3GWLA

Crystal structure of asfv pb119l, a viral sulfhydryl oxidase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
106
structure length
106
Chain Sequence
GSHMLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
source organism African swine fever virus ba71v
molecule tags Oxidoreductase
total genus 41
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwlA00
3GWNA 3GWLA 3TK0A 3W4YA 1JRAA 1OQCA 4E0IA 3LLIA 1JR8A 4E0HA 3MBGA 3U5SA 3LLKA 3O55A 4LDKA 3U2MA 3TD7A 3U2LA 2HJ3A 3R7CA
chains in the Genus database with same CATH superfamily
3N2ZB 3W4YA 1XWJA 2A68F 1Q0DA 3GM1A 2J9WA 2XLMA 4YL1A 4MS2A 2Y69C 4LDRA 4O79A 3HNJA 3C8ZA 4HFKB 1BR2A 1VOMA 5JT4A 4NCQA 1OW6A 3HTKC 3LLKA 4WABA 1UG7A 4XPWA 1HE1A 3L0IA 1V55C 3FHDA 2JD3A 3K1IA 2FFHA 1ZHWA 4C7OB 3NMIA 3GANA 3QW1A 1U89A 4IAOA 3U2LA 3M79A 3KH2A 1Q0MA 2IXMA 2HS5A 5CI8A 3DE9A 4IJJA 3JT1A 3ZG1A 2OEVA 5DLJA 2XLOA 2Q00A 3AG4C 3HNKA 4BPMA 4IWBA 5HSWA 1YYJA 3GWLA 1GS9A 4G7HF 3TJ6A 1NZEA 2IXPA 5L0GA 3U9JA 3FDQA 2H8AA 2XS1A 4MTFA 1KTMA 5EHHA 4Q4ZF 3I4UA 3C8GD 1NFNA 5D92A 3EQLF 1TR2A 4U5EE 1LI7A 2IOQA 4DRJB 4PJLA 3US6A 4BJ6A 1T6QA 2CW0F 2HSQA 3MFNA 1YZAA 3U0CA 1JPNA 1DOWA 2L6FA 2CNWA 4DBQA 1K40A 1G5ZA 4MW3A 1T9KA 3JYYA 3M4CA 4PJMA 3NRHA 2EILC 1PD1A 2EIMC 4EIYA 1MMAA 3JZ0A 4G78A 2XXAB 1RKEA 3EGXB 2Q9AA 4IB4A 3HNLA 3U3BA 1LS4A 1VK5A 2YLDA 3E9VA 1TWCA 1XZQA 4JJGA 3LJBA 2ZXRA 4QDLA 3AG3C 4EBKA 4FAPB 5KYUB 1E86A 3RVZA 2ZXOA 2FGYA 4JTDB 5L0DA 3QZCA 3JYHA 4PK4A 2IXNA 3EZIA 5COMA 1NFOA 2A0UA 2YVKA 3CSKA 4M63A 1E83A 2NSFA 1SF8A 4EKWA 2GFHA 2WB7A 2AVKA 3HNIA 4I1MA 1TQGA 2KYHA 1I4ZA 3SZRA 3UGOA 4ANJA 3U3FA 2R7RA 1AVOB 2Y3DA 3K33A 3KPHA 3DZAA 1RMVA 4CDYA 1L3PA 3DMDA 3ZTZA 3G4ZA 4U9DA 3B29A 2YLGA 4YK5A 1AEPA 3HLZA 1NG1A 4KNWA 1VYKA 2LFFA 4JZAA 1LKXA 2OKUA 4LERA 1DOVA 1AUEA 4LDQA 4O7GA 1ZHYA 3W8IA 3FMSA 2J0XA 2R05A 3IQ5A 1ZHTA 4DVYP 2IXOA 5DS5A 5F5FA 2H7VC 2VCBA 2Y3GA 4R32A 1ZVZA 2EPMX 1H9GA 1N1CA 3UGPA 2HZ8A 3OWTA 3FOOA 3HJCA 5T3TA 2H7OA 1MMDA 2YZSA 2CCYA 4FWVA 5KYYA 1SYQA 1ZU5A 2MHRA 2DGJA 4YWQA 2MYSA 2W45A 4KBLA 1MNEA 1Z3IX 1ST6A 1HE9A 1TWAA 3LLIA 2C03A 4O6YA 2Z15A 1OR2A 5BQIA 3ABKC 4PJJA 3T4RA 1QVXA 3BRJA 2NUTA 2QY9A 2H7BA 4HFFB 3NMJA 1TFOB 3FAPB 5JS5A 3E70C 3CEXA 3RF3A 2R7QA 4XPXA 5K0IA 3GM2A 4FESA 3DM5A 4I3MA 3DJNB 4F4BA 3HKKA 3PHF2 4D4XA 4L6RA 3SEOA 2VB6A 2IBFA 1OCCC 3DAGA 1T5OA 4U5FE 1H9TA 4JCZA 2XLVA 4FX5A 1ZW2A 4NTBA 4DRIB 1OQCA 1G8XA 3AQBA 3ASOC 3C63A 4JTCB 4DVZA 4EWCA 1EA8A 2WVOA 3KMIA 2ZXWC 4IARA 3QTHA 4WGYA 1D0YA 1K05A 2PP4A 3ZQVA 2XM0A 3X1OA 2D5RB 3JTLO 4AL1A 5B3SC 3JSEO 4GYTA 3V5YA 3MLGA 5EGYA 3CAXA 4XLPF 5JUAA 2Q3TA 3SNHA 4I44A 4AL0A 1WN0A 4CJGA 1LIHA 3NYMA 5COFA 2AWCA 2R7XA 4BJ5A 2OOCA 3RIPA 1FNTc 2B0HA 2AP3A 5D91A 4C3DA 3IQ6A 4HE8D 4XTKA 2DI3A 4JW1A 2YQYA 2OJED 3LNMB 2VC9A 2PX0A 4MQ9F 3RW0A 2I15A 3KL4A 4CX9A 4O6MA 1FMWA 4GQHA 3MYIA 2VCCA 4ONSA 2LCHA 3F47A 4MVQA 2YKZA 3U8PA 5DQZA 3TULA 3MYFA 4U5GA 4J7YA 2KJGA 2J0WA 2VCAA 4N6HA 1W2WA 4YT4A 1CGOA 2J45A 4NTFA 3L34A 5KYNA 1YARO 1HY5A 4NY3A 1YAUO 5A6KA 1M56C 2QTVA 2GAQA 3PMRA 4AK9A 2BE5F 3DXJF 4CS8A 1R5ID 2L6GA 2NSGA 2KSFA 3JSZA 4MVUA 5AC5A 3I5QA 5KYXB 2Y3HA 4CJOA 3K7DA 4ULVA 3S9OA 4RBNA 4CS7A 2XLWA 3C62A 3IHUA 3KKBA 5A6AA 4C7OA 2NUPB 4DXWA 1G4WR 2WZFA 1Z23A 3EJNA 4CSAC 1WGWA 1QQ3A 1Q0GA 2D4UA 4CBEA 3GEHA 2LIGA 2XLDA 3KYIA 4OINF 5CIVA 5JP7A 3TQOA 1VYIA 2B0JA 1RJ9A 2XL8A 1OKKD 2YEVA 1OXBA 3LNRA 4JC7A 1BR4A 1JRAA 1HMOA 5B1BC 2X0CA 4CIHA 2OU6A 1RXQA 2XRHA 4H4KC 4NTAA 1LE2A 4XLNF 1E2XA 3W2WA 1ZU4A 4XWJA 2PBEA 5L0HA 3ZC4A 1CGME 3WHNA 2HJMA 5L3QA 2KW3C 4WGZA 3KYJA 3B0VC 4DJ9A 4JVSA 1VB5A 5L0CA 3C8GA 4C3EA 3AGTA 1E85A 3DJUB 3EH2A 1A7EA 4JKVA 2NPUA 2GDCA 1S7ZA 4MW8A 2LD6A 1WTYA 3B0PA 4MTGA 3T6BA 3VAYA 1A41A 2CGEA 3MX3A 3TD7A 3L8JA 4KC9A 2ZXPA 2R7UA 4N6CA 4RDAA 1VTMP 3NKEA 4U5BE 2G62A 1SMYF 5BUOA 2ASRA 2XXAA 1OR3A 2AWYA 3EGXA 1FTSA 1NU7D 2R9RB 3OA1A 5L0JA 3S84A 1QKRA 3R7CA 1TWGA 2UUHA 3EG9B 3AG2C 1T01A 1APCA 1NLXA 2OCCC 2PNOA 4JEBA 4W8PA 1YZCA 5EK0A 5AC4A 3AQCA 2EIJC 1Q0KA 5CI9A 2VASA 1R4TA 4CS9C 4YT2A 1YA7O 4RD9A 4K1OA 4AE4A 2Y3BA 1V4AA 4B6IA 1LPEA 2C04A 2G3VA 4WJ0A 4JTAB 5KYWA 2QUPA 3O39A 2YL1A 3FVYA 4OD5A 1RKEB 4YN0B 3RYLA 3ZSUA 5FCLA 4OIQF 2WL8A 4E17A 4P9FA 2ZD9A 1OW7A 3NYJA 4XPYA 3RQEA 2KC3A 1ZYRF 3CZ6A 3S29A 3SYNA 4E7ZA 3NDBB 4U5CE 4KI2A 3IPMO 3AG1C 2P1AA 2CDQA 4OIRF 5A69A 2R7WA 3B9QA 3FXHA 4A4AA 2RD9A 1NSGB 1T6UA 3RH3A 5DS4A 3RQGA 1I4YA 2OG2A 3K1IC 2WZGA 1S05A 1QPUA 2JX0A 1YYXA 4PFPA 4BJ1A 4ZLDA 2IM8A 1ZHZA 3Q6MA 2XM4A 3OEOA 4PACA 3T6JA 3TOLA 4H54A 4HEAJ 3BEHA 1FMVA 1L7CA 3S90A 4X0RA 2EINC 1WASA 4P6IC 1JOGA 3K66A 3U2MA 3SXYA 1E84A 4N4WA 3U9MA 2P7VA 4J7TA 2JPUA 3N24A 1NU9C 2OEXA 2XL4A 4O6NA 2P6VA 4JE9A 3WAQA 1GQAA 4GEHA 3X2QC 5DS6A 4MVMA 3K1HA 2P0NA 3T6GB 3ZVRA 1ZW3A 1OCZC 3ZDLA 4AX2A 2EPKX 3AJMA 2RSEB 3CQZA 5JVEA 1QZXA 3U8VA 2QE9A 3LEVA 1YJGA 2ICWG 5COGA 1KU2A 3POVA 1M2VB 3ITFA 2QNLA 4CIPA 1VMAA 1YLMA 2F22A 4XEKA 3EFOA 2HSBA 5E3CA 3MBGA 1CPRA 4OIOF 4DRHB 2Q7RA 3IEEA 1JAFA 4LDKA 1C03A 2FAPB 2AU5A 5B3IA 5IY5C 4QI0A 4YT8A 1T6IA 5A6BD 1O3UA 4NC3A 4XQ1A 2Q9CA 2MWQA 3EGDA 1HW1A 4OD4A 2V3CC 3DAFA 1LI5A 4JEAA 1ZZPA 1WWPA 2QLAA 1BDJB 4YL3A 5GPGB 4BG0A 4K0DA 2W4BA 1LM3B 2EPOA 3LS0A 4LLEA 1Z7Qc 5L0IA 2YWAA 3I5PA 1JPJA 4JRZA 2J7PD 3G4XA 3TJ5A 4NQFA 3AGUA 3G50A 1M6TA 1H6GA 1ORYA 1D0XA 3NKDA 2HMZA 4KNVA 1U6HA 1QSPA 3ECSA 2L7AA 3LS1A 3J06A 3RKOF 2X51A 3DM9B 1YA9A 3DKAA 3UMHA 2ZPAA 3IQTA 1RKCA 1C02A 3K6BA 1FAPB 4MTOA 1LVKA 5TJ5E 1M2OA 2V26A 5KYXA 1G4US 1TWHA 4XEFA 2PF4E 4P9TA 3QVYA 3EPVA 5L0FA 5DQTA 4LLCA 4BJTA 1FFTC 4U9EA 3RFYA 1M57C 2HJ3A 4JURI 3ZWIA 1Q0FA 5AGFA 3GWNA 3UNGC 4C3BA 2Y39A 1J8MF 4Z9HA 2KK1A 4MNDA 1D1CA 3EHNA 3M1CB 4IGGA 5JSLA 3PCVA 2YRFA 4J32B 3NG1A 3A9CA 1OKKA 2YLIA 4DOZA 2HFIA 1VLTA 4YT5A 3UMKA 2GA0A 3QW0A 2YL0A 4ER9A 2J9BA 4CDVA 1F1MA 1MMNA 3C7JA 2YL3A 2XSEA 2HKVA 3GEEA 4PJNA 2KQ9A 3V5XA 2XLEA 1Y6DA 1MQVA 3IQCA 4IAQA 1O87A 5JLIA 2XL6A 3O6XA 3UR3C 2HV7A 2OQMA 2R02A 3F46A 2HUJA 1J8YF 4Z9JA 1D0ZA 3T9OA 3QVZA 1RJ9B 5HV9A 4YL0A 3GM3A 1NBBA 4BJ6C 1VLSA 2P61A 1PD0A 3H2UA 2ETSA 4MVZA 5E3AA 2DYRC 4MVRA 1OW8A 1YDIA 2OJQA 3ZIBA 3A11A 4EBBA 1WATA 2Q9BA 3TOMA 1QLEC 3EG9A 4D4NA 5DVWA 2YHSA 5KYUA 3ZQYA 2CYDA 3SXMA 3C8GB 3EZHA 1D1AA 4BJ5C 4E0HA 2CNWD 2LSEA 4IRUA 1TKNA 4G7OF 3WG7C 1V74B 1Z6AA 5BQHA 3V7OA 1CGNA 2YL7A 1H7IA 3O10A 3SP1A 2J9UA 4DBRA 4N06A 2LQGA 4MVSA 1RCPA 1SZIA 2EIKC 5T1DB 1C17M 1SR2A 5F5HA 2WVNA 2LP4A 5B1AC 3M4BA 3ABLC 3ABMC 1HW2A 3S28A 3LAYA 5FZTA 2XS8A 4PFOA 2W4MA 4ULWA 4W8KA 1PV3A 1B68A 3W8HA 1I5NA 2A6EF 3AOUA 5BQGA 3SXZA 2R25A 2Q4FA 2KNHA 4G7ZF 2HV6A 4AE4B 1A7VA 2L9JA 4CS8C 3B0UX 4E7SA 4OIPF 5E33A 4E0IA 5F28E 1D1BA 5KYWB 3GORA 1JR8A 2PFDA 3FAJA 3H2VA 2A0BA 1LE4A 2J9VA 2R7TA 2GWWA 3QMKA 3O55A 3DD7A 2WVQA 3VF0A 2E87A 2BC5A 2DYSC 2J8WA 1YVIA 3R2PA 4QI2A 3L8IA 1K04A 2LFDA 2WZLA 3SXKA 256BA 2IYLD 1ZHXA 5L3VA 4YJWA 1OXKA 3JCUQ 2M64A 2KGOA 4K7BA 1U0BB 1JMWA 3VM6A 1IW7F 1BZ4A 1WOLA 5KYYB 1OCRC 5T3WA 5A6BA 1FR0A 1FFHA 1CPQA 3FOPA 4MVOA 3GODA 2UUIA 1BBHA 2BL2A 4JJFA 1EI7A 3S27A 2A6HF 2W9YA 3JRTA 3N0TA 3NYLA 3RVYA 1UFBA 4CSAA 4BEMJ 1M2VA 2R03A 1PCXA 4U5DE 4Z9IA 5JRAA 1GGQA 2G3KA 4Q5SF 1EKYA 1EQ1A 3GEIA 3DI5A 3EHMA 3Q7GA 3S0XA 2NUTB 3C18A 3L1MA 1A7DA 2EPNA 4JCHA 4I1OB 2I8BA 4UDVA 2A1DD 3WODF 3ZTMA 4XEVA 1XZPA 3M15A 2LK4A 3H65A 4Q7CA 1V54C 3Q7LA 3Q6NA 2HMQA 1Y4CA 3EH1A 1O5HA 1MNDA 3VYWA 4EUKB 3VRCA 1HMDA 3JRMO 4JIOA 3EFOB 2VH3A 3TK0A 3UMIA 2R7SA 3V5ZA 4BEJA 2O9XA 2L6HA 3RQFA 2R7VA 1OCOC 4ZLCA 2A69F 3B71A 3PDMP 2J7PA 3ATPA 1IZMA 1Z5ZA 4PR9A 2M4EA 4CDAA 4LACB 3U5SA 3LUTB 2R7OA 1GM5A 1KNYA 2J46A 4E18A 3EGDB 2XLHA 4G0HA 3DE8A 5E2QA 2TMVP 4CS9A 4EBJA 2PX3A 2DB4A 4A2NB 2L81A 4J30B 1ORJA 1BR1A 2NG1A 4EHPA 1LS1A 3LESA 1Z63A 1ORSC 5A6JA 3DWWA 1A0BA 1MMGA 3ASNC 3LEOA 4U5HA 3W2VA 1TFKB 3NMKA 2EPLX 2NUPA
chains in the Genus database with same CATH topology
3GWNA 3GWLA 3TK0A 3W4YA 1JRAA 1OQCA 4E0IA 3LLIA 1JR8A 4E0HA 3MBGA 3U5SA 3LLKA 3O55A 4LDKA 3U2MA 3TD7A 3U2LA 2HJ3A 3R7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWN A;  3GWL A;  3TK0 A;  3W4Y A;  1JRA A;  1OQC A;  4E0I A;  3LLI A;  1JR8 A;  4E0H A;  3MBG A;  3U5S A;  3LLK A;  3O55 A;  4LDK A;  3U2M A;  3TD7 A;  3U2L A;  2HJ3 A;  3R7C A; 
#chains in the Genus database with same CATH topology
 3N2Z B;  3W4Y A;  1XWJ A;  2A68 F;  1Q0D A;  3GM1 A;  2J9W A;  2XLM A;  4YL1 A;  4MS2 A;  2Y69 C;  4LDR A;  4O79 A;  3HNJ A;  3C8Z A;  4HFK B;  1BR2 A;  1VOM A;  5JT4 A;  4NCQ A;  1OW6 A;  3HTK C;  3LLK A;  4WAB A;  1UG7 A;  4XPW A;  1HE1 A;  3L0I A;  1V55 C;  3FHD A;  2JD3 A;  3K1I A;  2FFH A;  1ZHW A;  4C7O B;  3NMI A;  3GAN A;  3QW1 A;  1U89 A;  4IAO A;  3U2L A;  3M79 A;  3KH2 A;  1Q0M A;  2IXM A;  2HS5 A;  5CI8 A;  3DE9 A;  4IJJ A;  3JT1 A;  3ZG1 A;  2OEV A;  5DLJ A;  2XLO A;  2Q00 A;  3AG4 C;  3HNK A;  4BPM A;  4IWB A;  5HSW A;  1YYJ A;  3GWL A;  1GS9 A;  4G7H F;  3TJ6 A;  1NZE A;  2IXP A;  5L0G A;  3U9J A;  3FDQ A;  2H8A A;  2XS1 A;  4MTF A;  1KTM A;  5EHH A;  4Q4Z F;  3I4U A;  3C8G D;  1NFN A;  5D92 A;  3EQL F;  1TR2 A;  4U5E E;  1LI7 A;  2IOQ A;  4DRJ B;  4PJL A;  3US6 A;  4BJ6 A;  1T6Q A;  2CW0 F;  2HSQ A;  3MFN A;  1YZA A;  3U0C A;  1JPN A;  1DOW A;  2L6F A;  2CNW A;  4DBQ A;  1K40 A;  1G5Z A;  4MW3 A;  1T9K A;  3JYY A;  3M4C A;  4PJM A;  3NRH A;  2EIL C;  1PD1 A;  2EIM C;  4EIY A;  1MMA A;  3JZ0 A;  4G78 A;  2XXA B;  1RKE A;  3EGX B;  2Q9A A;  4IB4 A;  3HNL A;  3U3B A;  1LS4 A;  1VK5 A;  2YLD A;  3E9V A;  1TWC A;  1XZQ A;  4JJG A;  3LJB A;  2ZXR A;  4QDL A;  3AG3 C;  4EBK A;  4FAP B;  5KYU B;  1E86 A;  3RVZ A;  2ZXO A;  2FGY A;  4JTD B;  5L0D A;  3QZC A;  3JYH A;  4PK4 A;  2IXN A;  3EZI A;  5COM A;  1NFO A;  2A0U A;  2YVK A;  3CSK A;  4M63 A;  1E83 A;  2NSF A;  1SF8 A;  4EKW A;  2GFH A;  2WB7 A;  2AVK A;  3HNI A;  4I1M A;  1TQG A;  2KYH A;  1I4Z A;  3SZR A;  3UGO A;  4ANJ A;  3U3F A;  2R7R A;  1AVO B;  2Y3D A;  3K33 A;  3KPH A;  3DZA A;  1RMV A;  4CDY A;  1L3P A;  3DMD A;  3ZTZ A;  3G4Z A;  4U9D A;  3B29 A;  2YLG A;  4YK5 A;  1AEP A;  3HLZ A;  1NG1 A;  4KNW A;  1VYK A;  2LFF A;  4JZA A;  1LKX A;  2OKU A;  4LER A;  1DOV A;  1AUE A;  4LDQ A;  4O7G A;  1ZHY A;  3W8I A;  3FMS A;  2J0X A;  2R05 A;  3IQ5 A;  1ZHT A;  4DVY P;  2IXO A;  5DS5 A;  5F5F A;  2H7V C;  2VCB A;  2Y3G A;  4R32 A;  1ZVZ A;  2EPM X;  1H9G A;  1N1C A;  3UGP A;  2HZ8 A;  3OWT A;  3FOO A;  3HJC A;  5T3T A;  2H7O A;  1MMD A;  2YZS A;  2CCY A;  4FWV A;  5KYY A;  1SYQ A;  1ZU5 A;  2MHR A;  2DGJ A;  4YWQ A;  2MYS A;  2W45 A;  4KBL A;  1MNE A;  1Z3I X;  1ST6 A;  1HE9 A;  1TWA A;  3LLI A;  2C03 A;  4O6Y A;  2Z15 A;  1OR2 A;  5BQI A;  3ABK C;  4PJJ A;  3T4R A;  1QVX A;  3BRJ A;  2NUT A;  2QY9 A;  2H7B A;  4HFF B;  3NMJ A;  1TFO B;  3FAP B;  5JS5 A;  3E70 C;  3CEX A;  3RF3 A;  2R7Q A;  4XPX A;  5K0I A;  3GM2 A;  4FES A;  3DM5 A;  4I3M A;  3DJN B;  4F4B A;  3HKK A;  3PHF 2;  4D4X A;  4L6R A;  3SEO A;  2VB6 A;  2IBF A;  1OCC C;  3DAG A;  1T5O A;  4U5F E;  1H9T A;  4JCZ A;  2XLV A;  4FX5 A;  1ZW2 A;  4NTB A;  4DRI B;  1OQC A;  1G8X A;  3AQB A;  3ASO C;  3C63 A;  4JTC B;  4DVZ A;  4EWC A;  1EA8 A;  2WVO A;  3KMI A;  2ZXW C;  4IAR A;  3QTH A;  4WGY A;  1D0Y A;  1K05 A;  2PP4 A;  3ZQV A;  2XM0 A;  3X1O A;  2D5R B;  3JTL O;  4AL1 A;  5B3S C;  3JSE O;  4GYT A;  3V5Y A;  3MLG A;  5EGY A;  3CAX A;  4XLP F;  5JUA A;  2Q3T A;  3SNH A;  4I44 A;  4AL0 A;  1WN0 A;  4CJG A;  1LIH A;  3NYM A;  5COF A;  2AWC A;  2R7X A;  4BJ5 A;  2OOC A;  3RIP A;  1FNT c;  2B0H A;  2AP3 A;  5D91 A;  4C3D A;  3IQ6 A;  4HE8 D;  4XTK A;  2DI3 A;  4JW1 A;  2YQY A;  2OJE D;  3LNM B;  2VC9 A;  2PX0 A;  4MQ9 F;  3RW0 A;  2I15 A;  3KL4 A;  4CX9 A;  4O6M A;  1FMW A;  4GQH A;  3MYI A;  2VCC A;  4ONS A;  2LCH A;  3F47 A;  4MVQ A;  2YKZ A;  3U8P A;  5DQZ A;  3TUL A;  3MYF A;  4U5G A;  4J7Y A;  2KJG A;  2J0W A;  2VCA A;  4N6H A;  1W2W A;  4YT4 A;  1CGO A;  2J45 A;  4NTF A;  3L34 A;  5KYN A;  1YAR O;  1HY5 A;  4NY3 A;  1YAU O;  5A6K A;  1M56 C;  2QTV A;  2GAQ A;  3PMR A;  4AK9 A;  2BE5 F;  3DXJ F;  4CS8 A;  1R5I D;  2L6G A;  2NSG A;  2KSF A;  3JSZ A;  4MVU A;  5AC5 A;  3I5Q A;  5KYX B;  2Y3H A;  4CJO A;  3K7D A;  4ULV A;  3S9O A;  4RBN A;  4CS7 A;  2XLW A;  3C62 A;  3IHU A;  3KKB A;  5A6A A;  4C7O A;  2NUP B;  4DXW A;  1G4W R;  2WZF A;  1Z23 A;  3EJN A;  4CSA C;  1WGW A;  1QQ3 A;  1Q0G A;  2D4U A;  4CBE A;  3GEH A;  2LIG A;  2XLD A;  3KYI A;  4OIN F;  5CIV A;  5JP7 A;  3TQO A;  1VYI A;  2B0J A;  1RJ9 A;  2XL8 A;  1OKK D;  2YEV A;  1OXB A;  3LNR A;  4JC7 A;  1BR4 A;  1JRA A;  1HMO A;  5B1B C;  2X0C A;  4CIH A;  2OU6 A;  1RXQ A;  2XRH A;  4H4K C;  4NTA A;  1LE2 A;  4XLN F;  1E2X A;  3W2W A;  1ZU4 A;  4XWJ A;  2PBE A;  5L0H A;  3ZC4 A;  1CGM E;  3WHN A;  2HJM A;  5L3Q A;  2KW3 C;  4WGZ A;  3KYJ A;  3B0V C;  4DJ9 A;  4JVS A;  1VB5 A;  5L0C A;  3C8G A;  4C3E A;  3AGT A;  1E85 A;  3DJU B;  3EH2 A;  1A7E A;  4JKV A;  2NPU A;  2GDC A;  1S7Z A;  4MW8 A;  2LD6 A;  1WTY A;  3B0P A;  4MTG A;  3T6B A;  3VAY A;  1A41 A;  2CGE A;  3MX3 A;  3TD7 A;  3L8J A;  4KC9 A;  2ZXP A;  2R7U A;  4N6C A;  4RDA A;  1VTM P;  3NKE A;  4U5B E;  2G62 A;  1SMY F;  5BUO A;  2ASR A;  2XXA A;  1OR3 A;  2AWY A;  3EGX A;  1FTS A;  1NU7 D;  2R9R B;  3OA1 A;  5L0J A;  3S84 A;  1QKR A;  3R7C A;  1TWG A;  2UUH A;  3EG9 B;  3AG2 C;  1T01 A;  1APC A;  1NLX A;  2OCC C;  2PNO A;  4JEB A;  4W8P A;  1YZC A;  5EK0 A;  5AC4 A;  3AQC A;  2EIJ C;  1Q0K A;  5CI9 A;  2VAS A;  1R4T A;  4CS9 C;  4YT2 A;  1YA7 O;  4RD9 A;  4K1O A;  4AE4 A;  2Y3B A;  1V4A A;  4B6I A;  1LPE A;  2C04 A;  2G3V A;  4WJ0 A;  4JTA B;  5KYW A;  2QUP A;  3O39 A;  2YL1 A;  3FVY A;  4OD5 A;  1RKE B;  4YN0 B;  3RYL A;  3ZSU A;  5FCL A;  4OIQ F;  2WL8 A;  4E17 A;  4P9F A;  2ZD9 A;  1OW7 A;  3NYJ A;  4XPY A;  3RQE A;  2KC3 A;  1ZYR F;  3CZ6 A;  3S29 A;  3SYN A;  4E7Z A;  3NDB B;  4U5C E;  4KI2 A;  3IPM O;  3AG1 C;  2P1A A;  2CDQ A;  4OIR F;  5A69 A;  2R7W A;  3B9Q A;  3FXH A;  4A4A A;  2RD9 A;  1NSG B;  1T6U A;  3RH3 A;  5DS4 A;  3RQG A;  1I4Y A;  2OG2 A;  3K1I C;  2WZG A;  1S05 A;  1QPU A;  2JX0 A;  1YYX A;  4PFP A;  4BJ1 A;  4ZLD A;  2IM8 A;  1ZHZ A;  3Q6M A;  2XM4 A;  3OEO A;  4PAC A;  3T6J A;  3TOL A;  4H54 A;  4HEA J;  3BEH A;  1FMV A;  1L7C A;  3S90 A;  4X0R A;  2EIN C;  1WAS A;  4P6I C;  1JOG A;  3K66 A;  3U2M A;  3SXY A;  1E84 A;  4N4W A;  3U9M A;  2P7V A;  4J7T A;  2JPU A;  3N24 A;  1NU9 C;  2OEX A;  2XL4 A;  4O6N A;  2P6V A;  4JE9 A;  3WAQ A;  1GQA A;  4GEH A;  3X2Q C;  5DS6 A;  4MVM A;  3K1H A;  2P0N A;  3T6G B;  3ZVR A;  1ZW3 A;  1OCZ C;  3ZDL A;  4AX2 A;  2EPK X;  3AJM A;  2RSE B;  3CQZ A;  5JVE A;  1QZX A;  3U8V A;  2QE9 A;  3LEV A;  1YJG A;  2ICW G;  5COG A;  1KU2 A;  3POV A;  1M2V B;  3ITF A;  2QNL A;  4CIP A;  1VMA A;  1YLM A;  2F22 A;  4XEK A;  3EFO A;  2HSB A;  5E3C A;  3MBG A;  1CPR A;  4OIO F;  4DRH B;  2Q7R A;  3IEE A;  1JAF A;  4LDK A;  1C03 A;  2FAP B;  2AU5 A;  5B3I A;  5IY5 C;  4QI0 A;  4YT8 A;  1T6I A;  5A6B D;  1O3U A;  4NC3 A;  4XQ1 A;  2Q9C A;  2MWQ A;  3EGD A;  1HW1 A;  4OD4 A;  2V3C C;  3DAF A;  1LI5 A;  4JEA A;  1ZZP A;  1WWP A;  2QLA A;  1BDJ B;  4YL3 A;  5GPG B;  4BG0 A;  4K0D A;  2W4B A;  1LM3 B;  2EPO A;  3LS0 A;  4LLE A;  1Z7Q c;  5L0I A;  2YWA A;  3I5P A;  1JPJ A;  4JRZ A;  2J7P D;  3G4X A;  3TJ5 A;  4NQF A;  3AGU A;  3G50 A;  1M6T A;  1H6G A;  1ORY A;  1D0X A;  3NKD A;  2HMZ A;  4KNV A;  1U6H A;  1QSP A;  3ECS A;  2L7A A;  3LS1 A;  3J06 A;  3RKO F;  2X51 A;  3DM9 B;  1YA9 A;  3DKA A;  3UMH A;  2ZPA A;  3IQT A;  1RKC A;  1C02 A;  3K6B A;  1FAP B;  4MTO A;  1LVK A;  5TJ5 E;  1M2O A;  2V26 A;  5KYX A;  1G4U S;  1TWH A;  4XEF A;  2PF4 E;  4P9T A;  3QVY A;  3EPV A;  5L0F A;  5DQT A;  4LLC A;  4BJT A;  1FFT C;  4U9E A;  3RFY A;  1M57 C;  2HJ3 A;  4JUR I;  3ZWI A;  1Q0F A;  5AGF A;  3GWN A;  3UNG C;  4C3B A;  2Y39 A;  1J8M F;  4Z9H A;  2KK1 A;  4MND A;  1D1C A;  3EHN A;  3M1C B;  4IGG A;  5JSL A;  3PCV A;  2YRF A;  4J32 B;  3NG1 A;  3A9C A;  1OKK A;  2YLI A;  4DOZ A;  2HFI A;  1VLT A;  4YT5 A;  3UMK A;  2GA0 A;  3QW0 A;  2YL0 A;  4ER9 A;  2J9B A;  4CDV A;  1F1M A;  1MMN A;  3C7J A;  2YL3 A;  2XSE A;  2HKV A;  3GEE A;  4PJN A;  2KQ9 A;  3V5X A;  2XLE A;  1Y6D A;  1MQV A;  3IQC A;  4IAQ A;  1O87 A;  5JLI A;  2XL6 A;  3O6X A;  3UR3 C;  2HV7 A;  2OQM A;  2R02 A;  3F46 A;  2HUJ A;  1J8Y F;  4Z9J A;  1D0Z A;  3T9O A;  3QVZ A;  1RJ9 B;  5HV9 A;  4YL0 A;  3GM3 A;  1NBB A;  4BJ6 C;  1VLS A;  2P61 A;  1PD0 A;  3H2U A;  2ETS A;  4MVZ A;  5E3A A;  2DYR C;  4MVR A;  1OW8 A;  1YDI A;  2OJQ A;  3ZIB A;  3A11 A;  4EBB A;  1WAT A;  2Q9B A;  3TOM A;  1QLE C;  3EG9 A;  4D4N A;  5DVW A;  2YHS A;  5KYU A;  3ZQY A;  2CYD A;  3SXM A;  3C8G B;  3EZH A;  1D1A A;  4BJ5 C;  4E0H A;  2CNW D;  2LSE A;  4IRU A;  1TKN A;  4G7O F;  3WG7 C;  1V74 B;  1Z6A A;  5BQH A;  3V7O A;  1CGN A;  2YL7 A;  1H7I A;  3O10 A;  3SP1 A;  2J9U A;  4DBR A;  4N06 A;  2LQG A;  4MVS A;  1RCP A;  1SZI A;  2EIK C;  5T1D B;  1C17 M;  1SR2 A;  5F5H A;  2WVN A;  2LP4 A;  5B1A C;  3M4B A;  3ABL C;  3ABM C;  1HW2 A;  3S28 A;  3LAY A;  5FZT A;  2XS8 A;  4PFO A;  2W4M A;  4ULW A;  4W8K A;  1PV3 A;  1B68 A;  3W8H A;  1I5N A;  2A6E F;  3AOU A;  5BQG A;  3SXZ A;  2R25 A;  2Q4F A;  2KNH A;  4G7Z F;  2HV6 A;  4AE4 B;  1A7V A;  2L9J A;  4CS8 C;  3B0U X;  4E7S A;  4OIP F;  5E33 A;  4E0I A;  5F28 E;  1D1B A;  5KYW B;  3GOR A;  1JR8 A;  2PFD A;  3FAJ A;  3H2V A;  2A0B A;  1LE4 A;  2J9V A;  2R7T A;  2GWW A;  3QMK A;  3O55 A;  3DD7 A;  2WVQ A;  3VF0 A;  2E87 A;  2BC5 A;  2DYS C;  2J8W A;  1YVI A;  3R2P A;  4QI2 A;  3L8I A;  1K04 A;  2LFD A;  2WZL A;  3SXK A;  256B A;  2IYL D;  1ZHX A;  5L3V A;  4YJW A;  1OXK A;  3JCU Q;  2M64 A;  2KGO A;  4K7B A;  1U0B B;  1JMW A;  3VM6 A;  1IW7 F;  1BZ4 A;  1WOL A;  5KYY B;  1OCR C;  5T3W A;  5A6B A;  1FR0 A;  1FFH A;  1CPQ A;  3FOP A;  4MVO A;  3GOD A;  2UUI A;  1BBH A;  2BL2 A;  4JJF A;  1EI7 A;  3S27 A;  2A6H F;  2W9Y A;  3JRT A;  3N0T A;  3NYL A;  3RVY A;  1UFB A;  4CSA A;  4BEM J;  1M2V A;  2R03 A;  1PCX A;  4U5D E;  4Z9I A;  5JRA A;  1GGQ A;  2G3K A;  4Q5S F;  1EKY A;  1EQ1 A;  3GEI A;  3DI5 A;  3EHM A;  3Q7G A;  3S0X A;  2NUT B;  3C18 A;  3L1M A;  1A7D A;  2EPN A;  4JCH A;  4I1O B;  2I8B A;  4UDV A;  2A1D D;  3WOD F;  3ZTM A;  4XEV A;  1XZP A;  3M15 A;  2LK4 A;  3H65 A;  4Q7C A;  1V54 C;  3Q7L A;  3Q6N A;  2HMQ A;  1Y4C A;  3EH1 A;  1O5H A;  1MND A;  3VYW A;  4EUK B;  3VRC A;  1HMD A;  3JRM O;  4JIO A;  3EFO B;  2VH3 A;  3TK0 A;  3UMI A;  2R7S A;  3V5Z A;  4BEJ A;  2O9X A;  2L6H A;  3RQF A;  2R7V A;  1OCO C;  4ZLC A;  2A69 F;  3B71 A;  3PDM P;  2J7P A;  3ATP A;  1IZM A;  1Z5Z A;  4PR9 A;  2M4E A;  4CDA A;  4LAC B;  3U5S A;  3LUT B;  2R7O A;  1GM5 A;  1KNY A;  2J46 A;  4E18 A;  3EGD B;  2XLH A;  4G0H A;  3DE8 A;  5E2Q A;  2TMV P;  4CS9 A;  4EBJ A;  2PX3 A;  2DB4 A;  4A2N B;  2L81 A;  4J30 B;  1ORJ A;  1BR1 A;  2NG1 A;  4EHP A;  1LS1 A;  3LES A;  1Z63 A;  1ORS C;  5A6J A;  3DWW A;  1A0B A;  1MMG A;  3ASN C;  3LEO A;  4U5H A;  3W2V A;  1TFK B;  3NMK A;  2EPL X;  2NUP A; 
#chains in the Genus database with same CATH homology
 3GWN A;  3GWL A;  3TK0 A;  3W4Y A;  1JRA A;  1OQC A;  4E0I A;  3LLI A;  1JR8 A;  4E0H A;  3MBG A;  3U5S A;  3LLK A;  3O55 A;  4LDK A;  3U2M A;  3TD7 A;  3U2L A;  2HJ3 A;  3R7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...