3GW2A

Crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
b'RKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulatory arsR-family protein
publication title Northeast Structural Genomics Consortium Target MbR242E
rcsb
source organism Mycobacterium bovis
molecule tags Transcription regulator
total genus 28
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2009-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gw2A00
2DK5A 2OQRA 5IT9K 4L9JA 3TOAA 3V7CA 5J8CA 2OU2A 2M5WA 1XN7A 2BGCA 4LK1F 2IRFG 1SD7A 1E17A 4N0BA 3GWZA 2VBZA 3GUDA 2XKPA 1B59A 4ESBA 3V4GA 1XMAA 1R00A 4LD5A 1G3SA 1LEAA 1FOKA 2K86A 2F5DA 2VT2A 2DQRA 3O2PE 3K9TA 2PEXA 2VC0A 3RYPA 5K5QA 2NRAC 5LHIA 1LDJA 4ZYDA 4RB2C 4KNYA 3F72A 2WC2A 2HR3A 2XAGA 1HKSA 1TBXA 3CDHA 3CLOA 3N4MA 4G6QA 2EJRA 5CYVA 4EGYA 1K78A 1R5HA 3HRMA 4GYGA 4Q48A 2JSCA 1EH6A 3LWFA 2KJCA 1BI3A 3GFMA 3ABTA 1IRFA 1MJAA 2DPUA 2NS0A 3CJNA 4R8HA 3RPUA 1RNLA 4FT8A 3DP7A 2EV0A 5K1YA 1O3QA 4ETSA 4HZFA 3GFJA 4MQVA 3NQOA 1LDDA 2DK8A 1KYZA 3KCCA 2LDUA 4BHBA 1LQ1A 2DI3A 1GXQA 3J81K 4WK8F 1HW1A 2DQLA 4KDPA 4Y13A 1EH8A 1PUEE 1ZRDA 2QBYB 3F8CA 3TO6A 4EJTA 3Q9VA 3SFZA 3BZ6A 1SMTA 1DPUA 2QZ8A 3BP8A 4HQEA 3VB2A 2VN2A 3R60A 3GFIA 5DDGA 1KU2A 4AIHA 1XSVA 2Z9OA 4RB1A 3V8LA 2VE8A 5CVJA 2NNYA 1XDSA 1HBXG 3WTVC 3GFLA 3E3VA 1KQ0A 5ICFA 1CF7B 1OKRA 2PI0A 1J59A 4YFNF 4ZYGA 2QWWA 2JT1A 4A5MA 4XLPF 1C0WA 3LSTA 3RJPA 2D1HA 1FY7A 4PGHA 1T39A 4JQFA 2FOKA 1D3YA 1E2XA 2MLGA 3HHHA 3QRFF 3ZMUA 1JGSA 4RGRA 4LGWA 4BHCA 1KQ9A 2B0LA 2HZTA 4BHPA 3U1DA 2QQ9A 2P6TA 1ONVA 3JW4A 3VEPA 1H9TA 3F22A 3M8EA 1FWZA 4RB0A 4WF2A 1HSJA 2GXGA 1FBQA 1U5TC 5BPDA 1EH7A 3H3UA 1JHHA 1QGPA 5LEKA 2RQPA 4ESJA 2V79A 2A07F 1QO0D 2K4JA 5LEJA 2YR2A 2FA5A 5E1WA 2DTRA 3KFWX 1ZARA 5DYMA 1XD7A 4UXNA 4Y15A 3J81Z 4KIFA 4OIOF 3C18A 2YX7A 2VE9A 5DV5A 2CSOA 4UVCA 1SMYF 4A6DA 1BI0A 4FX4A 2ZXJA 1F9NA 2ZKZA 1Y0UA 2EB7A 4G9YA 3MQ0A 2H27A 1R7JA 4GGGA 2NAZA 4I2OA 2RGVA 1ZAOA 5BPIA 1J9IA 2Q0OA 3LAPA 4LMYA 3TDUC 3GZ5A 3F6OA 1W7PA 1KQ8A 1LVAA 2IA0A 1R1TA 2W85A 4FX0A 4HAMA 5DD4A 5HDKA 2XUBA 4AD9A 1TW3A 4HLXA 3E5XA 4O3MA 3GX4X 5D8KB 5H6QA 1BBYA 4WXCA 4HV5A 2HKXA 3LFKA 3LAJA 2ZMEA 4Z2YA 1IRGA 3HTUA 3QP5A 3QPTA 1BC7C 4OU0A 1ZH5A 2PMHA 4ZZDA 2FU4A 2CQKA 3ECOA 3T8RA 1TW2A 3J80Z 3I0TA 3FHZA 2WTEA 2WWYA 2DBBA 1ZGAA 5L3BA 4OIPF 1BM9A 4G7ZF 3BJAA 1TNTA 2K7LA 2OBPA 1MDMB 3B73A 1HSTA 4XLNF 1XGSA 4K2EA 1HKTA 5E1ZB 1P6RA 2DU9A 5L3EA 4HX4A 4OIRF 4CXFA 1FYMA 4S05A 3JSPA 4Q47A 3EETA 2QVOA 1W4MA 3L7WA 1XGNA 2RVCA 2UWMA 2Z3YA 3FWEA 2XKOA 5D4RA 2D1VA 2OQGA 3KEOA 4M9XA 2PMUA 4M9ZA 4TV7A 1U3EM 1IXCA 2ESHA 1O3RA 4M6YA 2OD5A 1S7AA 1QNTA 5DCMB 4HDVA 2O3FA 3I64A 3T1BA 3MCZA 2GQQA 1FX7A 3RI4A 2XAQA 3ZMTA 4P9FA 1B9NA 3JTGA 1LNWA 4A0XA 5J8FA 1IN8A 4EVIA 3ECHA 2R7FA 2DLLA 2HGCA 1S3JA 1IN7A 4XBFA 5ERIA 4UVAA 1MJ9A 3M1EA 4L18B 3M7GA 2BE5F 2IA1A 3GW2A 1U8RA 3I54A 1WKMA 5LGTA 5FFXA 4OIQF 3B02A 1BI2A 3WTWC 4HF1A 2P6SA 1ZHFA 2PFBA 2DAOA 3FX3A 3H3ZA 3RKYA 4KMUX 2HKOA 2RC4A 2P7CB 1XSDA 3RYRA 1K78B 3LA7A 2P8TA 1TQMA 3MZYA 3C1DA 1LB2A 2RNJA 3KP6A 2DW4A 2H94A 4A6EA 4RGXA 1HW2A 2HFHA 2CO5A 4MTEA 2W57A 1J7KA 4WWCA 3HOSA 2O6GE 2K4BA 4UV8A 4UV9A 1S6LA 1H0MA 1YW7A 2W25A 2VBYA 2HTJA 5IT3A 2EK5A 1TQPA 4N9IA 2ESNA 5JHUA 4OMYA 5LRSA 1F1ZA 2XV4S 4D0PA 3VOEA 1ZG5A 5FLXZ 2MA3A 2L3DA 5LHGA 1LDKB 3S2WA 2HYFA 5LHHA 3F6VA 4ZYEA 4U88A 1R1UA 3GLXA 4I7HA 3WU1B 4LJZF 4UUVA 1UHMA 1ZLKA 5L3FA 4PDKA 3K69A 2EFWA 4IJAA 3PQKA 2VOOA 3KLNA 2RKHA 4IRGA 1ON1A 1RZ4A 1IW7F 4EJUA 4L0YB 3DV8A 2PJPA 5DUKA 1R1VA 2K27A 2FMLA 2UXXA 4KMFA 5D6EA 3KE2A 3REOA 1XCBA 4ZYHA 4KN4X 4KIGA 1KU3A 2F5CA 2HOEA 2HDCA 2L54A 1YIOA 2DFIA 1P92A 1AWCA 1BOAA 1F5TA 3BJ6A 4HV6A 3PFIA 4WXHA 1B4AA 2CYYA 3DXJF 4RAZA 4R1HA 4ENNA 1IF1A 2DO7A 2FNAA 4HBLA 2MH2A 4HLYA 2QQBA 4R79A 5HVQC 2O03A 2FNPA 5CVRA 2ISYA 2EFOA 2RV8A 1U5TB 5D5UB 1J2XA 1IAWA 1GXPA 4LB6B 1W5TA 2ISZA 2A69F 2QLZA 2P5VA 2X4HA 4KICA 3RKWA 3HRTA 2M8EA 3BPVA 4PGGA 1SD6A 1R22A 3FXRA 1FZPB 2XGXA 3LA3A 3F8BA 4A0ZA 1S29A 1IN4A 1J5YA 4I01A 1U2WA 3WTUC 1FNNA 5JVTA 3KP4A 5AIQA 1VTNC 3KP3A 1RUOA 4NQWA 1FYKA 3BY6A 4M72A 2YU3A 4KA4A 3GVAA 5IT9Z 3DKWA 3F23A 3KP5A 1RI7A 3I59B 3BOQA 4S04A 1KA8A 5CVVA 4KN7X 5HDGA 3ML6A 1FSEA 5TJJA 5E1XA 2FF4A 1XGMA 4E70A 2PLYA 3WTXC 3QOPA 4MEXF 2NNNA 5CJ9A 2L4MA 3MWMA 3L9FA 2JTVA 2J5PA 3HRUA 3O6BB 2ZBKA 2FXAA 5F1RA 1LEBA 1HW5A 3K2ZA 1OR7A 2KIUA 3E6CC 5E8IA 2J5OA 4I02A 1YLFA 4EJOA 4L5IA 4MTDA 3HOTA 1O7FA 4M74A 1W7PB 2QENA 4RAYA 2MH9A 3RKXA 2MLKA 5HOOA 1IN6A 4CO8A 4CZZA 1DDNA 4EMSA 2EFNA 2A3SA 4ENKA 1B1BA 2D2WA 2LF8A 4L0ZB 3R0JA 4BNCA 5D6FA 5L3DA 2JZYA 1FLIA 3WTZA 3FF5A 1Z6RA 2ZMEB 3GF2A 2Z33A 1UFMA 2STTA 3K1MA 2K02A 2Z5UA 5FD6A 5HLGA 2ADUA 1HXDA 3U2RA 5A2QK 3BWGA 1FT9A 3ZPLA 3K1NA 5L3CA 2M30A 4DNCA 2KRFA 2CFXA 3WTYC 3WGIA 1FBSA 4CDGA 5ILVA 2G9WA 3I58A 3BJOA 2O0YA 3BPXA 3ERED 1Z9CA 4KFCA 1ULYA 2F2EA 3DPLC 3HUGA 4KUMA 1DP7P 3CUQA 4L9TA 3ABUA 1QPMA 2MBFA 2OAZA 2GA1A 5D5WB 1OYWA 3E6BA 1RIOH 1XMKA 5JFRA 2ZO4A 1T2KA 3HSFA 2EA2A 1P2FA 5EEGA 3SZPA 4I98B 1ZRCA 2VODA 4MGRA 3RDIA 4HF0A 3CUQC 3FMQA 2XAHA 1CF7A 1SFUA 3E6MA 1T6SA 2V1DA 4OMZA 2HWVA 3E5UA 1L0OC 4IVNA 4ASNA 3AAFA 3V7RA 2FEZA 4BH9A 1W5SA 1X3UA 2M45A 2R7DA 4HQMA 4AIJA 3L09A 1DUXC 1LJ9A 1Z91A 4OOIA 3R4KA 5K5OA 5LGUA 1T98A 4XSZF 1FC3A 1SFEA 4BQAA 1Z05A 1P4XA 1R23A 2W24A 3F8FA 3TO7A 5CVIA 4UVBA 4A0YA 3ZN1A 1WQ2A 3IWFA 4CYDA 4KIBA 3I53A 2EA4A 3K1PA 3QP6A 3L00A 1YO5C 2VBWA 5L3GA 1JHFA 2A5YB 2GAUA 4HX8A 5ED4A 1CGPA 4HA8A 4H0EA 4JK1X 2LF7A 1FYLA 3LA2A 5H20A 4HX7A 3T8TA 2QQAA 3F3XA 3GYHX 4Q5SF 1SFXA 1OMIA 1J0RA 5HDNA 2HQRA 4JBAA 2BEOA 1B6AA 4EM0B 1REPC 3FXQA 1PDNC 1P4AA 3KETA 1T38A 2XIGA 1OYIA 2G7HA 4Y17A 2IA2A 3EDPA 1WRJA 4LFUA 4IHTA 3ZMVA 2FQ3A 1ZGJA 1D8JA 2XRNA 3IWZA 3SQNA 1FP2A 4G8XA 1UCRA 3WTSC 4YIIA 4P96A 1W7PD 3IC7A 1IZ1A 4M6XA 2P5LC 1XCVA 4U0YA 3TDZC 3MZHA 4LLLA 4XSXF 4G94A 4KYWA 3M8FA 2FE3A 4RB3C 5DCFA 3TGNA 2ELHA 3RIRA 4CHUA 2XAJA 4M9SA 2Y0MA 4EM1A 3HTSB 4N9HA 3T0YA 3R6SA 4HYEA 3QU6A 4LG0A 2Q2EA 3ZQ7A 2HYGD 3P7NA 1I5ZA 3TKYA 1ZREA 4ENJA 3I5UA 1H9GA 2MD5A 4EV0A 4RGSA 1I6XA 4P5OA 1GHCA 4UNOA 2GIVA 2FBHA 2H6BA 3MAJA 2AS5F 2P5KA 2FRHA 1L3LA 1ON2A 1RUNA 1TLHB 3PQJA 3ZP5A 2D45A 3COAC 4ZH4F 4MNUA 1P4WA 2JPCA 4OINF 3Q9SA 3WODF 5AONA 3IL2A 4EJVA 2IVMA 3V8KA 4G7OF 4ESFA 3FMRA 2HEOA 1YFHA 3HSEA 4YFKF 1G3TA 3U9GA 5KVRA 3LQQA 1XSXA 5LRRA 3HRSA 4BYYA 2ZNZA 2ZJ2A 4G6DA 1YS7A 1SAXA 3M9AA 1YYVA 2BYVE 1K7AA 3Q5FA 4Q4ZF 6PAXA 1YG2A 3D5LA 1MGTA 3TO9A 1YW9A 3GEZA 5DCMA 2ZFWA 5D4SA 1MKMA 5HLHA 1ZG3A 1ZG1A 3ZN0A 3I4PA 2GXBA 1WI9A 4B8XA 3IKVA 1R36A 5BQTA 4HF2A 3WG9A 5DEQA 5LBQA 2GZWA 4LLGF 3DF8A 3E6DA 3VODA 4GXOA 5D8LB 4EJWA 2LNBA 2E7XA 3V7SA 4A2UA 3FXUA 4CICA 3CO6C 5D5XB 1NHAA 4QLCU 1O57A 5E20A 1J75A 2HQNA 1R58A 3EUHA 2VC1A 4LLNA 5D5VB 4QWQA 1HKQA 4GYIA 5CLSA 4U7BA 2YPRA 1IXRC 2V1XA 1UHWA 2XAFA 2HTSA 3F8MA 3ELKA 2A6EF 4BAYA 4YIFA 5HS7A 4O5VA 1B9MA 2V6CA 3KLOA 3VFZA 4GO1A 3D0SA 3SXYA 1F4KA 3JAMK 1WWXA 2WV0A 2KIMA 5BS6A 1TNSA 2HS5A 4P55A 3HSRA 2Z99A 2F5EA 4LB5A 5HS9A 3L2CA 2YX4A 2KKOA 3KEQA 2BV6A 4NHJA 3IRQA 1PP7U 3FM3A 3GXOA 1QQIA 2X0LA 5HLIA 3MEXA 2E7WA 1HQCA 1XGOA 1JE8A 1JXSA 1MD0A 2OZUA 4F7ZA 4A12A 2PG4A 1WSUA 3CUQB 2IPQX 1Q1HA 2E1CA 1MJBA 2MC3A 4WXDA 3T5XA 4HOBA 4ON0A 2YSRA 5FGMA 5ICGA 2LSOA 3BDDA 1USSA 5HS8A 1FBUA 2R3SA 2CGPA 2E1NA 1QBJA 2KJBA 5F6FA 2DPDA 3RTRA 3WE2A 3JSOA 1MZBA 2ACJA 1I1GA 1ODDA 3ULQB 3ZMSA 3HYIA 1FP1D 4YFXF 1ZN2A 2RN7A 3DQVC 3FZVA 2PBIA 1KYWA 3SZTA 2DT5A 1PP8F 2CWEA 2ZCWA 2P7VB 5E17F 4IRHA 3H92A 1TQIA 1S8NA 5DD8A 4RS8A 3QU3A 1BIAA 2ETHA 1U5TA 2JRTA 5FD5A 3J80K 3HIFA 3V8JA 4DQ2A 3P9IA 4U0VA 2G7UA 5KK1A 1AOYA 4AWXB 1BJAA 2H09A 3DFGA 4XRFA 3OOPA 1QZZA 4RGUA 4L5JA 2OZ6A 3O3KA 2FBKA 3W6JB 2Q8KA 1Z6TA 1EV7A 3GZ6A 1O3SA 2QM3A 3JAMZ 3FMSA 1G4DA 4M73A 2EV6A 5AIPA 4UHTA 1STZA 1IN5A 4EGZA 2VT3A 3W6KB 2QBYA 5ICCA 3MFKA 4A5NA 5LLQA 5DUIA 3DEUA 3WTTC 4CGZA 2IJLA 2CW0F 3I59A 3P9KA 4GCVA 3WE3A 3CO7C 2QUFA 2XHKA 3EYIA 2KIFA 1V4RA 4PCQA 1TTYA 1QZYA 1KU9A 2GWRA 2L02A 2O8XA 3CUOA 1G3WA 2V1UA 4AIKA 2VBXA 1Z1DA 4M71A 5JI6A 3E97A 1U78A 2XROA 3J7AO 3KZZA 2IP2A 2PQ8A 4IRIA 4G7HF 3E5QA 1I1SA 4L9VA 2UZKA 4NB5A 1K6OA 1U6GA 5EEHA 1ZRFA 4EQQA 5BOXA 3P9CA 2TDXA 3SHFA 2LKPA 4KT5C 1XDUA 2EFQA 4LG0B 5JR3A 3N97A 1ZLJA 4MQ9F 2ZNYA 2H6CA 1YTYA 2COMA 5A2QZ 4MHGA 5CVUA 4ZZLA 2IW5A 5LGNA 3G73A 4YG2F 3WGHA 3R61A 4IF4A 5FFZA 3IKTA 2A6HF 3JTHA 2O61A 2VXZA 2FSWA 2XASA 3RPQA 1K79A 5K5RA 1OPCA 2FMYA 4IPAA 5FLXK 5E8GA 5ILSA 1G6NA 1YW8A 2UXNA 2M87A 3NEUA 3I71A 1I27A 5FO5A 4B09A 4L9NA 2W84A 4U7DA 2GA2A 2AXLA 2IT0A 3FM5A 5ICEA 3TOBA 3LQRA 3HHGA 4MEYF 1IUYA 3K0LA 1O7LA 3IRRA 5H6RA 2BBYA 1SD4A 1O3TA 1D5VA 4HW0A 1A04A 5E18F 2A68F 3ISPA 2EV5A 3TQNA 1G3YA 5F64A 1BN5A 1XB4A 2Y75A 3GO5A 3WGGA 5TRDA 1BIBA 5ILUA 2XVCA 4HDUA 4AVPA 3F21A 4FHTA 4LK0F 1BC8C 4I0AA 2V9VA 4WCGA 1KGSA 2VOPA 3IHUA 3QPHA 1BI1A 2FBIA 2L01A 2NYXA 3R0AA 2VONA 2P4WA 3DPTA 1FSHA 1YQAA 3BROA 3ZMDA 2STWA 2PN6A 2CG4A 1S7OA 1D8KA 1IXSB 1GVJA 3OV8A 4I0BA 3EQLF 2A61A 1T0FA 2OA4A 1YS6A 3NRVA 4I09A 3CTAA 1KU7A 2C6YA 3KP2A 1MDMA 2F5FA 3C7JA 2RDPA 4IXAA 2JPBA 4U0WA 1V3FA 2EWNA 3QAHA 4PZJA 1OYYA 1ZYRF 4IHSA 2L4AA 4O6JA 3KP7A 3C3WA 3F8NA 3G3ZA 4BXUA 3ROUA 4EM2A 1UB9A 5FB2A 4ENMA 1R5GA 3ZMZA 1Z7UA 3EYYA 2Y48A 5J6XA 2QYOA 3WU0A 5BMZA 3KZYA 2EFPA 1DPRA 4P9UA 1SD5A 2M1BA 4WX9A 1FPQA 1USTA
chains in the Genus database with same CATH superfamily
2DK5A 1IO2A 2OQRA 2M7BA 5IT9K 2VXDA 4L9JA 3TOAA 4BQOA 3J7AY 3V7CA 5J8CA 2OU2A 4ZDPA 4W97A 2M5WA 1XN7A 2BGCA 1MBKA 2VQCA 3G71I 2RNGA 1MBEA 4KJZA 4LK1F 1P7IA 4AU7A 2HQ5A 2BHYA 2IRFG 1VQ8I 4ZTJA 1SD7A 1ETXA 4XLHA 5F27A 3QYEA 1E17A 4N0BA 3GWZA 2VBZA 3GUDA 2XKPA 4BQQA 3SEQA 1X4PA 2FUG2 5JLWA 1B59A 4ESBA 1GV5A 3A2KA 3V4GA 3JRDA 1XMAA 3Q0UA 3GCMA 2OPTA 2LK2A 1R00A 4LD5A 1G3SA 1LEAA 4BKXA 3HBLA 1FOKA 2K86A 4BJTA 2F5DA 4RM2A 2VT2A 1S72I 2DQRA 4Y33A 3O2PE 3K9TA 3DLLF 3S8PA 2A6TA 2PEXA 1YJNI 2VC0A 4RMNA 3RYPA 5K5QA 2NRAC 2A5WA 2JSPA 5LHIA 1LDJA 3GTQJ 4ZYDA 3D5RC 3SZGA 4RB2C 2H1KA 4KNYA 3F72A 3QOEA 2WC2A 4CCMA 2HR3A 1VQMI 2XAGA 2JVGA 1HKSA 1TBXA 1VQ4I 3K70D 3D5SC 2DA1A 3CDHA 3CLOA 2YS9A 3N4MA 2E19A 2DA2A 4G6QA 2EJRA 3HB9A 1RRJA 1AKHA 5CYVA 4EGYA 1K78A 2ELKA 1R5HA 3HC7A 3HRMA 4GYGA 4Q48A 1GT0C 2JSCA 1EJ9A 2R92J 1EH6A 4I99C 3LWFA 2KJCA 3H0GJ 5F0HA 4QTRA 4YIRX 1BI3A 1A5JA 3GFMA 2EZLA 4IHVA 3ABTA 1TT0A 1IRFA 1MJAA 2X1EA 2DPUA 2NS0A 4BBRJ 5FKNA 2ICWG 2E5ZA 3CJNA 5KAIC 1YI2I 3ZR8X 1U9OA 1WJCA 1VI0A 4R8HA 1FMWA 3RPUA 1RNLA 4YELA 4FT8A 3DP7A 1I39A 2EV0A 5K1YA 2CV0A 3K4NA 2HU9A 2IS1A 1O3QA 3G6EI 2K5CA 3OYLA 3QPLA 5M3FJ 4ETSA 2BY0A 4HZFA 3GFJA 2ZSHB 4MQVA 3NQOA 1LDDA 2EINH 4RM3A 3RCOA 2VJJA 2DK8A 2K85A 1KYZA 3IAS2 3KCCA 1IG7A 2L7FP 3RKQA 2LDUA 4BHBA 1LQ1A 2DI3A 1GXQA 4AC0A 3J81K 1BW5A 4BL0B 4WK8F 1HW1A 2DQLA 2HZDA 3CDLA 4KDPA 3KIOA 2EZIA 4E7KA 2DJIA 2K3PA 4Y13A 1EH8A 4CA0A 4A3JJ 1PUEE 1ZRDA 2HQAA 2NOJB 5B1AH 1Y8QB 1UELB 5GTHC 1HA8A 2QBYB 1M1EB 3F8CA 3TO6A 2R5ZA 1IC8A 4EJTA 3Q9VA 4A69C 3SFZA 3BZ6A 1SMTA 4YEJA 2MABA 1JTXA 4F52A 1DPUA 3NARA 2Y9YA 2QZ8A 2V9KA 4C9YA 3BP8A 2CRGA 4HQEA 1ETKA 3VB2A 1LFUP 2VN2A 3R60A 3GFIA 3SDBA 5DDGA 5E3OA 2EPFA 1KU2A 1VQNI 4AIHA 1XSVA 2Z9OA 2R7RA 2VKEA 4RB1A 3GTKJ 2ME6A 3V8LA 1BR2A 2VE8A 5CVJA 2NNYA 1XDSA 1HBXG 3SYTA 3WTVC 4QSHA 3GFLA 4PSWA 3E3VA 4IQ4A 1KQ0A 5ICFA 1LE8B 2VQHA 4P1WA 5B5EC 1HF0A 1FMVA 3OOUA 1CF7B 2N8GA 1OKRA 2OV7A 2JQ7A 2PI0A 4X1EA 4RLFA 2Z2SB 3K6GA 3CJQB 1J59A 3IH2A 2E2IJ 4YFNF 4ZYGA 2QWWA 2JT1A 4A5MA 4XLPF 3GBGA 1WH7A 1C0WA 2X9DA 3LSTA 3RJPA 3LSRA 3HDDA 4RDUA 2VUMJ 2D1HA 1OCOH 1FY7A 4PGHA 1T39A 4UY8I 4XLCA 3QPSA 2VJ5A 4JQFA 2FOKA 4FE4A 1D3YA 1E2XA 1JTYA 2MLGA 2QSGX 4LIUA 4GDFA 2K40A 2IGOA 4N4OB 4XN3A 1DGRM 1VQ9I 4IHYA 2L7MP 1B72A 1RKTA 3HHHA 2KQRA 3QRFF 3LSPA 3ZMUA 3L2UA 1JGSA 4RGRA 4XK4A 3H5NA 2E36A 2RQQA 1DGWY 4LGWA 5GPCA 4BHCA 3FK7A 5LD2C 3CMEI 1KQ9A 1QRYA 2B0LA 2HZTA 3CP8A 3HPGA 4BHPA 2HOAA 5F0FA 3CDIA 4D5FA 3U1DA 1YITI 2JRMA 2QQ9A 2XRLA 2P6TA 1ONVA 4PJJA 3BR0A 3JW4A 3VEPA 1ZK8A 2CQXA 1H9TA 2YUSA 4MFDA 5IY5H 4XRMA 3CJRB 3ZRGA 3JRFA 1YIJI 4DBRA 5C4JJ 3F22A 3QQAA 5E79C 5HNFA 3M8EA 1FWZA 2TRTA 4E7LA 4RB0A 4WF2A 1HSJA 2GXGA 1FBQA 1U5TC 5JVGF 1N25A 5BPDA 2O9LA 5EJCA 1EH7A 3F9KA 3H3UA 1B8IA 1JT6A 1JHHA 4CYCB 1QGPA 5LEKA 4BU2A 2RQPA 2F48A 4ESJA 2V79A 2A07F 3CJTB 3S15J 3JRCA 3GTGJ 1QO0D 2K4JA 3ABLH 5LEJA 2QEXI 2YR2A 5FLMJ 1WJDA 2FA5A 5E1WA 5J4VA 2DTRA 3MN2A 1JJ6C 3KFWX 3RZDJ 1ZARA 5DYMA 1XD7A 3H35A 3MMYB 4UXNA 4Y15A 2WB1N 4M6VA 3J81Z 4KIFA 4OIOF 3C18A 2E5NA 2YX7A 3PM1A 2ID3A 5DV5A 2CSOA 2DYSH 2VE9A 4UVCA 2WAFA 1SMYF 4A6DA 2MC4A 1BI0A 1X1DA 3LL7A 5IP9J 4FX4A 2ZXJA 1F9NA 2ZKZA 3BTLA 1Y0UA 2EB7A 4LITA 1P9QC 3OIOA 2KZGA 4G9YA 3MQ0A 1R6RA 2H27A 3E1SA 1T33A 1XTAA 3S1QJ 1R7JA 3BR2A 4GGGA 2NAZA 4I2OA 3LOCA 2D5VA 1PVEA 1Y6IA 1ZAOA 2RGVA 2ZFUA 3L2VA 5BPIA 4Y7NJ 3RQ4A 1J9IA 2Q0OA 3LAPA 4LMYA 3TDUC 3GZ5A 3F6OA 2VASA 4Z6YA 2CV2A 3FIWA 2NVXJ 1WJFA 4XLAA 1W7PA 1KQ8A 1LVAA 2IA0A 2XPUA 1ZQ3P 1LKXA 1R1TA 2W85A 4FX0A 4HAMA 2A05A 1AU7A 5DD4A 2DTZA 1A36A 5HDKA 2XUBA 4AD9A 1TW3A 3HJEA 4HLXA 3E5XA 4AYBN 4O3MA 2BW3B 3GX4X 2V6EA 2EBIA 3ASOH 2DN0A 4XKCA 2TCTA 5D8KB 3CCVI 4BACA 5H6QA 1BBYA 3FXOA 4RAFA 4WXCA 4HV5A 2HKXA 3LFKA 2WY8Q 1O4XA 3LAJA 2ZMEA 4Z2YA 1IRGA 2HDDA 3HTUA 4HPQA 4CCOA 5HLTA 2X6XA 5E3MA 3QP5A 3QPTA 1X2NA 2Q2EB 3WG7H 2DA7A 3I4NJ 2DT7B 5J4YA 1BC7C 4OU0A 3E0JB 1GUUA 1ZH5A 2PMHA 4ZZDA 1X4OA 2FU4A 2Y0SA 2CH0A 2NVUB 2CQKA 1QU3A 3H9QA 2MW8A 3ECOA 2EIKH 1WFXA 3T8RA 1TW2A 3BR5A 3J80Z 2VB6A 3I0TA 3FHZA 5GAGJ 3JRBA 3IH3A 2WTEA 4PUSA 2WWYA 3O8GA 2ZMEC 2IXSA 2ZJQF 2DBBA 4BQNA 1ZGAA 2R0QC 2RAEA 5L3BA 4OIPF 3SJMA 2XSDC 1BM9A 2JMWA 4G7ZF 3BJAA 1OQYA 4A3GJ 1TNTA 1RKWA 2K7LA 2OBPA 3B73A 4NC6A 1MDMB 4IHWA 1X1BA 1HSTA 3CP2A 1XX5A 4XLNF 2NS7A 2H8RA 1XGSA 4K2EA 1HKTA 4BJ5C 5E1ZB 1HOMA 5K7HA 1P6RA 2DU9A 5L3EA 3AL0C 4HX4A 2CQNA 2ZXHA 3BR3A 1ZR2A 2KZVA 2BXYA 3CCUI 5EZGA 4OIRF 4CXFA 1FYMA 4F93B 2VL8A 2DJNA 4II3A 4S05A 3JSPA 1E3PA 3LSMA 4Q47A 3IH4A 3EETA 2QVOA 1W4MA 3L7WA 1XGNA 2RVCA 2MFZA 2Z3YA 4I76A 1Y1WJ 2UWMA 2BVLA 3JRHA 5IPAA 3BCAA 3FWEA 2XKOA 5D4RA 2G0EA 2DXIA 2HVSA 2D1VA 2KRHA 2OQGA 3KEOA 4BDZA 3W3CA 4M9XA 1U9NA 4F91B 2PMUA 4M9ZA 1PUFA 1UHSA 4BUPA 4Y52J 3CMAI 4TV7A 4BXFA 1U3EM 1IXCA 3TP0A 3OYCA 4ANJA 2ESHA 3B6AA 4CH7A 1O3RA 3DU6A 4M6YA 2M3AA 2OD5A 1S7AA 4N4NB 1HLVA 2OCCH 1QNTA 5DCMB 4HDVA 2QKLB 4BS9A 2O3FA 3I64A 3T1BA 3MCZA 2LH9A 5J1UA 1N77A 2GQQA 1FX7A 3RI4A 3K4JA 3JREA 2XAQA 3ZMTA 3DKYA 4P9FA 1B9NA 3AG4H 4XMYA 3JTGA 1LNWA 4A0XA 3OS0A 3OY9A 5J8FA 5F0CA 1IN8A 4EVIA 2DOFA 3OYGA 3ECHA 2R7FA 2DLLA 2HGCA 4NDLA 1S3JA 5FKLA 5GP9A 3K4KA 2DT6A 1IN7A 5FJ8J 1WGXA 1N75A 4UUTA 4XBFA 5ERIA 2W7NA 1I3AA 4UVAA 2MD0A 2AHQA 1MJ9A 2F4IA 4JP0A 4XKBA 3M1EA 4L18B 3M7GA 3HGGA 2BY3A 2ZJRF 2BE5F 2GBYA 5F1JA 3OYAA 2IA1A 3GW2A 1U8RA 3I54A 1WKMA 5LGTA 5FFXA 4OIQF 3OR1C 1F36A 3B02A 1BI2A 3BQZA 2B9SA 4H4KC 3WTWC 2QCOA 5GAEJ 2IGKA 4HF1A 2P6SA 1ZHFA 2PFBA 2E1MC 1SC7A 4DYCA 2DAOA 3DPUA 3FX3A 3OIQA 3H3ZA 4G6TB 3RKYA 2K9SA 4B43A 1H8AC 1OCZH 4KMUX 4XLEA 2HKOA 2X6YA 1K4SA 2RC4A 3DBLB 1I6HJ 2P7CB 1XSDA 1AKHB 3RYRA 1K78B 1TC3C 3LA7A 2P8TA 1TQMA 1Z7LA 3MZYA 4B3XA 1FIPA 3GTLJ 3C1DA 1ETVA 2JWTA 2FJ1A 4S0HB 2DFHA 5TISC 2PMZA 1LB2A 2W82A 4B47A 2W00A 1BOBA 2RNJA 3KP6A 4DJAA 3CCSI 5DS9A 4UB6C 2P81A 4A3BJ 3ABKH 3ZQFA 2DW4A 3MKYB 1DQUA 2H94A 3PNYA 4A6EA 4RGXA 1HW2A 2HFHA 1WJEA 2CO5A 4MTEA 2W57A 1J7KA 5DTDA 1Y8RB 1K83J 4WWCA 3HOSA 2O6GE 2K4BA 3PNTA 2QSHX 4UV8A 4UV9A 1S6LA 2LY9A 4OAYA 1H0MA 4NBQA 2GIZA 3ZQCA 4A3IJ 1YW7A 2LLKA 3I56I 2W25A 1FOYA 2VBYA 1ACIA 3UR3C 2HTJA 5IT3A 2EK5A 3VSLA 1TQPA 2DMQA 2JA5J 4N9IA 1HCRA 2ESNA 4M3GA 1MNEA 1KZHA 2WAEA 5JHUA 4OMYA 3C2BA 3Q3SA 3RQIA 2JA8J 5LRSA 1F1ZA 2XV4S 4D0PA 3VOEA 2EZKA 1ZG5A 1U8BA 5FLXZ 2MA3A 3Q0WA 1QA6A 3JR9A 2L3DA 4A3MJ 5LHGA 1LDKB 3S2WA 2HYFA 5LHHA 2O7OA 3F6VA 4ZYEA 2NVYJ 4PK4A 4U88A 3EUAA 3GTOJ 1R1UA 3CCRI 1MW7A 2JUGA 3GLXA 4I7HA 3WU1B 4LJZF 2M4GA 4UUVA 4E7JA 1UHMA 4D1QA 1ZLKA 1MMSA 2R7TA 4DBQA 1A6IA 4XR6A 5L3FA 2R5ZB 4PDKA 3K69A 2EFWA 3HPHA 4IJAA 2WADA 3S16J 1TWFJ 3PQKA 2VOOA 1SFKA 2QGUA 1QZEA 3KLNA 3FBIB 2RKHA 1MSEC 1XC5A 4IRGA 1JKPC 1K61A 1ON1A 1RZ4A 2LOOA 1IW7F 4BJ6C 4EJUA 4L0YB 1YX5A 2W1OA 3BCBA 1TWAJ 3DV8A 4XICA 5DUKA 2PJPA 2VJIA 1LUJB 1VQ7I 1R1VA 3SFIA 2K27A 2FMLA 2DOEA 2UXXA 3K4MA 5D6EA 1W0UA 4KMFA 3KE2A 2X85A 3FXJA 3PUBA 3REOA 1XCBA 2R7QA 4ZYHA 4KN4X 4KIGA 1KU3A 1DU6A 2F5CA 2HOEA 3PSIA 2HDCA 2L54A 4E4HA 3FDYA 1YIOA 1RPWA 2NOGA 2X6OA 2DFIA 2KL4A 3A02A 1SAUA 1P92A 1AWCA 4XKWA 3HZJA 1BOAA 1F5TA 3BJ6A 4HV6A 4Y4RA 4ZYAA 3ZQQA 3HOVJ 1HC8A 3PFIA 4WXHA 1B4AA 2CYYA 3S93A 4BDYA 3S1MJ 3DXJF 4HRIA 4RAZA 4R1HA 2CUFA 4ENNA 3AG1H 4A3DJ 4PJ0C 1IF1A 4V19K 1BA5A 1B72B 2DO7A 2XPVA 2VLAA 2FNAA 2JK3A 2V4JC 2WY7Q 4HBLA 1XG1A 1ZTRA 2MH2A 1F43A 4HLYA 2QQBA 1JUSA 4R79A 4JOMA 5HVQC 2O03A 2FNPA 5CVRA 5FRMA 2ISYA 2EFOA 5B66C 2RV8A 3HG9A 1FIAA 4A3KJ 1U5TB 5D5UB 2F4OB 1J2XA 1WJ5A 1IAWA 4BY1J 1GXPA 4MLOA 2LG4A 4LB6B 1Z77A 1W5TA 2ISZA 2A69F 3QWLA 5CPRB 4DZPA 3J7ZI 3S1RJ 4KISA 2QLZA 3ESWB 3KZIC 2P5VA 4HEA2 2X4HA 4KICA 3RKWA 4HNVA 3GTJJ 3HRTA 2R7WA 2LBFB 2M8EA 3BPVA 4PGGA 3MKWB 3ZGKA 1SD6A 2R5YA 1R22A 1D1BA 2H1LA 1WJBA 3FXRA 1FZPB 5FKMA 2XGXA 3LA3A 2O5RA 3F8BA 3DCFA 4A0ZA 3MVPA 1S29A 1IN4A 1J5YA 3S3NA 2LYCA 1LFBA 4GFBA 2DDBA 1B8IB 4I01A 1U2WA 4XNFA 3ZQLA 2LD5A 3SDGA 3WTUC 1FNNA 2XC7A 5JVTA 3KP4A 5AIQA 1VTNC 3KP3A 1RUOA 4NQWA 2XB5A 1Y0NA 2NXNB 1POGA 4QPOA 1FYKA 2I5UA 4CCKA 1H88C 2I8DA 4UB8C 2MGQA 3BY6A 4M72A 2YU3A 3H5RA 1H89C 2OC6A 3OYBA 3CCYA 3L1PA 4KA4A 2LY2A 3GVAA 5IT9Z 4G12A 3BZKA 2L5QA 3GZNB 3DKWA 3F23A 3KP5A 2DMTA 1RI7A 1RR8C 4RBOA 4L5EA 3I59B 3BOQA 1D0XA 1OFCX 4S04A 1KA8A 5CVVA 4KN7X 2CUZA 2Y0SN 5HDGA 3ML6A 1UJ8A 4ZTFA 1FSEA 2CMPA 5TJJA 5E1XA 3CZ6A 2FF4A 2BOLA 1XGMA 4E70A 2PLYA 3WTXC 3L2RA 3QOPA 3AG2H 4MEXF 2NNNA 3AKZA 5CJ9A 2L4MA 3MWMA 3L9FA 2JTVA 2J5PA 5E3NA 2K9NA 2XF5A 3HRUA 3O6BB 3ZOBA 2ZBKA 2FXAA 3BR6A 3GMEA 5F1RA 1LEBA 1X1PA 1HW5A 3K2ZA 1OR7A 2KIUA 3E6CC 2B63J 5E8IA 2J5OA 4I02A 5C44J 1YLFA 4IL6C 4PJMA 3FKIJ 4EJOA 3V42A 2ME0A 3OYJA 4L5IA 2OJED 4MTDA 2GOXB 3HOTA 1O7FA 1BJZA 4M74A 1W7PB 2QENA 4RAYA 2MH9A 3RKXA 4KITB 1TWHJ 2CS3A 1R4MB 1S5LC 2MLKA 2OTJI 5HOOA 1IN6A 1ETYA 4CO8A 4CZZA 1DDNA 2OUMA 2K3FA 1G59A 1OJLA 4EMSA 2EFNA 2A3SA 2LTPA 4ENKA 1B1BA 2D2WA 2LF8A 2X1CA 4L0ZB 1Z21A 3ONQA 1OR7C 2R4GA 3R0JA 4BNCA 5D6FA 3A03A 5L3DA 5HODA 2JZYA 2EH3A 2ELJA 1UG0A 1FLIA 5M5XJ 3WTZA 2B7EA 1ZELA 3FF5A 3QYFA 1Z6RA 2ZMEB 4HG2A 3GF2A 3ZXSA 3I55I 1NG7A 1YX3A 3CQZJ 2Z33A 2M7AA 1MMDA 4BE0A 3W2VA 1UFMA 2STTA 3K1MA 3VYUB 2Q1ZB 2K02A 2Z5UA 1NG6A 5FD6A 5HLGA 2ADUA 1HXDA 3U2RA 3S1NJ 3VPRA 5GTIC 5A2QK 1MNDA 3PIOF 4C3JJ 3BWGA 4X6AJ 2GOMA 1FT9A 3ZPLA 1V54H 3CCLI 2DFFA 4XOPA 3AL0B 2ZB9A 3K1NA 4M3FA 4M3DA 4XORA 4HNTA 1MNMC 5L3CA 3GTPJ 2M30A 4DNCA 2KRFA 3VSKA 2CFXA 2DDAA 3WTYC 2Y31A 3WGIA 4C3IJ 1FBSA 4CDGA 5ILVA 2LC2A 2G9WA 3I58A 3MZ8A 2E2HJ 3C2HA 1I3QJ 1MH4A 3PO3J 3BJOA 3RZOJ 2DA6A 1E3HA 4PSXA 1XS9A 2IS4A 3I3LA 2O0YA 4M3EA 4RA2A 3BPXA 5K7FA 3ERED 2L7ZA 1Z9CA 4KFCA 1ULYA 2F2EA 1JKRC 3DPLC 3HUGA 3UNGC 4KUMA 1X19A 1DP7P 4IZZA 5IOZA 3CUQA 4L9TA 2CUJA 3ABUA 1QPMA 2MBFA 2QF7A 2OAZA 2GA1A 3QODA 2PJRA 1MBJA 3EPZA 5D5WB 1OYWA 2HOTA 3SEZA 3E6BA 1RIOH 1XMKA 4XKVA 5EG0A 5JFRA 2ZO4A 1T2KA 3MKLA 1VQ5I 2LFBA 3HSFA 4FQGA 1VQLI 1FOXA 2EA2A 1P2FA 1WPKA 5EEGA 4I98B 2KP6A 1D0ZA 3SZPA 1ZRCA 2VODA 3KPHA 2HPIA 4MGRA 3PL8A 3RDIA 4HF0A 3CUQC 2BVMA 3FMQA 1DP3A 3TW7A 4XRSA 2PX9A 2XAHA 1CF7A 3CESA 3TEDA 1U0JA 1SFUA 3E6MA 5IP7J 1T6SA 2V1DA 1W0TA 1V5GA 2WAQA 4OMZA 2HWVA 3E5UA 1L0OC 2Y30A 4IVNA 1LFPA 4ASNA 1T8IA 3AAFA 3V7RA 3PJRA 5KAFC 1WHUA 2MSYA 1BR4A 2FEZA 2H8WA 4BH9A 5IYBJ 1VF9A 1W5SA 1X3UA 3S3MA 1ITYA 2M45A 3CMMA 3BG7A 2R7DA 4HQMA 2E1MB 4LIVA 1MBFA 4GRIA 5M5WJ 4AIJA 1X3WB 1IGNA 1OCTC 2FQ4A 3G1OA 4X0GA 1ERDA 2KT0A 3L09A 1DUXC 3A01A 3RSNA 2CV1A 1LJ9A 1X1CA 1Q1VA 1Z91A 4OOIA 2M4KA 4FASD 3QYBA 3R4KA 5K5OA 5LGUA 4QPQA 1SANA 3OS1A 1T98A 2V1NA 1OISA 2K9QA 1YRNB 4XSZF 1FC3A 1SFEA 1UG2A 1Z67A 4BQAA 2EIMH 1Z05A 2AO9A 1P4XA 1R23A 2W24A 2AQEA 3F8FA 1Z0XA 2M0MA 3TO7A 1CQTA 2XF6A 5CVIA 4UVBA 4A0YA 3I9V2 3ZN1A 1WQ2A 3C2GA 2ZXIA 4FE7A 3PO2J 3IWFA 1QVUA 4KIBA 3I53A 2EA4A 4CYDA 1NH3A 3K1PA 3QP6A 1WI3A 5FKKA 2BY2A 3L00A 1YO5C 4E7IA 3M3YJ 2KFDA 2VBWA 5L3GA 1JHFA 2A5YB 2GAUA 3AG3H 3PSFA 4CUGA 1APLC 4HX8A 5ED4A 1Z3XA 3M07A 1CGPA 4HA8A 2K9MA 1JT0A 1PJRA 4H0EA 2LREA 4JK1X 5JHFA 1S7EA 2LF7A 1FYLA 3LA2A 3CC7I 1TT5B 5H20A 4HX7A 3T8TA 1T08B 2MG4A 3ERMA 2QQAA 3F3XA 3GYHX 4QIWN 4Q5SF 3DLAA 2DMPA 3OIPA 3OYKA 1SFXA 1OMIA 4DYRA 1J0RA 3JCUC 1QHHD 5HDNA 2HQRA 4JBAA 3OYIA 1N78A 1YOVB 2L9SA 4IOAF 2BEOA 1B6AA 2VKDA 1ORKA 4BEHB 4PFOA 4DOZA 4EM0B 5EGOA 4YRVA 1REPC 3FXQA 4C2MJ 1PDNC 1P4AA 4MIMA 1MBHA 2JJ7A 4MFEA 1R4NB 3KETA 3BTIA 1ZGWA 1T38A 1IDYA 2XIGA 4HSTA 1OYIA 2G7HA 4Y17A 3HOUJ 2LMDA 2IA2A 3EDPA 1WRJA 4UUSA 4LFUA 1JI8A 2ID6A 4JX6A 4IHTA 3ZMVA 2W4SA 4V2GA 2FQ3A 1X3ZB 1S9HA 1ZGJA 2WV1A 1D8JA 1W36C 2XRNA 4EATA 5IYDJ 3IWZA 3BG9A 4XONA 3CCJI 2O8KA 3K4CA 3SQNA 4BBSJ 1FP2A 3CMYA 4G8XA 1UCRA 2Y9ZA 2L9VA 1OCPA 3WTSC 1VZ0A 2L0KA 2AXTC 3HKZA 4YIIA 3W6VA 4P96A 1DU0A 3MKZA 1Z3YA 1W7PD 3IC7A 1IZ1A 2XGCA 4M6XA 3ZQGA 1VNDA 4A93J 2P5LC 1XCVA 4U0YA 3OYFA 3OYDA 3TDZC 3MZHA 4EEFG 3AFHA 2VIXA 3G2BA 4LLLA 4BXXJ 3IP4B 3A0HC 3LSIA 4XSXF 4G94A 4I6ZA 3CC4I 1D1AA 3H0DA 3CF5F 2VJ4A 4KYWA 2F4MB 3M8FA 2FE3A 2ZJPF 4RB3C 5DCFA 3TGNA 2ELHA 3RIRA 4CHUA 4Y3OA 4CZCA 2XAJA 4M9SA 1YJ9I 2Y0MA 4EM1A 1BL0A 1TZLA 3HTSB 4N9HA 4XRSG 2KISA 4NNJA 4DGWB 2R93J 1SVLA 2KHMA 2YU9J 3T0YA 3HOZJ 5J1YA 2EILH 2KPMA 3R6SA 4HYEA 3QU6A 4LG0A 2Q2EA 3K4LA 1FEXA 2VQLA 2F6CA 3ZQ7A 2HYGD 3P7NA 3OWTA 1I5ZA 3TKYA 3TBIA 3OYNA 1ZREA 2ECBA 4ENJA 1SEUA 2JA2A 3I5UA 3L2QA 1H9GA 3CCQI 2MD5A 1G2HA 4EV0A 2QQ8A 4RGSA 1I6XA 3CCEI 3X2QH 3K70C 3CD6I 3IUOA 4P5OA 1GHCA 3L2WA 4B3AA 2GIVA 2DA5A 4UNOA 2HOSA 2FBHA 2H6BA 3MAJA 1A35A 4KT6A 2AS5F 3GLLA 4B44A 2P5KA 1GV2A 2FRHA 5DM7F 1L3LA 4J00A 1ON2A 4W1UA 4JX4A 1TLHB 1RUNA 3PQJA 2EZHA 3ZP5A 2D45A 3COAC 4ZH4F 1WVRA 4MNUA 1P4WA 2JPCA 3HOYJ 3ABMH 4BE2A 4OINF 3Q9SA 1UZCA 3HEFA 3WODF 3A1YA 3LFUA 2DA3A 5AONA 2HXIA 3IL2A 3IAM2 3JRIA 4EJVA 2IVMA 1ETQA 4D7MA 3V8KA 3DKXA 2KIQA 5J3LA 4G7OF 3FXMA 4ESFA 3FMRA 2HEOA 3OSFA 3ZQHA 4XLFA 1VQPI 3D1NI 1YFHA 4AYBA 3N05A 3HSEA 4YFKF 5F08A 1G3TA 4NC8A 4IO9F 3U9GA 2BXZA 2LVSA 1XSXA 3LQQA 1IV8A 5KVRA 4AVZA 5LRRA 3HRSA 4BYYA 2DCEA 2ZNZA 2ZJ2A 1YS7A 4G6DA 1SAXA 5FRNA 1E0EA 3M9AA 1YYVA 1IUFA 2BYVE 1K7AA 3Q5FA 4Q4ZF 2CJJA 6PAXA 1YG2A 3D5LA 3DTKA 1MGTA 2GLOA 3FXLA 3TO9A 4ZDLA 2LKXA 1YW9A 3GEZA 5DCMA 2X51A 2F5VA 2ZFWA 1IJWC 5D4SA 2COBA 1ETOA 3CF2A 1T95A 1MKMA 5HLHA 4HNUA 3JRAA 2X6WA 1ZG3A 1TWGJ 3A4CA 1ZG1A 3ZN0A 3H5AA 3HL2A 3I4PA 5B3SH 2GXBA 1WI9A 4B8XA 1WZ2A 3IKVA 1R36A 5BQTA 2EIJH 3FHNA 4HF2A 3FBNB 3HXLA 3DU5A 3KX2A 3WG9A 3S17J 5DEQA 5LBQA 2GZWA 1ENHA 4LLGF 1GLNA 3DF8A 3E6DA 3VODA 1JKOC 3WHBA 1K6YA 1ZR4A 4GXOA 2L9RA 3Q0VA 5D8LB 4EJWA 2LNBA 2E7XA 3V7SA 2R7OA 3B6CA 3HGYA 4D9JA 4A2UA 3FXUA 4CICA 3CO6C 5KNLA 5D5XB 4OWRB 3WHCA 3KYLA 1Y1VJ 2JN6A 2L2OA 1NHAA 4QLCU 1O57A 5E20A 1J75A 2HQNA 3DBHB 1R58A 3EUHA 5EEAA 2VC1A 4J19A 4LLNA 5D5VB 4QWQA 4JX5A 1HKQA 3DBRB 4GYIA 1EA3A 5FKOA 5K7ZA 2M34A 5CLSA 2VKHA 4U7BA 1OCCH 2YPRA 1IXRC 3BG6A 2V1XA 5M3MJ 2R7XA 1W1WE 5J47A 3WU2C 3KYDB 3W2AA 1UHWA 2XAFA 4MO7A 3DWLE 3OSGA 4XOTA 5EZHA 5EDNA 2HTSA 3F8MA 3ELKA 2A6EF 4BAYA 4YIFA 5HS7A 3H1CA 3EUHC 4O5VA 1B9MA 9ANTA 2V6CA 2RREA 5IOYA 3KLOA 4ITVA 3VFZA 2WAQN 4GO1A 2E34A 5FROA 4E7ZA 3D0SA 3SXYA 2R7SA 3MD2A 2Y2ZA 1F4KA 3JAMK 4NC7A 1WWXA 2WV0A 2KIMA 5BS6A 1TNSA 1OCRH 2HS5A 3DTEA 3HSRA 4P55A 2KDZA 2Z99A 2F5EA 2I10A 3TMOA 1JKQC 5CQGA 4A3EJ 4LB5A 1LPQA 3HOWJ 5HS9A 3L2CA 2W48A 2YX4A 2KKOA 3KEQA 2BV6A 4NHJA 3BZCA 4CCLA 3IRQA 1J09A 2ECCA 3FM3A 1A6QA 3GXOA 1PP7U 2HPMA 1BW6A 1QQIA 4JYKA 2X0LA 1R49A 5HLIA 3MEXA 1QHGA 2E7WA 1HQCA 4PJLA 1XGOA 1JE8A 1GVDA 1JXSA 2ZSIB 3J7YJ 4IQJA 4IX7A 1MD0A 2OZUA 4F7ZA 3HUGB 5BNGA 3G4SI 4A12A 2PG4A 4A3CJ 1WSUA 2DODA 1UAAA 1NK3P 3CUQB 2IPQX 1JUPA 3S14J 1Q1HA 2E1CA 1MJBA 2MC3A 4HSRA 3F0CA 3M4OJ 4E7HA 2PJRB 4WXDA 2EQRA 3H9JA 2CW7A 1WCMJ 3BR1A 5EG0B 3T5XA 4HOBA 3K10A 2YSRA 4ON0A 5KCMA 5FGMA 4FETA 5ICGA 4LG3A 2LSOA 2HDWA 2ZC2A 4M3BA 1IDZA 3BDDA 3KEYA 2BY1A 1USSA 5HS8A 1FBUA 2R3SA 4E7SA 2JA7J 2Y69H 1OLTA 3M8JA 2E1NA 2CGPA 1QBJA 2KJBA 5F6FA 2DOAA 2DPDA 3RTRA 3WE2A 3JSOA 1MZBA 2ACJA 3NWSA 1MH3A 5EYRA 5C4XJ 3K4BA 3DTIA 1I1GA 1ODDA 1V5EA 2FD5A 1D1CA 2QKMB 4LOCA 2R7UA 2IEKA 1MMNA 3ULQB 1EKEA 3ZMSA 3HYIA 1FP1D 3LNQA 4II2A 2CW8A 1YE9A 3DEWA 4YFXF 1ZN2A 2RN7A 3HOXJ 2VI6A 1G8XA 3OR2C 3DQVC 3FZVA 3OMYA 2PBIA 1KYWA 3SZTA 2DT5A 1PP8F 2CUEA 2CWEA 2ZCWA 5E3LA 2P7VB 3K7AJ 3GTMJ 1KONA 5JLXA 3A01B 5E17F 4IRHA 3H92A 4AIDA 1TQIA 1S8NA 4PFPA 5DD8A 4RS8A 3QU3A 3E7LA 2Z16A 1TWCJ 3RPUD 1BR1A 2MYSA 2V7FA 1BIAA 2ETHA 1TL8A 1U5TA 4U87A 2JRTA 4IHXA 1IRXA 5FD5A 2M8GX 4IEJA 3HIFA 5J1RA 3J80K 2VPRA 3V8JA 4DQ2A 3ZCOA 1LVKA 2M0CA 3P9IA 4U0VA 4C2UA 2G7UA 5KK1A 2XAUA 1AOYA 3HKZN 1BJAA 1QVTA 2LBFA 4AWXB 5C3EJ 2GXAA 2H09A 4CCNA 3DFGA 2XGDA 3VDXA 5HNHA 4XRFA 3OOPA 1QZZA 4RGUA 4L5JA 2OZ6A 2VKVA 5KHDA 3A0BC 2FBKA 3O3KA 3W6JB 2Q8KA 1HDPA 1XMXA 2DFEA 1Z6TA 1EV7A 2K9LA 3GZ6A 1R71A 1O3SA 2QM3A 2E60A 3JAMZ 2KLOA 4XIDA 1RETA 3FMSA 1G4DA 4M73A 2EV6A 5AIPA 4UHTA 2V26A 1STZA 2R7VA 3DEEA 1IN5A 4EGZA 2VT3A 2IGMA 2NS8A 4XM3A 3W6KB 4J01A 3FXKA 4ABZA 1RR7A 3G1MA 2XDVA 2QBYA 2XB0X 5ICCA 2X48A 3MFKA 3OYEA 4A5NA 5LLQA 3VYTB 3BG5A 5DUIA 3DEUA 2VQGA 4V2FA 5FLVA 1MMAA 3WTTC 4CGZA 5EGOB 1FOWA 2IS6A 2KMUA 1UMQA 2IJLA 3M1CA 2CW0F 3I59A 3P9KA 4GCVA 2JA6J 1RC9A 1JUMA 2R7ZJ 1PUFB 2XF7A 3WE3A 2PMZN 2HVRA 3CO7C 3FK6A 2M2EA 3PIPF 2CQQA 1MMGA 2QUFA 2XHKA 1JJ8C 3EYIA 2KIFA 1LE8A 4BGDA 1V4RA 1SFOJ 4PCQA 5EF6A 1YHQI 4UUSB 4B48A 1TTYA 2E2JJ 3P5JA 1QZYA 3VYRB 5GADJ 4DW6A 1Y39A 1R9TJ 2OTLI 1KU9A 2IBDA 2GWRA 2L02A 2O8XA 2BZTA 2KRCA 3LSKA 3CUOA 4DYQA 5H2FC 2ZXWH 1G3WA 5GAHJ 2V1UA 4AIKA 3CCMI 5GPAA 2VBXA 1Z1DA 1SVMA 4M71A 5JI6A 3E97A 5CKTA 4BE1A 4D7NA 1U78A 2OCEA 2XROA 4B1RA 3S3OA 4F92B 4ZC3A 3H36A 3J7AO 2E1OA 3TP3A 1R5ID 3KZZA 2IP2A 3VWBA 1RESA 1NTCA 2PQ8A 1NK2P 4IRIA 3OYMA 4G7HF 3E5QA 1I1SA 3NAUA 4L9VA 2V9PA 3JRGA 2UZKA 3S32A 5IP6A 1VQKI 4ZDOA 4NB5A 1K6OA 1U6GA 4RLQA 1D5YA 5EEHA 1ZRFA 1VFCA 5CQEA 4EQQA 5BOXA 2IAIA 4IOCF 3P9CA 2TDXA 3SHFA 2FX0A 2LKPA 2M9HA 4KT5C 4A3LJ 2UUZA 2HXOA 1XDUA 2EFQA 4LG0B 1W5CC 3S2HJ 2IS2A 5JR3A 3N97A 1ZLJA 4F3QA 2NVQJ 4MQ9F 4PJNA 1P7JA 2ZNYA 3W2WA 2H6CA 1YTYA 1AHDP 2COMA 1MSFC 1SVOA 5A2QZ 1YJWI 4MHGA 5CVUA 2L7KA 4ZZLA 2X1DA 1QPIA 3PUFA 2DA4A 4CYCA 2IW5A 5LGNA 1VQ6I 3G73A 4XN0A 2WA0A 4YG2F 3WGHA 3R61A 3BTJA 4IF4A 5FFZA 3IKTA 3TL4X 2A6HF 4ZJZA 2IGNA 3JTHA 2O61A 5J40A 4AM3A 2VXZA 2FSWA 1A31A 2DYRH 2CFOA 1ETWA 2XASA 3RPQA 1K79A 5K5RA 3BLYA 1OPCA 4FTHA 2FMYA 1I50J 4IPAA 5FLXK 5E8GA 5ILSA 1G6NA 4C3HJ 1YW8A 1MIJA 3LSGA 2XGEA 2UXNA 2M87A 4C2TA 3NEUA 3I71A 1WJAA 1I27A 5FO5A 3OS2A 1JGGA 1HDDC 4B09A 1WH5A 4L9NA 2W84A 3IV5A 4U7DA 2GA2A 2AXLA 2IT0A 3FM5A 5ICEA 3TOBA 3LQRA 3HHGA 4MEYF 3TW6A 4NUBA 3G1LA 1IUYA 3K2AA 3K0LA 1O7LA 3H9GA 1IV6A 3U1KA 3IRRA 2CQ7A 3CC2I 2BHZA 2GM4A 5H6RA 2BBYA 3BTCA 1SD4A 1O3TA 2FOWA 1D5VA 3O8HA 4HW0A 5B1BH 2HNHA 2JVHA 2QSFX 1A04A 2CU7A 5LFAA 5E18F 2JUCA 3BQYA 2A68F 2XSJC 3ISPA 2P0WA 1IRZA 3PFYA 2EV5A 3TQNA 1G3YA 5F64A 2BW3A 1BN5A 1X1AA 1XB4A 2XPWA 2Y75A 3GO5A 3WGGA 2LKSA 1V5FA 5TRDA 1BIBA 5ILUA 2XVCA 4AVPA 4HDUA 3F21A 3LMMA 4FHTA 3FISA 1T56A 2QA4I 4LK0F 1BC8C 1GDTA 4I0AA 2V9VA 4CCJA 4WCGA 2WB1A 1KGSA 2VOPA 3IHUA 2E35A 3QPHA 4DZJA 1AA7A 3NWTA 3OL3A 5IYCJ 1E3OC 4IKFA 1BI1A 5DM6F 2FBIA 4C30A 2LRDA 2L01A 1YRNA 2NYXA 3R0AA 4B4CA 2DMNA 2P4WA 3DPTA 2VONA 2VPLA 1YQAA 3H3VK 3BROA 3ZMDA 1FSHA 2STWA 2PN6A 2CG4A 1S7OA 3ASNH 1D8KA 3BC8A 3BT9A 3UKGA 1IXSB 1GVJA 3OV8A 3VYSB 4I0BA 4DIQA 3EQLF 2A61A 1T0FA 2OA4A 3U21A 2LY1A 5F04A 1YS6A 3NRVA 4E6KG 1D0YA 4XQFA 1ZKGA 1K4TA 3EUKL 2UV1A 1X58A 4I09A 1FJLA 1V55H 3S2DJ 3CTAA 1KU7A 3KYCB 2Z1DA 2LR8A 2C6YA 3OL4A 3KP2A 1VQOI 3ZQIA 1MDMA 3LSJA 2F5FA 3C7JA 2RDPA 4IXAA 2JPBA 3HM5A 4U0WA 2HVQA 1V3FA 2EWNA 3QAHA 4XL9A 4A3FJ 2NVTJ 4PZJA 1OYYA 1ZYRF 1EF4A 2DMUA 1X2MA 5TGTA 2AQFA 4IHSA 3PNVA 2L4AA 2R5YB 1PYVA 4O6JA 1T0FC 3KP7A 4OAZA 3C3WA 4D5CA 3F8NA 3G3ZA 4BXUA 2WBMA 3ROUA 4EM2A 1UB9A 5FB2A 3CLQA 4RAGA 4BY7J 2E71A 2HYJA 2L9NA 4AUXA 4FCYA 4ENMA 1R5GA 3ZMZA 1Z7UA 3I4MJ 1W36D 3EYYA 4BEHA 2KDOA 2Y48A 4CSWA 2HI3A 2OF7A 2LP0A 3LSHA 5J6XA 2QYOA 1Y56A 3WU0A 5BMZA 3KZYA 4FISA 2EFPA 1MBGA 1DPRA 3FKJA 4NQWB 4P9UA 5M5YJ 1SD5A 3BG3A 1TP4A 2M1BA 4WX9A 3OYHA 1FPQA 1FTZA 1FTTA 1USTA 1XPXA 4F55A
chains in the Genus database with same CATH topology
2DK5A 2OQRA 5IT9K 4L9JA 3TOAA 3V7CA 5J8CA 2OU2A 2M5WA 1XN7A 2BGCA 4LK1F 2IRFG 1SD7A 1E17A 4N0BA 3GWZA 2VBZA 3GUDA 2XKPA 1B59A 4ESBA 3V4GA 1XMAA 1R00A 4LD5A 1G3SA 1LEAA 1FOKA 2K86A 2F5DA 2VT2A 2DQRA 3O2PE 3K9TA 2PEXA 2VC0A 3RYPA 5K5QA 2NRAC 5LHIA 1LDJA 4ZYDA 4RB2C 4KNYA 3F72A 2WC2A 2HR3A 2XAGA 1HKSA 1TBXA 3CDHA 3CLOA 3N4MA 4G6QA 2EJRA 5CYVA 4EGYA 1K78A 1R5HA 3HRMA 4GYGA 4Q48A 2JSCA 1EH6A 3LWFA 2KJCA 1BI3A 3GFMA 3ABTA 1IRFA 1MJAA 2DPUA 2NS0A 3CJNA 4R8HA 3RPUA 1RNLA 4FT8A 3DP7A 2EV0A 5K1YA 1O3QA 4ETSA 4HZFA 3GFJA 4MQVA 3NQOA 1LDDA 2DK8A 1KYZA 3KCCA 2LDUA 4BHBA 1LQ1A 2DI3A 1GXQA 3J81K 4WK8F 1HW1A 2DQLA 4KDPA 4Y13A 1EH8A 1PUEE 1ZRDA 2QBYB 3F8CA 3TO6A 4EJTA 3Q9VA 3SFZA 3BZ6A 1SMTA 1DPUA 2QZ8A 3BP8A 4HQEA 3VB2A 2VN2A 3R60A 3GFIA 5DDGA 1KU2A 4AIHA 1XSVA 2Z9OA 4RB1A 3V8LA 2VE8A 5CVJA 2NNYA 1XDSA 1HBXG 3WTVC 3GFLA 3E3VA 1KQ0A 5ICFA 1CF7B 1OKRA 2PI0A 1J59A 4YFNF 4ZYGA 2QWWA 2JT1A 4A5MA 4XLPF 1C0WA 3LSTA 3RJPA 2D1HA 1FY7A 4PGHA 1T39A 4JQFA 2FOKA 1D3YA 1E2XA 2MLGA 3HHHA 3QRFF 3ZMUA 1JGSA 4RGRA 4LGWA 4BHCA 1KQ9A 2B0LA 2HZTA 4BHPA 3U1DA 2QQ9A 2P6TA 1ONVA 3JW4A 3VEPA 1H9TA 3F22A 3M8EA 1FWZA 4RB0A 4WF2A 1HSJA 2GXGA 1FBQA 1U5TC 5BPDA 1EH7A 3H3UA 1JHHA 1QGPA 5LEKA 2RQPA 4ESJA 2V79A 2A07F 1QO0D 2K4JA 5LEJA 2YR2A 2FA5A 5E1WA 2DTRA 3KFWX 1ZARA 5DYMA 1XD7A 4UXNA 4Y15A 3J81Z 4KIFA 4OIOF 3C18A 2YX7A 2VE9A 5DV5A 2CSOA 4UVCA 1SMYF 4A6DA 1BI0A 4FX4A 2ZXJA 1F9NA 2ZKZA 1Y0UA 2EB7A 4G9YA 3MQ0A 2H27A 1R7JA 4GGGA 2NAZA 4I2OA 2RGVA 1ZAOA 5BPIA 1J9IA 2Q0OA 3LAPA 4LMYA 3TDUC 3GZ5A 3F6OA 1W7PA 1KQ8A 1LVAA 2IA0A 1R1TA 2W85A 4FX0A 4HAMA 5DD4A 5HDKA 2XUBA 4AD9A 1TW3A 4HLXA 3E5XA 4O3MA 3GX4X 5D8KB 5H6QA 1BBYA 4WXCA 4HV5A 2HKXA 3LFKA 3LAJA 2ZMEA 4Z2YA 1IRGA 3HTUA 3QP5A 3QPTA 1BC7C 4OU0A 1ZH5A 2PMHA 4ZZDA 2FU4A 2CQKA 3ECOA 3T8RA 1TW2A 3J80Z 3I0TA 3FHZA 2WTEA 2WWYA 2DBBA 1ZGAA 5L3BA 4OIPF 1BM9A 4G7ZF 3BJAA 1TNTA 2K7LA 2OBPA 1MDMB 3B73A 1HSTA 4XLNF 1XGSA 4K2EA 1HKTA 5E1ZB 1P6RA 2DU9A 5L3EA 4HX4A 4OIRF 4CXFA 1FYMA 4S05A 3JSPA 4Q47A 3EETA 2QVOA 1W4MA 3L7WA 1XGNA 2RVCA 2UWMA 2Z3YA 3FWEA 2XKOA 5D4RA 2D1VA 2OQGA 3KEOA 4M9XA 2PMUA 4M9ZA 4TV7A 1U3EM 1IXCA 2ESHA 1O3RA 4M6YA 2OD5A 1S7AA 1QNTA 5DCMB 4HDVA 2O3FA 3I64A 3T1BA 3MCZA 2GQQA 1FX7A 3RI4A 2XAQA 3ZMTA 4P9FA 1B9NA 3JTGA 1LNWA 4A0XA 5J8FA 1IN8A 4EVIA 3ECHA 2R7FA 2DLLA 2HGCA 1S3JA 1IN7A 4XBFA 5ERIA 4UVAA 1MJ9A 3M1EA 4L18B 3M7GA 2BE5F 2IA1A 3GW2A 1U8RA 3I54A 1WKMA 5LGTA 5FFXA 4OIQF 3B02A 1BI2A 3WTWC 4HF1A 2P6SA 1ZHFA 2PFBA 2DAOA 3FX3A 3H3ZA 3RKYA 4KMUX 2HKOA 2RC4A 2P7CB 1XSDA 3RYRA 1K78B 3LA7A 2P8TA 1TQMA 3MZYA 3C1DA 1LB2A 2RNJA 3KP6A 2DW4A 2H94A 4A6EA 4RGXA 1HW2A 2HFHA 2CO5A 4MTEA 2W57A 1J7KA 4WWCA 3HOSA 2O6GE 2K4BA 4UV8A 4UV9A 1S6LA 1H0MA 1YW7A 2W25A 2VBYA 2HTJA 5IT3A 2EK5A 1TQPA 4N9IA 2ESNA 5JHUA 4OMYA 5LRSA 1F1ZA 2XV4S 4D0PA 3VOEA 1ZG5A 5FLXZ 2MA3A 2L3DA 5LHGA 1LDKB 3S2WA 2HYFA 5LHHA 3F6VA 4ZYEA 4U88A 1R1UA 3GLXA 4I7HA 3WU1B 4LJZF 4UUVA 1UHMA 1ZLKA 5L3FA 4PDKA 3K69A 2EFWA 4IJAA 3PQKA 2VOOA 3KLNA 2RKHA 4IRGA 1ON1A 1RZ4A 1IW7F 4EJUA 4L0YB 3DV8A 2PJPA 5DUKA 1R1VA 2K27A 2FMLA 2UXXA 4KMFA 5D6EA 3KE2A 3REOA 1XCBA 4ZYHA 4KN4X 4KIGA 1KU3A 2F5CA 2HOEA 2HDCA 2L54A 1YIOA 2DFIA 1P92A 1AWCA 1BOAA 1F5TA 3BJ6A 4HV6A 3PFIA 4WXHA 1B4AA 2CYYA 3DXJF 4RAZA 4R1HA 4ENNA 1IF1A 2DO7A 2FNAA 4HBLA 2MH2A 4HLYA 2QQBA 4R79A 5HVQC 2O03A 2FNPA 5CVRA 2ISYA 2EFOA 2RV8A 1U5TB 5D5UB 1J2XA 1IAWA 1GXPA 4LB6B 1W5TA 2ISZA 2A69F 2QLZA 2P5VA 2X4HA 4KICA 3RKWA 3HRTA 2M8EA 3BPVA 4PGGA 1SD6A 1R22A 3FXRA 1FZPB 2XGXA 3LA3A 3F8BA 4A0ZA 1S29A 1IN4A 1J5YA 4I01A 1U2WA 3WTUC 1FNNA 5JVTA 3KP4A 5AIQA 1VTNC 3KP3A 1RUOA 4NQWA 1FYKA 3BY6A 4M72A 2YU3A 4KA4A 3GVAA 5IT9Z 3DKWA 3F23A 3KP5A 1RI7A 3I59B 3BOQA 4S04A 1KA8A 5CVVA 4KN7X 5HDGA 3ML6A 1FSEA 5TJJA 5E1XA 2FF4A 1XGMA 4E70A 2PLYA 3WTXC 3QOPA 4MEXF 2NNNA 5CJ9A 2L4MA 3MWMA 3L9FA 2JTVA 2J5PA 3HRUA 3O6BB 2ZBKA 2FXAA 5F1RA 1LEBA 1HW5A 3K2ZA 1OR7A 2KIUA 3E6CC 5E8IA 2J5OA 4I02A 1YLFA 4EJOA 4L5IA 4MTDA 3HOTA 1O7FA 4M74A 1W7PB 2QENA 4RAYA 2MH9A 3RKXA 2MLKA 5HOOA 1IN6A 4CO8A 4CZZA 1DDNA 4EMSA 2EFNA 2A3SA 4ENKA 1B1BA 2D2WA 2LF8A 4L0ZB 3R0JA 4BNCA 5D6FA 5L3DA 2JZYA 1FLIA 3WTZA 3FF5A 1Z6RA 2ZMEB 3GF2A 2Z33A 1UFMA 2STTA 3K1MA 2K02A 2Z5UA 5FD6A 5HLGA 2ADUA 1HXDA 3U2RA 5A2QK 3BWGA 1FT9A 3ZPLA 3K1NA 5L3CA 2M30A 4DNCA 2KRFA 2CFXA 3WTYC 3WGIA 1FBSA 4CDGA 5ILVA 2G9WA 3I58A 3BJOA 2O0YA 3BPXA 3ERED 1Z9CA 4KFCA 1ULYA 2F2EA 3DPLC 3HUGA 4KUMA 1DP7P 3CUQA 4L9TA 3ABUA 1QPMA 2MBFA 2OAZA 2GA1A 5D5WB 1OYWA 3E6BA 1RIOH 1XMKA 5JFRA 2ZO4A 1T2KA 3HSFA 2EA2A 1P2FA 5EEGA 3SZPA 4I98B 1ZRCA 2VODA 4MGRA 3RDIA 4HF0A 3CUQC 3FMQA 2XAHA 1CF7A 1SFUA 3E6MA 1T6SA 2V1DA 4OMZA 2HWVA 3E5UA 1L0OC 4IVNA 4ASNA 3AAFA 3V7RA 2FEZA 4BH9A 1W5SA 1X3UA 2M45A 2R7DA 4HQMA 4AIJA 3L09A 1DUXC 1LJ9A 1Z91A 4OOIA 3R4KA 5K5OA 5LGUA 1T98A 4XSZF 1FC3A 1SFEA 4BQAA 1Z05A 1P4XA 1R23A 2W24A 3F8FA 3TO7A 5CVIA 4UVBA 4A0YA 3ZN1A 1WQ2A 3IWFA 4CYDA 4KIBA 3I53A 2EA4A 3K1PA 3QP6A 3L00A 1YO5C 2VBWA 5L3GA 1JHFA 2A5YB 2GAUA 4HX8A 5ED4A 1CGPA 4HA8A 4H0EA 4JK1X 2LF7A 1FYLA 3LA2A 5H20A 4HX7A 3T8TA 2QQAA 3F3XA 3GYHX 4Q5SF 1SFXA 1OMIA 1J0RA 5HDNA 2HQRA 4JBAA 2BEOA 1B6AA 4EM0B 1REPC 3FXQA 1PDNC 1P4AA 3KETA 1T38A 2XIGA 1OYIA 2G7HA 4Y17A 2IA2A 3EDPA 1WRJA 4LFUA 4IHTA 3ZMVA 2FQ3A 1ZGJA 1D8JA 2XRNA 3IWZA 3SQNA 1FP2A 4G8XA 1UCRA 3WTSC 4YIIA 4P96A 1W7PD 3IC7A 1IZ1A 4M6XA 2P5LC 1XCVA 4U0YA 3TDZC 3MZHA 4LLLA 4XSXF 4G94A 4KYWA 3M8FA 2FE3A 4RB3C 5DCFA 3TGNA 2ELHA 3RIRA 4CHUA 2XAJA 4M9SA 2Y0MA 4EM1A 3HTSB 4N9HA 3T0YA 3R6SA 4HYEA 3QU6A 4LG0A 2Q2EA 3ZQ7A 2HYGD 3P7NA 1I5ZA 3TKYA 1ZREA 4ENJA 3I5UA 1H9GA 2MD5A 4EV0A 4RGSA 1I6XA 4P5OA 1GHCA 4UNOA 2GIVA 2FBHA 2H6BA 3MAJA 2AS5F 2P5KA 2FRHA 1L3LA 1ON2A 1RUNA 1TLHB 3PQJA 3ZP5A 2D45A 3COAC 4ZH4F 4MNUA 1P4WA 2JPCA 4OINF 3Q9SA 3WODF 5AONA 3IL2A 4EJVA 2IVMA 3V8KA 4G7OF 4ESFA 3FMRA 2HEOA 1YFHA 3HSEA 4YFKF 1G3TA 3U9GA 5KVRA 3LQQA 1XSXA 5LRRA 3HRSA 4BYYA 2ZNZA 2ZJ2A 4G6DA 1YS7A 1SAXA 3M9AA 1YYVA 2BYVE 1K7AA 3Q5FA 4Q4ZF 6PAXA 1YG2A 3D5LA 1MGTA 3TO9A 1YW9A 3GEZA 5DCMA 2ZFWA 5D4SA 1MKMA 5HLHA 1ZG3A 1ZG1A 3ZN0A 3I4PA 2GXBA 1WI9A 4B8XA 3IKVA 1R36A 5BQTA 4HF2A 3WG9A 5DEQA 5LBQA 2GZWA 4LLGF 3DF8A 3E6DA 3VODA 4GXOA 5D8LB 4EJWA 2LNBA 2E7XA 3V7SA 4A2UA 3FXUA 4CICA 3CO6C 5D5XB 1NHAA 4QLCU 1O57A 5E20A 1J75A 2HQNA 1R58A 3EUHA 2VC1A 4LLNA 5D5VB 4QWQA 1HKQA 4GYIA 5CLSA 4U7BA 2YPRA 1IXRC 2V1XA 1UHWA 2XAFA 2HTSA 3F8MA 3ELKA 2A6EF 4BAYA 4YIFA 5HS7A 4O5VA 1B9MA 2V6CA 3KLOA 3VFZA 4GO1A 3D0SA 3SXYA 1F4KA 3JAMK 1WWXA 2WV0A 2KIMA 5BS6A 1TNSA 2HS5A 4P55A 3HSRA 2Z99A 2F5EA 4LB5A 5HS9A 3L2CA 2YX4A 2KKOA 3KEQA 2BV6A 4NHJA 3IRQA 1PP7U 3FM3A 3GXOA 1QQIA 2X0LA 5HLIA 3MEXA 2E7WA 1HQCA 1XGOA 1JE8A 1JXSA 1MD0A 2OZUA 4F7ZA 4A12A 2PG4A 1WSUA 3CUQB 2IPQX 1Q1HA 2E1CA 1MJBA 2MC3A 4WXDA 3T5XA 4HOBA 4ON0A 2YSRA 5FGMA 5ICGA 2LSOA 3BDDA 1USSA 5HS8A 1FBUA 2R3SA 2CGPA 2E1NA 1QBJA 2KJBA 5F6FA 2DPDA 3RTRA 3WE2A 3JSOA 1MZBA 2ACJA 1I1GA 1ODDA 3ULQB 3ZMSA 3HYIA 1FP1D 4YFXF 1ZN2A 2RN7A 3DQVC 3FZVA 2PBIA 1KYWA 3SZTA 2DT5A 1PP8F 2CWEA 2ZCWA 2P7VB 5E17F 4IRHA 3H92A 1TQIA 1S8NA 5DD8A 4RS8A 3QU3A 1BIAA 2ETHA 1U5TA 2JRTA 5FD5A 3J80K 3HIFA 3V8JA 4DQ2A 3P9IA 4U0VA 2G7UA 5KK1A 1AOYA 4AWXB 1BJAA 2H09A 3DFGA 4XRFA 3OOPA 1QZZA 4RGUA 4L5JA 2OZ6A 3O3KA 2FBKA 3W6JB 2Q8KA 1Z6TA 1EV7A 3GZ6A 1O3SA 2QM3A 3JAMZ 3FMSA 1G4DA 4M73A 2EV6A 5AIPA 4UHTA 1STZA 1IN5A 4EGZA 2VT3A 3W6KB 2QBYA 5ICCA 3MFKA 4A5NA 5LLQA 5DUIA 3DEUA 3WTTC 4CGZA 2IJLA 2CW0F 3I59A 3P9KA 4GCVA 3WE3A 3CO7C 2QUFA 2XHKA 3EYIA 2KIFA 1V4RA 4PCQA 1TTYA 1QZYA 1KU9A 2GWRA 2L02A 2O8XA 3CUOA 1G3WA 2V1UA 4AIKA 2VBXA 1Z1DA 4M71A 5JI6A 3E97A 1U78A 2XROA 3J7AO 3KZZA 2IP2A 2PQ8A 4IRIA 4G7HF 3E5QA 1I1SA 4L9VA 2UZKA 4NB5A 1K6OA 1U6GA 5EEHA 1ZRFA 4EQQA 5BOXA 3P9CA 2TDXA 3SHFA 2LKPA 4KT5C 1XDUA 2EFQA 4LG0B 5JR3A 3N97A 1ZLJA 4MQ9F 2ZNYA 2H6CA 1YTYA 2COMA 5A2QZ 4MHGA 5CVUA 4ZZLA 2IW5A 5LGNA 3G73A 4YG2F 3WGHA 3R61A 4IF4A 5FFZA 3IKTA 2A6HF 3JTHA 2O61A 2VXZA 2FSWA 2XASA 3RPQA 1K79A 5K5RA 1OPCA 2FMYA 4IPAA 5FLXK 5E8GA 5ILSA 1G6NA 1YW8A 2UXNA 2M87A 3NEUA 3I71A 1I27A 5FO5A 4B09A 4L9NA 2W84A 4U7DA 2GA2A 2AXLA 2IT0A 3FM5A 5ICEA 3TOBA 3LQRA 3HHGA 4MEYF 1IUYA 3K0LA 1O7LA 3IRRA 5H6RA 2BBYA 1SD4A 1O3TA 1D5VA 4HW0A 1A04A 5E18F 2A68F 3ISPA 2EV5A 3TQNA 1G3YA 5F64A 1BN5A 1XB4A 2Y75A 3GO5A 3WGGA 5TRDA 1BIBA 5ILUA 2XVCA 4HDUA 4AVPA 3F21A 4FHTA 4LK0F 1BC8C 4I0AA 2V9VA 4WCGA 1KGSA 2VOPA 3IHUA 3QPHA 1BI1A 2FBIA 2L01A 2NYXA 3R0AA 2VONA 2P4WA 3DPTA 1FSHA 1YQAA 3BROA 3ZMDA 2STWA 2PN6A 2CG4A 1S7OA 1D8KA 1IXSB 1GVJA 3OV8A 4I0BA 3EQLF 2A61A 1T0FA 2OA4A 1YS6A 3NRVA 4I09A 3CTAA 1KU7A 2C6YA 3KP2A 1MDMA 2F5FA 3C7JA 2RDPA 4IXAA 2JPBA 4U0WA 1V3FA 2EWNA 3QAHA 4PZJA 1OYYA 1ZYRF 4IHSA 2L4AA 4O6JA 3KP7A 3C3WA 3F8NA 3G3ZA 4BXUA 3ROUA 4EM2A 1UB9A 5FB2A 4ENMA 1R5GA 3ZMZA 1Z7UA 3EYYA 2Y48A 5J6XA 2QYOA 3WU0A 5BMZA 3KZYA 2EFPA 1DPRA 4P9UA 1SD5A 2M1BA 4WX9A 1FPQA 1USTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK5 A;  2OQR A;  5IT9 K;  4L9J A;  3TOA A;  3V7C A;  5J8C A;  2OU2 A;  2M5W A;  1XN7 A;  2BGC A;  4LK1 F;  2IRF G;  1SD7 A;  1E17 A;  4N0B A;  3GWZ A;  2VBZ A;  3GUD A;  2XKP A;  1B59 A;  4ESB A;  3V4G A;  1XMA A;  1R00 A;  4LD5 A;  1G3S A;  1LEA A;  1FOK A;  2K86 A;  2F5D A;  2VT2 A;  2DQR A;  3O2P E;  3K9T A;  2PEX A;  2VC0 A;  3RYP A;  5K5Q A;  2NRA C;  5LHI A;  1LDJ A;  4ZYD A;  4RB2 C;  4KNY A;  3F72 A;  2WC2 A;  2HR3 A;  2XAG A;  1HKS A;  1TBX A;  3CDH A;  3CLO A;  3N4M A;  4G6Q A;  2EJR A;  5CYV A;  4EGY A;  1K78 A;  1R5H A;  3HRM A;  4GYG A;  4Q48 A;  2JSC A;  1EH6 A;  3LWF A;  2KJC A;  1BI3 A;  3GFM A;  3ABT A;  1IRF A;  1MJA A;  2DPU A;  2NS0 A;  3CJN A;  4R8H A;  3RPU A;  1RNL A;  4FT8 A;  3DP7 A;  2EV0 A;  5K1Y A;  1O3Q A;  4ETS A;  4HZF A;  3GFJ A;  4MQV A;  3NQO A;  1LDD A;  2DK8 A;  1KYZ A;  3KCC A;  2LDU A;  4BHB A;  1LQ1 A;  2DI3 A;  1GXQ A;  3J81 K;  4WK8 F;  1HW1 A;  2DQL A;  4KDP A;  4Y13 A;  1EH8 A;  1PUE E;  1ZRD A;  2QBY B;  3F8C A;  3TO6 A;  4EJT A;  3Q9V A;  3SFZ A;  3BZ6 A;  1SMT A;  1DPU A;  2QZ8 A;  3BP8 A;  4HQE A;  3VB2 A;  2VN2 A;  3R60 A;  3GFI A;  5DDG A;  1KU2 A;  4AIH A;  1XSV A;  2Z9O A;  4RB1 A;  3V8L A;  2VE8 A;  5CVJ A;  2NNY A;  1XDS A;  1HBX G;  3WTV C;  3GFL A;  3E3V A;  1KQ0 A;  5ICF A;  1CF7 B;  1OKR A;  2PI0 A;  1J59 A;  4YFN F;  4ZYG A;  2QWW A;  2JT1 A;  4A5M A;  4XLP F;  1C0W A;  3LST A;  3RJP A;  2D1H A;  1FY7 A;  4PGH A;  1T39 A;  4JQF A;  2FOK A;  1D3Y A;  1E2X A;  2MLG A;  3HHH A;  3QRF F;  3ZMU A;  1JGS A;  4RGR A;  4LGW A;  4BHC A;  1KQ9 A;  2B0L A;  2HZT A;  4BHP A;  3U1D A;  2QQ9 A;  2P6T A;  1ONV A;  3JW4 A;  3VEP A;  1H9T A;  3F22 A;  3M8E A;  1FWZ A;  4RB0 A;  4WF2 A;  1HSJ A;  2GXG A;  1FBQ A;  1U5T C;  5BPD A;  1EH7 A;  3H3U A;  1JHH A;  1QGP A;  5LEK A;  2RQP A;  4ESJ A;  2V79 A;  2A07 F;  1QO0 D;  2K4J A;  5LEJ A;  2YR2 A;  2FA5 A;  5E1W A;  2DTR A;  3KFW X;  1ZAR A;  5DYM A;  1XD7 A;  4UXN A;  4Y15 A;  3J81 Z;  4KIF A;  4OIO F;  3C18 A;  2YX7 A;  2VE9 A;  5DV5 A;  2CSO A;  4UVC A;  1SMY F;  4A6D A;  1BI0 A;  4FX4 A;  2ZXJ A;  1F9N A;  2ZKZ A;  1Y0U A;  2EB7 A;  4G9Y A;  3MQ0 A;  2H27 A;  1R7J A;  4GGG A;  2NAZ A;  4I2O A;  2RGV A;  1ZAO A;  5BPI A;  1J9I A;  2Q0O A;  3LAP A;  4LMY A;  3TDU C;  3GZ5 A;  3F6O A;  1W7P A;  1KQ8 A;  1LVA A;  2IA0 A;  1R1T A;  2W85 A;  4FX0 A;  4HAM A;  5DD4 A;  5HDK A;  2XUB A;  4AD9 A;  1TW3 A;  4HLX A;  3E5X A;  4O3M A;  3GX4 X;  5D8K B;  5H6Q A;  1BBY A;  4WXC A;  4HV5 A;  2HKX A;  3LFK A;  3LAJ A;  2ZME A;  4Z2Y A;  1IRG A;  3HTU A;  3QP5 A;  3QPT A;  1BC7 C;  4OU0 A;  1ZH5 A;  2PMH A;  4ZZD A;  2FU4 A;  2CQK A;  3ECO A;  3T8R A;  1TW2 A;  3J80 Z;  3I0T A;  3FHZ A;  2WTE A;  2WWY A;  2DBB A;  1ZGA A;  5L3B A;  4OIP F;  1BM9 A;  4G7Z F;  3BJA A;  1TNT A;  2K7L A;  2OBP A;  1MDM B;  3B73 A;  1HST A;  4XLN F;  1XGS A;  4K2E A;  1HKT A;  5E1Z B;  1P6R A;  2DU9 A;  5L3E A;  4HX4 A;  4OIR F;  4CXF A;  1FYM A;  4S05 A;  3JSP A;  4Q47 A;  3EET A;  2QVO A;  1W4M A;  3L7W A;  1XGN A;  2RVC A;  2UWM A;  2Z3Y A;  3FWE A;  2XKO A;  5D4R A;  2D1V A;  2OQG A;  3KEO A;  4M9X A;  2PMU A;  4M9Z A;  4TV7 A;  1U3E M;  1IXC A;  2ESH A;  1O3R A;  4M6Y A;  2OD5 A;  1S7A A;  1QNT A;  5DCM B;  4HDV A;  2O3F A;  3I64 A;  3T1B A;  3MCZ A;  2GQQ A;  1FX7 A;  3RI4 A;  2XAQ A;  3ZMT A;  4P9F A;  1B9N A;  3JTG A;  1LNW A;  4A0X A;  5J8F A;  1IN8 A;  4EVI A;  3ECH A;  2R7F A;  2DLL A;  2HGC A;  1S3J A;  1IN7 A;  4XBF A;  5ERI A;  4UVA A;  1MJ9 A;  3M1E A;  4L18 B;  3M7G A;  2BE5 F;  2IA1 A;  3GW2 A;  1U8R A;  3I54 A;  1WKM A;  5LGT A;  5FFX A;  4OIQ F;  3B02 A;  1BI2 A;  3WTW C;  4HF1 A;  2P6S A;  1ZHF A;  2PFB A;  2DAO A;  3FX3 A;  3H3Z A;  3RKY A;  4KMU X;  2HKO A;  2RC4 A;  2P7C B;  1XSD A;  3RYR A;  1K78 B;  3LA7 A;  2P8T A;  1TQM A;  3MZY A;  3C1D A;  1LB2 A;  2RNJ A;  3KP6 A;  2DW4 A;  2H94 A;  4A6E A;  4RGX A;  1HW2 A;  2HFH A;  2CO5 A;  4MTE A;  2W57 A;  1J7K A;  4WWC A;  3HOS A;  2O6G E;  2K4B A;  4UV8 A;  4UV9 A;  1S6L A;  1H0M A;  1YW7 A;  2W25 A;  2VBY A;  2HTJ A;  5IT3 A;  2EK5 A;  1TQP A;  4N9I A;  2ESN A;  5JHU A;  4OMY A;  5LRS A;  1F1Z A;  2XV4 S;  4D0P A;  3VOE A;  1ZG5 A;  5FLX Z;  2MA3 A;  2L3D A;  5LHG A;  1LDK B;  3S2W A;  2HYF A;  5LHH A;  3F6V A;  4ZYE A;  4U88 A;  1R1U A;  3GLX A;  4I7H A;  3WU1 B;  4LJZ F;  4UUV A;  1UHM A;  1ZLK A;  5L3F A;  4PDK A;  3K69 A;  2EFW A;  4IJA A;  3PQK A;  2VOO A;  3KLN A;  2RKH A;  4IRG A;  1ON1 A;  1RZ4 A;  1IW7 F;  4EJU A;  4L0Y B;  3DV8 A;  2PJP A;  5DUK A;  1R1V A;  2K27 A;  2FML A;  2UXX A;  4KMF A;  5D6E A;  3KE2 A;  3REO A;  1XCB A;  4ZYH A;  4KN4 X;  4KIG A;  1KU3 A;  2F5C A;  2HOE A;  2HDC A;  2L54 A;  1YIO A;  2DFI A;  1P92 A;  1AWC A;  1BOA A;  1F5T A;  3BJ6 A;  4HV6 A;  3PFI A;  4WXH A;  1B4A A;  2CYY A;  3DXJ F;  4RAZ A;  4R1H A;  4ENN A;  1IF1 A;  2DO7 A;  2FNA A;  4HBL A;  2MH2 A;  4HLY A;  2QQB A;  4R79 A;  5HVQ C;  2O03 A;  2FNP A;  5CVR A;  2ISY A;  2EFO A;  2RV8 A;  1U5T B;  5D5U B;  1J2X A;  1IAW A;  1GXP A;  4LB6 B;  1W5T A;  2ISZ A;  2A69 F;  2QLZ A;  2P5V A;  2X4H A;  4KIC A;  3RKW A;  3HRT A;  2M8E A;  3BPV A;  4PGG A;  1SD6 A;  1R22 A;  3FXR A;  1FZP B;  2XGX A;  3LA3 A;  3F8B A;  4A0Z A;  1S29 A;  1IN4 A;  1J5Y A;  4I01 A;  1U2W A;  3WTU C;  1FNN A;  5JVT A;  3KP4 A;  5AIQ A;  1VTN C;  3KP3 A;  1RUO A;  4NQW A;  1FYK A;  3BY6 A;  4M72 A;  2YU3 A;  4KA4 A;  3GVA A;  5IT9 Z;  3DKW A;  3F23 A;  3KP5 A;  1RI7 A;  3I59 B;  3BOQ A;  4S04 A;  1KA8 A;  5CVV A;  4KN7 X;  5HDG A;  3ML6 A;  1FSE A;  5TJJ A;  5E1X A;  2FF4 A;  1XGM A;  4E70 A;  2PLY A;  3WTX C;  3QOP A;  4MEX F;  2NNN A;  5CJ9 A;  2L4M A;  3MWM A;  3L9F A;  2JTV A;  2J5P A;  3HRU A;  3O6B B;  2ZBK A;  2FXA A;  5F1R A;  1LEB A;  1HW5 A;  3K2Z A;  1OR7 A;  2KIU A;  3E6C C;  5E8I A;  2J5O A;  4I02 A;  1YLF A;  4EJO A;  4L5I A;  4MTD A;  3HOT A;  1O7F A;  4M74 A;  1W7P B;  2QEN A;  4RAY A;  2MH9 A;  3RKX A;  2MLK A;  5HOO A;  1IN6 A;  4CO8 A;  4CZZ A;  1DDN A;  4EMS A;  2EFN A;  2A3S A;  4ENK A;  1B1B A;  2D2W A;  2LF8 A;  4L0Z B;  3R0J A;  4BNC A;  5D6F A;  5L3D A;  2JZY A;  1FLI A;  3WTZ A;  3FF5 A;  1Z6R A;  2ZME B;  3GF2 A;  2Z33 A;  1UFM A;  2STT A;  3K1M A;  2K02 A;  2Z5U A;  5FD6 A;  5HLG A;  2ADU A;  1HXD A;  3U2R A;  5A2Q K;  3BWG A;  1FT9 A;  3ZPL A;  3K1N A;  5L3C A;  2M30 A;  4DNC A;  2KRF A;  2CFX A;  3WTY C;  3WGI A;  1FBS A;  4CDG A;  5ILV A;  2G9W A;  3I58 A;  3BJO A;  2O0Y A;  3BPX A;  3ERE D;  1Z9C A;  4KFC A;  1ULY A;  2F2E A;  3DPL C;  3HUG A;  4KUM A;  1DP7 P;  3CUQ A;  4L9T A;  3ABU A;  1QPM A;  2MBF A;  2OAZ A;  2GA1 A;  5D5W B;  1OYW A;  3E6B A;  1RIO H;  1XMK A;  5JFR A;  2ZO4 A;  1T2K A;  3HSF A;  2EA2 A;  1P2F A;  5EEG A;  3SZP A;  4I98 B;  1ZRC A;  2VOD A;  4MGR A;  3RDI A;  4HF0 A;  3CUQ C;  3FMQ A;  2XAH A;  1CF7 A;  1SFU A;  3E6M A;  1T6S A;  2V1D A;  4OMZ A;  2HWV A;  3E5U A;  1L0O C;  4IVN A;  4ASN A;  3AAF A;  3V7R A;  2FEZ A;  4BH9 A;  1W5S A;  1X3U A;  2M45 A;  2R7D A;  4HQM A;  4AIJ A;  3L09 A;  1DUX C;  1LJ9 A;  1Z91 A;  4OOI A;  3R4K A;  5K5O A;  5LGU A;  1T98 A;  4XSZ F;  1FC3 A;  1SFE A;  4BQA A;  1Z05 A;  1P4X A;  1R23 A;  2W24 A;  3F8F A;  3TO7 A;  5CVI A;  4UVB A;  4A0Y A;  3ZN1 A;  1WQ2 A;  3IWF A;  4CYD A;  4KIB A;  3I53 A;  2EA4 A;  3K1P A;  3QP6 A;  3L00 A;  1YO5 C;  2VBW A;  5L3G A;  1JHF A;  2A5Y B;  2GAU A;  4HX8 A;  5ED4 A;  1CGP A;  4HA8 A;  4H0E A;  4JK1 X;  2LF7 A;  1FYL A;  3LA2 A;  5H20 A;  4HX7 A;  3T8T A;  2QQA A;  3F3X A;  3GYH X;  4Q5S F;  1SFX A;  1OMI A;  1J0R A;  5HDN A;  2HQR A;  4JBA A;  2BEO A;  1B6A A;  4EM0 B;  1REP C;  3FXQ A;  1PDN C;  1P4A A;  3KET A;  1T38 A;  2XIG A;  1OYI A;  2G7H A;  4Y17 A;  2IA2 A;  3EDP A;  1WRJ A;  4LFU A;  4IHT A;  3ZMV A;  2FQ3 A;  1ZGJ A;  1D8J A;  2XRN A;  3IWZ A;  3SQN A;  1FP2 A;  4G8X A;  1UCR A;  3WTS C;  4YII A;  4P96 A;  1W7P D;  3IC7 A;  1IZ1 A;  4M6X A;  2P5L C;  1XCV A;  4U0Y A;  3TDZ C;  3MZH A;  4LLL A;  4XSX F;  4G94 A;  4KYW A;  3M8F A;  2FE3 A;  4RB3 C;  5DCF A;  3TGN A;  2ELH A;  3RIR A;  4CHU A;  2XAJ A;  4M9S A;  2Y0M A;  4EM1 A;  3HTS B;  4N9H A;  3T0Y A;  3R6S A;  4HYE A;  3QU6 A;  4LG0 A;  2Q2E A;  3ZQ7 A;  2HYG D;  3P7N A;  1I5Z A;  3TKY A;  1ZRE A;  4ENJ A;  3I5U A;  1H9G A;  2MD5 A;  4EV0 A;  4RGS A;  1I6X A;  4P5O A;  1GHC A;  4UNO A;  2GIV A;  2FBH A;  2H6B A;  3MAJ A;  2AS5 F;  2P5K A;  2FRH A;  1L3L A;  1ON2 A;  1RUN A;  1TLH B;  3PQJ A;  3ZP5 A;  2D45 A;  3COA C;  4ZH4 F;  4MNU A;  1P4W A;  2JPC A;  4OIN F;  3Q9S A;  3WOD F;  5AON A;  3IL2 A;  4EJV A;  2IVM A;  3V8K A;  4G7O F;  4ESF A;  3FMR A;  2HEO A;  1YFH A;  3HSE A;  4YFK F;  1G3T A;  3U9G A;  5KVR A;  3LQQ A;  1XSX A;  5LRR A;  3HRS A;  4BYY A;  2ZNZ A;  2ZJ2 A;  4G6D A;  1YS7 A;  1SAX A;  3M9A A;  1YYV A;  2BYV E;  1K7A A;  3Q5F A;  4Q4Z F;  6PAX A;  1YG2 A;  3D5L A;  1MGT A;  3TO9 A;  1YW9 A;  3GEZ A;  5DCM A;  2ZFW A;  5D4S A;  1MKM A;  5HLH A;  1ZG3 A;  1ZG1 A;  3ZN0 A;  3I4P A;  2GXB A;  1WI9 A;  4B8X A;  3IKV A;  1R36 A;  5BQT A;  4HF2 A;  3WG9 A;  5DEQ A;  5LBQ A;  2GZW A;  4LLG F;  3DF8 A;  3E6D A;  3VOD A;  4GXO A;  5D8L B;  4EJW A;  2LNB A;  2E7X A;  3V7S A;  4A2U A;  3FXU A;  4CIC A;  3CO6 C;  5D5X B;  1NHA A;  4QLC U;  1O57 A;  5E20 A;  1J75 A;  2HQN A;  1R58 A;  3EUH A;  2VC1 A;  4LLN A;  5D5V B;  4QWQ A;  1HKQ A;  4GYI A;  5CLS A;  4U7B A;  2YPR A;  1IXR C;  2V1X A;  1UHW A;  2XAF A;  2HTS A;  3F8M A;  3ELK A;  2A6E F;  4BAY A;  4YIF A;  5HS7 A;  4O5V A;  1B9M A;  2V6C A;  3KLO A;  3VFZ A;  4GO1 A;  3D0S A;  3SXY A;  1F4K A;  3JAM K;  1WWX A;  2WV0 A;  2KIM A;  5BS6 A;  1TNS A;  2HS5 A;  4P55 A;  3HSR A;  2Z99 A;  2F5E A;  4LB5 A;  5HS9 A;  3L2C A;  2YX4 A;  2KKO A;  3KEQ A;  2BV6 A;  4NHJ A;  3IRQ A;  1PP7 U;  3FM3 A;  3GXO A;  1QQI A;  2X0L A;  5HLI A;  3MEX A;  2E7W A;  1HQC A;  1XGO A;  1JE8 A;  1JXS A;  1MD0 A;  2OZU A;  4F7Z A;  4A12 A;  2PG4 A;  1WSU A;  3CUQ B;  2IPQ X;  1Q1H A;  2E1C A;  1MJB A;  2MC3 A;  4WXD A;  3T5X A;  4HOB A;  4ON0 A;  2YSR A;  5FGM A;  5ICG A;  2LSO A;  3BDD A;  1USS A;  5HS8 A;  1FBU A;  2R3S A;  2CGP A;  2E1N A;  1QBJ A;  2KJB A;  5F6F A;  2DPD A;  3RTR A;  3WE2 A;  3JSO A;  1MZB A;  2ACJ A;  1I1G A;  1ODD A;  3ULQ B;  3ZMS A;  3HYI A;  1FP1 D;  4YFX F;  1ZN2 A;  2RN7 A;  3DQV C;  3FZV A;  2PBI A;  1KYW A;  3SZT A;  2DT5 A;  1PP8 F;  2CWE A;  2ZCW A;  2P7V B;  5E17 F;  4IRH A;  3H92 A;  1TQI A;  1S8N A;  5DD8 A;  4RS8 A;  3QU3 A;  1BIA A;  2ETH A;  1U5T A;  2JRT A;  5FD5 A;  3J80 K;  3HIF A;  3V8J A;  4DQ2 A;  3P9I A;  4U0V A;  2G7U A;  5KK1 A;  1AOY A;  4AWX B;  1BJA A;  2H09 A;  3DFG A;  4XRF A;  3OOP A;  1QZZ A;  4RGU A;  4L5J A;  2OZ6 A;  3O3K A;  2FBK A;  3W6J B;  2Q8K A;  1Z6T A;  1EV7 A;  3GZ6 A;  1O3S A;  2QM3 A;  3JAM Z;  3FMS A;  1G4D A;  4M73 A;  2EV6 A;  5AIP A;  4UHT A;  1STZ A;  1IN5 A;  4EGZ A;  2VT3 A;  3W6K B;  2QBY A;  5ICC A;  3MFK A;  4A5N A;  5LLQ A;  5DUI A;  3DEU A;  3WTT C;  4CGZ A;  2IJL A;  2CW0 F;  3I59 A;  3P9K A;  4GCV A;  3WE3 A;  3CO7 C;  2QUF A;  2XHK A;  3EYI A;  2KIF A;  1V4R A;  4PCQ A;  1TTY A;  1QZY A;  1KU9 A;  2GWR A;  2L02 A;  2O8X A;  3CUO A;  1G3W A;  2V1U A;  4AIK A;  2VBX A;  1Z1D A;  4M71 A;  5JI6 A;  3E97 A;  1U78 A;  2XRO A;  3J7A O;  3KZZ A;  2IP2 A;  2PQ8 A;  4IRI A;  4G7H F;  3E5Q A;  1I1S A;  4L9V A;  2UZK A;  4NB5 A;  1K6O A;  1U6G A;  5EEH A;  1ZRF A;  4EQQ A;  5BOX A;  3P9C A;  2TDX A;  3SHF A;  2LKP A;  4KT5 C;  1XDU A;  2EFQ A;  4LG0 B;  5JR3 A;  3N97 A;  1ZLJ A;  4MQ9 F;  2ZNY A;  2H6C A;  1YTY A;  2COM A;  5A2Q Z;  4MHG A;  5CVU A;  4ZZL A;  2IW5 A;  5LGN A;  3G73 A;  4YG2 F;  3WGH A;  3R61 A;  4IF4 A;  5FFZ A;  3IKT A;  2A6H F;  3JTH A;  2O61 A;  2VXZ A;  2FSW A;  2XAS A;  3RPQ A;  1K79 A;  5K5R A;  1OPC A;  2FMY A;  4IPA A;  5FLX K;  5E8G A;  5ILS A;  1G6N A;  1YW8 A;  2UXN A;  2M87 A;  3NEU A;  3I71 A;  1I27 A;  5FO5 A;  4B09 A;  4L9N A;  2W84 A;  4U7D A;  2GA2 A;  2AXL A;  2IT0 A;  3FM5 A;  5ICE A;  3TOB A;  3LQR A;  3HHG A;  4MEY F;  1IUY A;  3K0L A;  1O7L A;  3IRR A;  5H6R A;  2BBY A;  1SD4 A;  1O3T A;  1D5V A;  4HW0 A;  1A04 A;  5E18 F;  2A68 F;  3ISP A;  2EV5 A;  3TQN A;  1G3Y A;  5F64 A;  1BN5 A;  1XB4 A;  2Y75 A;  3GO5 A;  3WGG A;  5TRD A;  1BIB A;  5ILU A;  2XVC A;  4HDU A;  4AVP A;  3F21 A;  4FHT A;  4LK0 F;  1BC8 C;  4I0A A;  2V9V A;  4WCG A;  1KGS A;  2VOP A;  3IHU A;  3QPH A;  1BI1 A;  2FBI A;  2L01 A;  2NYX A;  3R0A A;  2VON A;  2P4W A;  3DPT A;  1FSH A;  1YQA A;  3BRO A;  3ZMD A;  2STW A;  2PN6 A;  2CG4 A;  1S7O A;  1D8K A;  1IXS B;  1GVJ A;  3OV8 A;  4I0B A;  3EQL F;  2A61 A;  1T0F A;  2OA4 A;  1YS6 A;  3NRV A;  4I09 A;  3CTA A;  1KU7 A;  2C6Y A;  3KP2 A;  1MDM A;  2F5F A;  3C7J A;  2RDP A;  4IXA A;  2JPB A;  4U0W A;  1V3F A;  2EWN A;  3QAH A;  4PZJ A;  1OYY A;  1ZYR F;  4IHS A;  2L4A A;  4O6J A;  3KP7 A;  3C3W A;  3F8N A;  3G3Z A;  4BXU A;  3ROU A;  4EM2 A;  1UB9 A;  5FB2 A;  4ENM A;  1R5G A;  3ZMZ A;  1Z7U A;  3EYY A;  2Y48 A;  5J6X A;  2QYO A;  3WU0 A;  5BMZ A;  3KZY A;  2EFP A;  1DPR A;  4P9U A;  1SD5 A;  2M1B A;  4WX9 A;  1FPQ A;  1UST A; 
#chains in the Genus database with same CATH topology
 2DK5 A;  1IO2 A;  2OQR A;  2M7B A;  5IT9 K;  2VXD A;  4L9J A;  3TOA A;  4BQO A;  3J7A Y;  3V7C A;  5J8C A;  2OU2 A;  4ZDP A;  4W97 A;  2M5W A;  1XN7 A;  2BGC A;  1MBK A;  2VQC A;  3G71 I;  2RNG A;  1MBE A;  4KJZ A;  4LK1 F;  1P7I A;  4AU7 A;  2HQ5 A;  2BHY A;  2IRF G;  1VQ8 I;  4ZTJ A;  1SD7 A;  1ETX A;  4XLH A;  5F27 A;  3QYE A;  1E17 A;  4N0B A;  3GWZ A;  2VBZ A;  3GUD A;  2XKP A;  4BQQ A;  3SEQ A;  1X4P A;  2FUG 2;  5JLW A;  1B59 A;  4ESB A;  1GV5 A;  3A2K A;  3V4G A;  3JRD A;  1XMA A;  3Q0U A;  3GCM A;  2OPT A;  2LK2 A;  1R00 A;  4LD5 A;  1G3S A;  1LEA A;  4BKX A;  3HBL A;  1FOK A;  2K86 A;  4BJT A;  2F5D A;  4RM2 A;  2VT2 A;  1S72 I;  2DQR A;  4Y33 A;  3O2P E;  3K9T A;  3DLL F;  3S8P A;  2A6T A;  2PEX A;  1YJN I;  2VC0 A;  4RMN A;  3RYP A;  5K5Q A;  2NRA C;  2A5W A;  2JSP A;  5LHI A;  1LDJ A;  3GTQ J;  4ZYD A;  3D5R C;  3SZG A;  4RB2 C;  2H1K A;  4KNY A;  3F72 A;  3QOE A;  2WC2 A;  4CCM A;  2HR3 A;  1VQM I;  2XAG A;  2JVG A;  1HKS A;  1TBX A;  1VQ4 I;  3K70 D;  3D5S C;  2DA1 A;  3CDH A;  3CLO A;  2YS9 A;  3N4M A;  2E19 A;  2DA2 A;  4G6Q A;  2EJR A;  3HB9 A;  1RRJ A;  1AKH A;  5CYV A;  4EGY A;  1K78 A;  2ELK A;  1R5H A;  3HC7 A;  3HRM A;  4GYG A;  4Q48 A;  1GT0 C;  2JSC A;  1EJ9 A;  2R92 J;  1EH6 A;  4I99 C;  3LWF A;  2KJC A;  3H0G J;  5F0H A;  4QTR A;  4YIR X;  1BI3 A;  1A5J A;  3GFM A;  2EZL A;  4IHV A;  3ABT A;  1TT0 A;  1IRF A;  1MJA A;  2X1E A;  2DPU A;  2NS0 A;  4BBR J;  5FKN A;  2ICW G;  2E5Z A;  3CJN A;  5KAI C;  1YI2 I;  3ZR8 X;  1U9O A;  1WJC A;  1VI0 A;  4R8H A;  1FMW A;  3RPU A;  1RNL A;  4YEL A;  4FT8 A;  3DP7 A;  1I39 A;  2EV0 A;  5K1Y A;  2CV0 A;  3K4N A;  2HU9 A;  2IS1 A;  1O3Q A;  3G6E I;  2K5C A;  3OYL A;  3QPL A;  5M3F J;  4ETS A;  2BY0 A;  4HZF A;  3GFJ A;  2ZSH B;  4MQV A;  3NQO A;  1LDD A;  2EIN H;  4RM3 A;  3RCO A;  2VJJ A;  2DK8 A;  2K85 A;  1KYZ A;  3IAS 2;  3KCC A;  1IG7 A;  2L7F P;  3RKQ A;  2LDU A;  4BHB A;  1LQ1 A;  2DI3 A;  1GXQ A;  4AC0 A;  3J81 K;  1BW5 A;  4BL0 B;  4WK8 F;  1HW1 A;  2DQL A;  2HZD A;  3CDL A;  4KDP A;  3KIO A;  2EZI A;  4E7K A;  2DJI A;  2K3P A;  4Y13 A;  1EH8 A;  4CA0 A;  4A3J J;  1PUE E;  1ZRD A;  2HQA A;  2NOJ B;  5B1A H;  1Y8Q B;  1UEL B;  5GTH C;  1HA8 A;  2QBY B;  1M1E B;  3F8C A;  3TO6 A;  2R5Z A;  1IC8 A;  4EJT A;  3Q9V A;  4A69 C;  3SFZ A;  3BZ6 A;  1SMT A;  4YEJ A;  2MAB A;  1JTX A;  4F52 A;  1DPU A;  3NAR A;  2Y9Y A;  2QZ8 A;  2V9K A;  4C9Y A;  3BP8 A;  2CRG A;  4HQE A;  1ETK A;  3VB2 A;  1LFU P;  2VN2 A;  3R60 A;  3GFI A;  3SDB A;  5DDG A;  5E3O A;  2EPF A;  1KU2 A;  1VQN I;  4AIH A;  1XSV A;  2Z9O A;  2R7R A;  2VKE A;  4RB1 A;  3GTK J;  2ME6 A;  3V8L A;  1BR2 A;  2VE8 A;  5CVJ A;  2NNY A;  1XDS A;  1HBX G;  3SYT A;  3WTV C;  4QSH A;  3GFL A;  4PSW A;  3E3V A;  4IQ4 A;  1KQ0 A;  5ICF A;  1LE8 B;  2VQH A;  4P1W A;  5B5E C;  1HF0 A;  1FMV A;  3OOU A;  1CF7 B;  2N8G A;  1OKR A;  2OV7 A;  2JQ7 A;  2PI0 A;  4X1E A;  4RLF A;  2Z2S B;  3K6G A;  3CJQ B;  1J59 A;  3IH2 A;  2E2I J;  4YFN F;  4ZYG A;  2QWW A;  2JT1 A;  4A5M A;  4XLP F;  3GBG A;  1WH7 A;  1C0W A;  2X9D A;  3LST A;  3RJP A;  3LSR A;  3HDD A;  4RDU A;  2VUM J;  2D1H A;  1OCO H;  1FY7 A;  4PGH A;  1T39 A;  4UY8 I;  4XLC A;  3QPS A;  2VJ5 A;  4JQF A;  2FOK A;  4FE4 A;  1D3Y A;  1E2X A;  1JTY A;  2MLG A;  2QSG X;  4LIU A;  4GDF A;  2K40 A;  2IGO A;  4N4O B;  4XN3 A;  1DGR M;  1VQ9 I;  4IHY A;  2L7M P;  1B72 A;  1RKT A;  3HHH A;  2KQR A;  3QRF F;  3LSP A;  3ZMU A;  3L2U A;  1JGS A;  4RGR A;  4XK4 A;  3H5N A;  2E36 A;  2RQQ A;  1DGW Y;  4LGW A;  5GPC A;  4BHC A;  3FK7 A;  5LD2 C;  3CME I;  1KQ9 A;  1QRY A;  2B0L A;  2HZT A;  3CP8 A;  3HPG A;  4BHP A;  2HOA A;  5F0F A;  3CDI A;  4D5F A;  3U1D A;  1YIT I;  2JRM A;  2QQ9 A;  2XRL A;  2P6T A;  1ONV A;  4PJJ A;  3BR0 A;  3JW4 A;  3VEP A;  1ZK8 A;  2CQX A;  1H9T A;  2YUS A;  4MFD A;  5IY5 H;  4XRM A;  3CJR B;  3ZRG A;  3JRF A;  1YIJ I;  4DBR A;  5C4J J;  3F22 A;  3QQA A;  5E79 C;  5HNF A;  3M8E A;  1FWZ A;  2TRT A;  4E7L A;  4RB0 A;  4WF2 A;  1HSJ A;  2GXG A;  1FBQ A;  1U5T C;  5JVG F;  1N25 A;  5BPD A;  2O9L A;  5EJC A;  1EH7 A;  3F9K A;  3H3U A;  1B8I A;  1JT6 A;  1JHH A;  4CYC B;  1QGP A;  5LEK A;  4BU2 A;  2RQP A;  2F48 A;  4ESJ A;  2V79 A;  2A07 F;  3CJT B;  3S15 J;  3JRC A;  3GTG J;  1QO0 D;  2K4J A;  3ABL H;  5LEJ A;  2QEX I;  2YR2 A;  5FLM J;  1WJD A;  2FA5 A;  5E1W A;  5J4V A;  2DTR A;  3MN2 A;  1JJ6 C;  3KFW X;  3RZD J;  1ZAR A;  5DYM A;  1XD7 A;  3H35 A;  3MMY B;  4UXN A;  4Y15 A;  2WB1 N;  4M6V A;  3J81 Z;  4KIF A;  4OIO F;  3C18 A;  2E5N A;  2YX7 A;  3PM1 A;  2ID3 A;  5DV5 A;  2CSO A;  2DYS H;  2VE9 A;  4UVC A;  2WAF A;  1SMY F;  4A6D A;  2MC4 A;  1BI0 A;  1X1D A;  3LL7 A;  5IP9 J;  4FX4 A;  2ZXJ A;  1F9N A;  2ZKZ A;  3BTL A;  1Y0U A;  2EB7 A;  4LIT A;  1P9Q C;  3OIO A;  2KZG A;  4G9Y A;  3MQ0 A;  1R6R A;  2H27 A;  3E1S A;  1T33 A;  1XTA A;  3S1Q J;  1R7J A;  3BR2 A;  4GGG A;  2NAZ A;  4I2O A;  3LOC A;  2D5V A;  1PVE A;  1Y6I A;  1ZAO A;  2RGV A;  2ZFU A;  3L2V A;  5BPI A;  4Y7N J;  3RQ4 A;  1J9I A;  2Q0O A;  3LAP A;  4LMY A;  3TDU C;  3GZ5 A;  3F6O A;  2VAS A;  4Z6Y A;  2CV2 A;  3FIW A;  2NVX J;  1WJF A;  4XLA A;  1W7P A;  1KQ8 A;  1LVA A;  2IA0 A;  2XPU A;  1ZQ3 P;  1LKX A;  1R1T A;  2W85 A;  4FX0 A;  4HAM A;  2A05 A;  1AU7 A;  5DD4 A;  2DTZ A;  1A36 A;  5HDK A;  2XUB A;  4AD9 A;  1TW3 A;  3HJE A;  4HLX A;  3E5X A;  4AYB N;  4O3M A;  2BW3 B;  3GX4 X;  2V6E A;  2EBI A;  3ASO H;  2DN0 A;  4XKC A;  2TCT A;  5D8K B;  3CCV I;  4BAC A;  5H6Q A;  1BBY A;  3FXO A;  4RAF A;  4WXC A;  4HV5 A;  2HKX A;  3LFK A;  2WY8 Q;  1O4X A;  3LAJ A;  2ZME A;  4Z2Y A;  1IRG A;  2HDD A;  3HTU A;  4HPQ A;  4CCO A;  5HLT A;  2X6X A;  5E3M A;  3QP5 A;  3QPT A;  1X2N A;  2Q2E B;  3WG7 H;  2DA7 A;  3I4N J;  2DT7 B;  5J4Y A;  1BC7 C;  4OU0 A;  3E0J B;  1GUU A;  1ZH5 A;  2PMH A;  4ZZD A;  1X4O A;  2FU4 A;  2Y0S A;  2CH0 A;  2NVU B;  2CQK A;  1QU3 A;  3H9Q A;  2MW8 A;  3ECO A;  2EIK H;  1WFX A;  3T8R A;  1TW2 A;  3BR5 A;  3J80 Z;  2VB6 A;  3I0T A;  3FHZ A;  5GAG J;  3JRB A;  3IH3 A;  2WTE A;  4PUS A;  2WWY A;  3O8G A;  2ZME C;  2IXS A;  2ZJQ F;  2DBB A;  4BQN A;  1ZGA A;  2R0Q C;  2RAE A;  5L3B A;  4OIP F;  3SJM A;  2XSD C;  1BM9 A;  2JMW A;  4G7Z F;  3BJA A;  1OQY A;  4A3G J;  1TNT A;  1RKW A;  2K7L A;  2OBP A;  3B73 A;  4NC6 A;  1MDM B;  4IHW A;  1X1B A;  1HST A;  3CP2 A;  1XX5 A;  4XLN F;  2NS7 A;  2H8R A;  1XGS A;  4K2E A;  1HKT A;  4BJ5 C;  5E1Z B;  1HOM A;  5K7H A;  1P6R A;  2DU9 A;  5L3E A;  3AL0 C;  4HX4 A;  2CQN A;  2ZXH A;  3BR3 A;  1ZR2 A;  2KZV A;  2BXY A;  3CCU I;  5EZG A;  4OIR F;  4CXF A;  1FYM A;  4F93 B;  2VL8 A;  2DJN A;  4II3 A;  4S05 A;  3JSP A;  1E3P A;  3LSM A;  4Q47 A;  3IH4 A;  3EET A;  2QVO A;  1W4M A;  3L7W A;  1XGN A;  2RVC A;  2MFZ A;  2Z3Y A;  4I76 A;  1Y1W J;  2UWM A;  2BVL A;  3JRH A;  5IPA A;  3BCA A;  3FWE A;  2XKO A;  5D4R A;  2G0E A;  2DXI A;  2HVS A;  2D1V A;  2KRH A;  2OQG A;  3KEO A;  4BDZ A;  3W3C A;  4M9X A;  1U9N A;  4F91 B;  2PMU A;  4M9Z A;  1PUF A;  1UHS A;  4BUP A;  4Y52 J;  3CMA I;  4TV7 A;  4BXF A;  1U3E M;  1IXC A;  3TP0 A;  3OYC A;  4ANJ A;  2ESH A;  3B6A A;  4CH7 A;  1O3R A;  3DU6 A;  4M6Y A;  2M3A A;  2OD5 A;  1S7A A;  4N4N B;  1HLV A;  2OCC H;  1QNT A;  5DCM B;  4HDV A;  2QKL B;  4BS9 A;  2O3F A;  3I64 A;  3T1B A;  3MCZ A;  2LH9 A;  5J1U A;  1N77 A;  2GQQ A;  1FX7 A;  3RI4 A;  3K4J A;  3JRE A;  2XAQ A;  3ZMT A;  3DKY A;  4P9F A;  1B9N A;  3AG4 H;  4XMY A;  3JTG A;  1LNW A;  4A0X A;  3OS0 A;  3OY9 A;  5J8F A;  5F0C A;  1IN8 A;  4EVI A;  2DOF A;  3OYG A;  3ECH A;  2R7F A;  2DLL A;  2HGC A;  4NDL A;  1S3J A;  5FKL A;  5GP9 A;  3K4K A;  2DT6 A;  1IN7 A;  5FJ8 J;  1WGX A;  1N75 A;  4UUT A;  4XBF A;  5ERI A;  2W7N A;  1I3A A;  4UVA A;  2MD0 A;  2AHQ A;  1MJ9 A;  2F4I A;  4JP0 A;  4XKB A;  3M1E A;  4L18 B;  3M7G A;  3HGG A;  2BY3 A;  2ZJR F;  2BE5 F;  2GBY A;  5F1J A;  3OYA A;  2IA1 A;  3GW2 A;  1U8R A;  3I54 A;  1WKM A;  5LGT A;  5FFX A;  4OIQ F;  3OR1 C;  1F36 A;  3B02 A;  1BI2 A;  3BQZ A;  2B9S A;  4H4K C;  3WTW C;  2QCO A;  5GAE J;  2IGK A;  4HF1 A;  2P6S A;  1ZHF A;  2PFB A;  2E1M C;  1SC7 A;  4DYC A;  2DAO A;  3DPU A;  3FX3 A;  3OIQ A;  3H3Z A;  4G6T B;  3RKY A;  2K9S A;  4B43 A;  1H8A C;  1OCZ H;  4KMU X;  4XLE A;  2HKO A;  2X6Y A;  1K4S A;  2RC4 A;  3DBL B;  1I6H J;  2P7C B;  1XSD A;  1AKH B;  3RYR A;  1K78 B;  1TC3 C;  3LA7 A;  2P8T A;  1TQM A;  1Z7L A;  3MZY A;  4B3X A;  1FIP A;  3GTL J;  3C1D A;  1ETV A;  2JWT A;  2FJ1 A;  4S0H B;  2DFH A;  5TIS C;  2PMZ A;  1LB2 A;  2W82 A;  4B47 A;  2W00 A;  1BOB A;  2RNJ A;  3KP6 A;  4DJA A;  3CCS I;  5DS9 A;  4UB6 C;  2P81 A;  4A3B J;  3ABK H;  3ZQF A;  2DW4 A;  3MKY B;  1DQU A;  2H94 A;  3PNY A;  4A6E A;  4RGX A;  1HW2 A;  2HFH A;  1WJE A;  2CO5 A;  4MTE A;  2W57 A;  1J7K A;  5DTD A;  1Y8R B;  1K83 J;  4WWC A;  3HOS A;  2O6G E;  2K4B A;  3PNT A;  2QSH X;  4UV8 A;  4UV9 A;  1S6L A;  2LY9 A;  4OAY A;  1H0M A;  4NBQ A;  2GIZ A;  3ZQC A;  4A3I J;  1YW7 A;  2LLK A;  3I56 I;  2W25 A;  1FOY A;  2VBY A;  1ACI A;  3UR3 C;  2HTJ A;  5IT3 A;  2EK5 A;  3VSL A;  1TQP A;  2DMQ A;  2JA5 J;  4N9I A;  1HCR A;  2ESN A;  4M3G A;  1MNE A;  1KZH A;  2WAE A;  5JHU A;  4OMY A;  3C2B A;  3Q3S A;  3RQI A;  2JA8 J;  5LRS A;  1F1Z A;  2XV4 S;  4D0P A;  3VOE A;  2EZK A;  1ZG5 A;  1U8B A;  5FLX Z;  2MA3 A;  3Q0W A;  1QA6 A;  3JR9 A;  2L3D A;  4A3M J;  5LHG A;  1LDK B;  3S2W A;  2HYF A;  5LHH A;  2O7O A;  3F6V A;  4ZYE A;  2NVY J;  4PK4 A;  4U88 A;  3EUA A;  3GTO J;  1R1U A;  3CCR I;  1MW7 A;  2JUG A;  3GLX A;  4I7H A;  3WU1 B;  4LJZ F;  2M4G A;  4UUV A;  4E7J A;  1UHM A;  4D1Q A;  1ZLK A;  1MMS A;  2R7T A;  4DBQ A;  1A6I A;  4XR6 A;  5L3F A;  2R5Z B;  4PDK A;  3K69 A;  2EFW A;  3HPH A;  4IJA A;  2WAD A;  3S16 J;  1TWF J;  3PQK A;  2VOO A;  1SFK A;  2QGU A;  1QZE A;  3KLN A;  3FBI B;  2RKH A;  1MSE C;  1XC5 A;  4IRG A;  1JKP C;  1K61 A;  1ON1 A;  1RZ4 A;  2LOO A;  1IW7 F;  4BJ6 C;  4EJU A;  4L0Y B;  1YX5 A;  2W1O A;  3BCB A;  1TWA J;  3DV8 A;  4XIC A;  5DUK A;  2PJP A;  2VJI A;  1LUJ B;  1VQ7 I;  1R1V A;  3SFI A;  2K27 A;  2FML A;  2DOE A;  2UXX A;  3K4M A;  5D6E A;  1W0U A;  4KMF A;  3KE2 A;  2X85 A;  3FXJ A;  3PUB A;  3REO A;  1XCB A;  2R7Q A;  4ZYH A;  4KN4 X;  4KIG A;  1KU3 A;  1DU6 A;  2F5C A;  2HOE A;  3PSI A;  2HDC A;  2L54 A;  4E4H A;  3FDY A;  1YIO A;  1RPW A;  2NOG A;  2X6O A;  2DFI A;  2KL4 A;  3A02 A;  1SAU A;  1P92 A;  1AWC A;  4XKW A;  3HZJ A;  1BOA A;  1F5T A;  3BJ6 A;  4HV6 A;  4Y4R A;  4ZYA A;  3ZQQ A;  3HOV J;  1HC8 A;  3PFI A;  4WXH A;  1B4A A;  2CYY A;  3S93 A;  4BDY A;  3S1M J;  3DXJ F;  4HRI A;  4RAZ A;  4R1H A;  2CUF A;  4ENN A;  3AG1 H;  4A3D J;  4PJ0 C;  1IF1 A;  4V19 K;  1BA5 A;  1B72 B;  2DO7 A;  2XPV A;  2VLA A;  2FNA A;  2JK3 A;  2V4J C;  2WY7 Q;  4HBL A;  1XG1 A;  1ZTR A;  2MH2 A;  1F43 A;  4HLY A;  2QQB A;  1JUS A;  4R79 A;  4JOM A;  5HVQ C;  2O03 A;  2FNP A;  5CVR A;  5FRM A;  2ISY A;  2EFO A;  5B66 C;  2RV8 A;  3HG9 A;  1FIA A;  4A3K J;  1U5T B;  5D5U B;  2F4O B;  1J2X A;  1WJ5 A;  1IAW A;  4BY1 J;  1GXP A;  4MLO A;  2LG4 A;  4LB6 B;  1Z77 A;  1W5T A;  2ISZ A;  2A69 F;  3QWL A;  5CPR B;  4DZP A;  3J7Z I;  3S1R J;  4KIS A;  2QLZ A;  3ESW B;  3KZI C;  2P5V A;  4HEA 2;  2X4H A;  4KIC A;  3RKW A;  4HNV A;  3GTJ J;  3HRT A;  2R7W A;  2LBF B;  2M8E A;  3BPV A;  4PGG A;  3MKW B;  3ZGK A;  1SD6 A;  2R5Y A;  1R22 A;  1D1B A;  2H1L A;  1WJB A;  3FXR A;  1FZP B;  5FKM A;  2XGX A;  3LA3 A;  2O5R A;  3F8B A;  3DCF A;  4A0Z A;  3MVP A;  1S29 A;  1IN4 A;  1J5Y A;  3S3N A;  2LYC A;  1LFB A;  4GFB A;  2DDB A;  1B8I B;  4I01 A;  1U2W A;  4XNF A;  3ZQL A;  2LD5 A;  3SDG A;  3WTU C;  1FNN A;  2XC7 A;  5JVT A;  3KP4 A;  5AIQ A;  1VTN C;  3KP3 A;  1RUO A;  4NQW A;  2XB5 A;  1Y0N A;  2NXN B;  1POG A;  4QPO A;  1FYK A;  2I5U A;  4CCK A;  1H88 C;  2I8D A;  4UB8 C;  2MGQ A;  3BY6 A;  4M72 A;  2YU3 A;  3H5R A;  1H89 C;  2OC6 A;  3OYB A;  3CCY A;  3L1P A;  4KA4 A;  2LY2 A;  3GVA A;  5IT9 Z;  4G12 A;  3BZK A;  2L5Q A;  3GZN B;  3DKW A;  3F23 A;  3KP5 A;  2DMT A;  1RI7 A;  1RR8 C;  4RBO A;  4L5E A;  3I59 B;  3BOQ A;  1D0X A;  1OFC X;  4S04 A;  1KA8 A;  5CVV A;  4KN7 X;  2CUZ A;  2Y0S N;  5HDG A;  3ML6 A;  1UJ8 A;  4ZTF A;  1FSE A;  2CMP A;  5TJJ A;  5E1X A;  3CZ6 A;  2FF4 A;  2BOL A;  1XGM A;  4E70 A;  2PLY A;  3WTX C;  3L2R A;  3QOP A;  3AG2 H;  4MEX F;  2NNN A;  3AKZ A;  5CJ9 A;  2L4M A;  3MWM A;  3L9F A;  2JTV A;  2J5P A;  5E3N A;  2K9N A;  2XF5 A;  3HRU A;  3O6B B;  3ZOB A;  2ZBK A;  2FXA A;  3BR6 A;  3GME A;  5F1R A;  1LEB A;  1X1P A;  1HW5 A;  3K2Z A;  1OR7 A;  2KIU A;  3E6C C;  2B63 J;  5E8I A;  2J5O A;  4I02 A;  5C44 J;  1YLF A;  4IL6 C;  4PJM A;  3FKI J;  4EJO A;  3V42 A;  2ME0 A;  3OYJ A;  4L5I A;  2OJE D;  4MTD A;  2GOX B;  3HOT A;  1O7F A;  1BJZ A;  4M74 A;  1W7P B;  2QEN A;  4RAY A;  2MH9 A;  3RKX A;  4KIT B;  1TWH J;  2CS3 A;  1R4M B;  1S5L C;  2MLK A;  2OTJ I;  5HOO A;  1IN6 A;  1ETY A;  4CO8 A;  4CZZ A;  1DDN A;  2OUM A;  2K3F A;  1G59 A;  1OJL A;  4EMS A;  2EFN A;  2A3S A;  2LTP A;  4ENK A;  1B1B A;  2D2W A;  2LF8 A;  2X1C A;  4L0Z B;  1Z21 A;  3ONQ A;  1OR7 C;  2R4G A;  3R0J A;  4BNC A;  5D6F A;  3A03 A;  5L3D A;  5HOD A;  2JZY A;  2EH3 A;  2ELJ A;  1UG0 A;  1FLI A;  5M5X J;  3WTZ A;  2B7E A;  1ZEL A;  3FF5 A;  3QYF A;  1Z6R A;  2ZME B;  4HG2 A;  3GF2 A;  3ZXS A;  3I55 I;  1NG7 A;  1YX3 A;  3CQZ J;  2Z33 A;  2M7A A;  1MMD A;  4BE0 A;  3W2V A;  1UFM A;  2STT A;  3K1M A;  3VYU B;  2Q1Z B;  2K02 A;  2Z5U A;  1NG6 A;  5FD6 A;  5HLG A;  2ADU A;  1HXD A;  3U2R A;  3S1N J;  3VPR A;  5GTI C;  5A2Q K;  1MND A;  3PIO F;  4C3J J;  3BWG A;  4X6A J;  2GOM A;  1FT9 A;  3ZPL A;  1V54 H;  3CCL I;  2DFF A;  4XOP A;  3AL0 B;  2ZB9 A;  3K1N A;  4M3F A;  4M3D A;  4XOR A;  4HNT A;  1MNM C;  5L3C A;  3GTP J;  2M30 A;  4DNC A;  2KRF A;  3VSK A;  2CFX A;  2DDA A;  3WTY C;  2Y31 A;  3WGI A;  4C3I J;  1FBS A;  4CDG A;  5ILV A;  2LC2 A;  2G9W A;  3I58 A;  3MZ8 A;  2E2H J;  3C2H A;  1I3Q J;  1MH4 A;  3PO3 J;  3BJO A;  3RZO J;  2DA6 A;  1E3H A;  4PSX A;  1XS9 A;  2IS4 A;  3I3L A;  2O0Y A;  4M3E A;  4RA2 A;  3BPX A;  5K7F A;  3ERE D;  2L7Z A;  1Z9C A;  4KFC A;  1ULY A;  2F2E A;  1JKR C;  3DPL C;  3HUG A;  3UNG C;  4KUM A;  1X19 A;  1DP7 P;  4IZZ A;  5IOZ A;  3CUQ A;  4L9T A;  2CUJ A;  3ABU A;  1QPM A;  2MBF A;  2QF7 A;  2OAZ A;  2GA1 A;  3QOD A;  2PJR A;  1MBJ A;  3EPZ A;  5D5W B;  1OYW A;  2HOT A;  3SEZ A;  3E6B A;  1RIO H;  1XMK A;  4XKV A;  5EG0 A;  5JFR A;  2ZO4 A;  1T2K A;  3MKL A;  1VQ5 I;  2LFB A;  3HSF A;  4FQG A;  1VQL I;  1FOX A;  2EA2 A;  1P2F A;  1WPK A;  5EEG A;  4I98 B;  2KP6 A;  1D0Z A;  3SZP A;  1ZRC A;  2VOD A;  3KPH A;  2HPI A;  4MGR A;  3PL8 A;  3RDI A;  4HF0 A;  3CUQ C;  2BVM A;  3FMQ A;  1DP3 A;  3TW7 A;  4XRS A;  2PX9 A;  2XAH A;  1CF7 A;  3CES A;  3TED A;  1U0J A;  1SFU A;  3E6M A;  5IP7 J;  1T6S A;  2V1D A;  1W0T A;  1V5G A;  2WAQ A;  4OMZ A;  2HWV A;  3E5U A;  1L0O C;  2Y30 A;  4IVN A;  1LFP A;  4ASN A;  1T8I A;  3AAF A;  3V7R A;  3PJR A;  5KAF C;  1WHU A;  2MSY A;  1BR4 A;  2FEZ A;  2H8W A;  4BH9 A;  5IYB J;  1VF9 A;  1W5S A;  1X3U A;  3S3M A;  1ITY A;  2M45 A;  3CMM A;  3BG7 A;  2R7D A;  4HQM A;  2E1M B;  4LIV A;  1MBF A;  4GRI A;  5M5W J;  4AIJ A;  1X3W B;  1IGN A;  1OCT C;  2FQ4 A;  3G1O A;  4X0G A;  1ERD A;  2KT0 A;  3L09 A;  1DUX C;  3A01 A;  3RSN A;  2CV1 A;  1LJ9 A;  1X1C A;  1Q1V A;  1Z91 A;  4OOI A;  2M4K A;  4FAS D;  3QYB A;  3R4K A;  5K5O A;  5LGU A;  4QPQ A;  1SAN A;  3OS1 A;  1T98 A;  2V1N A;  1OIS A;  2K9Q A;  1YRN B;  4XSZ F;  1FC3 A;  1SFE A;  1UG2 A;  1Z67 A;  4BQA A;  2EIM H;  1Z05 A;  2AO9 A;  1P4X A;  1R23 A;  2W24 A;  2AQE A;  3F8F A;  1Z0X A;  2M0M A;  3TO7 A;  1CQT A;  2XF6 A;  5CVI A;  4UVB A;  4A0Y A;  3I9V 2;  3ZN1 A;  1WQ2 A;  3C2G A;  2ZXI A;  4FE7 A;  3PO2 J;  3IWF A;  1QVU A;  4KIB A;  3I53 A;  2EA4 A;  4CYD A;  1NH3 A;  3K1P A;  3QP6 A;  1WI3 A;  5FKK A;  2BY2 A;  3L00 A;  1YO5 C;  4E7I A;  3M3Y J;  2KFD A;  2VBW A;  5L3G A;  1JHF A;  2A5Y B;  2GAU A;  3AG3 H;  3PSF A;  4CUG A;  1APL C;  4HX8 A;  5ED4 A;  1Z3X A;  3M07 A;  1CGP A;  4HA8 A;  2K9M A;  1JT0 A;  1PJR A;  4H0E A;  2LRE A;  4JK1 X;  5JHF A;  1S7E A;  2LF7 A;  1FYL A;  3LA2 A;  3CC7 I;  1TT5 B;  5H20 A;  4HX7 A;  3T8T A;  1T08 B;  2MG4 A;  3ERM A;  2QQA A;  3F3X A;  3GYH X;  4QIW N;  4Q5S F;  3DLA A;  2DMP A;  3OIP A;  3OYK A;  1SFX A;  1OMI A;  4DYR A;  1J0R A;  3JCU C;  1QHH D;  5HDN A;  2HQR A;  4JBA A;  3OYI A;  1N78 A;  1YOV B;  2L9S A;  4IOA F;  2BEO A;  1B6A A;  2VKD A;  1ORK A;  4BEH B;  4PFO A;  4DOZ A;  4EM0 B;  5EGO A;  4YRV A;  1REP C;  3FXQ A;  4C2M J;  1PDN C;  1P4A A;  4MIM A;  1MBH A;  2JJ7 A;  4MFE A;  1R4N B;  3KET A;  3BTI A;  1ZGW A;  1T38 A;  1IDY A;  2XIG A;  4HST A;  1OYI A;  2G7H A;  4Y17 A;  3HOU J;  2LMD A;  2IA2 A;  3EDP A;  1WRJ A;  4UUS A;  4LFU A;  1JI8 A;  2ID6 A;  4JX6 A;  4IHT A;  3ZMV A;  2W4S A;  4V2G A;  2FQ3 A;  1X3Z B;  1S9H A;  1ZGJ A;  2WV1 A;  1D8J A;  1W36 C;  2XRN A;  4EAT A;  5IYD J;  3IWZ A;  3BG9 A;  4XON A;  3CCJ I;  2O8K A;  3K4C A;  3SQN A;  4BBS J;  1FP2 A;  3CMY A;  4G8X A;  1UCR A;  2Y9Z A;  2L9V A;  1OCP A;  3WTS C;  1VZ0 A;  2L0K A;  2AXT C;  3HKZ A;  4YII A;  3W6V A;  4P96 A;  1DU0 A;  3MKZ A;  1Z3Y A;  1W7P D;  3IC7 A;  1IZ1 A;  2XGC A;  4M6X A;  3ZQG A;  1VND A;  4A93 J;  2P5L C;  1XCV A;  4U0Y A;  3OYF A;  3OYD A;  3TDZ C;  3MZH A;  4EEF G;  3AFH A;  2VIX A;  3G2B A;  4LLL A;  4BXX J;  3IP4 B;  3A0H C;  3LSI A;  4XSX F;  4G94 A;  4I6Z A;  3CC4 I;  1D1A A;  3H0D A;  3CF5 F;  2VJ4 A;  4KYW A;  2F4M B;  3M8F A;  2FE3 A;  2ZJP F;  4RB3 C;  5DCF A;  3TGN A;  2ELH A;  3RIR A;  4CHU A;  4Y3O A;  4CZC A;  2XAJ A;  4M9S A;  1YJ9 I;  2Y0M A;  4EM1 A;  1BL0 A;  1TZL A;  3HTS B;  4N9H A;  4XRS G;  2KIS A;  4NNJ A;  4DGW B;  2R93 J;  1SVL A;  2KHM A;  2YU9 J;  3T0Y A;  3HOZ J;  5J1Y A;  2EIL H;  2KPM A;  3R6S A;  4HYE A;  3QU6 A;  4LG0 A;  2Q2E A;  3K4L A;  1FEX A;  2VQL A;  2F6C A;  3ZQ7 A;  2HYG D;  3P7N A;  3OWT A;  1I5Z A;  3TKY A;  3TBI A;  3OYN A;  1ZRE A;  2ECB A;  4ENJ A;  1SEU A;  2JA2 A;  3I5U A;  3L2Q A;  1H9G A;  3CCQ I;  2MD5 A;  1G2H A;  4EV0 A;  2QQ8 A;  4RGS A;  1I6X A;  3CCE I;  3X2Q H;  3K70 C;  3CD6 I;  3IUO A;  4P5O A;  1GHC A;  3L2W A;  4B3A A;  2GIV A;  2DA5 A;  4UNO A;  2HOS A;  2FBH A;  2H6B A;  3MAJ A;  1A35 A;  4KT6 A;  2AS5 F;  3GLL A;  4B44 A;  2P5K A;  1GV2 A;  2FRH A;  5DM7 F;  1L3L A;  4J00 A;  1ON2 A;  4W1U A;  4JX4 A;  1TLH B;  1RUN A;  3PQJ A;  2EZH A;  3ZP5 A;  2D45 A;  3COA C;  4ZH4 F;  1WVR A;  4MNU A;  1P4W A;  2JPC A;  3HOY J;  3ABM H;  4BE2 A;  4OIN F;  3Q9S A;  1UZC A;  3HEF A;  3WOD F;  3A1Y A;  3LFU A;  2DA3 A;  5AON A;  2HXI A;  3IL2 A;  3IAM 2;  3JRI A;  4EJV A;  2IVM A;  1ETQ A;  4D7M A;  3V8K A;  3DKX A;  2KIQ A;  5J3L A;  4G7O F;  3FXM A;  4ESF A;  3FMR A;  2HEO A;  3OSF A;  3ZQH A;  4XLF A;  1VQP I;  3D1N I;  1YFH A;  4AYB A;  3N05 A;  3HSE A;  4YFK F;  5F08 A;  1G3T A;  4NC8 A;  4IO9 F;  3U9G A;  2BXZ A;  2LVS A;  1XSX A;  3LQQ A;  1IV8 A;  5KVR A;  4AVZ A;  5LRR A;  3HRS A;  4BYY A;  2DCE A;  2ZNZ A;  2ZJ2 A;  1YS7 A;  4G6D A;  1SAX A;  5FRN A;  1E0E A;  3M9A A;  1YYV A;  1IUF A;  2BYV E;  1K7A A;  3Q5F A;  4Q4Z F;  2CJJ A;  6PAX A;  1YG2 A;  3D5L A;  3DTK A;  1MGT A;  2GLO A;  3FXL A;  3TO9 A;  4ZDL A;  2LKX A;  1YW9 A;  3GEZ A;  5DCM A;  2X51 A;  2F5V A;  2ZFW A;  1IJW C;  5D4S A;  2COB A;  1ETO A;  3CF2 A;  1T95 A;  1MKM A;  5HLH A;  4HNU A;  3JRA A;  2X6W A;  1ZG3 A;  1TWG J;  3A4C A;  1ZG1 A;  3ZN0 A;  3H5A A;  3HL2 A;  3I4P A;  5B3S H;  2GXB A;  1WI9 A;  4B8X A;  1WZ2 A;  3IKV A;  1R36 A;  5BQT A;  2EIJ H;  3FHN A;  4HF2 A;  3FBN B;  3HXL A;  3DU5 A;  3KX2 A;  3WG9 A;  3S17 J;  5DEQ A;  5LBQ A;  2GZW A;  1ENH A;  4LLG F;  1GLN A;  3DF8 A;  3E6D A;  3VOD A;  1JKO C;  3WHB A;  1K6Y A;  1ZR4 A;  4GXO A;  2L9R A;  3Q0V A;  5D8L B;  4EJW A;  2LNB A;  2E7X A;  3V7S A;  2R7O A;  3B6C A;  3HGY A;  4D9J A;  4A2U A;  3FXU A;  4CIC A;  3CO6 C;  5KNL A;  5D5X B;  4OWR B;  3WHC A;  3KYL A;  1Y1V J;  2JN6 A;  2L2O A;  1NHA A;  4QLC U;  1O57 A;  5E20 A;  1J75 A;  2HQN A;  3DBH B;  1R58 A;  3EUH A;  5EEA A;  2VC1 A;  4J19 A;  4LLN A;  5D5V B;  4QWQ A;  4JX5 A;  1HKQ A;  3DBR B;  4GYI A;  1EA3 A;  5FKO A;  5K7Z A;  2M34 A;  5CLS A;  2VKH A;  4U7B A;  1OCC H;  2YPR A;  1IXR C;  3BG6 A;  2V1X A;  5M3M J;  2R7X A;  1W1W E;  5J47 A;  3WU2 C;  3KYD B;  3W2A A;  1UHW A;  2XAF A;  4MO7 A;  3DWL E;  3OSG A;  4XOT A;  5EZH A;  5EDN A;  2HTS A;  3F8M A;  3ELK A;  2A6E F;  4BAY A;  4YIF A;  5HS7 A;  3H1C A;  3EUH C;  4O5V A;  1B9M A;  9ANT A;  2V6C A;  2RRE A;  5IOY A;  3KLO A;  4ITV A;  3VFZ A;  2WAQ N;  4GO1 A;  2E34 A;  5FRO A;  4E7Z A;  3D0S A;  3SXY A;  2R7S A;  3MD2 A;  2Y2Z A;  1F4K A;  3JAM K;  4NC7 A;  1WWX A;  2WV0 A;  2KIM A;  5BS6 A;  1TNS A;  1OCR H;  2HS5 A;  3DTE A;  3HSR A;  4P55 A;  2KDZ A;  2Z99 A;  2F5E A;  2I10 A;  3TMO A;  1JKQ C;  5CQG A;  4A3E J;  4LB5 A;  1LPQ A;  3HOW J;  5HS9 A;  3L2C A;  2W48 A;  2YX4 A;  2KKO A;  3KEQ A;  2BV6 A;  4NHJ A;  3BZC A;  4CCL A;  3IRQ A;  1J09 A;  2ECC A;  3FM3 A;  1A6Q A;  3GXO A;  1PP7 U;  2HPM A;  1BW6 A;  1QQI A;  4JYK A;  2X0L A;  1R49 A;  5HLI A;  3MEX A;  1QHG A;  2E7W A;  1HQC A;  4PJL A;  1XGO A;  1JE8 A;  1GVD A;  1JXS A;  2ZSI B;  3J7Y J;  4IQJ A;  4IX7 A;  1MD0 A;  2OZU A;  4F7Z A;  3HUG B;  5BNG A;  3G4S I;  4A12 A;  2PG4 A;  4A3C J;  1WSU A;  2DOD A;  1UAA A;  1NK3 P;  3CUQ B;  2IPQ X;  1JUP A;  3S14 J;  1Q1H A;  2E1C A;  1MJB A;  2MC3 A;  4HSR A;  3F0C A;  3M4O J;  4E7H A;  2PJR B;  4WXD A;  2EQR A;  3H9J A;  2CW7 A;  1WCM J;  3BR1 A;  5EG0 B;  3T5X A;  4HOB A;  3K10 A;  2YSR A;  4ON0 A;  5KCM A;  5FGM A;  4FET A;  5ICG A;  4LG3 A;  2LSO A;  2HDW A;  2ZC2 A;  4M3B A;  1IDZ A;  3BDD A;  3KEY A;  2BY1 A;  1USS A;  5HS8 A;  1FBU A;  2R3S A;  4E7S A;  2JA7 J;  2Y69 H;  1OLT A;  3M8J A;  2E1N A;  2CGP A;  1QBJ A;  2KJB A;  5F6F A;  2DOA A;  2DPD A;  3RTR A;  3WE2 A;  3JSO A;  1MZB A;  2ACJ A;  3NWS A;  1MH3 A;  5EYR A;  5C4X J;  3K4B A;  3DTI A;  1I1G A;  1ODD A;  1V5E A;  2FD5 A;  1D1C A;  2QKM B;  4LOC A;  2R7U A;  2IEK A;  1MMN A;  3ULQ B;  1EKE A;  3ZMS A;  3HYI A;  1FP1 D;  3LNQ A;  4II2 A;  2CW8 A;  1YE9 A;  3DEW A;  4YFX F;  1ZN2 A;  2RN7 A;  3HOX J;  2VI6 A;  1G8X A;  3OR2 C;  3DQV C;  3FZV A;  3OMY A;  2PBI A;  1KYW A;  3SZT A;  2DT5 A;  1PP8 F;  2CUE A;  2CWE A;  2ZCW A;  5E3L A;  2P7V B;  3K7A J;  3GTM J;  1KON A;  5JLX A;  3A01 B;  5E17 F;  4IRH A;  3H92 A;  4AID A;  1TQI A;  1S8N A;  4PFP A;  5DD8 A;  4RS8 A;  3QU3 A;  3E7L A;  2Z16 A;  1TWC J;  3RPU D;  1BR1 A;  2MYS A;  2V7F A;  1BIA A;  2ETH A;  1TL8 A;  1U5T A;  4U87 A;  2JRT A;  4IHX A;  1IRX A;  5FD5 A;  2M8G X;  4IEJ A;  3HIF A;  5J1R A;  3J80 K;  2VPR A;  3V8J A;  4DQ2 A;  3ZCO A;  1LVK A;  2M0C A;  3P9I A;  4U0V A;  4C2U A;  2G7U A;  5KK1 A;  2XAU A;  1AOY A;  3HKZ N;  1BJA A;  1QVT A;  2LBF A;  4AWX B;  5C3E J;  2GXA A;  2H09 A;  4CCN A;  3DFG A;  2XGD A;  3VDX A;  5HNH A;  4XRF A;  3OOP A;  1QZZ A;  4RGU A;  4L5J A;  2OZ6 A;  2VKV A;  5KHD A;  3A0B C;  2FBK A;  3O3K A;  3W6J B;  2Q8K A;  1HDP A;  1XMX A;  2DFE A;  1Z6T A;  1EV7 A;  2K9L A;  3GZ6 A;  1R71 A;  1O3S A;  2QM3 A;  2E60 A;  3JAM Z;  2KLO A;  4XID A;  1RET A;  3FMS A;  1G4D A;  4M73 A;  2EV6 A;  5AIP A;  4UHT A;  2V26 A;  1STZ A;  2R7V A;  3DEE A;  1IN5 A;  4EGZ A;  2VT3 A;  2IGM A;  2NS8 A;  4XM3 A;  3W6K B;  4J01 A;  3FXK A;  4ABZ A;  1RR7 A;  3G1M A;  2XDV A;  2QBY A;  2XB0 X;  5ICC A;  2X48 A;  3MFK A;  3OYE A;  4A5N A;  5LLQ A;  3VYT B;  3BG5 A;  5DUI A;  3DEU A;  2VQG A;  4V2F A;  5FLV A;  1MMA A;  3WTT C;  4CGZ A;  5EGO B;  1FOW A;  2IS6 A;  2KMU A;  1UMQ A;  2IJL A;  3M1C A;  2CW0 F;  3I59 A;  3P9K A;  4GCV A;  2JA6 J;  1RC9 A;  1JUM A;  2R7Z J;  1PUF B;  2XF7 A;  3WE3 A;  2PMZ N;  2HVR A;  3CO7 C;  3FK6 A;  2M2E A;  3PIP F;  2CQQ A;  1MMG A;  2QUF A;  2XHK A;  1JJ8 C;  3EYI A;  2KIF A;  1LE8 A;  4BGD A;  1V4R A;  1SFO J;  4PCQ A;  5EF6 A;  1YHQ I;  4UUS B;  4B48 A;  1TTY A;  2E2J J;  3P5J A;  1QZY A;  3VYR B;  5GAD J;  4DW6 A;  1Y39 A;  1R9T J;  2OTL I;  1KU9 A;  2IBD A;  2GWR A;  2L02 A;  2O8X A;  2BZT A;  2KRC A;  3LSK A;  3CUO A;  4DYQ A;  5H2F C;  2ZXW H;  1G3W A;  5GAH J;  2V1U A;  4AIK A;  3CCM I;  5GPA A;  2VBX A;  1Z1D A;  1SVM A;  4M71 A;  5JI6 A;  3E97 A;  5CKT A;  4BE1 A;  4D7N A;  1U78 A;  2OCE A;  2XRO A;  4B1R A;  3S3O A;  4F92 B;  4ZC3 A;  3H36 A;  3J7A O;  2E1O A;  3TP3 A;  1R5I D;  3KZZ A;  2IP2 A;  3VWB A;  1RES A;  1NTC A;  2PQ8 A;  1NK2 P;  4IRI A;  3OYM A;  4G7H F;  3E5Q A;  1I1S A;  3NAU A;  4L9V A;  2V9P A;  3JRG A;  2UZK A;  3S32 A;  5IP6 A;  1VQK I;  4ZDO A;  4NB5 A;  1K6O A;  1U6G A;  4RLQ A;  1D5Y A;  5EEH A;  1ZRF A;  1VFC A;  5CQE A;  4EQQ A;  5BOX A;  2IAI A;  4IOC F;  3P9C A;  2TDX A;  3SHF A;  2FX0 A;  2LKP A;  2M9H A;  4KT5 C;  4A3L J;  2UUZ A;  2HXO A;  1XDU A;  2EFQ A;  4LG0 B;  1W5C C;  3S2H J;  2IS2 A;  5JR3 A;  3N97 A;  1ZLJ A;  4F3Q A;  2NVQ J;  4MQ9 F;  4PJN A;  1P7J A;  2ZNY A;  3W2W A;  2H6C A;  1YTY A;  1AHD P;  2COM A;  1MSF C;  1SVO A;  5A2Q Z;  1YJW I;  4MHG A;  5CVU A;  2L7K A;  4ZZL A;  2X1D A;  1QPI A;  3PUF A;  2DA4 A;  4CYC A;  2IW5 A;  5LGN A;  1VQ6 I;  3G73 A;  4XN0 A;  2WA0 A;  4YG2 F;  3WGH A;  3R61 A;  3BTJ A;  4IF4 A;  5FFZ A;  3IKT A;  3TL4 X;  2A6H F;  4ZJZ A;  2IGN A;  3JTH A;  2O61 A;  5J40 A;  4AM3 A;  2VXZ A;  2FSW A;  1A31 A;  2DYR H;  2CFO A;  1ETW A;  2XAS A;  3RPQ A;  1K79 A;  5K5R A;  3BLY A;  1OPC A;  4FTH A;  2FMY A;  1I50 J;  4IPA A;  5FLX K;  5E8G A;  5ILS A;  1G6N A;  4C3H J;  1YW8 A;  1MIJ A;  3LSG A;  2XGE A;  2UXN A;  2M87 A;  4C2T A;  3NEU A;  3I71 A;  1WJA A;  1I27 A;  5FO5 A;  3OS2 A;  1JGG A;  1HDD C;  4B09 A;  1WH5 A;  4L9N A;  2W84 A;  3IV5 A;  4U7D A;  2GA2 A;  2AXL A;  2IT0 A;  3FM5 A;  5ICE A;  3TOB A;  3LQR A;  3HHG A;  4MEY F;  3TW6 A;  4NUB A;  3G1L A;  1IUY A;  3K2A A;  3K0L A;  1O7L A;  3H9G A;  1IV6 A;  3U1K A;  3IRR A;  2CQ7 A;  3CC2 I;  2BHZ A;  2GM4 A;  5H6R A;  2BBY A;  3BTC A;  1SD4 A;  1O3T A;  2FOW A;  1D5V A;  3O8H A;  4HW0 A;  5B1B H;  2HNH A;  2JVH A;  2QSF X;  1A04 A;  2CU7 A;  5LFA A;  5E18 F;  2JUC A;  3BQY A;  2A68 F;  2XSJ C;  3ISP A;  2P0W A;  1IRZ A;  3PFY A;  2EV5 A;  3TQN A;  1G3Y A;  5F64 A;  2BW3 A;  1BN5 A;  1X1A A;  1XB4 A;  2XPW A;  2Y75 A;  3GO5 A;  3WGG A;  2LKS A;  1V5F A;  5TRD A;  1BIB A;  5ILU A;  2XVC A;  4AVP A;  4HDU A;  3F21 A;  3LMM A;  4FHT A;  3FIS A;  1T56 A;  2QA4 I;  4LK0 F;  1BC8 C;  1GDT A;  4I0A A;  2V9V A;  4CCJ A;  4WCG A;  2WB1 A;  1KGS A;  2VOP A;  3IHU A;  2E35 A;  3QPH A;  4DZJ A;  1AA7 A;  3NWT A;  3OL3 A;  5IYC J;  1E3O C;  4IKF A;  1BI1 A;  5DM6 F;  2FBI A;  4C30 A;  2LRD A;  2L01 A;  1YRN A;  2NYX A;  3R0A A;  4B4C A;  2DMN A;  2P4W A;  3DPT A;  2VON A;  2VPL A;  1YQA A;  3H3V K;  3BRO A;  3ZMD A;  1FSH A;  2STW A;  2PN6 A;  2CG4 A;  1S7O A;  3ASN H;  1D8K A;  3BC8 A;  3BT9 A;  3UKG A;  1IXS B;  1GVJ A;  3OV8 A;  3VYS B;  4I0B A;  4DIQ A;  3EQL F;  2A61 A;  1T0F A;  2OA4 A;  3U21 A;  2LY1 A;  5F04 A;  1YS6 A;  3NRV A;  4E6K G;  1D0Y A;  4XQF A;  1ZKG A;  1K4T A;  3EUK L;  2UV1 A;  1X58 A;  4I09 A;  1FJL A;  1V55 H;  3S2D J;  3CTA A;  1KU7 A;  3KYC B;  2Z1D A;  2LR8 A;  2C6Y A;  3OL4 A;  3KP2 A;  1VQO I;  3ZQI A;  1MDM A;  3LSJ A;  2F5F A;  3C7J A;  2RDP A;  4IXA A;  2JPB A;  3HM5 A;  4U0W A;  2HVQ A;  1V3F A;  2EWN A;  3QAH A;  4XL9 A;  4A3F J;  2NVT J;  4PZJ A;  1OYY A;  1ZYR F;  1EF4 A;  2DMU A;  1X2M A;  5TGT A;  2AQF A;  4IHS A;  3PNV A;  2L4A A;  2R5Y B;  1PYV A;  4O6J A;  1T0F C;  3KP7 A;  4OAZ A;  3C3W A;  4D5C A;  3F8N A;  3G3Z A;  4BXU A;  2WBM A;  3ROU A;  4EM2 A;  1UB9 A;  5FB2 A;  3CLQ A;  4RAG A;  4BY7 J;  2E71 A;  2HYJ A;  2L9N A;  4AUX A;  4FCY A;  4ENM A;  1R5G A;  3ZMZ A;  1Z7U A;  3I4M J;  1W36 D;  3EYY A;  4BEH A;  2KDO A;  2Y48 A;  4CSW A;  2HI3 A;  2OF7 A;  2LP0 A;  3LSH A;  5J6X A;  2QYO A;  1Y56 A;  3WU0 A;  5BMZ A;  3KZY A;  4FIS A;  2EFP A;  1MBG A;  1DPR A;  3FKJ A;  4NQW B;  4P9U A;  5M5Y J;  1SD5 A;  3BG3 A;  1TP4 A;  2M1B A;  4WX9 A;  3OYH A;  1FPQ A;  1FTZ A;  1FTT A;  1UST A;  1XPX A;  4F55 A; 
#chains in the Genus database with same CATH homology
 2DK5 A;  2OQR A;  5IT9 K;  4L9J A;  3TOA A;  3V7C A;  5J8C A;  2OU2 A;  2M5W A;  1XN7 A;  2BGC A;  4LK1 F;  2IRF G;  1SD7 A;  1E17 A;  4N0B A;  3GWZ A;  2VBZ A;  3GUD A;  2XKP A;  1B59 A;  4ESB A;  3V4G A;  1XMA A;  1R00 A;  4LD5 A;  1G3S A;  1LEA A;  1FOK A;  2K86 A;  2F5D A;  2VT2 A;  2DQR A;  3O2P E;  3K9T A;  2PEX A;  2VC0 A;  3RYP A;  5K5Q A;  2NRA C;  5LHI A;  1LDJ A;  4ZYD A;  4RB2 C;  4KNY A;  3F72 A;  2WC2 A;  2HR3 A;  2XAG A;  1HKS A;  1TBX A;  3CDH A;  3CLO A;  3N4M A;  4G6Q A;  2EJR A;  5CYV A;  4EGY A;  1K78 A;  1R5H A;  3HRM A;  4GYG A;  4Q48 A;  2JSC A;  1EH6 A;  3LWF A;  2KJC A;  1BI3 A;  3GFM A;  3ABT A;  1IRF A;  1MJA A;  2DPU A;  2NS0 A;  3CJN A;  4R8H A;  3RPU A;  1RNL A;  4FT8 A;  3DP7 A;  2EV0 A;  5K1Y A;  1O3Q A;  4ETS A;  4HZF A;  3GFJ A;  4MQV A;  3NQO A;  1LDD A;  2DK8 A;  1KYZ A;  3KCC A;  2LDU A;  4BHB A;  1LQ1 A;  2DI3 A;  1GXQ A;  3J81 K;  4WK8 F;  1HW1 A;  2DQL A;  4KDP A;  4Y13 A;  1EH8 A;  1PUE E;  1ZRD A;  2QBY B;  3F8C A;  3TO6 A;  4EJT A;  3Q9V A;  3SFZ A;  3BZ6 A;  1SMT A;  1DPU A;  2QZ8 A;  3BP8 A;  4HQE A;  3VB2 A;  2VN2 A;  3R60 A;  3GFI A;  5DDG A;  1KU2 A;  4AIH A;  1XSV A;  2Z9O A;  4RB1 A;  3V8L A;  2VE8 A;  5CVJ A;  2NNY A;  1XDS A;  1HBX G;  3WTV C;  3GFL A;  3E3V A;  1KQ0 A;  5ICF A;  1CF7 B;  1OKR A;  2PI0 A;  1J59 A;  4YFN F;  4ZYG A;  2QWW A;  2JT1 A;  4A5M A;  4XLP F;  1C0W A;  3LST A;  3RJP A;  2D1H A;  1FY7 A;  4PGH A;  1T39 A;  4JQF A;  2FOK A;  1D3Y A;  1E2X A;  2MLG A;  3HHH A;  3QRF F;  3ZMU A;  1JGS A;  4RGR A;  4LGW A;  4BHC A;  1KQ9 A;  2B0L A;  2HZT A;  4BHP A;  3U1D A;  2QQ9 A;  2P6T A;  1ONV A;  3JW4 A;  3VEP A;  1H9T A;  3F22 A;  3M8E A;  1FWZ A;  4RB0 A;  4WF2 A;  1HSJ A;  2GXG A;  1FBQ A;  1U5T C;  5BPD A;  1EH7 A;  3H3U A;  1JHH A;  1QGP A;  5LEK A;  2RQP A;  4ESJ A;  2V79 A;  2A07 F;  1QO0 D;  2K4J A;  5LEJ A;  2YR2 A;  2FA5 A;  5E1W A;  2DTR A;  3KFW X;  1ZAR A;  5DYM A;  1XD7 A;  4UXN A;  4Y15 A;  3J81 Z;  4KIF A;  4OIO F;  3C18 A;  2YX7 A;  2VE9 A;  5DV5 A;  2CSO A;  4UVC A;  1SMY F;  4A6D A;  1BI0 A;  4FX4 A;  2ZXJ A;  1F9N A;  2ZKZ A;  1Y0U A;  2EB7 A;  4G9Y A;  3MQ0 A;  2H27 A;  1R7J A;  4GGG A;  2NAZ A;  4I2O A;  2RGV A;  1ZAO A;  5BPI A;  1J9I A;  2Q0O A;  3LAP A;  4LMY A;  3TDU C;  3GZ5 A;  3F6O A;  1W7P A;  1KQ8 A;  1LVA A;  2IA0 A;  1R1T A;  2W85 A;  4FX0 A;  4HAM A;  5DD4 A;  5HDK A;  2XUB A;  4AD9 A;  1TW3 A;  4HLX A;  3E5X A;  4O3M A;  3GX4 X;  5D8K B;  5H6Q A;  1BBY A;  4WXC A;  4HV5 A;  2HKX A;  3LFK A;  3LAJ A;  2ZME A;  4Z2Y A;  1IRG A;  3HTU A;  3QP5 A;  3QPT A;  1BC7 C;  4OU0 A;  1ZH5 A;  2PMH A;  4ZZD A;  2FU4 A;  2CQK A;  3ECO A;  3T8R A;  1TW2 A;  3J80 Z;  3I0T A;  3FHZ A;  2WTE A;  2WWY A;  2DBB A;  1ZGA A;  5L3B A;  4OIP F;  1BM9 A;  4G7Z F;  3BJA A;  1TNT A;  2K7L A;  2OBP A;  1MDM B;  3B73 A;  1HST A;  4XLN F;  1XGS A;  4K2E A;  1HKT A;  5E1Z B;  1P6R A;  2DU9 A;  5L3E A;  4HX4 A;  4OIR F;  4CXF A;  1FYM A;  4S05 A;  3JSP A;  4Q47 A;  3EET A;  2QVO A;  1W4M A;  3L7W A;  1XGN A;  2RVC A;  2UWM A;  2Z3Y A;  3FWE A;  2XKO A;  5D4R A;  2D1V A;  2OQG A;  3KEO A;  4M9X A;  2PMU A;  4M9Z A;  4TV7 A;  1U3E M;  1IXC A;  2ESH A;  1O3R A;  4M6Y A;  2OD5 A;  1S7A A;  1QNT A;  5DCM B;  4HDV A;  2O3F A;  3I64 A;  3T1B A;  3MCZ A;  2GQQ A;  1FX7 A;  3RI4 A;  2XAQ A;  3ZMT A;  4P9F A;  1B9N A;  3JTG A;  1LNW A;  4A0X A;  5J8F A;  1IN8 A;  4EVI A;  3ECH A;  2R7F A;  2DLL A;  2HGC A;  1S3J A;  1IN7 A;  4XBF A;  5ERI A;  4UVA A;  1MJ9 A;  3M1E A;  4L18 B;  3M7G A;  2BE5 F;  2IA1 A;  3GW2 A;  1U8R A;  3I54 A;  1WKM A;  5LGT A;  5FFX A;  4OIQ F;  3B02 A;  1BI2 A;  3WTW C;  4HF1 A;  2P6S A;  1ZHF A;  2PFB A;  2DAO A;  3FX3 A;  3H3Z A;  3RKY A;  4KMU X;  2HKO A;  2RC4 A;  2P7C B;  1XSD A;  3RYR A;  1K78 B;  3LA7 A;  2P8T A;  1TQM A;  3MZY A;  3C1D A;  1LB2 A;  2RNJ A;  3KP6 A;  2DW4 A;  2H94 A;  4A6E A;  4RGX A;  1HW2 A;  2HFH A;  2CO5 A;  4MTE A;  2W57 A;  1J7K A;  4WWC A;  3HOS A;  2O6G E;  2K4B A;  4UV8 A;  4UV9 A;  1S6L A;  1H0M A;  1YW7 A;  2W25 A;  2VBY A;  2HTJ A;  5IT3 A;  2EK5 A;  1TQP A;  4N9I A;  2ESN A;  5JHU A;  4OMY A;  5LRS A;  1F1Z A;  2XV4 S;  4D0P A;  3VOE A;  1ZG5 A;  5FLX Z;  2MA3 A;  2L3D A;  5LHG A;  1LDK B;  3S2W A;  2HYF A;  5LHH A;  3F6V A;  4ZYE A;  4U88 A;  1R1U A;  3GLX A;  4I7H A;  3WU1 B;  4LJZ F;  4UUV A;  1UHM A;  1ZLK A;  5L3F A;  4PDK A;  3K69 A;  2EFW A;  4IJA A;  3PQK A;  2VOO A;  3KLN A;  2RKH A;  4IRG A;  1ON1 A;  1RZ4 A;  1IW7 F;  4EJU A;  4L0Y B;  3DV8 A;  2PJP A;  5DUK A;  1R1V A;  2K27 A;  2FML A;  2UXX A;  4KMF A;  5D6E A;  3KE2 A;  3REO A;  1XCB A;  4ZYH A;  4KN4 X;  4KIG A;  1KU3 A;  2F5C A;  2HOE A;  2HDC A;  2L54 A;  1YIO A;  2DFI A;  1P92 A;  1AWC A;  1BOA A;  1F5T A;  3BJ6 A;  4HV6 A;  3PFI A;  4WXH A;  1B4A A;  2CYY A;  3DXJ F;  4RAZ A;  4R1H A;  4ENN A;  1IF1 A;  2DO7 A;  2FNA A;  4HBL A;  2MH2 A;  4HLY A;  2QQB A;  4R79 A;  5HVQ C;  2O03 A;  2FNP A;  5CVR A;  2ISY A;  2EFO A;  2RV8 A;  1U5T B;  5D5U B;  1J2X A;  1IAW A;  1GXP A;  4LB6 B;  1W5T A;  2ISZ A;  2A69 F;  2QLZ A;  2P5V A;  2X4H A;  4KIC A;  3RKW A;  3HRT A;  2M8E A;  3BPV A;  4PGG A;  1SD6 A;  1R22 A;  3FXR A;  1FZP B;  2XGX A;  3LA3 A;  3F8B A;  4A0Z A;  1S29 A;  1IN4 A;  1J5Y A;  4I01 A;  1U2W A;  3WTU C;  1FNN A;  5JVT A;  3KP4 A;  5AIQ A;  1VTN C;  3KP3 A;  1RUO A;  4NQW A;  1FYK A;  3BY6 A;  4M72 A;  2YU3 A;  4KA4 A;  3GVA A;  5IT9 Z;  3DKW A;  3F23 A;  3KP5 A;  1RI7 A;  3I59 B;  3BOQ A;  4S04 A;  1KA8 A;  5CVV A;  4KN7 X;  5HDG A;  3ML6 A;  1FSE A;  5TJJ A;  5E1X A;  2FF4 A;  1XGM A;  4E70 A;  2PLY A;  3WTX C;  3QOP A;  4MEX F;  2NNN A;  5CJ9 A;  2L4M A;  3MWM A;  3L9F A;  2JTV A;  2J5P A;  3HRU A;  3O6B B;  2ZBK A;  2FXA A;  5F1R A;  1LEB A;  1HW5 A;  3K2Z A;  1OR7 A;  2KIU A;  3E6C C;  5E8I A;  2J5O A;  4I02 A;  1YLF A;  4EJO A;  4L5I A;  4MTD A;  3HOT A;  1O7F A;  4M74 A;  1W7P B;  2QEN A;  4RAY A;  2MH9 A;  3RKX A;  2MLK A;  5HOO A;  1IN6 A;  4CO8 A;  4CZZ A;  1DDN A;  4EMS A;  2EFN A;  2A3S A;  4ENK A;  1B1B A;  2D2W A;  2LF8 A;  4L0Z B;  3R0J A;  4BNC A;  5D6F A;  5L3D A;  2JZY A;  1FLI A;  3WTZ A;  3FF5 A;  1Z6R A;  2ZME B;  3GF2 A;  2Z33 A;  1UFM A;  2STT A;  3K1M A;  2K02 A;  2Z5U A;  5FD6 A;  5HLG A;  2ADU A;  1HXD A;  3U2R A;  5A2Q K;  3BWG A;  1FT9 A;  3ZPL A;  3K1N A;  5L3C A;  2M30 A;  4DNC A;  2KRF A;  2CFX A;  3WTY C;  3WGI A;  1FBS A;  4CDG A;  5ILV A;  2G9W A;  3I58 A;  3BJO A;  2O0Y A;  3BPX A;  3ERE D;  1Z9C A;  4KFC A;  1ULY A;  2F2E A;  3DPL C;  3HUG A;  4KUM A;  1DP7 P;  3CUQ A;  4L9T A;  3ABU A;  1QPM A;  2MBF A;  2OAZ A;  2GA1 A;  5D5W B;  1OYW A;  3E6B A;  1RIO H;  1XMK A;  5JFR A;  2ZO4 A;  1T2K A;  3HSF A;  2EA2 A;  1P2F A;  5EEG A;  3SZP A;  4I98 B;  1ZRC A;  2VOD A;  4MGR A;  3RDI A;  4HF0 A;  3CUQ C;  3FMQ A;  2XAH A;  1CF7 A;  1SFU A;  3E6M A;  1T6S A;  2V1D A;  4OMZ A;  2HWV A;  3E5U A;  1L0O C;  4IVN A;  4ASN A;  3AAF A;  3V7R A;  2FEZ A;  4BH9 A;  1W5S A;  1X3U A;  2M45 A;  2R7D A;  4HQM A;  4AIJ A;  3L09 A;  1DUX C;  1LJ9 A;  1Z91 A;  4OOI A;  3R4K A;  5K5O A;  5LGU A;  1T98 A;  4XSZ F;  1FC3 A;  1SFE A;  4BQA A;  1Z05 A;  1P4X A;  1R23 A;  2W24 A;  3F8F A;  3TO7 A;  5CVI A;  4UVB A;  4A0Y A;  3ZN1 A;  1WQ2 A;  3IWF A;  4CYD A;  4KIB A;  3I53 A;  2EA4 A;  3K1P A;  3QP6 A;  3L00 A;  1YO5 C;  2VBW A;  5L3G A;  1JHF A;  2A5Y B;  2GAU A;  4HX8 A;  5ED4 A;  1CGP A;  4HA8 A;  4H0E A;  4JK1 X;  2LF7 A;  1FYL A;  3LA2 A;  5H20 A;  4HX7 A;  3T8T A;  2QQA A;  3F3X A;  3GYH X;  4Q5S F;  1SFX A;  1OMI A;  1J0R A;  5HDN A;  2HQR A;  4JBA A;  2BEO A;  1B6A A;  4EM0 B;  1REP C;  3FXQ A;  1PDN C;  1P4A A;  3KET A;  1T38 A;  2XIG A;  1OYI A;  2G7H A;  4Y17 A;  2IA2 A;  3EDP A;  1WRJ A;  4LFU A;  4IHT A;  3ZMV A;  2FQ3 A;  1ZGJ A;  1D8J A;  2XRN A;  3IWZ A;  3SQN A;  1FP2 A;  4G8X A;  1UCR A;  3WTS C;  4YII A;  4P96 A;  1W7P D;  3IC7 A;  1IZ1 A;  4M6X A;  2P5L C;  1XCV A;  4U0Y A;  3TDZ C;  3MZH A;  4LLL A;  4XSX F;  4G94 A;  4KYW A;  3M8F A;  2FE3 A;  4RB3 C;  5DCF A;  3TGN A;  2ELH A;  3RIR A;  4CHU A;  2XAJ A;  4M9S A;  2Y0M A;  4EM1 A;  3HTS B;  4N9H A;  3T0Y A;  3R6S A;  4HYE A;  3QU6 A;  4LG0 A;  2Q2E A;  3ZQ7 A;  2HYG D;  3P7N A;  1I5Z A;  3TKY A;  1ZRE A;  4ENJ A;  3I5U A;  1H9G A;  2MD5 A;  4EV0 A;  4RGS A;  1I6X A;  4P5O A;  1GHC A;  4UNO A;  2GIV A;  2FBH A;  2H6B A;  3MAJ A;  2AS5 F;  2P5K A;  2FRH A;  1L3L A;  1ON2 A;  1RUN A;  1TLH B;  3PQJ A;  3ZP5 A;  2D45 A;  3COA C;  4ZH4 F;  4MNU A;  1P4W A;  2JPC A;  4OIN F;  3Q9S A;  3WOD F;  5AON A;  3IL2 A;  4EJV A;  2IVM A;  3V8K A;  4G7O F;  4ESF A;  3FMR A;  2HEO A;  1YFH A;  3HSE A;  4YFK F;  1G3T A;  3U9G A;  5KVR A;  3LQQ A;  1XSX A;  5LRR A;  3HRS A;  4BYY A;  2ZNZ A;  2ZJ2 A;  4G6D A;  1YS7 A;  1SAX A;  3M9A A;  1YYV A;  2BYV E;  1K7A A;  3Q5F A;  4Q4Z F;  6PAX A;  1YG2 A;  3D5L A;  1MGT A;  3TO9 A;  1YW9 A;  3GEZ A;  5DCM A;  2ZFW A;  5D4S A;  1MKM A;  5HLH A;  1ZG3 A;  1ZG1 A;  3ZN0 A;  3I4P A;  2GXB A;  1WI9 A;  4B8X A;  3IKV A;  1R36 A;  5BQT A;  4HF2 A;  3WG9 A;  5DEQ A;  5LBQ A;  2GZW A;  4LLG F;  3DF8 A;  3E6D A;  3VOD A;  4GXO A;  5D8L B;  4EJW A;  2LNB A;  2E7X A;  3V7S A;  4A2U A;  3FXU A;  4CIC A;  3CO6 C;  5D5X B;  1NHA A;  4QLC U;  1O57 A;  5E20 A;  1J75 A;  2HQN A;  1R58 A;  3EUH A;  2VC1 A;  4LLN A;  5D5V B;  4QWQ A;  1HKQ A;  4GYI A;  5CLS A;  4U7B A;  2YPR A;  1IXR C;  2V1X A;  1UHW A;  2XAF A;  2HTS A;  3F8M A;  3ELK A;  2A6E F;  4BAY A;  4YIF A;  5HS7 A;  4O5V A;  1B9M A;  2V6C A;  3KLO A;  3VFZ A;  4GO1 A;  3D0S A;  3SXY A;  1F4K A;  3JAM K;  1WWX A;  2WV0 A;  2KIM A;  5BS6 A;  1TNS A;  2HS5 A;  4P55 A;  3HSR A;  2Z99 A;  2F5E A;  4LB5 A;  5HS9 A;  3L2C A;  2YX4 A;  2KKO A;  3KEQ A;  2BV6 A;  4NHJ A;  3IRQ A;  1PP7 U;  3FM3 A;  3GXO A;  1QQI A;  2X0L A;  5HLI A;  3MEX A;  2E7W A;  1HQC A;  1XGO A;  1JE8 A;  1JXS A;  1MD0 A;  2OZU A;  4F7Z A;  4A12 A;  2PG4 A;  1WSU A;  3CUQ B;  2IPQ X;  1Q1H A;  2E1C A;  1MJB A;  2MC3 A;  4WXD A;  3T5X A;  4HOB A;  4ON0 A;  2YSR A;  5FGM A;  5ICG A;  2LSO A;  3BDD A;  1USS A;  5HS8 A;  1FBU A;  2R3S A;  2CGP A;  2E1N A;  1QBJ A;  2KJB A;  5F6F A;  2DPD A;  3RTR A;  3WE2 A;  3JSO A;  1MZB A;  2ACJ A;  1I1G A;  1ODD A;  3ULQ B;  3ZMS A;  3HYI A;  1FP1 D;  4YFX F;  1ZN2 A;  2RN7 A;  3DQV C;  3FZV A;  2PBI A;  1KYW A;  3SZT A;  2DT5 A;  1PP8 F;  2CWE A;  2ZCW A;  2P7V B;  5E17 F;  4IRH A;  3H92 A;  1TQI A;  1S8N A;  5DD8 A;  4RS8 A;  3QU3 A;  1BIA A;  2ETH A;  1U5T A;  2JRT A;  5FD5 A;  3J80 K;  3HIF A;  3V8J A;  4DQ2 A;  3P9I A;  4U0V A;  2G7U A;  5KK1 A;  1AOY A;  4AWX B;  1BJA A;  2H09 A;  3DFG A;  4XRF A;  3OOP A;  1QZZ A;  4RGU A;  4L5J A;  2OZ6 A;  3O3K A;  2FBK A;  3W6J B;  2Q8K A;  1Z6T A;  1EV7 A;  3GZ6 A;  1O3S A;  2QM3 A;  3JAM Z;  3FMS A;  1G4D A;  4M73 A;  2EV6 A;  5AIP A;  4UHT A;  1STZ A;  1IN5 A;  4EGZ A;  2VT3 A;  3W6K B;  2QBY A;  5ICC A;  3MFK A;  4A5N A;  5LLQ A;  5DUI A;  3DEU A;  3WTT C;  4CGZ A;  2IJL A;  2CW0 F;  3I59 A;  3P9K A;  4GCV A;  3WE3 A;  3CO7 C;  2QUF A;  2XHK A;  3EYI A;  2KIF A;  1V4R A;  4PCQ A;  1TTY A;  1QZY A;  1KU9 A;  2GWR A;  2L02 A;  2O8X A;  3CUO A;  1G3W A;  2V1U A;  4AIK A;  2VBX A;  1Z1D A;  4M71 A;  5JI6 A;  3E97 A;  1U78 A;  2XRO A;  3J7A O;  3KZZ A;  2IP2 A;  2PQ8 A;  4IRI A;  4G7H F;  3E5Q A;  1I1S A;  4L9V A;  2UZK A;  4NB5 A;  1K6O A;  1U6G A;  5EEH A;  1ZRF A;  4EQQ A;  5BOX A;  3P9C A;  2TDX A;  3SHF A;  2LKP A;  4KT5 C;  1XDU A;  2EFQ A;  4LG0 B;  5JR3 A;  3N97 A;  1ZLJ A;  4MQ9 F;  2ZNY A;  2H6C A;  1YTY A;  2COM A;  5A2Q Z;  4MHG A;  5CVU A;  4ZZL A;  2IW5 A;  5LGN A;  3G73 A;  4YG2 F;  3WGH A;  3R61 A;  4IF4 A;  5FFZ A;  3IKT A;  2A6H F;  3JTH A;  2O61 A;  2VXZ A;  2FSW A;  2XAS A;  3RPQ A;  1K79 A;  5K5R A;  1OPC A;  2FMY A;  4IPA A;  5FLX K;  5E8G A;  5ILS A;  1G6N A;  1YW8 A;  2UXN A;  2M87 A;  3NEU A;  3I71 A;  1I27 A;  5FO5 A;  4B09 A;  4L9N A;  2W84 A;  4U7D A;  2GA2 A;  2AXL A;  2IT0 A;  3FM5 A;  5ICE A;  3TOB A;  3LQR A;  3HHG A;  4MEY F;  1IUY A;  3K0L A;  1O7L A;  3IRR A;  5H6R A;  2BBY A;  1SD4 A;  1O3T A;  1D5V A;  4HW0 A;  1A04 A;  5E18 F;  2A68 F;  3ISP A;  2EV5 A;  3TQN A;  1G3Y A;  5F64 A;  1BN5 A;  1XB4 A;  2Y75 A;  3GO5 A;  3WGG A;  5TRD A;  1BIB A;  5ILU A;  2XVC A;  4HDU A;  4AVP A;  3F21 A;  4FHT A;  4LK0 F;  1BC8 C;  4I0A A;  2V9V A;  4WCG A;  1KGS A;  2VOP A;  3IHU A;  3QPH A;  1BI1 A;  2FBI A;  2L01 A;  2NYX A;  3R0A A;  2VON A;  2P4W A;  3DPT A;  1FSH A;  1YQA A;  3BRO A;  3ZMD A;  2STW A;  2PN6 A;  2CG4 A;  1S7O A;  1D8K A;  1IXS B;  1GVJ A;  3OV8 A;  4I0B A;  3EQL F;  2A61 A;  1T0F A;  2OA4 A;  1YS6 A;  3NRV A;  4I09 A;  3CTA A;  1KU7 A;  2C6Y A;  3KP2 A;  1MDM A;  2F5F A;  3C7J A;  2RDP A;  4IXA A;  2JPB A;  4U0W A;  1V3F A;  2EWN A;  3QAH A;  4PZJ A;  1OYY A;  1ZYR F;  4IHS A;  2L4A A;  4O6J A;  3KP7 A;  3C3W A;  3F8N A;  3G3Z A;  4BXU A;  3ROU A;  4EM2 A;  1UB9 A;  5FB2 A;  4ENM A;  1R5G A;  3ZMZ A;  1Z7U A;  3EYY A;  2Y48 A;  5J6X A;  2QYO A;  3WU0 A;  5BMZ A;  3KZY A;  2EFP A;  1DPR A;  4P9U A;  1SD5 A;  2M1B A;  4WX9 A;  1FPQ A;  1UST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...