXQ A;  4ENK A;  3OOU A;  4FQG A;  1W7P B;  3RKW A;  2BY0 A;  1ZK8 A;  1Y39 A;  1WGX A;  5FKK A;  2B0L A;  1RNL A;  3GTM J;  3ZMV A;  2O7O A;  1B1B A;  2V1D A;  4AU7 A;  3DPU A;  5E3N A;  2P4W A;  3ONQ A;  2IA1 A;  5HOD A;  4QIW N;  3FIW A;  3KP4 A;  2VI6 A;  3PL8 A;  3LQR A;  5JI6 A;  1DU0 A;  3F8F A;  1HDD C;  2W24 A;  2CV0 A;  2F5V A;  2M30 A;  1Y0N A;  2JPB A;  3E5U A;  4HST A;  2KJC A;  1BJZ A;  4UXN A;  4ZDP A;  1YX3 A;  2LMD A;  3LSK A;  1W36 C;  1XTA A;  3GTG J;  1J9I A;  3LQQ A;  3VYU B;  2CUE A;  1F4K A;  1DGW Y;  2XRN A;  4PGG A;  3COA C;  4G8X A;  1TNT A;  2K9N A;  4MO7 A;  1EKE A;  3BZ6 A;  1HDP A;  3HPG A;  2TDX A;  4B1R A;  3TMO A;  5FO5 A;  4U87 A;  1XMK A;  3HRU A;  4HF1 A;  5E1W A;  2QKL B;  3VFZ A;  4CIC A;  2AQE A;  3A2K A;  2X9D A;  2ME6 A;  3WHC A;  5HLI A;  2GIZ A;  1IXR C;  4BNC A;  2PMH A;  4G7Z F;  1WKM A;  2EV5 A;  4RAY A;  1A04 A;  1YW9 A;  4BQQ A;  1UFM A;  4AUX A;  1VND A;  2MYS A;  3MMY B;  5HVQ C;  2GXA A;  2HVR A;  4N4N B;  4WF2 A;  1Z05 A;  1KQ8 A;  1JUP A;  1Y56 A;  4IZZ A;  3OL3 A;  3I4M J;  2XF5 A;  4II3 A;  3U2R A;  2AS5 F;  1JKR C;  1U8R A;  2HQ5 A;  3E97 A;  3QYE A;  2MD5 A;  2YU3 A;  4EM2 A;  1RRJ A;  1OYI A;  5DM7 F;  2JA6 J;  2EZK A;  4H4K C;  3S1R J;  2P8T A;  2LP0 A;  3BQZ A;  2X0L A;  4E7Z A;  4FE7 A;  3F23 A;  3HZJ A;  4FTH A;  3GTP J;  2X51 A;  2VKE A;  4P9U A;  4I0A A;  4AYB A;  3A01 A;  1I27 A;  2QYO A;  2XF7 A;  4PK4 A;  1WJB A;  1FOW A;  1Z1D A;  3LWF A;  2M0C A;  3CTA A;  3SZP A;  4E7S A;  2IGK A;  1OCT C;  2VJ4 A;  2DA3 A;  4RGX A;  4IOC F;  4FX0 A;  3DQV C;  3BG6 A;  3PFY A;  2UZK A;  3ML6 A;  3JAM Z;  4I09 A;  1YJ9 I;  1DU6 A;  3CJT B;  1XGO A;  2K86 A;  5F0F A;  1V55 H;  1SFU A;  4A0Y A;  3L2Q A;  2YX4 A;  4D5F A;  1BOA A;  1S7E A;  1BJA A;  1LEA A;  4LB6 B;  3IUO A;  1VFC A;  2XAG A;  4KIG A;  5GAG J;  2DI3 A;  3LA2 A;  4HDU A;  4A12 A;  4CYC B;  1VF9 A;  3S16 J;  1JJ6 C;  3L2V A;  3K4K A;  3OYF A;  4RGU A;  3S1N J;  1R5H A;  1HCR A;  2NNN A;  3MKW B;  3A03 A;  2V9K A;  1ZN2 A;  2CO5 A;  3OYE A;  3CDI A;  1A5J A;  2V79 A;  1KU7 A;  2JUG A;  5HS7 A;  3IKV A;  2MA3 A;  4LIT A;  3NQO A;  2XGD A;  2ZXJ A;  1IXS B;  1T33 A;  4LLG F;  4ESF A;  4QLC U;  4ZZL A;  5M3F J;  2AQF A;  2HS5 A;  3FBI B;  2K9Q A;  4BL0 B;  4E7H A;  2W82 A;  2M8G X;  3L9F A;  2W25 A;  2Z33 A;  1VQ5 I;  3AFH A;  1KU9 A;  3T8R A;  3OWT A;  4PJ0 C;  3V8K A;  3CF5 F;  1OCP A;  4XOT A;  4RAZ A;  4EQQ A;  3HTS B;  1ETQ A;  5LEJ A;  3FM3 A;  4GCV A;  4F93 B;  3KP3 A;  1YG2 A;  3RJP A;  2KRF A;  2WTE A;  1IN7 A;  1P7J A;  4LIV A;  3MFK A;  1R1U A;  2MD0 A;  1TTY A;  1SVO A;  1RET A;  2GAU A;  5BPD A;  1BIA A;  3K70 D;  1N75 A;  3E1S A;  3KET A;  4PZJ A;  4HF2 A;  4J01 A;  2R7X A;  2HVS A;  1O57 A;  5DM6 F;  5FRN A;  5LFA A;  2EWN A;  4ZC3 A;  2WV0 A;  3J80 K;  2KDZ A;  2BVL A;  3HUG B;  1W5C C;  3RPU D;  1OYY A;  3WGH A;  1Z0X A;  2JWT A;  1BI2 A;  4CH7 A;  2V1N A; 
#chains in the Genus database with same CATH homology
 3I58 A;  1MJA A;  3R6S A;  3KP2 A;  5D4S A;  2NNY A;  2PLY A;  4HLY A;  2HTS A;  3O6B B;  2Q0O A;  2RNJ A;  2XGX A;  1T6S A;  5LBQ A;  3RKY A;  2ZJ2 A;  3F22 A;  3ROU A;  4TV7 A;  4KA4 A;  4JK1 X;  4AWX B;  1WWX A;  2K4J A;  2XKP A;  4N9I A;  3HRM A;  4A5N A;  1RUN A;  5EEG A;  1U6G A;  1FZP B;  2P5K A;  1HSJ A;  4NHJ A;  2X4H A;  3HHG A;  2HQR A;  4RB1 A;  1Z6R A;  3DV8 A;  4G6D A;  4MEX F;  3TQN A;  4NQW A;  4LG0 B;  3J7A O;  1U5T B;  4PDK A;  3EYY A;  4GXO A;  4M9Z A;  3ZMZ A;  2W57 A;  1K78 A;  2PMU A;  3I54 A;  4HX8 A;  1DPU A;  1W4M A;  3QP6 A;  4QWQ A;  1YLF A;  1T38 A;  2OBP A;  2O6G E;  1ZLJ A;  2JTV A;  2FF4 A;  1HW2 A;  4L9V A;  3EET A;  5AON A;  1JGS A;  2FEZ A;  1AWC A;  3G73 A;  1ZRD A;  2A3S A;  1HKS A;  1OR7 A;  3IC7 A;  1YTY A;  2RQP A;  2BE5 F;  1MDM A;  2FRH A;  5E20 A;  1B6A A;  3JW4 A;  3NRV A;  5DV5 A;  5ICG A;  2XVC A;  4GYG A;  1R7J A;  1K7A A;  3ZN1 A;  4A5M A;  3I5U A;  3FF5 A;  3HSE A;  3I53 A;  4L9N A;  4HW0 A;  4AIH A;  2LNB A;  3WTY C;  3KP7 A;  2MLG A;  3T8T A;  4EJW A;  3FMQ A;  2VOP A;  2QQ9 A;  1KQ0 A;  1ZYR F;  1LDK B;  4CDG A;  1D8J A;  4M74 A;  3QPH A;  3VOD A;  3GFM A;  4BHB A;  2A6E F;  2CQK A;  3LFK A;  4M9X A;  2QEN A;  1YS6 A;  4P96 A;  3MAJ A;  1XN7 A;  5DCF A;  1W5S A;  1EH7 A;  3H3U A;  4MHG A;  2RV8 A;  3WGG A;  3ZPL A;  1KA8 A;  2OA4 A;  3M8F A;  5K5R A;  1ZG3 A;  3KEO A;  1ZHF A;  5AIP A;  2DPU A;  1D5V A;  2M8E A;  3QU6 A;  2O03 A;  4RGS A;  4CO8 A;  1FP2 A;  1TQM A;  1ON1 A;  4XRF A;  1DPR A;  1FLI A;  5HLH A;  1K6O A;  3B73 A;  1SMT A;  3Q9V A;  3F8C A;  3KLO A;  2EFO A;  1O7L A;  2DT5 A;  4FX4 A;  1ZH5 A;  5LGT A;  2UWM A;  3QRF F;  2GXB A;  1YW7 A;  3DFG A;  3ERE D;  4CZZ A;  1NHA A;  2YR2 A;  2IW5 A;  4BH9 A;  3B02 A;  2RVC A;  2DK8 A;  3FXR A;  5DD4 A;  5FFZ A;  4M6X A;  3EDP A;  4IVN A;  4M71 A;  5ICF A;  4UVB A;  4JBA A;  2M5W A;  1B9N A;  4I01 A;  3BPX A;  2A5Y B;  2Y48 A;  4B8X A;  1BI3 A;  1L0O C;  1XMA A;  1WI9 A;  4ENJ A;  3KE2 A;  4HX7 A;  3DF8 A;  1XDS A;  1S7O A;  1QZZ A;  1UB9 A;  1XSX A;  3N97 A;  2IVM A;  1FWZ A;  4G6Q A;  5JFR A;  4MGR A;  3PFI A;  3TGN A;  2FA5 A;  1U78 A;  4H0E A;  1HKQ A;  2D2W A;  3T5X A;  2EJR A;  3SFZ A;  3VB2 A;  2H09 A;  2LSO A;  2E1C A;  2E1N A;  2XUB A;  3Q5F A;  1XCB A;  2J5O A;  2QQB A;  4L0Y B;  3HSF A;  2FBH A;  4OIQ F;  2JT1 A;  4I0B A;  4Y17 A;  4IRH A;  4S04 A;  1QQI A;  3IWF A;  1R36 A;  2VT2 A;  2WC2 A;  1SD6 A;  4EGZ A;  1Q1H A;  3J81 K;  5DCM B;  3FM5 A;  2QBY A;  2GA2 A;  2E7W A;  5ILV A;  1I5Z A;  3F8M A;  3N4M A;  4ZYH A;  1BBY A;  2PEX A;  3GW2 A;  5CVV A;  1FYL A;  4RB0 A;  2HGC A;  3F6O A;  4IRI A;  2NYX A;  3K2Z A;  5HDG A;  1FBQ A;  3M8E A;  2GQQ A;  4EJU A;  2XIG A;  2EV0 A;  5CVJ A;  5JHU A;  2EFQ A;  5E17 F;  4BHP A;  3GO5 A;  2K02 A;  4HDV A;  1TW3 A;  5HS9 A;  4R79 A;  3J80 Z;  4WX9 A;  2UXN A;  5E1X A;  3SHF A;  1VTN C;  3EQL F;  3KP5 A;  1BM9 A;  3I59 B;  2VBZ A;  3E5X A;  1KU2 A;  1ZLK A;  1P6R A;  3KZY A;  3WTV C;  2YPR A;  2J5P A;  2HOE A;  2Q2E A;  2Z99 A;  2LF7 A;  1V3F A;  3E3V A;  5CVI A;  2P5V A;  2K27 A;  5LRS A;  2C6Y A;  2F5D A;  2HYF A;  3C1D A;  5D8K B;  4G7H F;  1T2K A;  4PCQ A;  3F72 A;  2CWE A;  1S29 A;  1ZG1 A;  1Z6T A;  4CHU A;  2ZME A;  3GFI A;  5L3D A;  3I71 A;  1GXP A;  4UV9 A;  4XLN F;  2RN7 A;  4HBL A;  3BY6 A;  4LGW A;  1IN4 A;  1ULY A;  3MZY A;  3SZT A;  2W85 A;  3QU3 A;  3TO7 A;  1IAW A;  3IL2 A;  2EFN A;  5CJ9 A;  5DUI A;  1WRJ A;  4EGY A;  1SMY F;  4I2O A;  3CUO A;  3L7W A;  3JSO A;  1B59 A;  3MZH A;  2IA2 A;  3ISP A;  1DDN A;  2KKO A;  4KUM A;  4UNO A;  2QZ8 A;  1HKT A;  2A61 A;  5J8F A;  1OYW A;  5D6F A;  1S3J A;  3CDH A;  5L3B A;  4OIN F;  1J59 A;  1ZRF A;  2L4A A;  3ECH A;  4YFK F;  2STT A;  4U0V A;  5ILU A;  2IT0 A;  3P9C A;  2HWV A;  2Z9O A;  4L9J A;  4CXF A;  4LB5 A;  1LJ9 A;  4IHS A;  1BIB A;  1LVA A;  1MZB A;  2VXZ A;  2HKX A;  2EFP A;  5A2Q K;  5BOX A;  3K1P A;  2EA4 A;  4FHT A;  1ZG5 A;  1XCV A;  3GZ5 A;  4R1H A;  4A6D A;  1ZAR A;  3DEU A;  2ESH A;  2RDP A;  1JE8 A;  4OMY A;  1H0M A;  2LKP A;  1CF7 B;  1FSE A;  3VOE A;  4U88 A;  4KIF A;  2VOD A;  3R60 A;  1G3T A;  5HDK A;  3PQJ A;  2MH2 A;  1I1G A;  3V8L A;  3QP5 A;  2EFW A;  3G3Z A;  1LDD A;  2XAJ A;  1MJ9 A;  2Y0M A;  4Q5S F;  1RIO H;  5D5X B;  4AVP A;  3E6M A;  1FSH A;  1JHF A;  2QWW A;  1O7F A;  3IWZ A;  5DDG A;  2FML A;  5HDN A;  1FBS A;  1FX7 A;  1OMI A;  3KP6 A;  1IW7 F;  4A2U A;  5J8C A;  1ZRC A;  3RIR A;  4EMS A;  3K1N A;  3PQK A;  5L3E A;  2M45 A;  4Y13 A;  4HYE A;  1XGS A;  5JR3 A;  2QLZ A;  5D8L B;  2FU4 A;  4WXD A;  1J7K A;  4CYD A;  3L2C A;  2ISZ A;  1JXS A;  3EYI A;  1ONV A;  5EEH A;  5K5Q A;  2IRF G;  5CVR A;  1HQC A;  5KVR A;  1DUX C;  4LLN A;  3FMS A;  1P92 A;  2KJB A;  4ESJ A;  3F8N A;  1SFE A;  3K1M A;  3GFJ A;  2O3F A;  3RDI A;  3GLX A;  3CLO A;  4YG2 F;  2H27 A;  1O3R A;  1LEB A;  3CUQ A;  1R1T A;  3CJN A;  2DQR A;  5DUK A;  2G9W A;  4ZZD A;  3Q9S A;  3ECO A;  1U2W A;  3O2P E;  1UHM A;  5D6E A;  2STW A;  1LNW A;  4HOB A;  1MJB A;  4CGZ A;  4G7O F;  2P7V B;  4LLL A;  1AOY A;  2NRA C;  4M6Y A;  1Y0U A;  3BDD A;  4KMU X;  2HR3 A;  3HIF A;  4P9F A;  4G94 A;  1MGT A;  1G3Y A;  3J81 Z;  4LFU A;  1YYV A;  2A68 F;  1F1Z A;  2VBX A;  1YW8 A;  4HV6 A;  4P5O A;  1IF1 A;  4ESB A;  3ABT A;  3IRR A;  3GFL A;  1ZGJ A;  2BEO A;  4EM1 A;  5L3G A;  4R8H A;  2PJP A;  1T39 A;  4BXU A;  4BQA A;  1U3E M;  1J75 A;  4AIJ A;  4A6E A;  2EV6 A;  3V8J A;  2HKO A;  3RYR A;  3E6C C;  2RC4 A;  1KYZ A;  2LDU A;  3TO6 A;  5FB2 A;  1B4A A;  5ICC A;  4KFC A;  4D0P A;  4K2E A;  5FD6 A;  5TJJ A;  2L02 A;  4A0Z A;  2R3S A;  2FE3 A;  2BV6 A;  4XLP F;  4OIO F;  1QBJ A;  5IT9 K;  2MH9 A;  2ETH A;  3JSP A;  5LGN A;  1O3Q A;  2K4B A;  4MQ9 F;  1R58 A;  2W84 A;  1YQA A;  3BP8 A;  3H3Z A;  3BWG A;  5HS8 A;  2FQ3 A;  1PDN C;  1R22 A;  3NEU A;  4BAY A;  2HFH A;  5D4R A;  4N0B A;  5FGM A;  3CO6 C;  4RB3 C;  2ZFW A;  1IN5 A;  1OPC A;  1W7P A;  2AXL A;  3F6V A;  2ZNZ A;  3ZMD A;  5FLX K;  4I98 B;  3WOD F;  2CW0 F;  1G3W A;  2XKO A;  5LEK A;  5F1R A;  1SFX A;  1K78 B;  4ZYD A;  5BMZ A;  2JZY A;  5TRD A;  1PP7 U;  2L3D A;  2XAQ A;  3I4P A;  4O3M A;  1YO5 C;  4GYI A;  1J0R A;  3GF2 A;  2RKH A;  2UXX A;  2O0Y A;  2PBI A;  3E5Q A;  2V6C A;  1HST A;  1IRG A;  1BC7 C;  2MC3 A;  1IRF A;  1UCR A;  3JTH A;  1XSD A;  2GIV A;  2GWR A;  3DKW A;  1MDM B;  4GO1 A;  3GUD A;  2KIF A;  1TLH B;  2G7H A;  2GZW A;  3TKY A;  5D5U B;  1ON2 A;  1FT9 A;  4IHT A;  2XAF A;  4MTD A;  4Z2Y A;  4ENM A;  1Z9C A;  4UUV A;  5ILS A;  4BHC A;  4EJT A;  1EH8 A;  3RI4 A;  5H6Q A;  3RKX A;  1P4A A;  2CG4 A;  2IPQ X;  3HSR A;  1EV7 A;  1P4W A;  3C18 A;  3CO7 C;  3K69 A;  3KLN A;  4IJA A;  2QM3 A;  3WTS C;  3CUQ C;  4S05 A;  3WTW C;  4I7H A;  3K9T A;  2A6H F;  4KN7 X;  5A2Q Z;  1C0W A;  4OIP F;  3M1E A;  2O61 A;  2FSW A;  1H9T A;  1XGM A;  3F8B A;  2WWY A;  3GYH X;  2L54 A;  3DPT A;  4RS8 A;  3WG9 A;  1LQ1 A;  5DEQ A;  4NB5 A;  4IXA A;  5E8G A;  1HXD A;  2P6T A;  1PP8 F;  4JQF A;  2DU9 A;  4RGR A;  2Q8K A;  3P9I A;  3L00 A;  1RUO A;  4UHT A;  5BS6 A;  2VN2 A;  3V7C A;  4OMZ A;  4ON0 A;  4P55 A;  3QAH A;  1REP C;  1BI1 A;  3BRO A;  3P9K A;  2VOO A;  1GHC A;  1JHH A;  1YIO A;  2H6B A;  3HUG A;  5LHG A;  3R0J A;  2H6C A;  4ZYE A;  3BOQ A;  2HYG D;  5K1Y A;  2EB7 A;  2PI0 A;  1ODD A;  1RI7 A;  3W6K B;  3M7G A;  3D0S A;  1D8K A;  3LA7 A;  1S7A A;  2HDC A;  2CYY A;  3WTU C;  3FZV A;  3EUH A;  4O5V A;  2FXA A;  2DO7 A;  3E6D A;  3BPV A;  4EVI A;  3QPT A;  1ZRE A;  4UVC A;  3RPU A;  3DXJ F;  1FOK A;  3KZZ A;  4EV0 A;  2VE9 A;  5BQT A;  2IA0 A;  3TDU C;  2BGC A;  2PFB A;  3I0T A;  1XSV A;  4HAM A;  4KNY A;  3ZMT A;  4N9H A;  4UV8 A;  1KGS A;  3DPL C;  4WCG A;  4LG0 A;  1TBX A;  1U5T A;  4U7D A;  4WWC A;  2OAZ A;  1E2X A;  3ZP5 A;  5LHH A;  1XB4 A;  4ZYG A;  4ZH4 F;  3U1D A;  3WTX C;  5BPI A;  2DFI A;  3V7R A;  2V1X A;  2OZ6 A;  5CLS A;  2DK5 A;  3TOB A;  1IN8 A;  4HQM A;  3RYP A;  2NAZ A;  3GWZ A;  3W6J B;  5JVT A;  3DP7 A;  1J5Y A;  1MD0 A;  3GEZ A;  3ZN0 A;  1FY7 A;  5IT3 A;  1Z91 A;  4IF4 A;  4LJZ F;  2F5F A;  3MWM A;  4AIK A;  2PN6 A;  3RPQ A;  1UHW A;  2QBY B;  3ELK A;  3IKT A;  2XRO A;  4XSX F;  1T0F A;  4I02 A;  4O6J A;  1FP1 D;  2FBI A;  2DBB A;  1KU3 A;  1F9N A;  2CFX A;  4EJO A;  3BJA A;  5H20 A;  4HA8 A;  5FD5 A;  1L3L A;  3VEP A;  5L3F A;  5D5W B;  4M72 A;  2QUF A;  3R0A A;  4Q47 A;  1USS A;  1TNS A;  3T1B A;  4XBF A;  3ZMU A;  4GGG A;  2Y75 A;  1TQP A;  3HRS A;  3R4K A;  2JPC A;  1FYK A;  4RB2 C;  3LST A;  2Z3Y A;  1O3T A;  1MKM A;  3L09 A;  4HF0 A;  1R1V A;  2DAO A;  1KQ9 A;  1HW1 A;  2O8X A;  1STZ A;  3FHZ A;  5HLG A;  3R61 A;  1HW5 A;  5IT9 Z;  4LMY A;  1V4R A;  2XAH A;  4OOI A;  1F5T A;  2FNA A;  3TOA A;  3O3K A;  2ADU A;  5LLQ A;  3WU0 A;  3LA3 A;  2XAS A;  2G7U A;  4HQE A;  4IRG A;  4AD9 A;  3F3X A;  4LK1 F;  2QVO A;  4EJV A;  4WK8 F;  3MCZ A;  2F5E A;  3ZQ7 A;  4FT8 A;  2HEO A;  1SAX A;  4YIF A;  2OU2 A;  5D5V B;  1TQI A;  3T0Y A;  3LAJ A;  2CGP A;  2D1V A;  2DTR A;  2COM A;  2V9V A;  5AIQ A;  2ZME B;  5FLX Z;  2ACJ A;  3HHH A;  3I64 A;  4HV5 A;  3ULQ B;  2ZKZ A;  3IRQ A;  4YII A;  1CGP A;  3SXY A;  2YX7 A;  4U0W A;  4LK0 F;  1BN5 A;  4XSZ F;  5K5O A;  4DQ2 A;  1G6N A;  2L01 A;  1O3S A;  2QQA A;  2PQ8 A;  2DW4 A;  1XD7 A;  3K0L A;  1FYM A;  2OQR A;  1K79 A;  1FNN A;  1IZ1 A;  4MQV A;  4YFN F;  1DP7 P;  2OQG A;  2VE8 A;  1R5G A;  2XHK A;  2F2E A;  3OV8 A;  2GXG A;  3U9G A;  4KT5 C;  3HOT A;  2ESN A;  2L4M A;  3E6B A;  4KDP A;  3JAM K;  1QZY A;  1B9M A;  2IJL A;  2A69 F;  3MEX A;  5F64 A;  1U5T C;  4ETS A;  1QPM A;  4OIR F;  3MQ0 A;  1LB2 A;  2ELH A;  2XV4 S;  3IHU A;  3LAP A;  2GA1 A;  5DCM A;  2M87 A;  1OKR A;  1XGN A;  4UVA A;  3TDZ C;  4OU0 A;  1UST A;  1D3Y A;  4U0Y A;  4E70 A;  1S8N A;  3WTT C;  3QOP A;  5KK1 A;  1QO0 D;  3FX3 A;  5LGU A;  1RZ4 A;  2K7L A;  2MBF A;  5E8I A;  2RGV A;  2PG4 A;  4L5I A;  2VBW A;  4PGH A;  2E7X A;  1YS7 A;  4A0X A;  2VT3 A;  5LHI A;  3GX4 X;  3S2W A;  4M73 A;  3KCC A;  5E1Z B;  3I59 A;  3JTG A;  1FC3 A;  3ZMS A;  4KIC A;  3BJO A;  1R23 A;  1XDU A;  2Z5U A;  3HRT A;  2DLL A;  4MTE A;  2ZCW A;  3WE3 A;  4KMF A;  2FMY A;  1BI0 A;  2F5C A;  1SD7 A;  3FXU A;  1SD5 A;  1LDJ A;  2HTJ A;  1R00 A;  1S6L A;  4MEY F;  2KIM A;  5FFX A;  4ENN A;  4B09 A;  2A07 F;  3P7N A;  2HZT A;  2BBY A;  2DQL A;  5ED4 A;  1PUE E;  2FOK A;  5L3C A;  2VC0 A;  5E18 F;  4F7Z A;  4L0Z B;  3CUQ B;  2ZBK A;  4LD5 A;  1WSU A;  5ERI A;  2M1B A;  3WTZ A;  3H92 A;  1W5T A;  4KYW A;  1KYW A;  4L9T A;  2BYV E;  2ZNY A;  3GVA A;  4EM0 B;  1IXC A;  4IPA A;  2FNP A;  3GZ6 A;  2ZO4 A;  3GXO A;  1SD4 A;  2IP2 A;  4WXH A;  4G9Y A;  1P2F A;  2FBK A;  1FPQ A;  5ICE A;  3HOS A;  1WQ2 A;  1G4D A;  1H9G A;  3WE2 A;  1EH6 A;  2VON A;  4Q48 A;  1Z7U A;  3FMR A;  3F21 A;  5LRR A;  4M9S A;  2V1U A;  3HTU A;  1IN6 A;  1P4X A;  1ZAO A;  1G3S A;  4L5J A;  2P7C B;  5DYM A;  4KIB A;  3V4G A;  1J2X A;  3OOP A;  2VC1 A;  4Q4Z F;  2VBY A;  3HYI A;  5H6R A;  3V7S A;  4MNU A;  4HZF A;  1FBU A;  1X3U A;  3KEQ A;  2P5L C;  4BYY A;  1I1S A;  3SQN A;  2EK5 A;  4DNC A;  2MLK A;  2KIU A;  1GVJ A;  4KN4 X;  3AAF A;  2DPD A;  5J6X A;  1IUY A;  3FWE A;  3BJ6 A;  2D45 A;  5F6F A;  4YFX F;  1GXQ A;  3RTR A;  1TW2 A;  2EA2 A;  2JRT A;  3D5L A;  1T98 A;  2HQN A;  2D1H A;  1QNT A;  3KFW X;  1YFH A;  5CVU A;  5CYV A;  1CF7 A;  5DD8 A;  4HX4 A;  3TO9 A;  2ISY A;  1W7P D;  1QGP A;  2NS0 A;  3WU1 B;  2R7F A;  3C3W A;  3ABU A;  3M9A A;  4U7B A;  3C7J A;  1BC8 C;  4WXC A;  2OZU A;  2OD5 A;  2P6S A;  2CSO A;  1HBX G;  2LF8 A;  4ASN A;  4L18 B;  1I6X A;  2H94 A;  1ZGA A;  5HOO A;  6PAX A;  1E17 A;  4HLX A;  2JSC A;  4Y15 A;  3WGI A;  2YSR A;  2R7D A;  3REO A;  3FXQ A;  4ENK A;  1W7P B;  3RKW A;  2B0L A;  1RNL A;  3ZMV A;  1B1B A;  2V1D A;  2P4W A;  2IA1 A;  3KP4 A;  3LQR A;  5JI6 A;  3F8F A;  2W24 A;  2M30 A;  2JPB A;  3E5U A;  2KJC A;  4UXN A;  1J9I A;  3LQQ A;  1F4K A;  2XRN A;  4PGG A;  3COA C;  4G8X A;  1TNT A;  3BZ6 A;  2TDX A;  5FO5 A;  1XMK A;  3HRU A;  4HF1 A;  5E1W A;  3VFZ A;  4CIC A;  5HLI A;  1IXR C;  4BNC A;  2PMH A;  4G7Z F;  1WKM A;  2EV5 A;  4RAY A;  1A04 A;  1YW9 A;  1UFM A;  5HVQ C;  4WF2 A;  1Z05 A;  1KQ8 A;  3U2R A;  2AS5 F;  1U8R A;  3E97 A;  2MD5 A;  2YU3 A;  4EM2 A;  1OYI A;  2P8T A;  2X0L A;  3F23 A;  4P9U A;  4I0A A;  1I27 A;  2QYO A;  1Z1D A;  3LWF A;  3SZP A;  3CTA A;  4RGX A;  4FX0 A;  3DQV C;  2UZK A;  3ML6 A;  3JAM Z;  4I09 A;  1XGO A;  2K86 A;  1SFU A;  4A0Y A;  2YX4 A;  1BOA A;  1BJA A;  1LEA A;  4LB6 B;  2XAG A;  4KIG A;  2DI3 A;  3LA2 A;  4HDU A;  4A12 A;  4RGU A;  1R5H A;  2NNN A;  2CO5 A;  1ZN2 A;  2V79 A;  1KU7 A;  5HS7 A;  3IKV A;  2MA3 A;  3NQO A;  2ZXJ A;  1IXS B;  4ESF A;  4LLG F;  4QLC U;  4ZZL A;  2HS5 A;  3L9F A;  2W25 A;  2Z33 A;  1KU9 A;  3T8R A;  3V8K A;  4RAZ A;  4EQQ A;  3HTS B;  5LEJ A;  3FM3 A;  4GCV A;  3KP3 A;  1YG2 A;  3RJP A;  2KRF A;  2WTE A;  1IN7 A;  3MFK A;  1R1U A;  1TTY A;  2GAU A;  5BPD A;  1BIA A;  3KET A;  4PZJ A;  4HF2 A;  1O57 A;  2EWN A;  2WV0 A;  3J80 K;  1OYY A;  3WGH A;  1BI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...