3GWKC

Structure of the homodimeric wxg-100 family protein from streptococcus agalactiae
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
b'GAMSQIKLTPEELRSSAQKYTAGSQQVTEVLNLLTQEQAVIDENWDGSTFDSFEAQFNELSPKITEFAQLLEDINQQLLKVADIIEQTDADIASQISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein SAG1039
publication title WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
pubmed doi rcsb
source organism Streptococcus agalactiae serogroup v
molecule tags Viral protein
total genus 42
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3gwkC00
4LWSB 3HR0A 2KG7A 3GWKC 3TXQA 3TXSA 3GVMA 2VRZA 2KG7B 4ABMA 4I0XA 3FAVA 2VS0A 1WA8A 4GZRB 2B9ZA 3Q4HA 3O9OA 4I0XB 4LWSA 3FAVB 3OGIB 3G80A 1WA8B 2AZ2A 3ZBHA 2AZ0A 2DE0X 3FD9A 3Q4HB
chains in the Genus database with same CATH superfamily
4TV9B 1FAFA 3CRAA 2XAGA 4MVSA 4LR3A 3ETEA 3ZX6A 1YVWA 1VF5B 1EM1A 3CPWU 3R66A 3TGUH 4P30A 1PL0A 4O4IA 2NR5A 3LNNA 3CJHB 1S72V 3ZHQA 1GH6A 1W0JG 3OR6C 1MSDA 4ZBMA 3ABKC 1UJWB 5IY5B 4B7EA 1D5NA 2KB1A 1DTOA 1OCZB 3I56V 4X1YB 4H44B 1IBKO 2UXXA 2VS0A 1S0VA 1US6A 3OTOO 2HVJC 1N32B 1SRYA 1F23A 5EYPA 1V55C 1S5JA 1R3KC 2H94A 2GUZB 1JJOA 3ZRVA 4JI3O 4DV5B 2WLLA 1N36B 3H9VA 1SA0A 5LGTA 1KQSU 2N04A 2LFRA 3NR7A 2B1GA 3DXRB 2L35A 3K59A 3T1YB 3SYPA 3X2QB 1OCZC 1AJNA 1Z5VA 4DR6O 3JD1A 4U3FH 3UCSC 1IXMA 4N21A 2GBOA 5LGNA 2HHHO 4GUNA 4I55A 4B3MO 3A0RA 2WAMA 4C7UA 1HW7A 3ZRWB 5CA0A 1RM1B 2UUAB 2JK5C 1M90W 3RYHB 3QO7A 3FAVA 1H2LA 1JA8A 3CCQV 3I5DA 3VQVA 3L70H 2PTMA 4TV9A 1PL4A 1R6TA 4HAMA 5L3BA 3A8TA 3T2MA 2EILC 2YEVB 2F66C 1YHQV 1FYJA 1I5YA 1BQ0A 1AI6A 3H1HH 4X1KA 1OCRB 1GM8A 3E8FA 2PUSA 1GMGA 1HP8A 3CJHA 1NT2B 2ZD9A 3CX5F 1TUBA 4JI4O 1BHBA 3B2EE 3CB2A 4X1YA 3H1KH 3J81N 4IGGA 4FM1A 4PV1B 4YY3O 3E2EA 4HYOA 2AXTZ 1J95A 4FLTA 3BRCA 3ABMC 1Y4MA 2GUZA 1YF2A 3BAAA 1OCRC 1QLEB 1VARA 4O4JB 2LJ2A 3CXHF 1N0JA 4O4LB 3DXRA 1SC5B 4DV6O 4I5SA 5IJ9B 4J10A 3CCRV 3ETQA 1YZBA 4UVAA 4UXNA 2QEXV 3D36A 2Y0PA 3BVOA 4GYCB 3UO3A 4FLVA 3ML0A 5EC2C 4JI2O 4GX5A 1IDSA 1P49A 2PI5A 1FJGO 1AJQA 2HVKC 1AVMA 3ASNB 1QBZA 2UXDO 1JX9A 3FB5C 1QLEC 2Q68A 2JEXA 3CCSV 4DV3O 4MVMA 4GX2A 2KQXA 2AHZA 2F93B 4W4LA 4FFKA 3GVMA 1H38A 1ZLZA 3RYFB 1QR8A 3ZMZA 4LFCB 4GKJO 2ZXWB 1XMOO 1NQTA 3U11A 2YEVA 3P3PA 5GONB 3OGIB 4NXMO 1N8RW 1HR0O 3K5LA 2ZE5A 1K97A 1SQGA 4J9YB 3K5OA 1SF9A 2EJ7A 1FS0G 3CP1A 3OTFA 3F5TA 2QWQB 5DEDA 2WLIB 3K0DA 2ITDC 1SQFA 3RGBA 4QPJA 1M56B 4ASUG 4UCVA 4LF5B 4ZIBA 4DUZB 3AG4C 4JI7O 1Y76B 2EINB 1GM7A 4JTAB 2KG7B 3RVYA 1NH2D 5L3FA 4JI8B 4O4JA 1BT8A 4ZKIA 2WWWA 2QKCA 4O4LA 1IURA 2N74A 4JAAA 1HNZB 5IJ9A 5J9PC 1TVKB 4F6RB 1M56C 3ZBHA 2DYSB 1Z2GA 3DGEA 3W7WA 3LUTB 2UXCO 4DK1A 2RJZA 2BCCH 2DW4A 2YC0A 3BEHA 1XOUA 4X1IB 2IH3C 5EZYA 2WSSG 1Q90D 5CB4B 1SQPH 2Q73A 3ZRSA 2IJHA 3OUSA 2XHBA 4O2BB 4DK0A 1VQLV 4MW8A 3EVKA 1XNQO 4X65B 3RYFA 4OX9O 4KXRA 5C8YB 1FPOA 1KYOF 3CRRA 2PI4A 3VBBA 3ZMTA 5GONA 1O9GA 1RFYA 3CCJV 2A9HA 1TUEB 4X64B 3PJSK 2P06A 3JSNA 1Y74A 2WLIA 1B6QA 3JASB 1XNRO 3CEIA 1DF5A 2ZIMA 4LP8A 1FFTB 3CCLV 3L9DA 1OCOC 3SDLA 2CUGA 2P4KA 4X20A 2IJJA 4MVOA 2QSAA 3S3WA 2ZE8A 5B3SB 2OCCC 1KU9A 4NKGB 1BS3A 1RSOB 1Y76A 3AG1C 4D6TH 4DR2B 2E75B 5J2UB 4DV7B 1Q6IA 4QIWF 1R3IC 3QTCA 1WAZA 4FK5C 4JI5O 1KD1W 2X6AA 2F1MA 4LH7A 1EZVH 4X66O 3CWBH 4CH6A 4FFBB 3ZN1A 5IDJA 3SPCA 5LMUO 1Q43A 4FLXA 2XTAA 2EBOA 3EHBB 4X1IA 1TGOA 5CB4A 1NR1A 1QVGU 3JSLA 4MTFA 4O2BA 2NNUA 5LYJB 3B40A 4JTDB 2FMLA 4G27B 1LNQA 3AK3A 1XMQO 4FLWA 3B8NA 2FTKA 4MTXA 5C8YA 5CA1B 3TK1A 5AG2A 3RYCB 1I94B 3CHXA 5ITZA 3WG7B 4GX0A 3UT5B 4UFZA 3BHPA 3CCMV 4J7KA 1S76D 2ADPA 1Q8IA 2BTOA 2NN4A 3HKBB 2Q0OC 3JASA 4UCRA 2ZM6B 4B3RO 4L87A 3L71H 1ZTEA 2XOKG 2OWOA 3ZMSA 2ZCEA 2DYRB 4BAYA 5LGUA 4WFHA 1K5QA 3HKDB 2QM7A 4RQFA 4XDKA 4DR5O 5L3CA 2YIBD 5L3DA 3WG7C 1AP6A 1RSOA 1PV0A 1M57C 5GTHZ 4DO2A 3K9AA 1PNMA 1TA8A 1KP2A 1FXVA 2DE0X 4AQYB 1D5AA 2Y48A 3T1HO 2IM9A 5KA5A 4IYHA 4DRXB 2BE3A 1PD3A 2XAFA 2A06H 1O9HA 4FFBA 3HKCB 1YJNV 2X0LA 5KA6A 4FM2A 2OIGA 2ILMA 3STZC 1VQMV 2R9RB 3JD4A 1SQBH 1Q82W 1QCEA 5EIBD 1NH2B 4DR7B 2E3CA 4UCOA 4DV2B 3BABA 3SGIA 3LDDA 2DQ3A 4PA6A 2DN9A 4DYLA 4DUYO 5LYJA 1XL4A 2YXLA 4H0LB 3D3QA 4DW0A 5CA1A 4JI0O 4KHPO 2EIJC 1VQ9V 5EBWC 2Y69B 3S3XA 3UT5A 4BIOA 5IWAO 5LA6B 3AG2C 4NXNB 2QM8A 1YIJV 3ZRXA 3TJTA 2G38A 1BMFG 3HKBA 3SJAC 2YSUB 2OTJV 4IIJB 2FKXA 1G1XB 3JATA 5EK0A 2WLJA 1I5XA 4PDRA 2GV9A 2GTAA 4PD4F 2HP8A 3G80A 4LFAO 4YIPA 3HKDA 1SS3A 3B77A 4CS4A 4LF9B 2Q4PA 5BZBA 1MMMA 3M8AA 4LF8B 3J80N 1AJPA 3ZMUA 1Q86W 4K35A 1VEWA 4LF4B 2DOSA 4GKKO 2OIEA 4DXWA 4PDMA 1M5IA 2UXNA 1ZAUA 1JOYA 1DF4A 4LCUC 4I0XB 1YITV 1NJIW 3CC2V 2P4VA 5KAIZ 1CEZA 2IBZH 4JI1O 4DRXA 4CC6A 2VQFO 3HKCA 1A32A 3KCYA 2Q69A 5HFLA 1NTKH 2OT5A 2XAQA 5B1BC 4EB6B 1BCCH 2AHYA 2F23A 3C3TA 4U7OA 2HEPA 2V7QG 3JYCA 1KBHA 3ZHUA 1XQ8A 5LHHA 3F7YC 1MOFA 3BCCH 3OR7C 4PJ0Z 2AGAA 3ETDA 4WFGA 4CC5A 3IC9A 2EZPA 1YDXA 4LH6A 2Y4UA 3G4SV 2XAHA 1AROP 2OTLV 2ADQB 1URFA 3K58A 2RQ6A 5IYBO 1VQKV 3R65A 1VIBA 4CS3A 1Q6HA 5LMNO 1U96A 2JGDA 3FYEB 1EFRG 2XT9A 3OT7A 1BGYH 4J9ZB 3SJQC 1S5HC 2ZT9B 3ZHSA 4DW1A 1YTFB 2QM4A 3LDEA 1EBOA 4R7CA 1WB7A 1WB8A 5IY5C 4DR4B 3SJBC 3GB7C 3O65A 1NZ6A 1P7BA 3E22B 1IVSA 2PGGA 5KX5A 2Q7EA 1S3JA 3B4SA 4NB5A 3ABUA 3E86A 2GSMB 4H37A 4LWSB 3HR0A 1IBLO 1KB9F 4EFEA 4ICGA 1K7DA 1VQ6V 1DLBA 4DV1O 3KZIZ 4TQFA 4F6EA 4P9PA 3F5WC 4ZHQB 5IJ0B 2E76B 3K08A 3CSXA 3X2QC 3D36C 4LFBB 3ZMVA 4EKWA 2DWEC 2CH7B 4MVQA 3IGAC 4K0KB 1L1FA 2BOBC 2PF4E 4CZZA 1YCIA 2JGUA 1SZXA 4J80A 1RM1C 2DJVA 4JV5O 5K1PA 3RWRD 5CMUA 2HG5C 4DV4O 1AP5A 1LR1A 1F4MA 1WNSA 4JYYA 4AILC 3JD3A 4J41A 1SESA 1ZX3A 5FLXN 3H01A 1BL8A 3A0BZ 1SZTA 4JZ2A 4Z1MG 4X9QA 2QKSA 1V54B 4DR3O 1OJHA 3E8BA 3JCZA 1AR5A 4NTWA 1JR9A 2CTPA 2JEUA 3KCXA 1I0HA 1V9PA 2JS3A 4FJCC 1IBKB 5H6QA 4YJ2B 3OTOB 2WPDG 3SPGA 4JAUA 4DR1O 4TT3G 3HB3B 5F2VO 3I55V 3OUFA 2KKWA 4JI3B 2BOCC 1IZ3A 1V54C 3C3SA 1GN2A 2JIZG 5JJNB 1VQ7V 5D5QA 2A79B 3ZRWA 2R9AA 4X62O 1JVMA 4DR6B 3L72H 3RYHA 4NR1A 4JI6O 4R6ZA 3QNEA 4ZHQA 2EIKB 4J11A 4B3MB 5C93A 4RQEA 2QWRB 2WLMA 1W2BU 5BMVB 2JJ2G 4AHCA 3CCVV 5LOVB 5JVDB 1WPXA 5A2QN 3ASNC 1ZWIC 3E8HA 1XUQA 1ROPA 2ZNIA 4P2ZA 1HNWO 2EIMB 2IJKA 4D7TA 3JD0A 4DV0O 2BTQB 4RWUA 2EIKC 4FLZA 1WP8A 1PNKA 2RNBA 3EXAA 4FPPA 2PZSA 2F4VO 3BA8A 4PA9A 3OD4A 4B3TO 5BXZA 2ZXWC 4JGSA 4E2LA 2BSKB 1KKCA 1QHTA 3TXQA 3CE2A 1S77D 1JQ0A 3E83A 4AI8A 1E1QG 4TSFG 3FKSG 4JI4B 4B7KA 5BY1A 4UCTA 2VWKA 1F7YA 2EIMC 1CP9A 1WPBA 1I08A 1MA1A 1R6KA 4YJ2A 5KHHA 2OYQA 3VOUA 3K06A 5L3GA 4MVUA 4PELA 4GLXA 5LXTB 1I7FA 1AR4A 1NVPD 2GHYA 2GTSA 2LP7A 3QVNA 4HNAB 5JCOA 4ZI7B 4TWKA 4DV6B 4UCSA 2EINC 1KP3A 3N2KB 1FXKB 2Q6AA 2UUBO 1JFFB 5IYDO 2EX3A 2R70A 1J5EO 5BR8O 4NYKA 3GWOA 4PA4A 4JI2B 2UXBO 5KUKA 1RPOA 3LDCA 2DYSC 5FNVB 5BMVA 3G71V 3JAKB 3OAAG 4JPRA 4DV3B 2CDYA 2Q5ZA 5LOVA 1I94O 3K57A 1E79G 1M1KW 5JVDA 3JD2A 4BIZA 1N33O 1PNLA 1FXKC 5KMGB 1IX9A 2E5LO 1XHXA 4HBNA 4GKJB 1UFIA 1OZ0A 1XMOB 2QA4V 2QGNA 2BTQA 4NXMB 5JQGB 3VQXA 2JRIA 1HR0B 3E8GA 2ZQMA 1IXBA 4QNHB 3B09A 3M7MX 4PA3A 5KHIA 2ZNJA 3SYCA 2BSKA 5CBGA 4IYIA 2IU3A 3FB7C 5IYZB 1L0NH 2ZE6A 2KG7A 2RMKB 4OGQB 2HJFC 4QE9A 2VQEO 4JI7B 2UU9O 1PM9A 1TVKA 4F6RA 2NLJC 3DTUB 5LXTA 4MW3A 3SPIA 3MAQA 1B06A 2QTOA 4EFBA 4ZOLB 5B3SC 5D5PA 4ZI7A 2DWDC 2CTWA 3WB1A 5LP6B 1FXKA 3N2KA 4Z1VA 1JFFA 4DR7O 2UUCO 4FLUA 4DV2O 5EBLC 1WP7A 2UXCB 4O4HB 2N05A 1Q5OA 1KUQA 3JAKA 4O2AB 1YJ9V 1T5EA 2E74B 4B3SO 2P6JA 1RP3B 3AG7A 1AI4A 2MW2B 1Y67A 4LC1A 3MDSA 4I7ZB 4OX9B 3WU2Z 5KMGA 3OMIB 4K8XA 4NXNO 1FFXB 4Q20A 3LSSA 3QF7A 1B04A 3VQYA 1QLNA 2EZOA 3ICXA 3OMAB 5JQGA 2ZR3A 3Q4HB 1GM9A 2CGOA 2HFEC 1EN5A 1GK9A 3AG3B 3MHSC 1XNRB 4LF9O 1H2KA 1K3EA 4BW9A 1HDJA 2Y0IA 5J2UA 4LF6O 3HKEB 1N34O 4LF4O 4KP4A 4U3JB 1BE3H 4BW5A 1H2SB 2H3OA 2JVDA 4MTOA 2D3OW 3CRQA 5LBQA 2LGQA 2DYRC 2WA4A 3G6EV 2ZINA 4ZOLA 5FPRA 4FMTA 3CXCU 4J42A 3AG3C 5CBHA 1K33A 4JZGA 1GAXA 5KUMA 3JAWB 4I4TB 1VQ4V 1XREA 1MABG 1P4RA 4X66B 2QJ1A 1GTOA 2Z0AA 2ARHA 3VQWA 4FVMA 3CC7V 4E4EA 1PPJH 3OW2U 3H1IH 1K8AW 3P3NA 5EBMC 1JMKC 1NKDA 5LMUB 4KUMA 2V4DA 3UKMA 3L75H 1NVPB 2C2AA 4MVZA 4IHJB 2RCVA 2X7RB 4O2AA 3RYCA 2IU0A 1JJ2U 1UPGA 5CA3A 3C90A 2A7WA 1XMQB 1N32O 4BWAA 1QU7A 4BR6A 1B3QA 2WLKA 3RBZA 2ZDIA 1F4NA 1RPRA 1GKFA 4DV5O 2XASA 1N36O 3Q4HA 1VQOV 4UVCA 3FFQA 3ABLB 1X59A 3T1YO 5EYPB 2Y69C 2JJ1G 3EFFK 1G8MA 3LSUA 3OE7G 4PDLA 4K8ZA 5A9GA 3HKEA 3W7UA 4UB8Z 2W6IG 4LBEC 2YI8A 3QG5A 4U3JA 1IBMB 3G6BA 3AEIA 5KHJA 2UUAO 4DR5B 2P22C 4MVRA 4MTGA 4NVPA 4RO2A 1NBMG 4WF9V 2ITCC 3H1LH 1YI2V 1K4DC 5E1AC 3ABLC 3JAMN 2AW9A 5GW7A 5KHGA 4KFMA 2QTSA 5B5EZ 3T1HB 3L73H 3SR2C 1NU1H 1XL6A 1F51A 3ABKB 3U0ZA 3P30A 1W59A 4IHJA 3ZIAG 2DQ0A 2LQTA 1Y6XA 2YS8A 1XDCA 4DUYB 1V55B 2CE4A 3AK1A 2F95B 1LUVA 4X1KB 2M6YA 5LA6A 1JPXA 5B1AB 4JI0B 1Q7YW 3FX7A 4IIJA 4KHPB 1TUBB 2K9PA 3RW0A 4FIPC 1NS1A 4UV9A 5IWAB 1W0KG 2X6CA 5KAFZ 4YIOA 3OEEG 4R50A 1K73W 1HNXB 3BFRA 4G28B 5JH7B 3D3IA 2LO1A 1VF6A 5B1AC 3RVZA 4LFAB 2YICA 1R6NA 5TISZ 4I0XA 1R3JC 3E89A 1XEQA 2IH1C 3DSQA 3K9SA 2WLHA 1KC8W 2EILB 3W7SA 4GKKB 4HZ3A 3ZHTA 4EB6A 3T4ZA 3W7XA 3K3WA 4LFCO 3WB2A 4JYAB 2QR4A 4JI1B 3MD0A 1M9NA 4YHHB 3IJ4A 4LF7B 2VQFB 4PI0A 3SYAA 1YJWV 1QR9A 1LUWA 4CS2A 1GO3F 2QE7G 4TUYB 3FD9A 5B66Z 2IJIA 3UM7A 3SYQA 2FL4A 4FZ0A 3JARB 3ABMB 4YJ3B 4GX1A 1XBLA 3B8MA 2Y4TA 5IYCO 4LF5O 2HLDG 2PYLA 4Q6GA 1NTMH 4DUZO 2JS5A 2B1IA 3FYIB 2EULA 1G6UA 2W0FC 5JJEB 1BHAA 3APQA 2Q7GA 1K4CC 2B5UA 2Q67A 4MT8A 4JI8O 2MK3A 1K34A 4KL1A 5LMNB 3RYIB 2RN9A 2P67A 3ASOB 1HNZO 3E22A 4ABMA 5DECA 5EIBC 4UB6Z 4I9QA 1ORQC 3THOA 5JH7A 1X4TA 1OV9A 4LWSA 1G4YB 1JCHA 2L6LA 5KLVH 5CBFA 3OMNB 1GN4A 2VWJA 3CRCA 3M99B 1M93A 1OCCB 1FD9A 1HWYA 1L8DA 3CMAV 1VQ5V 4XBFA 3RFRA 1Q3EA 5LHGA 3BPZA 1N0NA 5IJ0A 2HHHB 2XUMA 2YI9A 2YIBA 1SETA 1ZSPA 1N4CA 3ASOC 4X65O 4B08A 1IBLB 3IC7A 5EZYB 4DV1B 2CH7A 1CXZB 3TCUA 1CPYA 3JCUZ 2PYJA 3T1CA 5JCOC 1DK1A 1D2DA 1K5SA 1K92A 1EZJA 1Q6UA 3NXSA 4PHZA 3JALB 4X64O 1YSCA 1OCCC 4H13B 3FB8C 2RDCA 4TUYA 2W6JG 2Q8VA 3AG4B 3QO8A 1AILA 4MSWC 3JARA 4RUFA 4CH3A 4YJ3A 3ETGA 5H6RA 1QNMA 1KECA 4JV5B 2P5OA 3CC4V 3RN4A 4J7ZA 4DV4B 2CTRA 1Y74B 4QE7A 2LW7A 4DR2O 4I9WA 4YY3B 4X20B 4DV7O 2ZIOA 1P84F 2LFSA 3RYIA 2EJRA 4DR3B 1R3LC 1WA8B 1MZEA 1FXHA 2W0XA 1VF7A 1WLEA 4QPKA 2QWOB 5CN0A 3DC6A 1KKDA 2VRZA 3CCUV 4TV8B 5JJJB 4DR1B 1E1RG 3ZHVA 1YEWA 3OGCC 3SYOA 1S5LZ 1ENVA 5K1XA 4IT5A 2QWPB 4WBNB 3CMEV 4QGPA 2CK3G 3RT3C 1MSWD 4F4LA 4X89A 1Y66A 1FJGB 3BY6A 3WFVA 3KG2A 4WCEV 1AI5A 4GT1A 2UXDB 2ETNA 4X62B 4MS2A 3ZJZA 2LW1A 4JYBA 2KSDA 2Q0AA 4JI6B 4CBCA 2HR3A 5IE9A 1H2GA 1OCOB 3JALA 1XILA 3G67A 4UUJC 3SJCC 1VQ8V 1SQQH 4TQDA 4JYCA 2XNDG 4G2KA 4QJFB 2ZM6O 5ITZB 2CTQA 3U10A 5B1OA 2OCCB 5J2TB 4JF3A 2B9ZA 4PA7A 4PI2A 1HNWB 2ATKC 2XAJA 3AG1B 3APOA 2H8PC 2D2CB 4H33A 1THZA 4Z2WA 3A0HZ 4DV0B 2HKOA 4FM0A 2F4VB 3H1JH 4OPHA 2PY5A 4B3TB 4GCZA 3SPHA 4FLYA 5EC1C 1WA8A 2Z3YA 4AQYO 3T4DA 2A3QA 5KHKA 1MG1A 4UVBA 2Q7HA 3F7VC 4TV8A 4HNAA 1EN6A 1R73A 1PKXA 5B1NA 3D8CA 2A0LA 1GN3A 3HPLC 3ZN0A 3CCEV 3LNMB 3TETA 1SKVA 4WBNA 4NTYA 4N23A 2OCHA 5DN6G 3CD6V 5L3EA 2F43G 3K03A 2WA3A 1MZFA 1PP9H 3KKYA 5LL6Y 1XI1A 1NR7A 5FNVA 1BZKA 2K1EA 2UUBB 3K04A 3N27A 1M4UA 1J5EB 2V1DA 3AK2A 5BR8B 4YXWG 3UO2A 2ZE7A 4W4KA 2UXBB 1XNQB 4I50B 4WFBV 5LP6C 4P9OA 2WLNA 2X6BA 1NTZH 3ABTA 1YTFD 3N2GB 1BQZA 3K79A 4XDLA 4D7SA 3OEHG 2O57A 1N33B 5J2TA 5H9CA 1M57B 1Z5WA 4IL6Z 2E5LB 2ZR2A 1YXBA 4WFFA 2LGWA 4RUEA 3STLC 1VQNV 3OM3B 5IYZA 1BSMA 4R8CA 4LF8O 1NI8A 2ODMA 3JATB 1WN7A 5LHIA 3UQ8A 2YXHA 2AZ0A 2M7WA 2ZDIC 3K0GA 2GDSA 3E35A 1TAEA 1IBMO 2IW5A 1H8HG 4X88A 4LNUB 1R1BA 1OHHG 2YIAA 4U7NA 4EEQA 4NTXA 2P90A 2HJDA 2YDEA 3BA9A 4UV8A 1ZL8B 1KMIZ 4L8JA 2Q9LA 2R9IA 5H2FZ 3CS5A 2VQEB 4JI5B 1QVFU 5LP6A 2UU9B 3W7TA 1Q81W 3ZCCA 1WJZA 3SPJA 4X8AA 3LSQA 3A2FA 1COWG 3K5MA 1SERA 1AB3A 1U97A 2EIJB 1GRJA 1MNGA 3QO5A 4O4HA 1SQXH 1FKAO 2Z5UA 3IFXA 4K3AA 2QWNB 3AG2B 2UUCB 5FL7G 3GWKC 4I50A 1DGSA 5IT9N 5FPOA 2YXYA 4O4IB 3ZS8C 3K5NA 2FYUH 4OPAA 1XHZA 3IAYA 3DC5A 1FFXA 3N2GA 2QKAA 5E79Z 2YUAA 4UCUA 4B3SB 4XDJA 4JASA 1K9MW 3PN1A 5HFMA 2P7TC 2YIDA 4WFEA 2FB5A 2QDOA 2JGDB 4DR4O 2R72A 1L0LH 4CH5A 4CH4A 1HNXO 3TXSA 4B3RB 1VMGA 4TOIA 2WLLB 1QQCA 3MHHC 4J7JA 3L74H 4GZRB 1SA0B 3J7AU 1ZUQA 4WFAV 1GN6A 4FZ1A 1P7GA 3OFNG 2DMXA 5H5NA 5GTIZ 2CGNA 1AR1B 3ZHRA 5JWPA 2AZ2A 5B1BB 3CRMA 5KX5B 4LNUA 3WB0A 4JTCB 4LF6B 4A5UB 1ZL8A 1SQVH 1N34B 1AI7A 1H2NA 4PDVA 4I55B 2CAZC 3FB6C 4OXSA 2JDIG 3ZEDA 4BIUA 4RAIA 4LFBO 5CA0B 1EN4A 3JAWA 4I4TA 1VQPV 4JYAO 5DM6V 1H2MA 3O9OA 2ZKOA 1VP7A 1H8EG 3FAVB 1VF6C 4K0KO 4YHHO 4LF7O 3P32A 3CYOA 4JAVA
chains in the Genus database with same CATH topology
4LWSB 3HR0A 2KG7A 3GWKC 3TXQA 3TXSA 3GVMA 2VRZA 2KG7B 4ABMA 4I0XA 3FAVA 2VS0A 1WA8A 4GZRB 2B9ZA 3Q4HA 3O9OA 4I0XB 4LWSA 3FAVB 3OGIB 3G80A 1WA8B 2AZ2A 3ZBHA 2AZ0A 2DE0X 3FD9A 3Q4HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWS B;  3HR0 A;  2KG7 A;  3GWK C;  3TXQ A;  3TXS A;  3GVM A;  2VRZ A;  2KG7 B;  4ABM A;  4I0X A;  3FAV A;  2VS0 A;  1WA8 A;  4GZR B;  2B9Z A;  3Q4H A;  3O9O A;  4I0X B;  4LWS A;  3FAV B;  3OGI B;  3G80 A;  1WA8 B;  2AZ2 A;  3ZBH A;  2AZ0 A;  2DE0 X;  3FD9 A;  3Q4H B; 
#chains in the Genus database with same CATH topology
 4TV9 B;  1FAF A;  3CRA A;  2XAG A;  4MVS A;  4LR3 A;  3ETE A;  3ZX6 A;  1YVW A;  1VF5 B;  1EM1 A;  3CPW U;  3R66 A;  3TGU H;  4P30 A;  1PL0 A;  4O4I A;  2NR5 A;  3LNN A;  3CJH B;  1S72 V;  3ZHQ A;  1GH6 A;  1W0J G;  3OR6 C;  1MSD A;  4ZBM A;  3ABK C;  1UJW B;  5IY5 B;  4B7E A;  1D5N A;  2KB1 A;  1DTO A;  1OCZ B;  3I56 V;  4X1Y B;  4H44 B;  1IBK O;  2UXX A;  2VS0 A;  1S0V A;  1US6 A;  3OTO O;  2HVJ C;  1N32 B;  1SRY A;  1F23 A;  5EYP A;  1V55 C;  1S5J A;  1R3K C;  2H94 A;  2GUZ B;  1JJO A;  3ZRV A;  4JI3 O;  4DV5 B;  2WLL A;  1N36 B;  3H9V A;  1SA0 A;  5LGT A;  1KQS U;  2N04 A;  2LFR A;  3NR7 A;  2B1G A;  3DXR B;  2L35 A;  3K59 A;  3T1Y B;  3SYP A;  3X2Q B;  1OCZ C;  1AJN A;  1Z5V A;  4DR6 O;  3JD1 A;  4U3F H;  3UCS C;  1IXM A;  4N21 A;  2GBO A;  5LGN A;  2HHH O;  4GUN A;  4I55 A;  4B3M O;  3A0R A;  2WAM A;  4C7U A;  1HW7 A;  3ZRW B;  5CA0 A;  1RM1 B;  2UUA B;  2JK5 C;  1M90 W;  3RYH B;  3QO7 A;  3FAV A;  1H2L A;  1JA8 A;  3CCQ V;  3I5D A;  3VQV A;  3L70 H;  2PTM A;  4TV9 A;  1PL4 A;  1R6T A;  4HAM A;  5L3B A;  3A8T A;  3T2M A;  2EIL C;  2YEV B;  2F66 C;  1YHQ V;  1FYJ A;  1I5Y A;  1BQ0 A;  1AI6 A;  3H1H H;  4X1K A;  1OCR B;  1GM8 A;  3E8F A;  2PUS A;  1GMG A;  1HP8 A;  3CJH A;  1NT2 B;  2ZD9 A;  3CX5 F;  1TUB A;  4JI4 O;  1BHB A;  3B2E E;  3CB2 A;  4X1Y A;  3H1K H;  3J81 N;  4IGG A;  4FM1 A;  4PV1 B;  4YY3 O;  3E2E A;  4HYO A;  2AXT Z;  1J95 A;  4FLT A;  3BRC A;  3ABM C;  1Y4M A;  2GUZ A;  1YF2 A;  3BAA A;  1OCR C;  1QLE B;  1VAR A;  4O4J B;  2LJ2 A;  3CXH F;  1N0J A;  4O4L B;  3DXR A;  1SC5 B;  4DV6 O;  4I5S A;  5IJ9 B;  4J10 A;  3CCR V;  3ETQ A;  1YZB A;  4UVA A;  4UXN A;  2QEX V;  3D36 A;  2Y0P A;  3BVO A;  4GYC B;  3UO3 A;  4FLV A;  3ML0 A;  5EC2 C;  4JI2 O;  4GX5 A;  1IDS A;  1P49 A;  2PI5 A;  1FJG O;  1AJQ A;  2HVK C;  1AVM A;  3ASN B;  1QBZ A;  2UXD O;  1JX9 A;  3FB5 C;  1QLE C;  2Q68 A;  2JEX A;  3CCS V;  4DV3 O;  4MVM A;  4GX2 A;  2KQX A;  2AHZ A;  2F93 B;  4W4L A;  4FFK A;  3GVM A;  1H38 A;  1ZLZ A;  3RYF B;  1QR8 A;  3ZMZ A;  4LFC B;  4GKJ O;  2ZXW B;  1XMO O;  1NQT A;  3U11 A;  2YEV A;  3P3P A;  5GON B;  3OGI B;  4NXM O;  1N8R W;  1HR0 O;  3K5L A;  2ZE5 A;  1K97 A;  1SQG A;  4J9Y B;  3K5O A;  1SF9 A;  2EJ7 A;  1FS0 G;  3CP1 A;  3OTF A;  3F5T A;  2QWQ B;  5DED A;  2WLI B;  3K0D A;  2ITD C;  1SQF A;  3RGB A;  4QPJ A;  1M56 B;  4ASU G;  4UCV A;  4LF5 B;  4ZIB A;  4DUZ B;  3AG4 C;  4JI7 O;  1Y76 B;  2EIN B;  1GM7 A;  4JTA B;  2KG7 B;  3RVY A;  1NH2 D;  5L3F A;  4JI8 B;  4O4J A;  1BT8 A;  4ZKI A;  2WWW A;  2QKC A;  4O4L A;  1IUR A;  2N74 A;  4JAA A;  1HNZ B;  5IJ9 A;  5J9P C;  1TVK B;  4F6R B;  1M56 C;  3ZBH A;  2DYS B;  1Z2G A;  3DGE A;  3W7W A;  3LUT B;  2UXC O;  4DK1 A;  2RJZ A;  2BCC H;  2DW4 A;  2YC0 A;  3BEH A;  1XOU A;  4X1I B;  2IH3 C;  5EZY A;  2WSS G;  1Q90 D;  5CB4 B;  1SQP H;  2Q73 A;  3ZRS A;  2IJH A;  3OUS A;  2XHB A;  4O2B B;  4DK0 A;  1VQL V;  4MW8 A;  3EVK A;  1XNQ O;  4X65 B;  3RYF A;  4OX9 O;  4KXR A;  5C8Y B;  1FPO A;  1KYO F;  3CRR A;  2PI4 A;  3VBB A;  3ZMT A;  5GON A;  1O9G A;  1RFY A;  3CCJ V;  2A9H A;  1TUE B;  4X64 B;  3PJS K;  2P06 A;  3JSN A;  1Y74 A;  2WLI A;  1B6Q A;  3JAS B;  1XNR O;  3CEI A;  1DF5 A;  2ZIM A;  4LP8 A;  1FFT B;  3CCL V;  3L9D A;  1OCO C;  3SDL A;  2CUG A;  2P4K A;  4X20 A;  2IJJ A;  4MVO A;  2QSA A;  3S3W A;  2ZE8 A;  5B3S B;  2OCC C;  1KU9 A;  4NKG B;  1BS3 A;  1RSO B;  1Y76 A;  3AG1 C;  4D6T H;  4DR2 B;  2E75 B;  5J2U B;  4DV7 B;  1Q6I A;  4QIW F;  1R3I C;  3QTC A;  1WAZ A;  4FK5 C;  4JI5 O;  1KD1 W;  2X6A A;  2F1M A;  4LH7 A;  1EZV H;  4X66 O;  3CWB H;  4CH6 A;  4FFB B;  3ZN1 A;  5IDJ A;  3SPC A;  5LMU O;  1Q43 A;  4FLX A;  2XTA A;  2EBO A;  3EHB B;  4X1I A;  1TGO A;  5CB4 A;  1NR1 A;  1QVG U;  3JSL A;  4MTF A;  4O2B A;  2NNU A;  5LYJ B;  3B40 A;  4JTD B;  2FML A;  4G27 B;  1LNQ A;  3AK3 A;  1XMQ O;  4FLW A;  3B8N A;  2FTK A;  4MTX A;  5C8Y A;  5CA1 B;  3TK1 A;  5AG2 A;  3RYC B;  1I94 B;  3CHX A;  5ITZ A;  3WG7 B;  4GX0 A;  3UT5 B;  4UFZ A;  3BHP A;  3CCM V;  4J7K A;  1S76 D;  2ADP A;  1Q8I A;  2BTO A;  2NN4 A;  3HKB B;  2Q0O C;  3JAS A;  4UCR A;  2ZM6 B;  4B3R O;  4L87 A;  3L71 H;  1ZTE A;  2XOK G;  2OWO A;  3ZMS A;  2ZCE A;  2DYR B;  4BAY A;  5LGU A;  4WFH A;  1K5Q A;  3HKD B;  2QM7 A;  4RQF A;  4XDK A;  4DR5 O;  5L3C A;  2YIB D;  5L3D A;  3WG7 C;  1AP6 A;  1RSO A;  1PV0 A;  1M57 C;  5GTH Z;  4DO2 A;  3K9A A;  1PNM A;  1TA8 A;  1KP2 A;  1FXV A;  2DE0 X;  4AQY B;  1D5A A;  2Y48 A;  3T1H O;  2IM9 A;  5KA5 A;  4IYH A;  4DRX B;  2BE3 A;  1PD3 A;  2XAF A;  2A06 H;  1O9H A;  4FFB A;  3HKC B;  1YJN V;  2X0L A;  5KA6 A;  4FM2 A;  2OIG A;  2ILM A;  3STZ C;  1VQM V;  2R9R B;  3JD4 A;  1SQB H;  1Q82 W;  1QCE A;  5EIB D;  1NH2 B;  4DR7 B;  2E3C A;  4UCO A;  4DV2 B;  3BAB A;  3SGI A;  3LDD A;  2DQ3 A;  4PA6 A;  2DN9 A;  4DYL A;  4DUY O;  5LYJ A;  1XL4 A;  2YXL A;  4H0L B;  3D3Q A;  4DW0 A;  5CA1 A;  4JI0 O;  4KHP O;  2EIJ C;  1VQ9 V;  5EBW C;  2Y69 B;  3S3X A;  3UT5 A;  4BIO A;  5IWA O;  5LA6 B;  3AG2 C;  4NXN B;  2QM8 A;  1YIJ V;  3ZRX A;  3TJT A;  2G38 A;  1BMF G;  3HKB A;  3SJA C;  2YSU B;  2OTJ V;  4IIJ B;  2FKX A;  1G1X B;  3JAT A;  5EK0 A;  2WLJ A;  1I5X A;  4PDR A;  2GV9 A;  2GTA A;  4PD4 F;  2HP8 A;  3G80 A;  4LFA O;  4YIP A;  3HKD A;  1SS3 A;  3B77 A;  4CS4 A;  4LF9 B;  2Q4P A;  5BZB A;  1MMM A;  3M8A A;  4LF8 B;  3J80 N;  1AJP A;  3ZMU A;  1Q86 W;  4K35 A;  1VEW A;  4LF4 B;  2DOS A;  4GKK O;  2OIE A;  4DXW A;  4PDM A;  1M5I A;  2UXN A;  1ZAU A;  1JOY A;  1DF4 A;  4LCU C;  4I0X B;  1YIT V;  1NJI W;  3CC2 V;  2P4V A;  5KAI Z;  1CEZ A;  2IBZ H;  4JI1 O;  4DRX A;  4CC6 A;  2VQF O;  3HKC A;  1A32 A;  3KCY A;  2Q69 A;  5HFL A;  1NTK H;  2OT5 A;  2XAQ A;  5B1B C;  4EB6 B;  1BCC H;  2AHY A;  2F23 A;  3C3T A;  4U7O A;  2HEP A;  2V7Q G;  3JYC A;  1KBH A;  3ZHU A;  1XQ8 A;  5LHH A;  3F7Y C;  1MOF A;  3BCC H;  3OR7 C;  4PJ0 Z;  2AGA A;  3ETD A;  4WFG A;  4CC5 A;  3IC9 A;  2EZP A;  1YDX A;  4LH6 A;  2Y4U A;  3G4S V;  2XAH A;  1ARO P;  2OTL V;  2ADQ B;  1URF A;  3K58 A;  2RQ6 A;  5IYB O;  1VQK V;  3R65 A;  1VIB A;  4CS3 A;  1Q6H A;  5LMN O;  1U96 A;  2JGD A;  3FYE B;  1EFR G;  2XT9 A;  3OT7 A;  1BGY H;  4J9Z B;  3SJQ C;  1S5H C;  2ZT9 B;  3ZHS A;  4DW1 A;  1YTF B;  2QM4 A;  3LDE A;  1EBO A;  4R7C A;  1WB7 A;  1WB8 A;  5IY5 C;  4DR4 B;  3SJB C;  3GB7 C;  3O65 A;  1NZ6 A;  1P7B A;  3E22 B;  1IVS A;  2PGG A;  5KX5 A;  2Q7E A;  1S3J A;  3B4S A;  4NB5 A;  3ABU A;  3E86 A;  2GSM B;  4H37 A;  4LWS B;  3HR0 A;  1IBL O;  1KB9 F;  4EFE A;  4ICG A;  1K7D A;  1VQ6 V;  1DLB A;  4DV1 O;  3KZI Z;  4TQF A;  4F6E A;  4P9P A;  3F5W C;  4ZHQ B;  5IJ0 B;  2E76 B;  3K08 A;  3CSX A;  3X2Q C;  3D36 C;  4LFB B;  3ZMV A;  4EKW A;  2DWE C;  2CH7 B;  4MVQ A;  3IGA C;  4K0K B;  1L1F A;  2BOB C;  2PF4 E;  4CZZ A;  1YCI A;  2JGU A;  1SZX A;  4J80 A;  1RM1 C;  2DJV A;  4JV5 O;  5K1P A;  3RWR D;  5CMU A;  2HG5 C;  4DV4 O;  1AP5 A;  1LR1 A;  1F4M A;  1WNS A;  4JYY A;  4AIL C;  3JD3 A;  4J41 A;  1SES A;  1ZX3 A;  5FLX N;  3H01 A;  1BL8 A;  3A0B Z;  1SZT A;  4JZ2 A;  4Z1M G;  4X9Q A;  2QKS A;  1V54 B;  4DR3 O;  1OJH A;  3E8B A;  3JCZ A;  1AR5 A;  4NTW A;  1JR9 A;  2CTP A;  2JEU A;  3KCX A;  1I0H A;  1V9P A;  2JS3 A;  4FJC C;  1IBK B;  5H6Q A;  4YJ2 B;  3OTO B;  2WPD G;  3SPG A;  4JAU A;  4DR1 O;  4TT3 G;  3HB3 B;  5F2V O;  3I55 V;  3OUF A;  2KKW A;  4JI3 B;  2BOC C;  1IZ3 A;  1V54 C;  3C3S A;  1GN2 A;  2JIZ G;  5JJN B;  1VQ7 V;  5D5Q A;  2A79 B;  3ZRW A;  2R9A A;  4X62 O;  1JVM A;  4DR6 B;  3L72 H;  3RYH A;  4NR1 A;  4JI6 O;  4R6Z A;  3QNE A;  4ZHQ A;  2EIK B;  4J11 A;  4B3M B;  5C93 A;  4RQE A;  2QWR B;  2WLM A;  1W2B U;  5BMV B;  2JJ2 G;  4AHC A;  3CCV V;  5LOV B;  5JVD B;  1WPX A;  5A2Q N;  3ASN C;  1ZWI C;  3E8H A;  1XUQ A;  1ROP A;  2ZNI A;  4P2Z A;  1HNW O;  2EIM B;  2IJK A;  4D7T A;  3JD0 A;  4DV0 O;  2BTQ B;  4RWU A;  2EIK C;  4FLZ A;  1WP8 A;  1PNK A;  2RNB A;  3EXA A;  4FPP A;  2PZS A;  2F4V O;  3BA8 A;  4PA9 A;  3OD4 A;  4B3T O;  5BXZ A;  2ZXW C;  4JGS A;  4E2L A;  2BSK B;  1KKC A;  1QHT A;  3TXQ A;  3CE2 A;  1S77 D;  1JQ0 A;  3E83 A;  4AI8 A;  1E1Q G;  4TSF G;  3FKS G;  4JI4 B;  4B7K A;  5BY1 A;  4UCT A;  2VWK A;  1F7Y A;  2EIM C;  1CP9 A;  1WPB A;  1I08 A;  1MA1 A;  1R6K A;  4YJ2 A;  5KHH A;  2OYQ A;  3VOU A;  3K06 A;  5L3G A;  4MVU A;  4PEL A;  4GLX A;  5LXT B;  1I7F A;  1AR4 A;  1NVP D;  2GHY A;  2GTS A;  2LP7 A;  3QVN A;  4HNA B;  5JCO A;  4ZI7 B;  4TWK A;  4DV6 B;  4UCS A;  2EIN C;  1KP3 A;  3N2K B;  1FXK B;  2Q6A A;  2UUB O;  1JFF B;  5IYD O;  2EX3 A;  2R70 A;  1J5E O;  5BR8 O;  4NYK A;  3GWO A;  4PA4 A;  4JI2 B;  2UXB O;  5KUK A;  1RPO A;  3LDC A;  2DYS C;  5FNV B;  5BMV A;  3G71 V;  3JAK B;  3OAA G;  4JPR A;  4DV3 B;  2CDY A;  2Q5Z A;  5LOV A;  1I94 O;  3K57 A;  1E79 G;  1M1K W;  5JVD A;  3JD2 A;  4BIZ A;  1N33 O;  1PNL A;  1FXK C;  5KMG B;  1IX9 A;  2E5L O;  1XHX A;  4HBN A;  4GKJ B;  1UFI A;  1OZ0 A;  1XMO B;  2QA4 V;  2QGN A;  2BTQ A;  4NXM B;  5JQG B;  3VQX A;  2JRI A;  1HR0 B;  3E8G A;  2ZQM A;  1IXB A;  4QNH B;  3B09 A;  3M7M X;  4PA3 A;  5KHI A;  2ZNJ A;  3SYC A;  2BSK A;  5CBG A;  4IYI A;  2IU3 A;  3FB7 C;  5IYZ B;  1L0N H;  2ZE6 A;  2KG7 A;  2RMK B;  4OGQ B;  2HJF C;  4QE9 A;  2VQE O;  4JI7 B;  2UU9 O;  1PM9 A;  1TVK A;  4F6R A;  2NLJ C;  3DTU B;  5LXT A;  4MW3 A;  3SPI A;  3MAQ A;  1B06 A;  2QTO A;  4EFB A;  4ZOL B;  5B3S C;  5D5P A;  4ZI7 A;  2DWD C;  2CTW A;  3WB1 A;  5LP6 B;  1FXK A;  3N2K A;  4Z1V A;  1JFF A;  4DR7 O;  2UUC O;  4FLU A;  4DV2 O;  5EBL C;  1WP7 A;  2UXC B;  4O4H B;  2N05 A;  1Q5O A;  1KUQ A;  3JAK A;  4O2A B;  1YJ9 V;  1T5E A;  2E74 B;  4B3S O;  2P6J A;  1RP3 B;  3AG7 A;  1AI4 A;  2MW2 B;  1Y67 A;  4LC1 A;  3MDS A;  4I7Z B;  4OX9 B;  3WU2 Z;  5KMG A;  3OMI B;  4K8X A;  4NXN O;  1FFX B;  4Q20 A;  3LSS A;  3QF7 A;  1B04 A;  3VQY A;  1QLN A;  2EZO A;  3ICX A;  3OMA B;  5JQG A;  2ZR3 A;  3Q4H B;  1GM9 A;  2CGO A;  2HFE C;  1EN5 A;  1GK9 A;  3AG3 B;  3MHS C;  1XNR B;  4LF9 O;  1H2K A;  1K3E A;  4BW9 A;  1HDJ A;  2Y0I A;  5J2U A;  4LF6 O;  3HKE B;  1N34 O;  4LF4 O;  4KP4 A;  4U3J B;  1BE3 H;  4BW5 A;  1H2S B;  2H3O A;  2JVD A;  4MTO A;  2D3O W;  3CRQ A;  5LBQ A;  2LGQ A;  2DYR C;  2WA4 A;  3G6E V;  2ZIN A;  4ZOL A;  5FPR A;  4FMT A;  3CXC U;  4J42 A;  3AG3 C;  5CBH A;  1K33 A;  4JZG A;  1GAX A;  5KUM A;  3JAW B;  4I4T B;  1VQ4 V;  1XRE A;  1MAB G;  1P4R A;  4X66 B;  2QJ1 A;  1GTO A;  2Z0A A;  2ARH A;  3VQW A;  4FVM A;  3CC7 V;  4E4E A;  1PPJ H;  3OW2 U;  3H1I H;  1K8A W;  3P3N A;  5EBM C;  1JMK C;  1NKD A;  5LMU B;  4KUM A;  2V4D A;  3UKM A;  3L75 H;  1NVP B;  2C2A A;  4MVZ A;  4IHJ B;  2RCV A;  2X7R B;  4O2A A;  3RYC A;  2IU0 A;  1JJ2 U;  1UPG A;  5CA3 A;  3C90 A;  2A7W A;  1XMQ B;  1N32 O;  4BWA A;  1QU7 A;  4BR6 A;  1B3Q A;  2WLK A;  3RBZ A;  2ZDI A;  1F4N A;  1RPR A;  1GKF A;  4DV5 O;  2XAS A;  1N36 O;  3Q4H A;  1VQO V;  4UVC A;  3FFQ A;  3ABL B;  1X59 A;  3T1Y O;  5EYP B;  2Y69 C;  2JJ1 G;  3EFF K;  1G8M A;  3LSU A;  3OE7 G;  4PDL A;  4K8Z A;  5A9G A;  3HKE A;  3W7U A;  4UB8 Z;  2W6I G;  4LBE C;  2YI8 A;  3QG5 A;  4U3J A;  1IBM B;  3G6B A;  3AEI A;  5KHJ A;  2UUA O;  4DR5 B;  2P22 C;  4MVR A;  4MTG A;  4NVP A;  4RO2 A;  1NBM G;  4WF9 V;  2ITC C;  3H1L H;  1YI2 V;  1K4D C;  5E1A C;  3ABL C;  3JAM N;  2AW9 A;  5GW7 A;  5KHG A;  4KFM A;  2QTS A;  5B5E Z;  3T1H B;  3L73 H;  3SR2 C;  1NU1 H;  1XL6 A;  1F51 A;  3ABK B;  3U0Z A;  3P30 A;  1W59 A;  4IHJ A;  3ZIA G;  2DQ0 A;  2LQT A;  1Y6X A;  2YS8 A;  1XDC A;  4DUY B;  1V55 B;  2CE4 A;  3AK1 A;  2F95 B;  1LUV A;  4X1K B;  2M6Y A;  5LA6 A;  1JPX A;  5B1A B;  4JI0 B;  1Q7Y W;  3FX7 A;  4IIJ A;  4KHP B;  1TUB B;  2K9P A;  3RW0 A;  4FIP C;  1NS1 A;  4UV9 A;  5IWA B;  1W0K G;  2X6C A;  5KAF Z;  4YIO A;  3OEE G;  4R50 A;  1K73 W;  1HNX B;  3BFR A;  4G28 B;  5JH7 B;  3D3I A;  2LO1 A;  1VF6 A;  5B1A C;  3RVZ A;  4LFA B;  2YIC A;  1R6N A;  5TIS Z;  4I0X A;  1R3J C;  3E89 A;  1XEQ A;  2IH1 C;  3DSQ A;  3K9S A;  2WLH A;  1KC8 W;  2EIL B;  3W7S A;  4GKK B;  4HZ3 A;  3ZHT A;  4EB6 A;  3T4Z A;  3W7X A;  3K3W A;  4LFC O;  3WB2 A;  4JYA B;  2QR4 A;  4JI1 B;  3MD0 A;  1M9N A;  4YHH B;  3IJ4 A;  4LF7 B;  2VQF B;  4PI0 A;  3SYA A;  1YJW V;  1QR9 A;  1LUW A;  4CS2 A;  1GO3 F;  2QE7 G;  4TUY B;  3FD9 A;  5B66 Z;  2IJI A;  3UM7 A;  3SYQ A;  2FL4 A;  4FZ0 A;  3JAR B;  3ABM B;  4YJ3 B;  4GX1 A;  1XBL A;  3B8M A;  2Y4T A;  5IYC O;  4LF5 O;  2HLD G;  2PYL A;  4Q6G A;  1NTM H;  4DUZ O;  2JS5 A;  2B1I A;  3FYI B;  2EUL A;  1G6U A;  2W0F C;  5JJE B;  1BHA A;  3APQ A;  2Q7G A;  1K4C C;  2B5U A;  2Q67 A;  4MT8 A;  4JI8 O;  2MK3 A;  1K34 A;  4KL1 A;  5LMN B;  3RYI B;  2RN9 A;  2P67 A;  3ASO B;  1HNZ O;  3E22 A;  4ABM A;  5DEC A;  5EIB C;  4UB6 Z;  4I9Q A;  1ORQ C;  3THO A;  5JH7 A;  1X4T A;  1OV9 A;  4LWS A;  1G4Y B;  1JCH A;  2L6L A;  5KLV H;  5CBF A;  3OMN B;  1GN4 A;  2VWJ A;  3CRC A;  3M99 B;  1M93 A;  1OCC B;  1FD9 A;  1HWY A;  1L8D A;  3CMA V;  1VQ5 V;  4XBF A;  3RFR A;  1Q3E A;  5LHG A;  3BPZ A;  1N0N A;  5IJ0 A;  2HHH B;  2XUM A;  2YI9 A;  2YIB A;  1SET A;  1ZSP A;  1N4C A;  3ASO C;  4X65 O;  4B08 A;  1IBL B;  3IC7 A;  5EZY B;  4DV1 B;  2CH7 A;  1CXZ B;  3TCU A;  1CPY A;  3JCU Z;  2PYJ A;  3T1C A;  5JCO C;  1DK1 A;  1D2D A;  1K5S A;  1K92 A;  1EZJ A;  1Q6U A;  3NXS A;  4PHZ A;  3JAL B;  4X64 O;  1YSC A;  1OCC C;  4H13 B;  3FB8 C;  2RDC A;  4TUY A;  2W6J G;  2Q8V A;  3AG4 B;  3QO8 A;  1AIL A;  4MSW C;  3JAR A;  4RUF A;  4CH3 A;  4YJ3 A;  3ETG A;  5H6R A;  1QNM A;  1KEC A;  4JV5 B;  2P5O A;  3CC4 V;  3RN4 A;  4J7Z A;  4DV4 B;  2CTR A;  1Y74 B;  4QE7 A;  2LW7 A;  4DR2 O;  4I9W A;  4YY3 B;  4X20 B;  4DV7 O;  2ZIO A;  1P84 F;  2LFS A;  3RYI A;  2EJR A;  4DR3 B;  1R3L C;  1WA8 B;  1MZE A;  1FXH A;  2W0X A;  1VF7 A;  1WLE A;  4QPK A;  2QWO B;  5CN0 A;  3DC6 A;  1KKD A;  2VRZ A;  3CCU V;  4TV8 B;  5JJJ B;  4DR1 B;  1E1R G;  3ZHV A;  1YEW A;  3OGC C;  3SYO A;  1S5L Z;  1ENV A;  5K1X A;  4IT5 A;  2QWP B;  4WBN B;  3CME V;  4QGP A;  2CK3 G;  3RT3 C;  1MSW D;  4F4L A;  4X89 A;  1Y66 A;  1FJG B;  3BY6 A;  3WFV A;  3KG2 A;  4WCE V;  1AI5 A;  4GT1 A;  2UXD B;  2ETN A;  4X62 B;  4MS2 A;  3ZJZ A;  2LW1 A;  4JYB A;  2KSD A;  2Q0A A;  4JI6 B;  4CBC A;  2HR3 A;  5IE9 A;  1H2G A;  1OCO B;  3JAL A;  1XIL A;  3G67 A;  4UUJ C;  3SJC C;  1VQ8 V;  1SQQ H;  4TQD A;  4JYC A;  2XND G;  4G2K A;  4QJF B;  2ZM6 O;  5ITZ B;  2CTQ A;  3U10 A;  5B1O A;  2OCC B;  5J2T B;  4JF3 A;  2B9Z A;  4PA7 A;  4PI2 A;  1HNW B;  2ATK C;  2XAJ A;  3AG1 B;  3APO A;  2H8P C;  2D2C B;  4H33 A;  1THZ A;  4Z2W A;  3A0H Z;  4DV0 B;  2HKO A;  4FM0 A;  2F4V B;  3H1J H;  4OPH A;  2PY5 A;  4B3T B;  4GCZ A;  3SPH A;  4FLY A;  5EC1 C;  1WA8 A;  2Z3Y A;  4AQY O;  3T4D A;  2A3Q A;  5KHK A;  1MG1 A;  4UVB A;  2Q7H A;  3F7V C;  4TV8 A;  4HNA A;  1EN6 A;  1R73 A;  1PKX A;  5B1N A;  3D8C A;  2A0L A;  1GN3 A;  3HPL C;  3ZN0 A;  3CCE V;  3LNM B;  3TET A;  1SKV A;  4WBN A;  4NTY A;  4N23 A;  2OCH A;  5DN6 G;  3CD6 V;  5L3E A;  2F43 G;  3K03 A;  2WA3 A;  1MZF A;  1PP9 H;  3KKY A;  5LL6 Y;  1XI1 A;  1NR7 A;  5FNV A;  1BZK A;  2K1E A;  2UUB B;  3K04 A;  3N27 A;  1M4U A;  1J5E B;  2V1D A;  3AK2 A;  5BR8 B;  4YXW G;  3UO2 A;  2ZE7 A;  4W4K A;  2UXB B;  1XNQ B;  4I50 B;  4WFB V;  5LP6 C;  4P9O A;  2WLN A;  2X6B A;  1NTZ H;  3ABT A;  1YTF D;  3N2G B;  1BQZ A;  3K79 A;  4XDL A;  4D7S A;  3OEH G;  2O57 A;  1N33 B;  5J2T A;  5H9C A;  1M57 B;  1Z5W A;  4IL6 Z;  2E5L B;  2ZR2 A;  1YXB A;  4WFF A;  2LGW A;  4RUE A;  3STL C;  1VQN V;  3OM3 B;  5IYZ A;  1BSM A;  4R8C A;  4LF8 O;  1NI8 A;  2ODM A;  3JAT B;  1WN7 A;  5LHI A;  3UQ8 A;  2YXH A;  2AZ0 A;  2M7W A;  2ZDI C;  3K0G A;  2GDS A;  3E35 A;  1TAE A;  1IBM O;  2IW5 A;  1H8H G;  4X88 A;  4LNU B;  1R1B A;  1OHH G;  2YIA A;  4U7N A;  4EEQ A;  4NTX A;  2P90 A;  2HJD A;  2YDE A;  3BA9 A;  4UV8 A;  1ZL8 B;  1KMI Z;  4L8J A;  2Q9L A;  2R9I A;  5H2F Z;  3CS5 A;  2VQE B;  4JI5 B;  1QVF U;  5LP6 A;  2UU9 B;  3W7T A;  1Q81 W;  3ZCC A;  1WJZ A;  3SPJ A;  4X8A A;  3LSQ A;  3A2F A;  1COW G;  3K5M A;  1SER A;  1AB3 A;  1U97 A;  2EIJ B;  1GRJ A;  1MNG A;  3QO5 A;  4O4H A;  1SQX H;  1FKA O;  2Z5U A;  3IFX A;  4K3A A;  2QWN B;  3AG2 B;  2UUC B;  5FL7 G;  3GWK C;  4I50 A;  1DGS A;  5IT9 N;  5FPO A;  2YXY A;  4O4I B;  3ZS8 C;  3K5N A;  2FYU H;  4OPA A;  1XHZ A;  3IAY A;  3DC5 A;  1FFX A;  3N2G A;  2QKA A;  5E79 Z;  2YUA A;  4UCU A;  4B3S B;  4XDJ A;  4JAS A;  1K9M W;  3PN1 A;  5HFM A;  2P7T C;  2YID A;  4WFE A;  2FB5 A;  2QDO A;  2JGD B;  4DR4 O;  2R72 A;  1L0L H;  4CH5 A;  4CH4 A;  1HNX O;  3TXS A;  4B3R B;  1VMG A;  4TOI A;  2WLL B;  1QQC A;  3MHH C;  4J7J A;  3L74 H;  4GZR B;  1SA0 B;  3J7A U;  1ZUQ A;  4WFA V;  1GN6 A;  4FZ1 A;  1P7G A;  3OFN G;  2DMX A;  5H5N A;  5GTI Z;  2CGN A;  1AR1 B;  3ZHR A;  5JWP A;  2AZ2 A;  5B1B B;  3CRM A;  5KX5 B;  4LNU A;  3WB0 A;  4JTC B;  4LF6 B;  4A5U B;  1ZL8 A;  1SQV H;  1N34 B;  1AI7 A;  1H2N A;  4PDV A;  4I55 B;  2CAZ C;  3FB6 C;  4OXS A;  2JDI G;  3ZED A;  4BIU A;  4RAI A;  4LFB O;  5CA0 B;  1EN4 A;  3JAW A;  4I4T A;  1VQP V;  4JYA O;  5DM6 V;  1H2M A;  3O9O A;  2ZKO A;  1VP7 A;  1H8E G;  3FAV B;  1VF6 C;  4K0K O;  4YHH O;  4LF7 O;  3P32 A;  3CYO A;  4JAV A; 
#chains in the Genus database with same CATH homology
 4LWS B;  3HR0 A;  2KG7 A;  3GWK C;  3TXQ A;  3TXS A;  3GVM A;  2VRZ A;  2KG7 B;  4ABM A;  4I0X A;  3FAV A;  2VS0 A;  1WA8 A;  4GZR B;  2B9Z A;  3Q4H A;  3O9O A;  4I0X B;  4LWS A;  3FAV B;  3OGI B;  3G80 A;  1WA8 B;  2AZ2 A;  3ZBH A;  2AZ0 A;  2DE0 X;  3FD9 A;  3Q4H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...