3GWKC

Structure of the homodimeric wxg-100 family protein from streptococcus agalactiae
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
b'GAMSQIKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein SAG1039
molecule tags Viral protein
source organism Streptococcus agalactiae serogroup v
publication title WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
pubmed doi rcsb
total genus 42
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3gwkC00
2VS0A 2KG7A 1WA8B 2DE0X 3FAVB 3GVMA 3HR0A 2B9ZA 3FAVA 1WA8A 3GWKC 3O9OA 3Q4HB 4LWSA 3OGIB 2KG7B 4I0XA 2AZ2A 3G80A 3ZBHA 2AZ0A 4GZRB 3Q4HA 3FD9A 2VRZA 4I0XB 4LWSB 3TXSA 4ABMA 3TXQA
chains in the Genus database with same CATH superfamily
4QNHB 3ABMC 1B6QA 1FFXA 3ZIAG 5DM6V 1S5HC 4PDLA 5CA1A 3LNNA 5JCOC 2A79B 3OGCC 4GKKO 4WBNB 4KP4A 3ZN0A 2QTSA 1MZEA 1WB7A 3ZBHA 3CCJV 1Q5OA 1NT2B 2DYRC 4G2KA 1D2DA 1IBMO 4JAAA 3CX5F 2VQFO 1IVSA 1XI1A 2QEXV 2NR5A 3B77A 4UUJC 3ZCCA 2PI5A 3OUSA 2EULA 2JVDA 1WP7A 1ZSPA 3UCSC 2W0FC 3O65A 3OW2U 3B8MA 3CCVV 3SJBC 3ETQA 3ZMUA 4FLWA 4LFAB 1IURA 3IC9A 1K34A 1Y66A 5D5QA 1RSOB 3BPZA 1VQ7V 1FXVA 2X6AA 1HNXB 3ZHVA 4TV8A 5JQGA 2XAQA 1JR9A 3OMIB 3I55V 4UCUA 4B3TB 2DW4A 4JI0O 2EILB 1VF7A 1W0JG 4UVCA 2HHHO 2ZM6B 1VARA 5H5NA 5J2TA 1N32B 1H2NA 1IXBA 1NR1A 3S3WA 2YICA 2BTQA 4GUNA 5B1OA 3R66A 1H2KA 3BAAA 2HVKC 4UVBA 1PV0A 3E2EA 1SETA 3CRAA 2ZXWC 4JI1O 4NXMB 3PN1A 3SJCC 5LYJA 2AXTZ 2WLLB 2UXNA 5LP6C 1WJZA 1EN6A 3H1KH 2MW2B 2B1GA 2QWQB 1WA8A 3QVNA 3FB8C 4OGQB 1GH6A 3OD4A 4GYCB 2O57A 4Q6GA 2UUAB 1YZBA 2E3CA 2H3OA 3RYFA 3W7XA 4RWUA 5IYZA 2EIKC 5ITZB 2RCVA 5J9PC 5IY5C 1FFXB 1S3JA 1PM9A 4AI8A 2CK3G 3FYEB 4RUEA 2Q7GA 4O4JB 2PF4E 5LYJB 1KECA 1K3EA 3IAYA 1E79G 2WWWA 2EIMC 3JYCA 4WFEA 4JYBA 1EZVH 3JALB 3K06A 1KC8W 2DOSA 1Q82W 2QKSA 4MVUA 4MTXA 5A2QN 3CRQA 4Z1VA 1Y74B 2N04A 2YSUB 3LDDA 4GCZA 1O9GA 3FYIB 3TGUH 1K9MW 2PGGA 4Z1MG 2FL4A 3SYPA 1YXBA 2YUAA 5CA3A 5IYBO 4X9QA 4HNAA 4AQYB 2IW5A 2GUZA 1RM1B 4KHPB 2WLHA 1X59A 3CE2A 4DR7O 3AG1C 4X65B 4UXNA 1TUBB 5DN6G 2DQ0A 2UXCO 4LR3A 4LFBO 4F4LA 2XASA 4LF5O 3CSXA 5JJEB 1HNZO 2OTJV 2CGNA 1RPRA 1NTKH 4J9ZB 4FMTA 2HJDA 5B1BB 5FLXN 4O4IA 4J10A 2UU9B 2FKXA 3TXQA 1WP8A 3L75H 2DN9A 2YEVA 3WG7C 2UXBB 5CB4A 1SS3A 2ADQB 4IYIA 4JTDB 4FM1A 2QM4A 5LMNB 1ZX3A 2N05A 2UUCO 4LF6O 3K04A 1CEZA 3CRCA 1Q8IA 1NR7A 3CC7V 1R3KC 2A06H 1MZFA 1BE3H 1SRYA 2EX3A 2ETNA 4PDVA 2N74A 4CH5A 1M90W 3L74H 4X62B 2KQXA 2V1DA 1V55B 5TISZ 3VQYA 4PDRA 3UKMA 3AG4B 3AK3A 1N8RW 3U11A 5IJ0B 4PJ0Z 1KP2A 3HKCA 4JGSA 3SYCA 1XEQA 3P30A 2YIBD 5KAIZ 3DC6A 3SPCA 4LF6B 5LP6A 1ZUQA 2ZKOA 3ABLB 1LUVA 3D8CA 2IM9A 4DXWA 3UT5A 5FL7G 1NVPB 2Q6AA 4DV5O 1K7DA 1N4CA 4NTYA 1NH2D 2PTMA 2WLLA 5A9GA 1GM9A 1FXKB 3TETA 3JASB 1V55C 5ITZA 1XNRB 1ZLZA 1S72V 1VIBA 2E74B 3CCQV 3C90A 4JI3O 1XMQB 3B4SA 5H6QA 3OR7C 1JMKC 1CPYA 2F93B 1GO3F 2LGWA 1OCOC 2LW7A 3A0HZ 3EFFK 3VQWA 3JD4A 3UO2A 4LF5B 4FJCC 4UCOA 2FMLA 4LFCB 5BMVB 3P3NA 3CXCU 3KZIZ 2AHZA 2OWOA 1IBLO 5C93A 1K4CC 1MSDA 3OR6C 1YTFD 3ZX6A 2YXHA 2GV9A 2ADPA 4X1KB 2EIMB 1PNLA 5KMGA 1QNMA 3OTFA 4YIOA 2ITDC 4JI6B 4LNUB 4MW3A 5EIBC 1LNQA 4KXRA 5J2UA 3ZMTA 4R50A 2F95B 3E86A 5JJNB 2YC0A 3ZHQA 4TSFG 5B1BC 4FZ1A 4CC6A 4JI7B 4DR3B 3CP1A 3G6BA 5CN0A 4RQFA 2OCCC 3SDLA 1SC5B 2P6JA 4QGPA 5HFLA 3T2MA 3J81N 3CMEV 2DMXA 1MG1A 3EHBB 1EM1A 2XAFA 1YCIA 1WN7A 4JI1B 4O2AB 4QIWF 4LF8O 2Q0OC 2PUSA 1EN4A 1NKDA 1GN3A 2QGNA 5GONB 1RSOA 4DV4O 5KHIA 5E79Z 4DUZB 3JAWA 4WF9V 1WB8A 3BA8A 1BL8A 1ZL8B 1SKVA 1AJPA 4LWSA 1V54C 4AILC 4LNUA 5EC1C 2VWJA 2HJFC 1IDSA 3RYHA 1RM1C 4BW5A 4GKJO 1RP3B 2PYLA 3UM7A 1K4DC 2VWKA 3N2GA 2WLJA 1BMFG 3AEIA 1VQ6V 3CRRA 1PP9H 1SF9A 2QJ1A 3NXSA 5B3SB 2RDCA 3CMAV 4ZOLA 2IU3A 1RFYA 3RYHB 3OEHG 1L8DA 1Y4MA 2AW9A 1MABG 1R3JC 1DLBA 4GKJB 4ABMA 5JJJB 2WSSG 4B3SB 1KKDA 1VQNV 1SERA 4KL1A 3HKEB 3JAWB 1Q7YW 4F6EA 2B1IA 1P7BA 3RVZA 3B09A 3CXHF 3KKYA 2JEUA 2P67A 2AZ0A 1M1KW 4TQDA 3STLC 2BSKA 2ZD9A 2XOKG 4P9PA 4ZOLB 4EFEA 2EZPA 2DWEC 1VQ9V 3ZRXA 4DV2B 4JI4O 4DYLA 2Y0PA 5CA0B 4DR3O 4LF4O 3K0DA 4H33A 3Q4HA 1K73W 5KHKA 1OCRC 1NI8A 1XDCA 2Q67A 3QG5A 5BR8B 3BVOA 1V9PA 1FXHA 4FLVA 3PJSK 4DR4O 4X89A 2YIAA 1JOYA 2JS5A 3SPGA 4MVMA 4UV9A 4HYOA 3RN4A 3RYIB 3H01A 4OPHA 2CTWA 3G6EV 3E35A 3X2QB 2VQEB 2ZIMA 2HVJC 5LL6Y 3MHHC 1I0HA 1PD3A 4B3RB 4DV6B 1OCRB 2EJ7A 4WFGA 4DK1A 1IBLB 4YHHO 4O2BB 1P49A 3G4SV 5C8YA 3L70H 4MSWC 3SYQA 2V4DA 3L9DA 4I50A 2LFRA 4BW9A 5H2FZ 2QWRB 2ATKC 1KU9A 4FLXA 2Y4TA 1Z5VA 4CC5A 2HG5C 4NXMO 5IT9N 1K5QA 1OCZC 3C3TA 2GBOA 3WU2Z 2Y4UA 3SR2C 4DV7B 3CYOA 4G27B 2AGAA 4LCUC 2Z3YA 4CS2A 1AVMA 3BRCA 3H1IH 3ZHUA 5LXTB 1HNZB 2P4KA 2QE7G 5EBWC 5GTIZ 2A3QA 3E22A 4OPAA 2F66C 2ZNIA 1U96A 3G67A 4UVAA 5CBHA 5LHIA 2IJKA 5CA0A 3FB6C 4K35A 1M56B 3E8GA 3ASNB 4MTFA 3FB7C 1BQZA 1Y76B 3CCMV 1VQOV 1AI5A 4J41A 1FJGB 4HBNA 2BSKB 1JJ2U 4LFAO 5LMUO 3T1HO 1N34B 3DTUB 1W2BU 4DR1B 3FKSG 4JTAB 1DF4A 3OGIB 3DXRB 4PA4A 4FLZA 4IT5A 2QSAA 2WA4A 5JCOA 3QNEA 5KAFZ 4C7UA 2LFSA 2ZT9B 2RMKB 2JK5C 5LA6A 2EINB 3RBZA 3K58A 2RQ6A 3H1HH 3E8BA 4YJ3B 1M5IA 3K57A 1F23A 4FM0A 3O9OA 1VQ8V 1JQ0A 2CTQA 3EVKA 4JV5B 1S5LZ 2Q4PA 2E5LO 1N34O 3H1JH 1PNKA 3JASA 2QR4A 4B3MB 3LDEA 4E2LA 3JAMN 4MVSA 3LNMB 1X4TA 5LGUA 3L71H 3W7WA 1N33B 2CUGA 2VQEO 4N21A 2B9ZA 1TAEA 3FAVA 4FZ0A 4LFBB 4W4LA 3OM3B 1BQ0A 4DR2O 1K5SA 1H2GA 3DC5A 3K5OA 5LHHA 4B7EA 3K5NA 3ZRWB 1VQKV 1N0NA 3ZMSA 4O4HB 3M7MX 2X7RB 4NB5A 1VQ5V 3W7SA 5B5EZ 2OT5A 2G38A 3A0RA 5HFMA 5IYCO 2JEXA 4ICGA 3JATA 1N33O 4JYAB 2L6LA 3N2KA 3CCUV 1AP6A 5FNVB 1JVMA 3M8AA 2HFEC 1EN5A 3U0ZA 1XOUA 3TCUA 1Q6IA 5CMUA 2GTSA 4PHZA 4ZI7A 5CBFA 3J7AU 2LP7A 4QPKA 1XILA 4DR5B 3CC4V 1XMOB 2Y69B 3CS5A 4NTWA 4O4JA 1FPOA 1PKXA 4DRXA 2Q69A 2XAJA 1R1BA 3HKEA 1Y76A 2IJHA 1AJQA 1VF5B 1O9HA 4K8XA 3ABLC 1SQVH 2ZE5A 4AHCA 5D5PA 3K79A 3JALA 2GTAA 3JARB 1HDJA 3N2KB 4H13B 1E1QG 3KCYA 1GM7A 2YXLA 3ABKB 4G28B 4GZRB 2BE3A 4BIZA 2YXYA 1DF5A 2FB5A 1G4YB 1QU7A 5GW7A 4UFZA 2JJ2G 3SYAA 4X1IA 4BIOA 1F4NA 1WLEA 3BHPA 5JQGB 4L87A 5B1AC 1N36O 1XHXA 4J7ZA 2YS8A 1HNWO 3VBBA 1TVKA 4JI3B 2X6CA 4NVPA 1GM8A 4IYHA 2YI9A 1F51A 5LMNO 1K33A 4EKWA 5FPOA 4FIPC 4LFCO 5B1NA 1R73A 1R6TA 4LC1A 2ZE8A 3OTOB 2F4VB 5EBMC 4QE7A 4I50B 2Y48A 4JI0B 2EIJC 5LMUB 1QLEC 3AG3B 3KCXA 3I5DA 4DR6O 2KG7A 2QM8A 4MT8A 4Q20A 1SQXH 5K1XA 1GRJA 3A0BZ 2P5OA 2W0XA 1Q43A 3S3XA 4B3RO 5BZBA 2YIDA 5KHGA 5C8YB 3T1YB 2P22C 4EFBA 3N2GB 2YDEA 3H1LH 4PI2A 3D36C 4WFHA 3ZJZA 2JS3A 2VQFB 4JI5B 3GWOA 1Q81W 5CB4B 1IBMB 2IJJA 2VS0A 1R6KA 4KHPO 2R9IA 3JAKB 3LSUA 5JVDA 5IDJA 1QR8A 4YJ2B 4JI7O 3FB5C 5DEDA 5L3CA 1VMGA 3ASOB 4OX9O 2R72A 1JFFB 2R70A 1Z2GA 4KFMA 4O4IB 4J9YB 4GX2A 1OZ0A 1JA8A 2KG7B 4I5SA 4X64B 5IWAO 2UXBO 3RYIA 1M56C 1HW7A 3FD9A 1NJIW 3WFVA 4GX0A 3JATB 1NZ6A 5EK0A 2EIKB 4QJFB 1PPJH 2P7TC 2FYUH 3K0GA 4B7KA 1QHTA 3K08A 3OUFA 3ABMB 4CH3A 4O2AA 3QO8A 2DQ3A 4U7OA 4EB6A 1KB9F 4MVOA 3T1CA 4H0LB 2EZOA 2WAMA 4ZBMA 1P7GA 5IWAB 1W59A 4X64O 2QKAA 4JI8B 1S5JA 4X66O 3CCSV 4AQYO 4NXNO 3JCUZ 1NH2B 5IJ9A 4B3SO 2RNBA 3ZMVA 1CP9A 1SQBH 1Y67A 4I4TA 5KHJA 4D7TA 3UQ8A 1ORQC 3JD2A 4DR6B 1YJ9V 4TV9B 1GN6A 3ASOC 2R9AA 1JPXA 3CRMA 3T1HB 4F6RB 3FAVB 1S0VA 4FK5C 5H9CA 3RYCB 4JAUA 4I7ZB 4BWAA 1Q3EA 2BOBC 2OCCB 2ZNJA 4Z2WA 4JTCB 1XQ8A 1BZKA 3E89A 2RJZA 1ROPA 3NR7A 5F2VO 1KKCA 2OCHA 4X8AA 4WFBV 3RW0A 1LR1A 2JRIA 1I5XA 3RYFB 4UCRA 3LSSA 3WB0A 1YI2V 3K5LA 4TUYB 1M93A 3HR0A 5KX5A 2XT9A 1SZTA 1N32O 3K5MA 1HNXO 4TV9A 1WPBA 1ZL8A 4DV7O 5JVDB 2UU9O 3ICXA 2PY5A 3SJQC 2UXXA 1SQGA 2LQTA 5AG2A 2M7WA 4JYYA 3SYOA 5GONA 3FFQA 2W6JG 3IJ4A 4TOIA 1HNWB 1H8EG 1VF6A 1GK9A 4P30A 1H8HG 2WLIA 3RT3C 2CTRA 1Z5WA 4X1KA 3SGIA 1VQPV 4U3JB 4QPJA 4IHJB 1IBKB 4J7JA 2CTPA 4ZIBA 4H37A 4NR1A 3R65A 2QDOA 5BMVA 4DV6O 5JWPA 1IXMA 1TA8A 1EBOA 2DYSB 1SQFA 2IH3C 2ZDIC 4HAMA 2Q5ZA 3AG2C 1WPXA 3T4ZA 2UXCB 4XBFA 1LUWA 5KA6A 3CB2A 2GDSA 2YIBA 4LF4B 3DGEA 2Q7EA 4JPRA 4O2BA 2V7QG 4GX5A 4GLXA 4JV5O 3AK2A 2ZE6A 5B3SC 3QO7A 2K9PA 2M6YA 1JFFA 3CCRV 4MTGA 4FLUA 1THZA 2UUCB 4I9QA 2XTAA 4CH6A 1DK1A 1AR5A 4DV1O 1D5NA 1H38A 3CD6V 3CPWU 1I94B 4U7NA 1NQTA 2P4VA 3B2EE 1V54B 4E4EA 1QVFU 4GT1A 4GKKB 4B08A 2ZDIA 2AHYA 1G8MA 3CJHB 4JI2B 3N27A 1KP3A 5IYDO 1FJGO 2F1MA 2CAZC 3HKCB 4LF9O 1XNQO 4EB6B 1AI6A 3LDCA 4X88A 3CCLV 1QVGU 3ML0A 4FLYA 3IC7A 1QR9A 1EFRG 2JGUA 1SA0B 1XL6A 4JASA 5KUKA 1QCEA 3E22B 1ZWIC 5LP6B 1I5YA 4UCSA 3RFRA 1B3QA 1G6UA 4HZ3A 2ZE7A 4JI2O 5KUMA 4LF7B 5IJ0A 1KMIZ 5IJ9B 3HB3B 1F7YA 3H9VA 4J42A 1R3IC 1YEWA 3MDSA 4DUZO 3K59A 3VQVA 4CBCA 4NTXA 4X66B 4NXNB 2ZCEA 3JSNA 2Y69C 4LWSB 1XMQO 1OCOB 4JZGA 2Q9LA 1VP7A 2A9HA 2R9RB 1TUEB 4PD4F 1XBLA 2BCCH 4DR1O 5LGTA 3CC2V 5L3BA 4LF7O 4LP8A 1GKFA 1KYOF 4YXWG 1AP5A 4H44B 4PELA 1TUBA 1AR1B 1M57C 4DR7B 3C3SA 4FLTA 4LBEC 1FAFA 4R6ZA 2XAGA 3DSQA 2EILC 4JI6O 1IX9A 2X6BA 3TJTA 1EZJA 1YHQV 3JD0A 4RAIA 1D5AA 3UT5B 1VQ4V 4DRXB 3ABUA 4I4TB 4DR5O 4YJ2A 1HWYA 4PV1B 3TK1A 2KKWA 4WCEV 2L35A 4LF9B 1XNQB 3IFXA 4B3MO 4A5UB 3AG4C 1Q86W 1YJWV 3E83A 4K0KO 1FFTB 2JDIG 4O4HA 1K92A 4LF8B 4X1YB 1IBKO 1YSCA 4TQFA 2XHBA 1I7FA 1XNRO 3WB2A 1AB3A 2F4VO 1BCCH 4I0XA 3BA9A 1UJWB 5FNVA 4J7KA 1KUQA 4JI4B 3SPJA 4DV0B 5KMGB 4IIJB 1COWG 1AI7A 1QQCA 1FD9A 1Y74A 2DJVA 2HEPA 5LGNA 3K9AA 1RPOA 4OXSA 2ZR3A 2Y0IA 4CS3A 5LOVA 1YIJV 2QKCA 3B8NA 3HKDA 3GB7C 3RWRD 1SQQH 3JARA 1M57B 1VF6C 1WNSA 4IIJA 2OTLV 5BXZA 1WA8B 2QM7A 1E1RG 3W7TA 1MOFA 3CHXA 5J2TB 1BSMA 3QTCA 4JF3A 1VEWA 3OE7G 4UV8A 4DW1A 1XHZA 3BFRA 1AROP 4FM2A 4L8JA 5L3GA 4ZHQA 3D36A 5IYZB 3QF7A 4U3FH 4BAYA 3F7YC 3CJHA 1UPGA 3ZHRA 2DE0X 4JYCA 3ZEDA 3OMNB 5H6RA 2BTOA 1MNGA 4LH6A 5GTHZ 1S76D 2HHHB 4GX1A 1L0NH 2ZM6O 2LO1A 3L72H 3DXRA 4JI8O 3K03A 1FYJA 4HNAB 1YF2A 1NTZH 3ABKC 4MW8A 4LH7A 2A0LA 2JGDB 4PA9A 1B04A 1NBMG 2HLDG 3HKDB 4UB8Z 4K3AA 4TUYA 2B5UA 2PYJA 4NKGB 5IY5B 3E8FA 3WG7B 5B1AB 4ZHQB 4ZI7B 1KBHA 3F5WC 2GUZB 1W0KG 1ENVA 4DV3O 4B3TO 2OYQA 1XREA 1ZTEA 3BCCH 4XDJA 2JGDA 2HP8A 4I55B 3SPHA 1YVWA 4K0KB 1OJHA 5LXTA 2ODMA 3APOA 1T5EA 3ZRSA 1OCCC 3MD0A 4J80A 3THOA 1Q6UA 2JJ1G 2P90A 2YI8A 1YDXA 5FPRA 4X65O 3ZRVA 2EINC 5BY1A 4PI0A 2XNDG 2EIJB 3A8TA 2ZINA 4FFBA 2WLIB 3QO5A 1L0LH 3HKBB 5EZYA 2ITCC 1OHHG 4MTOA 1J5EO 1MMMA 1G1XB 2W6IG 3F7VC 4CH4A 2P06A 1TGOA 2WLNA 4CS4A 3STZC 2E5LB 1I94O 2Q73A 4PA7A 2WA3A 4P9OA 5LOVB 4DV2O 3ZS8C 3D3IA 2UUBB 4IGGA 3GVMA 2DYSC 2WLMA 2Q7HA 3J80N 3RVYA 3CCEV 2WPDG 3ZMZA 4DW0A 1FKAO 3VOUA 1JJOA 4ASUG 4UCTA 5LHGA 1P4RA 1SZXA 3G80A 2H94A 1SESA 3OT7A 3LSQA 1OCZB 4X1YA 1N36B 5EBLC 4U3JA 1R3LC 1OCCB 5JH7A 4P2ZA 1IZ3A 1K97A 3HPLC 3P32A 1VQLV 3RGBA 4UCVA 3JAKA 4QE9A 1UFIA 4FVMA 3D3QA 3K3WA 5L3DA 1BGYH 3SJAC 2DYRB 4X20A 1N0JA 1GAXA 1AR4A 3M99B 4I0XB 2HR3A 4R7CA 1NTMH 4JAVA 4MS2A 3ZRWA 5E1AC 4RQEA 1QLNA 4PA3A 3OTOO 3JCZA 2D3OW 1AI4A 4KUMA 1AJNA 4FPPA 1NU1H 4F6RA 2D2CB 4X20B 3KG2A 4NYKA 4UB6Z 5EYPA 2LGQA 2CH7A 3BY6A 4MVRA 2QA4V 1Q90D 4N23A 3OEEG 3UO3A 2EJRA 3ABTA 3AG1B 2QWPB 2PZSA 2XAHA 1I08A 2FTKA 1U97A 1M9NA 1KD1W 2ZIOA 3AG2B 4DUYO 3Q4HB 1H2LA 2QWOB 1HR0B 1R6NA 2LW1A 4YIPA 1J5EB 4W4KA 3K9SA 1KQSU 5K1PA 2OIGA 1B06A 1WAZA 1FXKA 1OV9A 1YTFB 1H2SB 1US6A 4DUYB 1QLEB 1XL4A 3ETGA 1M4UA 3ZN1A 4YHHB 1GMGA 4J11A 2UUBO 4D6TH 4JYAO 2CE4A 2CDYA 1DTOA 4YJ3A 4TT3G 2HKOA 4D7SA 4BR6A 2IBZH 4FFKA 4XDKA 3BABA 5L3FA 4IHJA 2WLKA 3GWKC 4DO2A 3LUTB 3ZHSA 4EEQA 2GHYA 2GSMB 4DV4B 3G71V 1NVPD 5KLVH 2ZXWB 2E76B 3RYCA 1XMOO 5J2UB 2ARHA 4I55A 1CXZB 2IJIA 4O4LA 3OMAB 2QWNB 2ILMA 1P84F 2KB1A 3OAAG 4K8ZA 1L1FA 1JCHA 2Q0AA 5KA5A 1URFA 4YY3B 5KHHA 1PL0A 2A7WA 1MSWD 2RN9A 4BIUA 2VRZA 3JSLA 1BHBA 1FS0G 2Z5UA 2ZR2A 4PDMA 2OIEA 4O4LB 1J95A 1ZAUA 3ETDA 1QBZA 4WBNA 4DR4B 3A2FA 1BS3A 5B66Z 1GTOA 3T1YO 3AG3C 3U10A 3VQXA 1S77D 2CH7B 1DGSA 2EBOA 4X62O 3W7UA 3ZHTA 2MK3A 1TVKB 1SQPH 4PA6A 2H8PC 1F4MA 3OFNG 4XDLA 2LJ2A 3EXAA 4ZKIA 2UXDB 4X1IB 2BTQB 3HKBA 5EZYB 2F23A 2DWDC 1XUQA 2IH1C 2F43G 3CWBH 4JZ2A 5KX5B 1HR0O 3P3PA 1JX9A 1YITV 1BHAA 1AILA 1H2MA 4MVZA 2QTOA 4DV5B 1PL4A 4R8CA 2X0LA 5IE9A 2NNUA 3SPIA 2UUAO 4TV8B 3APQA 3MHSC 4DK0A 2ZQMA 2XUMA 5EC2C 3MAQA 3IGAC 1NS1A 2NN4A 3ETEA 5DECA 1A32A 2IU0A 3TXSA 2Q68A 2UXDO 3I56V 5EIBD 1BT8A 3JD3A 1Q6HA 1VQMV 4MVQA 3CEIA 4I9WA 4JI5O 2Z0AA 2K1EA 4WFAV 4IL6Z 5CBGA 1K8AW 3WB1A 2NLJC 4TWKA 1Y6XA 1PNMA 4RUFA 5EYPB 2AZ2A 3BEHA 4DR2B 4OX9B 1FXKC 1HP8A 2KSDA 2CGOA 2JIZG 5JH7B 1YJNV 3E8HA 1GN2A 5LBQA 1MA1A 2Q8VA 5BR8O 3L73H 3F5TA 2E75B 2YEVB 3AK1A 5L3EA 4DV1B 2C2AA 3X2QC 4RO2A 4CZZA 3AG7A 5CA1B 3T4DA 4DV3B 3JD1A 4DV0O 3FX7A 1GN4A 5LA6B 3B40A 2PI4A 4YY3O 3ASNC 4FFBB 2BOCC 4WFFA 1SA0A
chains in the Genus database with same CATH topology
2VS0A 2KG7A 1WA8B 2DE0X 3FAVB 3GVMA 3HR0A 2B9ZA 3FAVA 1WA8A 3GWKC 3O9OA 3Q4HB 4LWSA 3OGIB 2KG7B 4I0XA 2AZ2A 3G80A 3ZBHA 2AZ0A 4GZRB 3Q4HA 3FD9A 2VRZA 4I0XB 4LWSB 3TXSA 4ABMA 3TXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS0 A;  2KG7 A;  1WA8 B;  2DE0 X;  3FAV B;  3GVM A;  3HR0 A;  2B9Z A;  3FAV A;  1WA8 A;  3GWK C;  3O9O A;  3Q4H B;  4LWS A;  3OGI B;  2KG7 B;  4I0X A;  2AZ2 A;  3G80 A;  3ZBH A;  2AZ0 A;  4GZR B;  3Q4H A;  3FD9 A;  2VRZ A;  4I0X B;  4LWS B;  3TXS A;  4ABM A;  3TXQ A; 
#chains in the Genus database with same CATH topology
 4QNH B;  3ABM C;  1B6Q A;  1FFX A;  3ZIA G;  5DM6 V;  1S5H C;  4PDL A;  5CA1 A;  3LNN A;  5JCO C;  2A79 B;  3OGC C;  4GKK O;  4WBN B;  4KP4 A;  3ZN0 A;  2QTS A;  1MZE A;  1WB7 A;  3ZBH A;  3CCJ V;  1Q5O A;  1NT2 B;  2DYR C;  4G2K A;  1D2D A;  1IBM O;  4JAA A;  3CX5 F;  2VQF O;  1IVS A;  1XI1 A;  2QEX V;  2NR5 A;  3B77 A;  4UUJ C;  3ZCC A;  2PI5 A;  3OUS A;  2EUL A;  2JVD A;  1WP7 A;  1ZSP A;  3UCS C;  2W0F C;  3O65 A;  3OW2 U;  3B8M A;  3CCV V;  3SJB C;  3ETQ A;  3ZMU A;  4FLW A;  4LFA B;  1IUR A;  3IC9 A;  1K34 A;  1Y66 A;  5D5Q A;  1RSO B;  3BPZ A;  1VQ7 V;  1FXV A;  2X6A A;  1HNX B;  3ZHV A;  4TV8 A;  5JQG A;  2XAQ A;  1JR9 A;  3OMI B;  3I55 V;  4UCU A;  4B3T B;  2DW4 A;  4JI0 O;  2EIL B;  1VF7 A;  1W0J G;  4UVC A;  2HHH O;  2ZM6 B;  1VAR A;  5H5N A;  5J2T A;  1N32 B;  1H2N A;  1IXB A;  1NR1 A;  3S3W A;  2YIC A;  2BTQ A;  4GUN A;  5B1O A;  3R66 A;  1H2K A;  3BAA A;  2HVK C;  4UVB A;  1PV0 A;  3E2E A;  1SET A;  3CRA A;  2ZXW C;  4JI1 O;  4NXM B;  3PN1 A;  3SJC C;  5LYJ A;  2AXT Z;  2WLL B;  2UXN A;  5LP6 C;  1WJZ A;  1EN6 A;  3H1K H;  2MW2 B;  2B1G A;  2QWQ B;  1WA8 A;  3QVN A;  3FB8 C;  4OGQ B;  1GH6 A;  3OD4 A;  4GYC B;  2O57 A;  4Q6G A;  2UUA B;  1YZB A;  2E3C A;  2H3O A;  3RYF A;  3W7X A;  4RWU A;  5IYZ A;  2EIK C;  5ITZ B;  2RCV A;  5J9P C;  5IY5 C;  1FFX B;  1S3J A;  1PM9 A;  4AI8 A;  2CK3 G;  3FYE B;  4RUE A;  2Q7G A;  4O4J B;  2PF4 E;  5LYJ B;  1KEC A;  1K3E A;  3IAY A;  1E79 G;  2WWW A;  2EIM C;  3JYC A;  4WFE A;  4JYB A;  1EZV H;  3JAL B;  3K06 A;  1KC8 W;  2DOS A;  1Q82 W;  2QKS A;  4MVU A;  4MTX A;  5A2Q N;  3CRQ A;  4Z1V A;  1Y74 B;  2N04 A;  2YSU B;  3LDD A;  4GCZ A;  1O9G A;  3FYI B;  3TGU H;  1K9M W;  2PGG A;  4Z1M G;  2FL4 A;  3SYP A;  1YXB A;  2YUA A;  5CA3 A;  5IYB O;  4X9Q A;  4HNA A;  4AQY B;  2IW5 A;  2GUZ A;  1RM1 B;  4KHP B;  2WLH A;  1X59 A;  3CE2 A;  4DR7 O;  3AG1 C;  4X65 B;  4UXN A;  1TUB B;  5DN6 G;  2DQ0 A;  2UXC O;  4LR3 A;  4LFB O;  4F4L A;  2XAS A;  4LF5 O;  3CSX A;  5JJE B;  1HNZ O;  2OTJ V;  2CGN A;  1RPR A;  1NTK H;  4J9Z B;  4FMT A;  2HJD A;  5B1B B;  5FLX N;  4O4I A;  4J10 A;  2UU9 B;  2FKX A;  3TXQ A;  1WP8 A;  3L75 H;  2DN9 A;  2YEV A;  3WG7 C;  2UXB B;  5CB4 A;  1SS3 A;  2ADQ B;  4IYI A;  4JTD B;  4FM1 A;  2QM4 A;  5LMN B;  1ZX3 A;  2N05 A;  2UUC O;  4LF6 O;  3K04 A;  1CEZ A;  3CRC A;  1Q8I A;  1NR7 A;  3CC7 V;  1R3K C;  2A06 H;  1MZF A;  1BE3 H;  1SRY A;  2EX3 A;  2ETN A;  4PDV A;  2N74 A;  4CH5 A;  1M90 W;  3L74 H;  4X62 B;  2KQX A;  2V1D A;  1V55 B;  5TIS Z;  3VQY A;  4PDR A;  3UKM A;  3AG4 B;  3AK3 A;  1N8R W;  3U11 A;  5IJ0 B;  4PJ0 Z;  1KP2 A;  3HKC A;  4JGS A;  3SYC A;  1XEQ A;  3P30 A;  2YIB D;  5KAI Z;  3DC6 A;  3SPC A;  4LF6 B;  5LP6 A;  1ZUQ A;  2ZKO A;  3ABL B;  1LUV A;  3D8C A;  2IM9 A;  4DXW A;  3UT5 A;  5FL7 G;  1NVP B;  2Q6A A;  4DV5 O;  1K7D A;  1N4C A;  4NTY A;  1NH2 D;  2PTM A;  2WLL A;  5A9G A;  1GM9 A;  1FXK B;  3TET A;  3JAS B;  1V55 C;  5ITZ A;  1XNR B;  1ZLZ A;  1S72 V;  1VIB A;  2E74 B;  3CCQ V;  3C90 A;  4JI3 O;  1XMQ B;  3B4S A;  5H6Q A;  3OR7 C;  1JMK C;  1CPY A;  2F93 B;  1GO3 F;  2LGW A;  1OCO C;  2LW7 A;  3A0H Z;  3EFF K;  3VQW A;  3JD4 A;  3UO2 A;  4LF5 B;  4FJC C;  4UCO A;  2FML A;  4LFC B;  5BMV B;  3P3N A;  3CXC U;  3KZI Z;  2AHZ A;  2OWO A;  1IBL O;  5C93 A;  1K4C C;  1MSD A;  3OR6 C;  1YTF D;  3ZX6 A;  2YXH A;  2GV9 A;  2ADP A;  4X1K B;  2EIM B;  1PNL A;  5KMG A;  1QNM A;  3OTF A;  4YIO A;  2ITD C;  4JI6 B;  4LNU B;  4MW3 A;  5EIB C;  1LNQ A;  4KXR A;  5J2U A;  3ZMT A;  4R50 A;  2F95 B;  3E86 A;  5JJN B;  2YC0 A;  3ZHQ A;  4TSF G;  5B1B C;  4FZ1 A;  4CC6 A;  4JI7 B;  4DR3 B;  3CP1 A;  3G6B A;  5CN0 A;  4RQF A;  2OCC C;  3SDL A;  1SC5 B;  2P6J A;  4QGP A;  5HFL A;  3T2M A;  3J81 N;  3CME V;  2DMX A;  1MG1 A;  3EHB B;  1EM1 A;  2XAF A;  1YCI A;  1WN7 A;  4JI1 B;  4O2A B;  4QIW F;  4LF8 O;  2Q0O C;  2PUS A;  1EN4 A;  1NKD A;  1GN3 A;  2QGN A;  5GON B;  1RSO A;  4DV4 O;  5KHI A;  5E79 Z;  4DUZ B;  3JAW A;  4WF9 V;  1WB8 A;  3BA8 A;  1BL8 A;  1ZL8 B;  1SKV A;  1AJP A;  4LWS A;  1V54 C;  4AIL C;  4LNU A;  5EC1 C;  2VWJ A;  2HJF C;  1IDS A;  3RYH A;  1RM1 C;  4BW5 A;  4GKJ O;  1RP3 B;  2PYL A;  3UM7 A;  1K4D C;  2VWK A;  3N2G A;  2WLJ A;  1BMF G;  3AEI A;  1VQ6 V;  3CRR A;  1PP9 H;  1SF9 A;  2QJ1 A;  3NXS A;  5B3S B;  2RDC A;  3CMA V;  4ZOL A;  2IU3 A;  1RFY A;  3RYH B;  3OEH G;  1L8D A;  1Y4M A;  2AW9 A;  1MAB G;  1R3J C;  1DLB A;  4GKJ B;  4ABM A;  5JJJ B;  2WSS G;  4B3S B;  1KKD A;  1VQN V;  1SER A;  4KL1 A;  3HKE B;  3JAW B;  1Q7Y W;  4F6E A;  2B1I A;  1P7B A;  3RVZ A;  3B09 A;  3CXH F;  3KKY A;  2JEU A;  2P67 A;  2AZ0 A;  1M1K W;  4TQD A;  3STL C;  2BSK A;  2ZD9 A;  2XOK G;  4P9P A;  4ZOL B;  4EFE A;  2EZP A;  2DWE C;  1VQ9 V;  3ZRX A;  4DV2 B;  4JI4 O;  4DYL A;  2Y0P A;  5CA0 B;  4DR3 O;  4LF4 O;  3K0D A;  4H33 A;  3Q4H A;  1K73 W;  5KHK A;  1OCR C;  1NI8 A;  1XDC A;  2Q67 A;  3QG5 A;  5BR8 B;  3BVO A;  1V9P A;  1FXH A;  4FLV A;  3PJS K;  4DR4 O;  4X89 A;  2YIA A;  1JOY A;  2JS5 A;  3SPG A;  4MVM A;  4UV9 A;  4HYO A;  3RN4 A;  3RYI B;  3H01 A;  4OPH A;  2CTW A;  3G6E V;  3E35 A;  3X2Q B;  2VQE B;  2ZIM A;  2HVJ C;  5LL6 Y;  3MHH C;  1I0H A;  1PD3 A;  4B3R B;  4DV6 B;  1OCR B;  2EJ7 A;  4WFG A;  4DK1 A;  1IBL B;  4YHH O;  4O2B B;  1P49 A;  3G4S V;  5C8Y A;  3L70 H;  4MSW C;  3SYQ A;  2V4D A;  3L9D A;  4I50 A;  2LFR A;  4BW9 A;  5H2F Z;  2QWR B;  2ATK C;  1KU9 A;  4FLX A;  2Y4T A;  1Z5V A;  4CC5 A;  2HG5 C;  4NXM O;  5IT9 N;  1K5Q A;  1OCZ C;  3C3T A;  2GBO A;  3WU2 Z;  2Y4U A;  3SR2 C;  4DV7 B;  3CYO A;  4G27 B;  2AGA A;  4LCU C;  2Z3Y A;  4CS2 A;  1AVM A;  3BRC A;  3H1I H;  3ZHU A;  5LXT B;  1HNZ B;  2P4K A;  2QE7 G;  5EBW C;  5GTI Z;  2A3Q A;  3E22 A;  4OPA A;  2F66 C;  2ZNI A;  1U96 A;  3G67 A;  4UVA A;  5CBH A;  5LHI A;  2IJK A;  5CA0 A;  3FB6 C;  4K35 A;  1M56 B;  3E8G A;  3ASN B;  4MTF A;  3FB7 C;  1BQZ A;  1Y76 B;  3CCM V;  1VQO V;  1AI5 A;  4J41 A;  1FJG B;  4HBN A;  2BSK B;  1JJ2 U;  4LFA O;  5LMU O;  3T1H O;  1N34 B;  3DTU B;  1W2B U;  4DR1 B;  3FKS G;  4JTA B;  1DF4 A;  3OGI B;  3DXR B;  4PA4 A;  4FLZ A;  4IT5 A;  2QSA A;  2WA4 A;  5JCO A;  3QNE A;  5KAF Z;  4C7U A;  2LFS A;  2ZT9 B;  2RMK B;  2JK5 C;  5LA6 A;  2EIN B;  3RBZ A;  3K58 A;  2RQ6 A;  3H1H H;  3E8B A;  4YJ3 B;  1M5I A;  3K57 A;  1F23 A;  4FM0 A;  3O9O A;  1VQ8 V;  1JQ0 A;  2CTQ A;  3EVK A;  4JV5 B;  1S5L Z;  2Q4P A;  2E5L O;  1N34 O;  3H1J H;  1PNK A;  3JAS A;  2QR4 A;  4B3M B;  3LDE A;  4E2L A;  3JAM N;  4MVS A;  3LNM B;  1X4T A;  5LGU A;  3L71 H;  3W7W A;  1N33 B;  2CUG A;  2VQE O;  4N21 A;  2B9Z A;  1TAE A;  3FAV A;  4FZ0 A;  4LFB B;  4W4L A;  3OM3 B;  1BQ0 A;  4DR2 O;  1K5S A;  1H2G A;  3DC5 A;  3K5O A;  5LHH A;  4B7E A;  3K5N A;  3ZRW B;  1VQK V;  1N0N A;  3ZMS A;  4O4H B;  3M7M X;  2X7R B;  4NB5 A;  1VQ5 V;  3W7S A;  5B5E Z;  2OT5 A;  2G38 A;  3A0R A;  5HFM A;  5IYC O;  2JEX A;  4ICG A;  3JAT A;  1N33 O;  4JYA B;  2L6L A;  3N2K A;  3CCU V;  1AP6 A;  5FNV B;  1JVM A;  3M8A A;  2HFE C;  1EN5 A;  3U0Z A;  1XOU A;  3TCU A;  1Q6I A;  5CMU A;  2GTS A;  4PHZ A;  4ZI7 A;  5CBF A;  3J7A U;  2LP7 A;  4QPK A;  1XIL A;  4DR5 B;  3CC4 V;  1XMO B;  2Y69 B;  3CS5 A;  4NTW A;  4O4J A;  1FPO A;  1PKX A;  4DRX A;  2Q69 A;  2XAJ A;  1R1B A;  3HKE A;  1Y76 A;  2IJH A;  1AJQ A;  1VF5 B;  1O9H A;  4K8X A;  3ABL C;  1SQV H;  2ZE5 A;  4AHC A;  5D5P A;  3K79 A;  3JAL A;  2GTA A;  3JAR B;  1HDJ A;  3N2K B;  4H13 B;  1E1Q G;  3KCY A;  1GM7 A;  2YXL A;  3ABK B;  4G28 B;  4GZR B;  2BE3 A;  4BIZ A;  2YXY A;  1DF5 A;  2FB5 A;  1G4Y B;  1QU7 A;  5GW7 A;  4UFZ A;  2JJ2 G;  3SYA A;  4X1I A;  4BIO A;  1F4N A;  1WLE A;  3BHP A;  5JQG B;  4L87 A;  5B1A C;  1N36 O;  1XHX A;  4J7Z A;  2YS8 A;  1HNW O;  3VBB A;  1TVK A;  4JI3 B;  2X6C A;  4NVP A;  1GM8 A;  4IYH A;  2YI9 A;  1F51 A;  5LMN O;  1K33 A;  4EKW A;  5FPO A;  4FIP C;  4LFC O;  5B1N A;  1R73 A;  1R6T A;  4LC1 A;  2ZE8 A;  3OTO B;  2F4V B;  5EBM C;  4QE7 A;  4I50 B;  2Y48 A;  4JI0 B;  2EIJ C;  5LMU B;  1QLE C;  3AG3 B;  3KCX A;  3I5D A;  4DR6 O;  2KG7 A;  2QM8 A;  4MT8 A;  4Q20 A;  1SQX H;  5K1X A;  1GRJ A;  3A0B Z;  2P5O A;  2W0X A;  1Q43 A;  3S3X A;  4B3R O;  5BZB A;  2YID A;  5KHG A;  5C8Y B;  3T1Y B;  2P22 C;  4EFB A;  3N2G B;  2YDE A;  3H1L H;  4PI2 A;  3D36 C;  4WFH A;  3ZJZ A;  2JS3 A;  2VQF B;  4JI5 B;  3GWO A;  1Q81 W;  5CB4 B;  1IBM B;  2IJJ A;  2VS0 A;  1R6K A;  4KHP O;  2R9I A;  3JAK B;  3LSU A;  5JVD A;  5IDJ A;  1QR8 A;  4YJ2 B;  4JI7 O;  3FB5 C;  5DED A;  5L3C A;  1VMG A;  3ASO B;  4OX9 O;  2R72 A;  1JFF B;  2R70 A;  1Z2G A;  4KFM A;  4O4I B;  4J9Y B;  4GX2 A;  1OZ0 A;  1JA8 A;  2KG7 B;  4I5S A;  4X64 B;  5IWA O;  2UXB O;  3RYI A;  1M56 C;  1HW7 A;  3FD9 A;  1NJI W;  3WFV A;  4GX0 A;  3JAT B;  1NZ6 A;  5EK0 A;  2EIK B;  4QJF B;  1PPJ H;  2P7T C;  2FYU H;  3K0G A;  4B7K A;  1QHT A;  3K08 A;  3OUF A;  3ABM B;  4CH3 A;  4O2A A;  3QO8 A;  2DQ3 A;  4U7O A;  4EB6 A;  1KB9 F;  4MVO A;  3T1C A;  4H0L B;  2EZO A;  2WAM A;  4ZBM A;  1P7G A;  5IWA B;  1W59 A;  4X64 O;  2QKA A;  4JI8 B;  1S5J A;  4X66 O;  3CCS V;  4AQY O;  4NXN O;  3JCU Z;  1NH2 B;  5IJ9 A;  4B3S O;  2RNB A;  3ZMV A;  1CP9 A;  1SQB H;  1Y67 A;  4I4T A;  5KHJ A;  4D7T A;  3UQ8 A;  1ORQ C;  3JD2 A;  4DR6 B;  1YJ9 V;  4TV9 B;  1GN6 A;  3ASO C;  2R9A A;  1JPX A;  3CRM A;  3T1H B;  4F6R B;  3FAV B;  1S0V A;  4FK5 C;  5H9C A;  3RYC B;  4JAU A;  4I7Z B;  4BWA A;  1Q3E A;  2BOB C;  2OCC B;  2ZNJ A;  4Z2W A;  4JTC B;  1XQ8 A;  1BZK A;  3E89 A;  2RJZ A;  1ROP A;  3NR7 A;  5F2V O;  1KKC A;  2OCH A;  4X8A A;  4WFB V;  3RW0 A;  1LR1 A;  2JRI A;  1I5X A;  3RYF B;  4UCR A;  3LSS A;  3WB0 A;  1YI2 V;  3K5L A;  4TUY B;  1M93 A;  3HR0 A;  5KX5 A;  2XT9 A;  1SZT A;  1N32 O;  3K5M A;  1HNX O;  4TV9 A;  1WPB A;  1ZL8 A;  4DV7 O;  5JVD B;  2UU9 O;  3ICX A;  2PY5 A;  3SJQ C;  2UXX A;  1SQG A;  2LQT A;  5AG2 A;  2M7W A;  4JYY A;  3SYO A;  5GON A;  3FFQ A;  2W6J G;  3IJ4 A;  4TOI A;  1HNW B;  1H8E G;  1VF6 A;  1GK9 A;  4P30 A;  1H8H G;  2WLI A;  3RT3 C;  2CTR A;  1Z5W A;  4X1K A;  3SGI A;  1VQP V;  4U3J B;  4QPJ A;  4IHJ B;  1IBK B;  4J7J A;  2CTP A;  4ZIB A;  4H37 A;  4NR1 A;  3R65 A;  2QDO A;  5BMV A;  4DV6 O;  5JWP A;  1IXM A;  1TA8 A;  1EBO A;  2DYS B;  1SQF A;  2IH3 C;  2ZDI C;  4HAM A;  2Q5Z A;  3AG2 C;  1WPX A;  3T4Z A;  2UXC B;  4XBF A;  1LUW A;  5KA6 A;  3CB2 A;  2GDS A;  2YIB A;  4LF4 B;  3DGE A;  2Q7E A;  4JPR A;  4O2B A;  2V7Q G;  4GX5 A;  4GLX A;  4JV5 O;  3AK2 A;  2ZE6 A;  5B3S C;  3QO7 A;  2K9P A;  2M6Y A;  1JFF A;  3CCR V;  4MTG A;  4FLU A;  1THZ A;  2UUC B;  4I9Q A;  2XTA A;  4CH6 A;  1DK1 A;  1AR5 A;  4DV1 O;  1D5N A;  1H38 A;  3CD6 V;  3CPW U;  1I94 B;  4U7N A;  1NQT A;  2P4V A;  3B2E E;  1V54 B;  4E4E A;  1QVF U;  4GT1 A;  4GKK B;  4B08 A;  2ZDI A;  2AHY A;  1G8M A;  3CJH B;  4JI2 B;  3N27 A;  1KP3 A;  5IYD O;  1FJG O;  2F1M A;  2CAZ C;  3HKC B;  4LF9 O;  1XNQ O;  4EB6 B;  1AI6 A;  3LDC A;  4X88 A;  3CCL V;  1QVG U;  3ML0 A;  4FLY A;  3IC7 A;  1QR9 A;  1EFR G;  2JGU A;  1SA0 B;  1XL6 A;  4JAS A;  5KUK A;  1QCE A;  3E22 B;  1ZWI C;  5LP6 B;  1I5Y A;  4UCS A;  3RFR A;  1B3Q A;  1G6U A;  4HZ3 A;  2ZE7 A;  4JI2 O;  5KUM A;  4LF7 B;  5IJ0 A;  1KMI Z;  5IJ9 B;  3HB3 B;  1F7Y A;  3H9V A;  4J42 A;  1R3I C;  1YEW A;  3MDS A;  4DUZ O;  3K59 A;  3VQV A;  4CBC A;  4NTX A;  4X66 B;  4NXN B;  2ZCE A;  3JSN A;  2Y69 C;  4LWS B;  1XMQ O;  1OCO B;  4JZG A;  2Q9L A;  1VP7 A;  2A9H A;  2R9R B;  1TUE B;  4PD4 F;  1XBL A;  2BCC H;  4DR1 O;  5LGT A;  3CC2 V;  5L3B A;  4LF7 O;  4LP8 A;  1GKF A;  1KYO F;  4YXW G;  1AP5 A;  4H44 B;  4PEL A;  1TUB A;  1AR1 B;  1M57 C;  4DR7 B;  3C3S A;  4FLT A;  4LBE C;  1FAF A;  4R6Z A;  2XAG A;  3DSQ A;  2EIL C;  4JI6 O;  1IX9 A;  2X6B A;  3TJT A;  1EZJ A;  1YHQ V;  3JD0 A;  4RAI A;  1D5A A;  3UT5 B;  1VQ4 V;  4DRX B;  3ABU A;  4I4T B;  4DR5 O;  4YJ2 A;  1HWY A;  4PV1 B;  3TK1 A;  2KKW A;  4WCE V;  2L35 A;  4LF9 B;  1XNQ B;  3IFX A;  4B3M O;  4A5U B;  3AG4 C;  1Q86 W;  1YJW V;  3E83 A;  4K0K O;  1FFT B;  2JDI G;  4O4H A;  1K92 A;  4LF8 B;  4X1Y B;  1IBK O;  1YSC A;  4TQF A;  2XHB A;  1I7F A;  1XNR O;  3WB2 A;  1AB3 A;  2F4V O;  1BCC H;  4I0X A;  3BA9 A;  1UJW B;  5FNV A;  4J7K A;  1KUQ A;  4JI4 B;  3SPJ A;  4DV0 B;  5KMG B;  4IIJ B;  1COW G;  1AI7 A;  1QQC A;  1FD9 A;  1Y74 A;  2DJV A;  2HEP A;  5LGN A;  3K9A A;  1RPO A;  4OXS A;  2ZR3 A;  2Y0I A;  4CS3 A;  5LOV A;  1YIJ V;  2QKC A;  3B8N A;  3HKD A;  3GB7 C;  3RWR D;  1SQQ H;  3JAR A;  1M57 B;  1VF6 C;  1WNS A;  4IIJ A;  2OTL V;  5BXZ A;  1WA8 B;  2QM7 A;  1E1R G;  3W7T A;  1MOF A;  3CHX A;  5J2T B;  1BSM A;  3QTC A;  4JF3 A;  1VEW A;  3OE7 G;  4UV8 A;  4DW1 A;  1XHZ A;  3BFR A;  1ARO P;  4FM2 A;  4L8J A;  5L3G A;  4ZHQ A;  3D36 A;  5IYZ B;  3QF7 A;  4U3F H;  4BAY A;  3F7Y C;  3CJH A;  1UPG A;  3ZHR A;  2DE0 X;  4JYC A;  3ZED A;  3OMN B;  5H6R A;  2BTO A;  1MNG A;  4LH6 A;  5GTH Z;  1S76 D;  2HHH B;  4GX1 A;  1L0N H;  2ZM6 O;  2LO1 A;  3L72 H;  3DXR A;  4JI8 O;  3K03 A;  1FYJ A;  4HNA B;  1YF2 A;  1NTZ H;  3ABK C;  4MW8 A;  4LH7 A;  2A0L A;  2JGD B;  4PA9 A;  1B04 A;  1NBM G;  2HLD G;  3HKD B;  4UB8 Z;  4K3A A;  4TUY A;  2B5U A;  2PYJ A;  4NKG B;  5IY5 B;  3E8F A;  3WG7 B;  5B1A B;  4ZHQ B;  4ZI7 B;  1KBH A;  3F5W C;  2GUZ B;  1W0K G;  1ENV A;  4DV3 O;  4B3T O;  2OYQ A;  1XRE A;  1ZTE A;  3BCC H;  4XDJ A;  2JGD A;  2HP8 A;  4I55 B;  3SPH A;  1YVW A;  4K0K B;  1OJH A;  5LXT A;  2ODM A;  3APO A;  1T5E A;  3ZRS A;  1OCC C;  3MD0 A;  4J80 A;  3THO A;  1Q6U A;  2JJ1 G;  2P90 A;  2YI8 A;  1YDX A;  5FPR A;  4X65 O;  3ZRV A;  2EIN C;  5BY1 A;  4PI0 A;  2XND G;  2EIJ B;  3A8T A;  2ZIN A;  4FFB A;  2WLI B;  3QO5 A;  1L0L H;  3HKB B;  5EZY A;  2ITC C;  1OHH G;  4MTO A;  1J5E O;  1MMM A;  1G1X B;  2W6I G;  3F7V C;  4CH4 A;  2P06 A;  1TGO A;  2WLN A;  4CS4 A;  3STZ C;  2E5L B;  1I94 O;  2Q73 A;  4PA7 A;  2WA3 A;  4P9O A;  5LOV B;  4DV2 O;  3ZS8 C;  3D3I A;  2UUB B;  4IGG A;  3GVM A;  2DYS C;  2WLM A;  2Q7H A;  3J80 N;  3RVY A;  3CCE V;  2WPD G;  3ZMZ A;  4DW0 A;  1FKA O;  3VOU A;  1JJO A;  4ASU G;  4UCT A;  5LHG A;  1P4R A;  1SZX A;  3G80 A;  2H94 A;  1SES A;  3OT7 A;  3LSQ A;  1OCZ B;  4X1Y A;  1N36 B;  5EBL C;  4U3J A;  1R3L C;  1OCC B;  5JH7 A;  4P2Z A;  1IZ3 A;  1K97 A;  3HPL C;  3P32 A;  1VQL V;  3RGB A;  4UCV A;  3JAK A;  4QE9 A;  1UFI A;  4FVM A;  3D3Q A;  3K3W A;  5L3D A;  1BGY H;  3SJA C;  2DYR B;  4X20 A;  1N0J A;  1GAX A;  1AR4 A;  3M99 B;  4I0X B;  2HR3 A;  4R7C A;  1NTM H;  4JAV A;  4MS2 A;  3ZRW A;  5E1A C;  4RQE A;  1QLN A;  4PA3 A;  3OTO O;  3JCZ A;  2D3O W;  1AI4 A;  4KUM A;  1AJN A;  4FPP A;  1NU1 H;  4F6R A;  2D2C B;  4X20 B;  3KG2 A;  4NYK A;  4UB6 Z;  5EYP A;  2LGQ A;  2CH7 A;  3BY6 A;  4MVR A;  2QA4 V;  1Q90 D;  4N23 A;  3OEE G;  3UO3 A;  2EJR A;  3ABT A;  3AG1 B;  2QWP B;  2PZS A;  2XAH A;  1I08 A;  2FTK A;  1U97 A;  1M9N A;  1KD1 W;  2ZIO A;  3AG2 B;  4DUY O;  3Q4H B;  1H2L A;  2QWO B;  1HR0 B;  1R6N A;  2LW1 A;  4YIP A;  1J5E B;  4W4K A;  3K9S A;  1KQS U;  5K1P A;  2OIG A;  1B06 A;  1WAZ A;  1FXK A;  1OV9 A;  1YTF B;  1H2S B;  1US6 A;  4DUY B;  1QLE B;  1XL4 A;  3ETG A;  1M4U A;  3ZN1 A;  4YHH B;  1GMG A;  4J11 A;  2UUB O;  4D6T H;  4JYA O;  2CE4 A;  2CDY A;  1DTO A;  4YJ3 A;  4TT3 G;  2HKO A;  4D7S A;  4BR6 A;  2IBZ H;  4FFK A;  4XDK A;  3BAB A;  5L3F A;  4IHJ A;  2WLK A;  3GWK C;  4DO2 A;  3LUT B;  3ZHS A;  4EEQ A;  2GHY A;  2GSM B;  4DV4 B;  3G71 V;  1NVP D;  5KLV H;  2ZXW B;  2E76 B;  3RYC A;  1XMO O;  5J2U B;  2ARH A;  4I55 A;  1CXZ B;  2IJI A;  4O4L A;  3OMA B;  2QWN B;  2ILM A;  1P84 F;  2KB1 A;  3OAA G;  4K8Z A;  1L1F A;  1JCH A;  2Q0A A;  5KA5 A;  1URF A;  4YY3 B;  5KHH A;  1PL0 A;  2A7W A;  1MSW D;  2RN9 A;  4BIU A;  2VRZ A;  3JSL A;  1BHB A;  1FS0 G;  2Z5U A;  2ZR2 A;  4PDM A;  2OIE A;  4O4L B;  1J95 A;  1ZAU A;  3ETD A;  1QBZ A;  4WBN A;  4DR4 B;  3A2F A;  1BS3 A;  5B66 Z;  1GTO A;  3T1Y O;  3AG3 C;  3U10 A;  3VQX A;  1S77 D;  2CH7 B;  1DGS A;  2EBO A;  4X62 O;  3W7U A;  3ZHT A;  2MK3 A;  1TVK B;  1SQP H;  4PA6 A;  2H8P C;  1F4M A;  3OFN G;  4XDL A;  2LJ2 A;  3EXA A;  4ZKI A;  2UXD B;  4X1I B;  2BTQ B;  3HKB A;  5EZY B;  2F23 A;  2DWD C;  1XUQ A;  2IH1 C;  2F43 G;  3CWB H;  4JZ2 A;  5KX5 B;  1HR0 O;  3P3P A;  1JX9 A;  1YIT V;  1BHA A;  1AIL A;  1H2M A;  4MVZ A;  2QTO A;  4DV5 B;  1PL4 A;  4R8C A;  2X0L A;  5IE9 A;  2NNU A;  3SPI A;  2UUA O;  4TV8 B;  3APQ A;  3MHS C;  4DK0 A;  2ZQM A;  2XUM A;  5EC2 C;  3MAQ A;  3IGA C;  1NS1 A;  2NN4 A;  3ETE A;  5DEC A;  1A32 A;  2IU0 A;  3TXS A;  2Q68 A;  2UXD O;  3I56 V;  5EIB D;  1BT8 A;  3JD3 A;  1Q6H A;  1VQM V;  4MVQ A;  3CEI A;  4I9W A;  4JI5 O;  2Z0A A;  2K1E A;  4WFA V;  4IL6 Z;  5CBG A;  1K8A W;  3WB1 A;  2NLJ C;  4TWK A;  1Y6X A;  1PNM A;  4RUF A;  5EYP B;  2AZ2 A;  3BEH A;  4DR2 B;  4OX9 B;  1FXK C;  1HP8 A;  2KSD A;  2CGO A;  2JIZ G;  5JH7 B;  1YJN V;  3E8H A;  1GN2 A;  5LBQ A;  1MA1 A;  2Q8V A;  5BR8 O;  3L73 H;  3F5T A;  2E75 B;  2YEV B;  3AK1 A;  5L3E A;  4DV1 B;  2C2A A;  3X2Q C;  4RO2 A;  4CZZ A;  3AG7 A;  5CA1 B;  3T4D A;  4DV3 B;  3JD1 A;  4DV0 O;  3FX7 A;  1GN4 A;  5LA6 B;  3B40 A;  2PI4 A;  4YY3 O;  3ASN C;  4FFB B;  2BOC C;  4WFF A;  1SA0 A; 
#chains in the Genus database with same CATH homology
 2VS0 A;  2KG7 A;  1WA8 B;  2DE0 X;  3FAV B;  3GVM A;  3HR0 A;  2B9Z A;  3FAV A;  1WA8 A;  3GWK C;  3O9O A;  3Q4H B;  4LWS A;  3OGI B;  2KG7 B;  4I0X A;  2AZ2 A;  3G80 A;  3ZBH A;  2AZ0 A;  4GZR B;  3Q4H A;  3FD9 A;  2VRZ A;  4I0X B;  4LWS B;  3TXS A;  4ABM A;  3TXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...