3GWKC

Structure of the homodimeric wxg-100 family protein from streptococcus agalactiae
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
GAMSQIKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein SAG1039
publication title WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
pubmed doi rcsb
source organism Streptococcus agalactiae serogroup v
molecule tags Viral protein
total genus 42
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3gwkC00
2AZ0A 3TXSA 2B9ZA 3TXQA 3O9OA 3FAVB 3FD9A 3HR0A 1WA8B 3ZBHA 3OGIB 4GZRB 3Q4HB 4LWSB 2VRZA 2KG7A 4ABMA 3GVMA 4I0XA 2AZ2A 3FAVA 3GWKC 2DE0X 2VS0A 1WA8A 3G80A 2KG7B 4I0XB 3Q4HA 4LWSA
chains in the Genus database with same CATH superfamily
3T2MA 3JAWB 4QGPA 2CK3G 1Z5WA 2HP8A 5H6RA 3ZHTA 1XNRB 3OR7C 1E1RG 4X89A 1AP5A 3K0GA 4MTFA 1MABG 3JARA 2XAFA 3OR6C 3N2KB 4YY3B 3ZHRA 3G80A 1OCOB 5J2TA 2GUZA 1H2SB 3RVYA 4CZZA 1MZFA 4YIOA 3RYFA 2GV9A 3ABUA 4LR3A 5KAFZ 1W0KG 2ZXWC 3OW2U 3FFQA 1VQ7V 4ZI7B 1NVPD 1X59A 2XNDG 3RT3C 4LH7A 5JJJB 4FM2A 1W59A 1JA8A 5BY1A 2EINB 4X64B 2PI4A 4I55B 1WB7A 4JTAB 1G6UA 2OCCC 2EIMB 4PDLA 3QG5A 3NR7A 1Q81W 1LUVA 4U7NA 2VQEO 3ZRWA 1IBMB 1G4YB 1YF2A 4XDLA 1F4MA 4P30A 1BT8A 2KQXA 2YXHA 1R3IC 4OX9B 2WLIB 3A2FA 2YICA 1XMQO 3ML0A 3T1HB 1BL8A 4X9QA 5IJ9B 4PD4F 3B8NA 5LXTB 3W7UA 1RSOA 1RM1C 5LA6A 1K7DA 4RUEA 3P32A 1IBKO 1L1FA 4G27B 3G6BA 3JAWA 2WLLB 4YJ2A 1XL6A 5L3BA 3ABMB 2NR5A 3CRRA 1B04A 1ENVA 1TUBB 2Y69B 5L3GA 1KBHA 4JI8O 3ZHSA 2QM8A 5GONA 3G67A 1VQLV 4J42A 1Q6HA 4AILC 3B2EE 2XUMA 4NTYA 4JI6B 3E8HA 5AG2A 3GWKC 1Y4MA 4TV9B 5B3SB 3F7VC 1FJGB 2Q8VA 4LFBB 1Q90D 1WA8B 2PUSA 3K58A 1CEZA 4DK1A 4EFEA 3VQYA 4XDKA 1IDSA 2CGNA 4DR7B 1QLEC 1XDCA 4UV8A 2UU9B 3AG7A 4K35A 4FLYA 1FPOA 5LMNO 5IT9N 4JYYA 3SYOA 3TK1A 2KG7B 4GKKO 4GKJB 2P5OA 2IJJA 3DTUB 3BA8A 2BSKB 4LH6A 2HR3A 2WAMA 2Q0OC 1URFA 4HBNA 2JEXA 4DV6B 5LYJA 1YHQV 2ZIOA 2WLJA 5EBWC 2QM4A 4UCSA 3CWBH 1EN6A 2QSAA 3OT7A 1OCRB 2QWNB 1QNMA 1PNKA 1EN5A 1AB3A 1I94O 2X7RB 5LHIA 3S3XA 2VWJA 4JI2B 1FD9A 1K34A 5IY5B 4I5SA 4X88A 4PELA 1IZ3A 4PDVA 2R9IA 1TUBA 3ZHVA 1AILA 5KHKA 5FPRA 4MTXA 4DR5B 4KHPB 1KB9F 4GX2A 3X2QC 4DV3B 1ZL8B 2E3CA 4DV2B 1K3EA 1HNWO 3DSQA 1KMIZ 2CTPA 4G2KA 5BR8B 4TV9A 4F4LA 3VQVA 2DN9A 3VBBA 5B1BB 1YVWA 4LFAB 2AZ0A 4TOIA 5L3CA 1FYJA 5IWAB 4D6TH 1CXZB 2XASA 3WB2A 1M4UA 1QLNA 1K73W 4LFCB 2F43G 2HKOA 3CCJV 2YI9A 4MVOA 5IDJA 2FL4A 2LGQA 4DV5O 3ABTA 2BSKA 4B3MO 5DECA 1ZTEA 4YIPA 3RYIB 1N34O 4PV1B 1H2GA 1AJNA 2F23A 4LNUB 3Q4HA 3GWOA 2WSSG 1Y67A 4ASUG 3WB1A 3C90A 5B66Z 1N36B 2LO1A 1H2NA 3CYOA 2ZE6A 4JI5B 4A5UB 2FKXA 1QR8A 4FMTA 5KMGB 3HKDB 3E8GA 3U10A 4B3SB 3E22A 4X20B 5TISZ 1Q6UA 2PF4E 2XT9A 4P9OA 2KB1A 4DR6B 4NXNO 1WNSA 1N33B 4B3RO 4LWSB 1FAFA 1K5QA 1N8RW 4LF4O 4KP4A 3K5LA 1GN4A 2QKAA 4L87A 1HP8A 3K3WA 1XEQA 3WFVA 5LHGA 5B5EZ 1M57B 2K1EA 3DGEA 2F66C 4JI4B 2YIDA 4GX5A 3JCUZ 2FYUH 1KU9A 4DUYO 1N32B 2DYRC 1DF5A 1QVGU 2UXBO 1SS3A 5DEDA 1YTFD 2BTQB 4CS4A 4I0XB 3AK3A 2P90A 3SR2C 1Q43A 1SKVA 3S3WA 3OAAG 3KKYA 2JJ1G 2EJRA 3BRCA 5E1AC 4I50B 4J9ZB 3DXRB 4HNAB 4CH4A 2UUAB 1GMGA 4LF6O 1BHBA 4WBNB 4K8XA 5LOVB 2R72A 4DK0A 2AW9A 5FLXN 5A2QN 4GYCB 2N04A 2P22C 4X1YA 4X65B 1L0NH 1OCCC 4I7ZB 3G4SV 3D8CA 4GUNA 4QPKA 2OCCB 1Y74B 4NTWA 2M7WA 1K4CC 2QEXV 1XMOO 4J7ZA 2UXXA 1VP7A 2W0FC 4X20A 2EULA 3AK1A 3ZJZA 2M6YA 4W4KA 3ICXA 1XNQB 5JWPA 3P30A 1ORQC 4JYAB 2HFEC 1BE3H 4DR1O 4DR4B 3ZBHA 1GTOA 4EKWA 4DV0O 4H33A 3OM3B 3L75H 4Z2WA 4N23A 2OCHA 1RM1B 4BR6A 1P7BA 4HYOA 4JF3A 2WLNA 4GLXA 1N0JA 3UO2A 2UXCO 1MA1A 5EBLC 2DWEC 5B1NA 2XTAA 2WA4A 3T1YB 2LJ2A 4LF8B 1BSMA 1LUWA 2Q73A 2HEPA 4U7OA 1JVMA 1ZX3A 2EILB 4LCUC 2K9PA 4TQDA 2QE7G 2EZOA 4D7SA 5CN0A 3VOUA 1JPXA 4FJCC 2B1GA 4C7UA 2D3OW 4JI7O 4DUZO 1PKXA 2DYSB 5LOVA 4FM0A 3NXSA 1VQPV 3H1JH 4U3JB 5CB4A 1XOUA 3FAVA 2ZINA 5EC2C 1Q5OA 1I08A 4FLUA 1Y76B 4FFKA 4X1KA 4UCOA 3HKBA 3AG3C 3JAKA 1YSCA 2IU3A 3TXSA 2X6BA 2YS8A 3OFNG 2RMKB 2GBOA 5KX5A 3CCQV 1H38A 4EEQA 1GN2A 3SJCC 3H1KH 1DK1A 4O4LB 1H8EG 2O57A 3SJBC 2UUBB 1NQTA 1ZUQA 4P9PA 1KP3A 4DR3O 3SYPA 1PL4A 2H8PC 2P06A 3FB7C 5KA5A 1DLBA 3SJQC 2EX3A 1SQFA 2IM9A 2Q0AA 1MMMA 3HKCA 5C93A 2V1DA 3H9VA 1K4DC 4IIJA 4JAAA 1XQ8A 2E74B 2PYLA 3HR0A 1AI6A 3I5DA 4O4IA 1SETA 3G6EV 1XUQA 3LDCA 1J5EO 5KLVH 4JGSA 3JCZA 3TETA 3K06A 3HPLC 2IJKA 2JGUA 1XMQB 1SQQH 3ZRWB 2DE0X 1JR9A 3J7AU 5CA0A 1R73A 2ZT9B 2ZCEA 5BMVA 1QHTA 3IC7A 1IBLO 1MG1A 3CMAV 3MHHC 1IBKB 1HNZO 3X2QB 4PA4A 1NH2D 4TSFG 2OTJV 2ZM6O 4KL1A 1R6TA 1V55B 3STLC 3K04A 2A06H 1RSOB 4NKGB 4QPJA 1Y66A 2QGNA 3RGBA 1FXHA 4YJ2B 1TGOA 1OV9A 1YI2V 3LNMB 5LMUO 2D2CB 4UVAA 1IXBA 3CX5F 1Q7YW 2ZNIA 5A9GA 3GVMA 1Y76A 3BA9A 3OUFA 3CCLV 2AXTZ 3JD0A 4UV9A 3ZRSA 5HFLA 5GONB 3KCYA 1HW7A 1E79G 2ZE7A 1K97A 4IT5A 1VQ8V 5EK0A 5EBMC 4JAUA 4QNHB 1ZLZA 4O4LA 4QE9A 3IJ4A 5LMNB 1ZSPA 4R7CA 3RN4A 2BE3A 2CE4A 2JJ2G 4J41A 4ZBMA 3ZMSA 2E75B 1GM7A 1NS1A 3ETQA 2UUCO 2F4VB 1JMKC 2Z0AA 1XHZA 2P67A 1AVMA 4NR1A 3KCXA 5LHHA 4GT1A 3CCRV 3O9OA 5CBGA 3CD6V 1S5JA 3ETGA 5CBFA 2CAZC 3E86A 3OMIB 2JS3A 5IJ0B 2QKSA 5EIBD 1M9NA 2XHBA 4UVCA 1DGSA 4PI0A 3UCSC 1S5LZ 4JI1O 5LL6Y 1DF4A 4I9WA 1WPBA 4QIWF 5LYJB 1AR5A 3JASB 3SYAA 3JD1A 4LBEC 5H6QA 4DR2B 2CTQA 2YUAA 2ZKOA 5C8YA 1Z5VA 2Y48A 2ETNA 5EC1C 3SGIA 5ITZB 4WFGA 4MT8A 4FLXA 1O9GA 1NVPB 1BQ0A 4RAIA 3F7YC 4YHHB 2CDYA 1NR1A 1FFTB 3SPIA 5L3FA 3ZMVA 4MS2A 2DYRB 2IJHA 1NTKH 3PN1A 2ZR2A 4KXRA 4J80A 4MVQA 1UJWB 2XAQA 4IYHA 4WFBV 4PA9A 2QDOA 2QKCA 3CE2A 4DV7O 3B4SA 4JV5O 5BZBA 1FXVA 3L71H 1RPOA 2ZD9A 2ZDIA 2LP7A 1M56C 1S77D 5KHHA 1AR1B 3KZIZ 1B3QA 4BAYA 1YJWV 1OCZC 3R65A 1FFXA 2UXNA 5KHJA 3RYHA 3EHBB 2Y0PA 5BXZA 3ZMZA 4LC1A 3K08A 4DV5B 4B3MB 2C2AA 4I4TB 2RN9A 2UXDB 3LDDA 1M1KW 3K79A 3G71V 4OPAA 1XREA 4CBCA 4IL6Z 3SYQA 2W6JG 2DWDC 5GTHZ 2A7WA 2HLDG 5IJ0A 4MSWC 4GX0A 3L9DA 4CS2A 1OHHG 3Q4HB 3JASA 1AROP 2IBZH 1YCIA 2Q4PA 1I7FA 3CP1A 4DW0A 1AI7A 4FLWA 3AG2C 5ITZA 1HDJA 1ZAUA 2V7QG 2ZIMA 3BFRA 3M8AA 4X64O 4B3RB 1NTMH 1TA8A 3E22B 4LF4B 1LR1A 4LF7O 2JGDA 2X6CA 5H5NA 1VF7A 4J10A 2QA4V 1U97A 3CRQA 5EYPA 4LP8A 3OTOB 1IBMO 2EIJB 1TUEB 2BOCC 2OYQA 5LP6A 4AQYB 5LGNA 1SQXH 2IW5A 2YC0A 4TWKA 4PJ0Z 4J9YB 4J11A 5K1XA 2AGAA 4OX9O 5B1OA 3PJSK 2UXBB 3CCVV 3ZS8C 4X62O 4LF5O 4FLZA 5KUMA 4B7KA 2PI5A 2QM7A 3ZRXA 1PV0A 2P4KA 2LFSA 3EVKA 3E2EA 1R6KA 4I4TA 3AG4B 1G1XB 1UFIA 4LF6B 3IAYA 4WFEA 3MD0A 4TV8A 3JATA 1X4TA 4Z1VA 4UVBA 4JI0O 4UFZA 3MAQA 1XMOB 2F1MA 2ZDIC 2ATKC 3K59A 4K8ZA 3ASOB 2G38A 1MOFA 2CTWA 3FD9A 5J9PC 1FJGO 1M93A 1SQVH 4X1YB 5HFMA 4DV1B 1GK9A 3LDEA 3BHPA 1KQSU 4DR1B 1DTOA 1SF9A 1GM8A 2YXLA 4B3TB 3ZIAG 2UU9O 2IU0A 2HHHO 3STZC 1F23A 5JQGA 3JD2A 3JSLA 2Q7GA 3EXAA 4GKJO 1TAEA 4JTDB 4Z1MG 1VF5B 1S76D 3CCUV 1VQKV 2MW2B 3OTFA 4PHZA 2KKWA 3MHSC 1YZBA 1EBOA 1CP9A 1I0HA 2LW7A 1QVFU 1XILA 1JJ2U 4E4EA 3IFXA 3AG1C 4X1IB 4JI2O 2ZE5A 1MSDA 1YDXA 1B06A 4CH3A 1LNQA 3CCEV 1HNXB 1P84F 2JIZG 4JI7B 1JFFA 3J80N 4MTOA 2VQFB 4UXNA 3CMEV 3OMAB 5LP6C 1Q86W 1US6A 2PY5A 5EIBC 1WJZA 3N2GA 1TVKB 1Y6XA 4DRXA 4DV3O 2MK3A 2ITDC 3RW0A 1JJOA 3ABMC 2ZXWB 1BHAA 5BR8O 2A3QA 2VS0A 3QVNA 1V54C 3ETEA 5CB4B 4DV4O 3JAMN 1R3JC 2IH1C 2P4VA 5EZYA 1KYOF 5L3EA 3FAVB 4MVSA 3BPZA 2GTSA 3VQWA 4WFAV 4W4LA 4X1KB 4JI3B 2JK5C 3HKBB 3JAKB 1YXBA 4BW5A 3GB7C 4LFCO 1H2LA 3K9SA 5KX5B 2R70A 4FK5C 3E83A 1RP3B 3UKMA 1YTFB 4R8CA 3CPWU 3RVZA 1K8AW 1J5EB 1AI4A 4UCVA 5JVDB 1OZ0A 4MW8A 1G8MA 2WA3A 2ZR3A 2EBOA 3HKCB 2L6LA 4IIJB 1Z2GA 2QWRB 3SPGA 1AJQA 4O4IB 1NKDA 2ZQMA 3P3NA 1HNZB 1KUQA 1VQ5V 4HZ3A 1HR0B 1VQMV 4B3SO 1P7GA 4X1IA 1XHXA 1SESA 1KP2A 3O65A 2ZM6B 5CA0B 3IGAC 3QF7A 5BMVB 3H01A 5D5QA 4DR6O 5F2VO 4RUFA 4H13B 2IH3C 3K5MA 2Q68A 4U3FH 3WB0A 1N33O 1Q6IA 1M5IA 5IYBO 4FM1A 3IC9A 3P3PA 3E35A 4JPRA 3BAAA 1TVKA 1YJNV 1V9PA 1OCZB 5IY5C 5IYZA 4IYIA 2L35A 2BTOA 3ABLC 2PTMA 4B7EA 2WLKA 2DJVA 2LQTA 4P2ZA 2QJ1A 2Q6AA 3I55V 3CRMA 4JI4O 1BZKA 1QLEB 4MTGA 3EFFK 4CH6A 3K9AA 4BIZA 1QU7A 3TXQA 2LW1A 3BCCH 5KAIZ 4AHCA 2A9HA 2WLMA 1GN3A 4BWAA 4GZRB 3WG7C 1K92A 3CC7V 1UPGA 1AR4A 2UUCB 3K5NA 3HKEB 2H3OA 4LF9O 4PA7A 2DQ3A 4PA6A 3CRCA 1EZJA 4RWUA 4H44B 2HJFC 2RDCA 2OTLV 3C3TA 2E76B 2RCVA 5JVDA 3AG2B 2KSDA 2VQEB 1EFRG 2YEVB 1ROPA 2Q7HA 2FMLA 4G28B 1PP9H 3CB2A 4L8JA 1VIBA 3UT5B 1J95A 1SQGA 1BMFG 2OT5A 2Y4UA 1D2DA 2V4DA 2NLJC 5KA6A 4NXMO 2Y0IA 2EZPA 3SJAC 2ODMA 1XNQO 2Q67A 4CS3A 2OWOA 3FYIB 5JJEB 1QCEA 5FL7G 3FKSG 4WF9V 1BS3A 1L0LH 2P7TC 4RO2A 5CBHA 4YJ3B 2VWKA 3ZCCA 3U0ZA 5C8YB 5CA1A 2HVJC 4DR4O 1N0NA 1PL0A 4O4HA 1OJHA 1COWG 3BY6A 3W7WA 3JYCA 5LBQA 5J2UA 4JI8B 1BCCH 1VQOV 1W0JG 1EN4A 4RQFA 3E8FA 3ZHQA 4DV7B 1YIJV 2EIKC 4JV5B 1SC5B 3A0HZ 1E1QG 2H94A 2GSMB 2HVKC 3QO8A 1M57C 3THOA 3CS5A 3H1IH 1YITV 1BGYH 4GCZA 3HKEA 2JEUA 5CA3A 3BABA 2Z5UA 3C3SA 4ZIBA 5IYCO 4MVUA 5IE9A 1NH2B 1FFXB 3OUSA 4O4JB 1GRJA 3FB8C 4UB6Z 4ABMA 3RYHB 2W6IG 4GKKB 3L73H 1H8HG 2YEVA 1WPXA 2LFRA 1FXKC 4NYKA 3UT5A 5H9CA 1VF6C 2Q9LA 4TQFA 1KKCA 3RYCA 3J81N 3E89A 4RQEA 4D7TA 1GO3F 1NT2B 4X66O 1T5EA 4PDMA 1SA0B 3MDSA 2N05A 4UB8Z 2CH7B 1I94B 1R3KC 2UUBO 2P6JA 3LNNA 3ZX6A 4LF7B 3DC6A 4YJ3A 3ASNC 4FLVA 5JH7A 3T4DA 4ZOLB 3AEIA 3JD3A 1VQ4V 1SQBH 4K0KO 1SRYA 3AG1B 5LGTA 2N74A 5GW7A 4EFBA 4O2BA 3SYCA 1JQ0A 2JGDB 3QNEA 2AHYA 4DW1A 1HNWB 5EYPB 3TGUH 2Q7EA 4X62B 4LF5B 1K9MW 2ZNJA 5CMUA 3ZMUA 1GN6A 5LP6B 3OD4A 1H2KA 4KUMA 2E5LO 5JCOC 1KKDA 1GH6A 4HAMA 4NVPA 1V54B 3JD4A 4O4JA 4PDRA 4BIOA 1NTZH 3N2KA 5KUKA 4FZ0A 1S72V 1OCCB 2NNUA 4JI0B 2AHZA 1VMGA 3F5TA 1N34B 2EILC 3K0DA 2QWPB 3D36C 1XNRO 1XBLA 3SPHA 4JYCA 3ABKC 1EM1A 2JVDA 1Q8IA 4YY3O 3CXCU 1S0VA 4TV8B 2DYSC 3JATB 1FS0G 4ZI7A 4JZ2A 2ADPA 4JYBA 3T4ZA 1SA0A 1PPJH 4MVZA 2CH7A 1THZA 1WN7A 4I55A 5K1PA 1VQNV 2BOBC 1U96A 2HJDA 2HHHB 2DOSA 1PM9A 1B6QA 1SQPH 3AK2A 3CRAA 4NXNB 3W7XA 4FIPC 4ZOLA 1NU1H 1K33A 2F4VO 4X8AA 1W2BU 4DXWA 2PYJA 2WLIA 1L8DA 1D5NA 5JQGB 4R50A 3CEIA 4GX1A 2CTRA 5B1AC 5IJ9A 2F93B 1F4NA 2XAGA 5LXTA 2IJIA 3SDLA 4O2AB 2QR4A 5FNVB 3E8BA 1S5HC 4FFBB 3RWRD 1AJPA 1WP7A 3OGCC 2YSUB 4DR2O 2BCCH 2CUGA 3CSXA 2PZSA 2ZE8A 2WLLA 4DUYB 3TJTA 1S3JA 2ADQB 2VRZA 3T1HO 2CGOA 3ABLB 4CH5A 4UCRA 4N21A 4YHHO 3N27A 3L72H 1N4CA 4MVRA 1KC8W 2XOKG 4CC5A 3AG3B 1JFFB 4UUJC 3B77A 1GM9A 1V55C 3W7SA 2Q69A 4OGQB 5DM6V 3WG7B 1MNGA 1NZ6A 4DV4B 3A0RA 5D5PA 2LGWA 3M7MX 3OEEG 2X0LA 3N2GB 1WA8A 1VEWA 4NTXA 4DRXB 2ARHA 3LSUA 1ZWIC 2YIBD 4JAVA 4R6ZA 4JI6O 2W0XA 4JZGA 2GDSA 4PA3A 1WLEA 5LGUA 3RFRA 1XI1A 4ZHQB 3L70H 1I5XA 4B08A 1YEWA 4LFBO 3FB5C 3JSNA 2KG7A 5EZYB 4Q6GA 3VQXA 3FX7A 3QTCA 1OCOC 3K5OA 2QTOA 4WCEV 2UXDO 4DR7O 1R6NA 2WLHA 3F5WC 4DV0B 1QQCA 1BQZA 1M90W 2GHYA 3OMNB 4ICGA 2ILMA 1YJ9V 3A0BZ 3ZN0A 2OIEA 4I9QA 2EINC 2NN4A 4O2AA 2UXCB 4DV6O 1SZTA 5FNVA 2EIMC 1NI8A 4FFBA 1F7YA 3JALB 3T1CA 3K03A 3ZRVA 1NR7A 3B40A 1JX9A 4XDJA 2XAHA 1VQ9V 3HB3B 1IVSA 3OEHG 2EIKB 1QR9A 1D5AA 1A32A 3BVOA 2Z3YA 4KFMA 1ZL8A 4QJFB 1IXMA 3ZMTA 4DUZB 3OTOO 2HG5C 4AI8A 5E79Z 1JCHA 3CCMV 4BIUA 4DR5O 4AQYO 1GKFA 3B8MA 4KHPO 2YXYA 1NJIW 3CJHB 3QO5A 1VQ6V 1AI5A 4DV2O 1F51A 4OXSA 5DN6G 5IYZB 3D3QA 3UQ8A 2Y69C 4FLTA 2EJ7A 2QTSA 4ZHQA 2B1IA 4CC6A 1RFYA 2DQ0A 4LF9B 4OPHA 1FXKB 4LFAO 4EB6B 1WAZA 1WB8A 4DR3B 1PD3A 3A8TA 3RYIA 1P49A 2FTKA 4LNUA 5IWAO 5B3SC 4WFHA 1KECA 1EZVH 4H37A 1PNMA 4MVMA 2YIAA 3SPJA 4Q20A 3W7TA 1MSWD 2JS5A 4J7KA 5KMGA 2RNBA 3HKDA 3ASNB 3UO3A 5IYDO 2R9RB 3RBZA 2R9AA 4NXMB 1FKAO 2YIBA 3CC2V 2JDIG 3JALA 4E2LA 3UM7A 3CXHF 1N36O 1IBLB 4DV1O 4JI5O 3APQA 4JASA 1P4RA 3CHXA 4TT3G 2A0LA 3APOA 4LWSA 4F6EA 4B3TO 5GTIZ 1IURA 1Q3EA 3ZEDA 1RPRA 4ZKIA 3DC5A 3I56V 1OCRC 3FYEB 5JJNB 1O9HA 2PGGA 1MZEA 1Q82W 3L74H 5CA1B 2F95B 2QWQB 1M56B 5LMUB 4O4HB 1NBMG 3CJHA 5FPOA 3WU2Z 2B5UA 3BEHA 3R66A 5J2UB 4PI2A 1H2MA 2BTQA 4I0XA 4J7JA 4UCUA 2EIJC 4F6RB 2Y4TA 3TCUA 3LUTB 1FXKA 4I50A 1CPYA 2RQ6A 4EB6A 1VF6A 3K57A 4IHJB 3DXRA 4HNAA 1HNXO 3M99B 1N32O 3ABKB 4TUYB 3H1HH 2GTAA 4QE7A 4WBNA 3KG2A 2WPDG 4IGGA 2VQFO 5H2FZ 2DMXA 2YDEA 2FB5A 1SZXA 1JOYA 1HWYA 5B1BC 4MW3A 3H1LH 1PNLA 1Y74A 3ZN1A 3CCSV 2ITCC 1R3LC 2UUAO 1SERA 3JARB 3AG4C 4X66B 2JRIA 4NB5A 3QO7A 4WFFA 5J2TB 4FZ1A 4JI1B 1R1BA 2GUZB 4X65O 3B09A 3RYFB 3RYCB 1I5YA 3CC4V 3SPCA 5KHGA 5L3DA 4JI3O 3ASOC 1AP6A 1IX9A 1VARA 5B1AB 4K0KB 3LSQA 4DO2A 2OIGA 3FB6C 2Q5ZA 4DYLA 1XL4A 2YI8A 3OGIB 3OE7G 4FVMA 4JYAO 4H0LB 4K3AA 2WWWA 1KD1W 3D3IA 2AZ2A 4JTCB 3ZHUA 5JH7B 1QBZA 5JCOA 4XBFA 3U11A 4BW9A 4UCTA 5KHIA 2B9ZA 4O2BB 2DW4A 4F6RA 1HR0O 3D36A 2E5LB 3LSSA 3ETDA 4IHJA 1K5SA 4TUYA 4FPPA 3T1YO 4LF8O 1WP8A 4YXWG 2XAJA 5LA6B 2A79B 2RJZA 2QWOB 1GAXA 2X6AA 4U3JA
chains in the Genus database with same CATH topology
2AZ0A 3TXSA 2B9ZA 3TXQA 3O9OA 3FAVB 3FD9A 3HR0A 1WA8B 3ZBHA 3OGIB 4GZRB 3Q4HB 4LWSB 2VRZA 2KG7A 4ABMA 3GVMA 4I0XA 2AZ2A 3FAVA 3GWKC 2DE0X 2VS0A 1WA8A 3G80A 2KG7B 4I0XB 3Q4HA 4LWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ0 A;  3TXS A;  2B9Z A;  3TXQ A;  3O9O A;  3FAV B;  3FD9 A;  3HR0 A;  1WA8 B;  3ZBH A;  3OGI B;  4GZR B;  3Q4H B;  4LWS B;  2VRZ A;  2KG7 A;  4ABM A;  3GVM A;  4I0X A;  2AZ2 A;  3FAV A;  3GWK C;  2DE0 X;  2VS0 A;  1WA8 A;  3G80 A;  2KG7 B;  4I0X B;  3Q4H A;  4LWS A; 
#chains in the Genus database with same CATH topology
 3T2M A;  3JAW B;  4QGP A;  2CK3 G;  1Z5W A;  2HP8 A;  5H6R A;  3ZHT A;  1XNR B;  3OR7 C;  1E1R G;  4X89 A;  1AP5 A;  3K0G A;  4MTF A;  1MAB G;  3JAR A;  2XAF A;  3OR6 C;  3N2K B;  4YY3 B;  3ZHR A;  3G80 A;  1OCO B;  5J2T A;  2GUZ A;  1H2S B;  3RVY A;  4CZZ A;  1MZF A;  4YIO A;  3RYF A;  2GV9 A;  3ABU A;  4LR3 A;  5KAF Z;  1W0K G;  2ZXW C;  3OW2 U;  3FFQ A;  1VQ7 V;  4ZI7 B;  1NVP D;  1X59 A;  2XND G;  3RT3 C;  4LH7 A;  5JJJ B;  4FM2 A;  1W59 A;  1JA8 A;  5BY1 A;  2EIN B;  4X64 B;  2PI4 A;  4I55 B;  1WB7 A;  4JTA B;  1G6U A;  2OCC C;  2EIM B;  4PDL A;  3QG5 A;  3NR7 A;  1Q81 W;  1LUV A;  4U7N A;  2VQE O;  3ZRW A;  1IBM B;  1G4Y B;  1YF2 A;  4XDL A;  1F4M A;  4P30 A;  1BT8 A;  2KQX A;  2YXH A;  1R3I C;  4OX9 B;  2WLI B;  3A2F A;  2YIC A;  1XMQ O;  3ML0 A;  3T1H B;  1BL8 A;  4X9Q A;  5IJ9 B;  4PD4 F;  3B8N A;  5LXT B;  3W7U A;  1RSO A;  1RM1 C;  5LA6 A;  1K7D A;  4RUE A;  3P32 A;  1IBK O;  1L1F A;  4G27 B;  3G6B A;  3JAW A;  2WLL B;  4YJ2 A;  1XL6 A;  5L3B A;  3ABM B;  2NR5 A;  3CRR A;  1B04 A;  1ENV A;  1TUB B;  2Y69 B;  5L3G A;  1KBH A;  4JI8 O;  3ZHS A;  2QM8 A;  5GON A;  3G67 A;  1VQL V;  4J42 A;  1Q6H A;  4AIL C;  3B2E E;  2XUM A;  4NTY A;  4JI6 B;  3E8H A;  5AG2 A;  3GWK C;  1Y4M A;  4TV9 B;  5B3S B;  3F7V C;  1FJG B;  2Q8V A;  4LFB B;  1Q90 D;  1WA8 B;  2PUS A;  3K58 A;  1CEZ A;  4DK1 A;  4EFE A;  3VQY A;  4XDK A;  1IDS A;  2CGN A;  4DR7 B;  1QLE C;  1XDC A;  4UV8 A;  2UU9 B;  3AG7 A;  4K35 A;  4FLY A;  1FPO A;  5LMN O;  5IT9 N;  4JYY A;  3SYO A;  3TK1 A;  2KG7 B;  4GKK O;  4GKJ B;  2P5O A;  2IJJ A;  3DTU B;  3BA8 A;  2BSK B;  4LH6 A;  2HR3 A;  2WAM A;  2Q0O C;  1URF A;  4HBN A;  2JEX A;  4DV6 B;  5LYJ A;  1YHQ V;  2ZIO A;  2WLJ A;  5EBW C;  2QM4 A;  4UCS A;  3CWB H;  1EN6 A;  2QSA A;  3OT7 A;  1OCR B;  2QWN B;  1QNM A;  1PNK A;  1EN5 A;  1AB3 A;  1I94 O;  2X7R B;  5LHI A;  3S3X A;  2VWJ A;  4JI2 B;  1FD9 A;  1K34 A;  5IY5 B;  4I5S A;  4X88 A;  4PEL A;  1IZ3 A;  4PDV A;  2R9I A;  1TUB A;  3ZHV A;  1AIL A;  5KHK A;  5FPR A;  4MTX A;  4DR5 B;  4KHP B;  1KB9 F;  4GX2 A;  3X2Q C;  4DV3 B;  1ZL8 B;  2E3C A;  4DV2 B;  1K3E A;  1HNW O;  3DSQ A;  1KMI Z;  2CTP A;  4G2K A;  5BR8 B;  4TV9 A;  4F4L A;  3VQV A;  2DN9 A;  3VBB A;  5B1B B;  1YVW A;  4LFA B;  2AZ0 A;  4TOI A;  5L3C A;  1FYJ A;  5IWA B;  4D6T H;  1CXZ B;  2XAS A;  3WB2 A;  1M4U A;  1QLN A;  1K73 W;  4LFC B;  2F43 G;  2HKO A;  3CCJ V;  2YI9 A;  4MVO A;  5IDJ A;  2FL4 A;  2LGQ A;  4DV5 O;  3ABT A;  2BSK A;  4B3M O;  5DEC A;  1ZTE A;  4YIP A;  3RYI B;  1N34 O;  4PV1 B;  1H2G A;  1AJN A;  2F23 A;  4LNU B;  3Q4H A;  3GWO A;  2WSS G;  1Y67 A;  4ASU G;  3WB1 A;  3C90 A;  5B66 Z;  1N36 B;  2LO1 A;  1H2N A;  3CYO A;  2ZE6 A;  4JI5 B;  4A5U B;  2FKX A;  1QR8 A;  4FMT A;  5KMG B;  3HKD B;  3E8G A;  3U10 A;  4B3S B;  3E22 A;  4X20 B;  5TIS Z;  1Q6U A;  2PF4 E;  2XT9 A;  4P9O A;  2KB1 A;  4DR6 B;  4NXN O;  1WNS A;  1N33 B;  4B3R O;  4LWS B;  1FAF A;  1K5Q A;  1N8R W;  4LF4 O;  4KP4 A;  3K5L A;  1GN4 A;  2QKA A;  4L87 A;  1HP8 A;  3K3W A;  1XEQ A;  3WFV A;  5LHG A;  5B5E Z;  1M57 B;  2K1E A;  3DGE A;  2F66 C;  4JI4 B;  2YID A;  4GX5 A;  3JCU Z;  2FYU H;  1KU9 A;  4DUY O;  1N32 B;  2DYR C;  1DF5 A;  1QVG U;  2UXB O;  1SS3 A;  5DED A;  1YTF D;  2BTQ B;  4CS4 A;  4I0X B;  3AK3 A;  2P90 A;  3SR2 C;  1Q43 A;  1SKV A;  3S3W A;  3OAA G;  3KKY A;  2JJ1 G;  2EJR A;  3BRC A;  5E1A C;  4I50 B;  4J9Z B;  3DXR B;  4HNA B;  4CH4 A;  2UUA B;  1GMG A;  4LF6 O;  1BHB A;  4WBN B;  4K8X A;  5LOV B;  2R72 A;  4DK0 A;  2AW9 A;  5FLX N;  5A2Q N;  4GYC B;  2N04 A;  2P22 C;  4X1Y A;  4X65 B;  1L0N H;  1OCC C;  4I7Z B;  3G4S V;  3D8C A;  4GUN A;  4QPK A;  2OCC B;  1Y74 B;  4NTW A;  2M7W A;  1K4C C;  2QEX V;  1XMO O;  4J7Z A;  2UXX A;  1VP7 A;  2W0F C;  4X20 A;  2EUL A;  3AK1 A;  3ZJZ A;  2M6Y A;  4W4K A;  3ICX A;  1XNQ B;  5JWP A;  3P30 A;  1ORQ C;  4JYA B;  2HFE C;  1BE3 H;  4DR1 O;  4DR4 B;  3ZBH A;  1GTO A;  4EKW A;  4DV0 O;  4H33 A;  3OM3 B;  3L75 H;  4Z2W A;  4N23 A;  2OCH A;  1RM1 B;  4BR6 A;  1P7B A;  4HYO A;  4JF3 A;  2WLN A;  4GLX A;  1N0J A;  3UO2 A;  2UXC O;  1MA1 A;  5EBL C;  2DWE C;  5B1N A;  2XTA A;  2WA4 A;  3T1Y B;  2LJ2 A;  4LF8 B;  1BSM A;  1LUW A;  2Q73 A;  2HEP A;  4U7O A;  1JVM A;  1ZX3 A;  2EIL B;  4LCU C;  2K9P A;  4TQD A;  2QE7 G;  2EZO A;  4D7S A;  5CN0 A;  3VOU A;  1JPX A;  4FJC C;  2B1G A;  4C7U A;  2D3O W;  4JI7 O;  4DUZ O;  1PKX A;  2DYS B;  5LOV A;  4FM0 A;  3NXS A;  1VQP V;  3H1J H;  4U3J B;  5CB4 A;  1XOU A;  3FAV A;  2ZIN A;  5EC2 C;  1Q5O A;  1I08 A;  4FLU A;  1Y76 B;  4FFK A;  4X1K A;  4UCO A;  3HKB A;  3AG3 C;  3JAK A;  1YSC A;  2IU3 A;  3TXS A;  2X6B A;  2YS8 A;  3OFN G;  2RMK B;  2GBO A;  5KX5 A;  3CCQ V;  1H38 A;  4EEQ A;  1GN2 A;  3SJC C;  3H1K H;  1DK1 A;  4O4L B;  1H8E G;  2O57 A;  3SJB C;  2UUB B;  1NQT A;  1ZUQ A;  4P9P A;  1KP3 A;  4DR3 O;  3SYP A;  1PL4 A;  2H8P C;  2P06 A;  3FB7 C;  5KA5 A;  1DLB A;  3SJQ C;  2EX3 A;  1SQF A;  2IM9 A;  2Q0A A;  1MMM A;  3HKC A;  5C93 A;  2V1D A;  3H9V A;  1K4D C;  4IIJ A;  4JAA A;  1XQ8 A;  2E74 B;  2PYL A;  3HR0 A;  1AI6 A;  3I5D A;  4O4I A;  1SET A;  3G6E V;  1XUQ A;  3LDC A;  1J5E O;  5KLV H;  4JGS A;  3JCZ A;  3TET A;  3K06 A;  3HPL C;  2IJK A;  2JGU A;  1XMQ B;  1SQQ H;  3ZRW B;  2DE0 X;  1JR9 A;  3J7A U;  5CA0 A;  1R73 A;  2ZT9 B;  2ZCE A;  5BMV A;  1QHT A;  3IC7 A;  1IBL O;  1MG1 A;  3CMA V;  3MHH C;  1IBK B;  1HNZ O;  3X2Q B;  4PA4 A;  1NH2 D;  4TSF G;  2OTJ V;  2ZM6 O;  4KL1 A;  1R6T A;  1V55 B;  3STL C;  3K04 A;  2A06 H;  1RSO B;  4NKG B;  4QPJ A;  1Y66 A;  2QGN A;  3RGB A;  1FXH A;  4YJ2 B;  1TGO A;  1OV9 A;  1YI2 V;  3LNM B;  5LMU O;  2D2C B;  4UVA A;  1IXB A;  3CX5 F;  1Q7Y W;  2ZNI A;  5A9G A;  3GVM A;  1Y76 A;  3BA9 A;  3OUF A;  3CCL V;  2AXT Z;  3JD0 A;  4UV9 A;  3ZRS A;  5HFL A;  5GON B;  3KCY A;  1HW7 A;  1E79 G;  2ZE7 A;  1K97 A;  4IT5 A;  1VQ8 V;  5EK0 A;  5EBM C;  4JAU A;  4QNH B;  1ZLZ A;  4O4L A;  4QE9 A;  3IJ4 A;  5LMN B;  1ZSP A;  4R7C A;  3RN4 A;  2BE3 A;  2CE4 A;  2JJ2 G;  4J41 A;  4ZBM A;  3ZMS A;  2E75 B;  1GM7 A;  1NS1 A;  3ETQ A;  2UUC O;  2F4V B;  1JMK C;  2Z0A A;  1XHZ A;  2P67 A;  1AVM A;  4NR1 A;  3KCX A;  5LHH A;  4GT1 A;  3CCR V;  3O9O A;  5CBG A;  3CD6 V;  1S5J A;  3ETG A;  5CBF A;  2CAZ C;  3E86 A;  3OMI B;  2JS3 A;  5IJ0 B;  2QKS A;  5EIB D;  1M9N A;  2XHB A;  4UVC A;  1DGS A;  4PI0 A;  3UCS C;  1S5L Z;  4JI1 O;  5LL6 Y;  1DF4 A;  4I9W A;  1WPB A;  4QIW F;  5LYJ B;  1AR5 A;  3JAS B;  3SYA A;  3JD1 A;  4LBE C;  5H6Q A;  4DR2 B;  2CTQ A;  2YUA A;  2ZKO A;  5C8Y A;  1Z5V A;  2Y48 A;  2ETN A;  5EC1 C;  3SGI A;  5ITZ B;  4WFG A;  4MT8 A;  4FLX A;  1O9G A;  1NVP B;  1BQ0 A;  4RAI A;  3F7Y C;  4YHH B;  2CDY A;  1NR1 A;  1FFT B;  3SPI A;  5L3F A;  3ZMV A;  4MS2 A;  2DYR B;  2IJH A;  1NTK H;  3PN1 A;  2ZR2 A;  4KXR A;  4J80 A;  4MVQ A;  1UJW B;  2XAQ A;  4IYH A;  4WFB V;  4PA9 A;  2QDO A;  2QKC A;  3CE2 A;  4DV7 O;  3B4S A;  4JV5 O;  5BZB A;  1FXV A;  3L71 H;  1RPO A;  2ZD9 A;  2ZDI A;  2LP7 A;  1M56 C;  1S77 D;  5KHH A;  1AR1 B;  3KZI Z;  1B3Q A;  4BAY A;  1YJW V;  1OCZ C;  3R65 A;  1FFX A;  2UXN A;  5KHJ A;  3RYH A;  3EHB B;  2Y0P A;  5BXZ A;  3ZMZ A;  4LC1 A;  3K08 A;  4DV5 B;  4B3M B;  2C2A A;  4I4T B;  2RN9 A;  2UXD B;  3LDD A;  1M1K W;  3K79 A;  3G71 V;  4OPA A;  1XRE A;  4CBC A;  4IL6 Z;  3SYQ A;  2W6J G;  2DWD C;  5GTH Z;  2A7W A;  2HLD G;  5IJ0 A;  4MSW C;  4GX0 A;  3L9D A;  4CS2 A;  1OHH G;  3Q4H B;  3JAS A;  1ARO P;  2IBZ H;  1YCI A;  2Q4P A;  1I7F A;  3CP1 A;  4DW0 A;  1AI7 A;  4FLW A;  3AG2 C;  5ITZ A;  1HDJ A;  1ZAU A;  2V7Q G;  2ZIM A;  3BFR A;  3M8A A;  4X64 O;  4B3R B;  1NTM H;  1TA8 A;  3E22 B;  4LF4 B;  1LR1 A;  4LF7 O;  2JGD A;  2X6C A;  5H5N A;  1VF7 A;  4J10 A;  2QA4 V;  1U97 A;  3CRQ A;  5EYP A;  4LP8 A;  3OTO B;  1IBM O;  2EIJ B;  1TUE B;  2BOC C;  2OYQ A;  5LP6 A;  4AQY B;  5LGN A;  1SQX H;  2IW5 A;  2YC0 A;  4TWK A;  4PJ0 Z;  4J9Y B;  4J11 A;  5K1X A;  2AGA A;  4OX9 O;  5B1O A;  3PJS K;  2UXB B;  3CCV V;  3ZS8 C;  4X62 O;  4LF5 O;  4FLZ A;  5KUM A;  4B7K A;  2PI5 A;  2QM7 A;  3ZRX A;  1PV0 A;  2P4K A;  2LFS A;  3EVK A;  3E2E A;  1R6K A;  4I4T A;  3AG4 B;  1G1X B;  1UFI A;  4LF6 B;  3IAY A;  4WFE A;  3MD0 A;  4TV8 A;  3JAT A;  1X4T A;  4Z1V A;  4UVB A;  4JI0 O;  4UFZ A;  3MAQ A;  1XMO B;  2F1M A;  2ZDI C;  2ATK C;  3K59 A;  4K8Z A;  3ASO B;  2G38 A;  1MOF A;  2CTW A;  3FD9 A;  5J9P C;  1FJG O;  1M93 A;  1SQV H;  4X1Y B;  5HFM A;  4DV1 B;  1GK9 A;  3LDE A;  3BHP A;  1KQS U;  4DR1 B;  1DTO A;  1SF9 A;  1GM8 A;  2YXL A;  4B3T B;  3ZIA G;  2UU9 O;  2IU0 A;  2HHH O;  3STZ C;  1F23 A;  5JQG A;  3JD2 A;  3JSL A;  2Q7G A;  3EXA A;  4GKJ O;  1TAE A;  4JTD B;  4Z1M G;  1VF5 B;  1S76 D;  3CCU V;  1VQK V;  2MW2 B;  3OTF A;  4PHZ A;  2KKW A;  3MHS C;  1YZB A;  1EBO A;  1CP9 A;  1I0H A;  2LW7 A;  1QVF U;  1XIL A;  1JJ2 U;  4E4E A;  3IFX A;  3AG1 C;  4X1I B;  4JI2 O;  2ZE5 A;  1MSD A;  1YDX A;  1B06 A;  4CH3 A;  1LNQ A;  3CCE V;  1HNX B;  1P84 F;  2JIZ G;  4JI7 B;  1JFF A;  3J80 N;  4MTO A;  2VQF B;  4UXN A;  3CME V;  3OMA B;  5LP6 C;  1Q86 W;  1US6 A;  2PY5 A;  5EIB C;  1WJZ A;  3N2G A;  1TVK B;  1Y6X A;  4DRX A;  4DV3 O;  2MK3 A;  2ITD C;  3RW0 A;  1JJO A;  3ABM C;  2ZXW B;  1BHA A;  5BR8 O;  2A3Q A;  2VS0 A;  3QVN A;  1V54 C;  3ETE A;  5CB4 B;  4DV4 O;  3JAM N;  1R3J C;  2IH1 C;  2P4V A;  5EZY A;  1KYO F;  5L3E A;  3FAV B;  4MVS A;  3BPZ A;  2GTS A;  3VQW A;  4WFA V;  4W4L A;  4X1K B;  4JI3 B;  2JK5 C;  3HKB B;  3JAK B;  1YXB A;  4BW5 A;  3GB7 C;  4LFC O;  1H2L A;  3K9S A;  5KX5 B;  2R70 A;  4FK5 C;  3E83 A;  1RP3 B;  3UKM A;  1YTF B;  4R8C A;  3CPW U;  3RVZ A;  1K8A W;  1J5E B;  1AI4 A;  4UCV A;  5JVD B;  1OZ0 A;  4MW8 A;  1G8M A;  2WA3 A;  2ZR3 A;  2EBO A;  3HKC B;  2L6L A;  4IIJ B;  1Z2G A;  2QWR B;  3SPG A;  1AJQ A;  4O4I B;  1NKD A;  2ZQM A;  3P3N A;  1HNZ B;  1KUQ A;  1VQ5 V;  4HZ3 A;  1HR0 B;  1VQM V;  4B3S O;  1P7G A;  4X1I A;  1XHX A;  1SES A;  1KP2 A;  3O65 A;  2ZM6 B;  5CA0 B;  3IGA C;  3QF7 A;  5BMV B;  3H01 A;  5D5Q A;  4DR6 O;  5F2V O;  4RUF A;  4H13 B;  2IH3 C;  3K5M A;  2Q68 A;  4U3F H;  3WB0 A;  1N33 O;  1Q6I A;  1M5I A;  5IYB O;  4FM1 A;  3IC9 A;  3P3P A;  3E35 A;  4JPR A;  3BAA A;  1TVK A;  1YJN V;  1V9P A;  1OCZ B;  5IY5 C;  5IYZ A;  4IYI A;  2L35 A;  2BTO A;  3ABL C;  2PTM A;  4B7E A;  2WLK A;  2DJV A;  2LQT A;  4P2Z A;  2QJ1 A;  2Q6A A;  3I55 V;  3CRM A;  4JI4 O;  1BZK A;  1QLE B;  4MTG A;  3EFF K;  4CH6 A;  3K9A A;  4BIZ A;  1QU7 A;  3TXQ A;  2LW1 A;  3BCC H;  5KAI Z;  4AHC A;  2A9H A;  2WLM A;  1GN3 A;  4BWA A;  4GZR B;  3WG7 C;  1K92 A;  3CC7 V;  1UPG A;  1AR4 A;  2UUC B;  3K5N A;  3HKE B;  2H3O A;  4LF9 O;  4PA7 A;  2DQ3 A;  4PA6 A;  3CRC A;  1EZJ A;  4RWU A;  4H44 B;  2HJF C;  2RDC A;  2OTL V;  3C3T A;  2E76 B;  2RCV A;  5JVD A;  3AG2 B;  2KSD A;  2VQE B;  1EFR G;  2YEV B;  1ROP A;  2Q7H A;  2FML A;  4G28 B;  1PP9 H;  3CB2 A;  4L8J A;  1VIB A;  3UT5 B;  1J95 A;  1SQG A;  1BMF G;  2OT5 A;  2Y4U A;  1D2D A;  2V4D A;  2NLJ C;  5KA6 A;  4NXM O;  2Y0I A;  2EZP A;  3SJA C;  2ODM A;  1XNQ O;  2Q67 A;  4CS3 A;  2OWO A;  3FYI B;  5JJE B;  1QCE A;  5FL7 G;  3FKS G;  4WF9 V;  1BS3 A;  1L0L H;  2P7T C;  4RO2 A;  5CBH A;  4YJ3 B;  2VWK A;  3ZCC A;  3U0Z A;  5C8Y B;  5CA1 A;  2HVJ C;  4DR4 O;  1N0N A;  1PL0 A;  4O4H A;  1OJH A;  1COW G;  3BY6 A;  3W7W A;  3JYC A;  5LBQ A;  5J2U A;  4JI8 B;  1BCC H;  1VQO V;  1W0J G;  1EN4 A;  4RQF A;  3E8F A;  3ZHQ A;  4DV7 B;  1YIJ V;  2EIK C;  4JV5 B;  1SC5 B;  3A0H Z;  1E1Q G;  2H94 A;  2GSM B;  2HVK C;  3QO8 A;  1M57 C;  3THO A;  3CS5 A;  3H1I H;  1YIT V;  1BGY H;  4GCZ A;  3HKE A;  2JEU A;  5CA3 A;  3BAB A;  2Z5U A;  3C3S A;  4ZIB A;  5IYC O;  4MVU A;  5IE9 A;  1NH2 B;  1FFX B;  3OUS A;  4O4J B;  1GRJ A;  3FB8 C;  4UB6 Z;  4ABM A;  3RYH B;  2W6I G;  4GKK B;  3L73 H;  1H8H G;  2YEV A;  1WPX A;  2LFR A;  1FXK C;  4NYK A;  3UT5 A;  5H9C A;  1VF6 C;  2Q9L A;  4TQF A;  1KKC A;  3RYC A;  3J81 N;  3E89 A;  4RQE A;  4D7T A;  1GO3 F;  1NT2 B;  4X66 O;  1T5E A;  4PDM A;  1SA0 B;  3MDS A;  2N05 A;  4UB8 Z;  2CH7 B;  1I94 B;  1R3K C;  2UUB O;  2P6J A;  3LNN A;  3ZX6 A;  4LF7 B;  3DC6 A;  4YJ3 A;  3ASN C;  4FLV A;  5JH7 A;  3T4D A;  4ZOL B;  3AEI A;  3JD3 A;  1VQ4 V;  1SQB H;  4K0K O;  1SRY A;  3AG1 B;  5LGT A;  2N74 A;  5GW7 A;  4EFB A;  4O2B A;  3SYC A;  1JQ0 A;  2JGD B;  3QNE A;  2AHY A;  4DW1 A;  1HNW B;  5EYP B;  3TGU H;  2Q7E A;  4X62 B;  4LF5 B;  1K9M W;  2ZNJ A;  5CMU A;  3ZMU A;  1GN6 A;  5LP6 B;  3OD4 A;  1H2K A;  4KUM A;  2E5L O;  5JCO C;  1KKD A;  1GH6 A;  4HAM A;  4NVP A;  1V54 B;  3JD4 A;  4O4J A;  4PDR A;  4BIO A;  1NTZ H;  3N2K A;  5KUK A;  4FZ0 A;  1S72 V;  1OCC B;  2NNU A;  4JI0 B;  2AHZ A;  1VMG A;  3F5T A;  1N34 B;  2EIL C;  3K0D A;  2QWP B;  3D36 C;  1XNR O;  1XBL A;  3SPH A;  4JYC A;  3ABK C;  1EM1 A;  2JVD A;  1Q8I A;  4YY3 O;  3CXC U;  1S0V A;  4TV8 B;  2DYS C;  3JAT B;  1FS0 G;  4ZI7 A;  4JZ2 A;  2ADP A;  4JYB A;  3T4Z A;  1SA0 A;  1PPJ H;  4MVZ A;  2CH7 A;  1THZ A;  1WN7 A;  4I55 A;  5K1P A;  1VQN V;  2BOB C;  1U96 A;  2HJD A;  2HHH B;  2DOS A;  1PM9 A;  1B6Q A;  1SQP H;  3AK2 A;  3CRA A;  4NXN B;  3W7X A;  4FIP C;  4ZOL A;  1NU1 H;  1K33 A;  2F4V O;  4X8A A;  1W2B U;  4DXW A;  2PYJ A;  2WLI A;  1L8D A;  1D5N A;  5JQG B;  4R50 A;  3CEI A;  4GX1 A;  2CTR A;  5B1A C;  5IJ9 A;  2F93 B;  1F4N A;  2XAG A;  5LXT A;  2IJI A;  3SDL A;  4O2A B;  2QR4 A;  5FNV B;  3E8B A;  1S5H C;  4FFB B;  3RWR D;  1AJP A;  1WP7 A;  3OGC C;  2YSU B;  4DR2 O;  2BCC H;  2CUG A;  3CSX A;  2PZS A;  2ZE8 A;  2WLL A;  4DUY B;  3TJT A;  1S3J A;  2ADQ B;  2VRZ A;  3T1H O;  2CGO A;  3ABL B;  4CH5 A;  4UCR A;  4N21 A;  4YHH O;  3N27 A;  3L72 H;  1N4C A;  4MVR A;  1KC8 W;  2XOK G;  4CC5 A;  3AG3 B;  1JFF B;  4UUJ C;  3B77 A;  1GM9 A;  1V55 C;  3W7S A;  2Q69 A;  4OGQ B;  5DM6 V;  3WG7 B;  1MNG A;  1NZ6 A;  4DV4 B;  3A0R A;  5D5P A;  2LGW A;  3M7M X;  3OEE G;  2X0L A;  3N2G B;  1WA8 A;  1VEW A;  4NTX A;  4DRX B;  2ARH A;  3LSU A;  1ZWI C;  2YIB D;  4JAV A;  4R6Z A;  4JI6 O;  2W0X A;  4JZG A;  2GDS A;  4PA3 A;  1WLE A;  5LGU A;  3RFR A;  1XI1 A;  4ZHQ B;  3L70 H;  1I5X A;  4B08 A;  1YEW A;  4LFB O;  3FB5 C;  3JSN A;  2KG7 A;  5EZY B;  4Q6G A;  3VQX A;  3FX7 A;  3QTC A;  1OCO C;  3K5O A;  2QTO A;  4WCE V;  2UXD O;  4DR7 O;  1R6N A;  2WLH A;  3F5W C;  4DV0 B;  1QQC A;  1BQZ A;  1M90 W;  2GHY A;  3OMN B;  4ICG A;  2ILM A;  1YJ9 V;  3A0B Z;  3ZN0 A;  2OIE A;  4I9Q A;  2EIN C;  2NN4 A;  4O2A A;  2UXC B;  4DV6 O;  1SZT A;  5FNV A;  2EIM C;  1NI8 A;  4FFB A;  1F7Y A;  3JAL B;  3T1C A;  3K03 A;  3ZRV A;  1NR7 A;  3B40 A;  1JX9 A;  4XDJ A;  2XAH A;  1VQ9 V;  3HB3 B;  1IVS A;  3OEH G;  2EIK B;  1QR9 A;  1D5A A;  1A32 A;  3BVO A;  2Z3Y A;  4KFM A;  1ZL8 A;  4QJF B;  1IXM A;  3ZMT A;  4DUZ B;  3OTO O;  2HG5 C;  4AI8 A;  5E79 Z;  1JCH A;  3CCM V;  4BIU A;  4DR5 O;  4AQY O;  1GKF A;  3B8M A;  4KHP O;  2YXY A;  1NJI W;  3CJH B;  3QO5 A;  1VQ6 V;  1AI5 A;  4DV2 O;  1F51 A;  4OXS A;  5DN6 G;  5IYZ B;  3D3Q A;  3UQ8 A;  2Y69 C;  4FLT A;  2EJ7 A;  2QTS A;  4ZHQ A;  2B1I A;  4CC6 A;  1RFY A;  2DQ0 A;  4LF9 B;  4OPH A;  1FXK B;  4LFA O;  4EB6 B;  1WAZ A;  1WB8 A;  4DR3 B;  1PD3 A;  3A8T A;  3RYI A;  1P49 A;  2FTK A;  4LNU A;  5IWA O;  5B3S C;  4WFH A;  1KEC A;  1EZV H;  4H37 A;  1PNM A;  4MVM A;  2YIA A;  3SPJ A;  4Q20 A;  3W7T A;  1MSW D;  2JS5 A;  4J7K A;  5KMG A;  2RNB A;  3HKD A;  3ASN B;  3UO3 A;  5IYD O;  2R9R B;  3RBZ A;  2R9A A;  4NXM B;  1FKA O;  2YIB A;  3CC2 V;  2JDI G;  3JAL A;  4E2L A;  3UM7 A;  3CXH F;  1N36 O;  1IBL B;  4DV1 O;  4JI5 O;  3APQ A;  4JAS A;  1P4R A;  3CHX A;  4TT3 G;  2A0L A;  3APO A;  4LWS A;  4F6E A;  4B3T O;  5GTI Z;  1IUR A;  1Q3E A;  3ZED A;  1RPR A;  4ZKI A;  3DC5 A;  3I56 V;  1OCR C;  3FYE B;  5JJN B;  1O9H A;  2PGG A;  1MZE A;  1Q82 W;  3L74 H;  5CA1 B;  2F95 B;  2QWQ B;  1M56 B;  5LMU B;  4O4H B;  1NBM G;  3CJH A;  5FPO A;  3WU2 Z;  2B5U A;  3BEH A;  3R66 A;  5J2U B;  4PI2 A;  1H2M A;  2BTQ A;  4I0X A;  4J7J A;  4UCU A;  2EIJ C;  4F6R B;  2Y4T A;  3TCU A;  3LUT B;  1FXK A;  4I50 A;  1CPY A;  2RQ6 A;  4EB6 A;  1VF6 A;  3K57 A;  4IHJ B;  3DXR A;  4HNA A;  1HNX O;  3M99 B;  1N32 O;  3ABK B;  4TUY B;  3H1H H;  2GTA A;  4QE7 A;  4WBN A;  3KG2 A;  2WPD G;  4IGG A;  2VQF O;  5H2F Z;  2DMX A;  2YDE A;  2FB5 A;  1SZX A;  1JOY A;  1HWY A;  5B1B C;  4MW3 A;  3H1L H;  1PNL A;  1Y74 A;  3ZN1 A;  3CCS V;  2ITC C;  1R3L C;  2UUA O;  1SER A;  3JAR B;  3AG4 C;  4X66 B;  2JRI A;  4NB5 A;  3QO7 A;  4WFF A;  5J2T B;  4FZ1 A;  4JI1 B;  1R1B A;  2GUZ B;  4X65 O;  3B09 A;  3RYF B;  3RYC B;  1I5Y A;  3CC4 V;  3SPC A;  5KHG A;  5L3D A;  4JI3 O;  3ASO C;  1AP6 A;  1IX9 A;  1VAR A;  5B1A B;  4K0K B;  3LSQ A;  4DO2 A;  2OIG A;  3FB6 C;  2Q5Z A;  4DYL A;  1XL4 A;  2YI8 A;  3OGI B;  3OE7 G;  4FVM A;  4JYA O;  4H0L B;  4K3A A;  2WWW A;  1KD1 W;  3D3I A;  2AZ2 A;  4JTC B;  3ZHU A;  5JH7 B;  1QBZ A;  5JCO A;  4XBF A;  3U11 A;  4BW9 A;  4UCT A;  5KHI A;  2B9Z A;  4O2B B;  2DW4 A;  4F6R A;  1HR0 O;  3D36 A;  2E5L B;  3LSS A;  3ETD A;  4IHJ A;  1K5S A;  4TUY A;  4FPP A;  3T1Y O;  4LF8 O;  1WP8 A;  4YXW G;  2XAJ A;  5LA6 B;  2A79 B;  2RJZ A;  2QWO B;  1GAX A;  2X6A A;  4U3J A; 
#chains in the Genus database with same CATH homology
 2AZ0 A;  3TXS A;  2B9Z A;  3TXQ A;  3O9O A;  3FAV B;  3FD9 A;  3HR0 A;  1WA8 B;  3ZBH A;  3OGI B;  4GZR B;  3Q4H B;  4LWS B;  2VRZ A;  2KG7 A;  4ABM A;  3GVM A;  4I0X A;  2AZ2 A;  3FAV A;  3GWK C;  2DE0 X;  2VS0 A;  1WA8 A;  3G80 A;  2KG7 B;  4I0X B;  3Q4H A;  4LWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...