3GWLA

Crystal structure of asfv pb119l, a viral sulfhydryl oxidase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
106
structure length
106
Chain Sequence
GSHMLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
source organism African swine fever virus ba71v
molecule tags Oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase
total genus 41
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwlA00
3U2LA 3U5SA 3TK0A 3LLKA 3GWLA 4E0IA 3R7CA 4LDKA 3GWNA 3U2MA 4E0HA 3W4YA 2HJ3A 3MBGA 3TD7A 1OQCA 3LLIA 1JR8A 3O55A 1JRAA
chains in the Genus database with same CATH superfamily
3AG1C 2Z15A 4G7HF 3S29A 4NCQA 2QTVA 5D91A 3POVA 4YL0A 3QVYA 1YZCA 3EFOB 3DI5A 2XLMA 4ULWA 1NBBA 2FGYA 2IOQA 4Q5SF 3RVYA 1SYQA 2OJQA 1YZAA 3ZQVA 1TWCA 4BJ5C 3LNMB 1G4WR 1NFNA 3GANA 2EPOA 4JRZA 3RVZA 1LE2A 1JR8A 1SR2A 4JW1A 5K0IA 1CGOA 4AK9A 2J9WA 3PHF2 1NSGB 1H7IA 4CBEA 5BQHA 4IARA 1Z5ZA 2KK1A 1RKCA 2FFHA 2Y3GA 4BEMJ 1BZ4A 2H7BA 1FNTc 1OXBA 3G50A 3RF3A 3RQGA 1YJGA 2IBFA 4OIOF 1MMNA 2O9XA 4J30B 1JPNA 2IXOA 3BEHA 3DAGA 4XPYA 1BBHA 5JSLA 1XZQA 3EGXB 4PR9A 2A0UA 3RQFA 4DRIB 4K0DA 1S05A 2HFIA 2YWAA 3K7DA 1JRAA 2HV7A 2P61A 1TQGA 4CSAA 2R7UA 3R2PA 3FVYA 5KYXA 1WTYA 5COFA 3N24A 1YVIA 5KYYB 3ZVRA 3DJNB 1LKXA 5F5FA 4JCZA 1JOGA 4U9EA 3KMIA 1Q0FA 1GM5A 3DM5A 2MWQA 2XLOA 5KYUB 2XS1A 2Q9BA 2CCYA 3H65A 1K40A 1PD1A 3O10A 3WAQA 2Q9CA 3C8GD 2ETSA 1YAUO 4IAOA 3RIPA 2EILC 2HMZA 1MQVA 1I4ZA 3DE8A 1E84A 3U3FA 1E83A 1EKYA 2DI3A 3DE9A 4XPWA 4EKWA 1I4YA 3K1HA 3N2ZB 3HLZA 2BE5F 4JEAA 2IYLD 4XLNF 2VCBA 1K05A 4C3BA 1U89A 2R03A 1JPJA 3HJCA 2YLDA 3DMDA 3FHDA 1HMOA 2M4EA 3U3BA 2J0WA 1G5ZA 5JRAA 2NUPB 2MHRA 4UDVA 2YZSA 4YN0B 2Y3DA 2Q3TA 1T01A 2ZXWC 3H2VA 3LS1A 4IWBA 3ABLC 2ZXPA 1EQ1A 3U9MA 2HSBA 1KTMA 1WGWA 2EIJC 4BJTA 4NC3A 1QPUA 3F46A 2DYSC 3HKKA 5L0DA 5CI9A 4M63A 2CGEA 1FMVA 3ZIBA 1TFOB 2A1DD 2VC9A 2R7WA 1YDIA 3LNRA 2ZXOA 3ITFA 1CGNA 4NTFA 4I44A 2R02A 1M57C 2W4BA 3V5YA 3I5QA 4U9DA 1G8XA 3SXYA 4E17A 1SF8A 3B0PA 1U0BB 3QW0A 3K33A 2FAPB 4MTFA 2OU6A 2GAQA 3W2VA 3W8HA 4XWJA 2OOCA 2OCCC 5KYUA 1OKKA 3C7JA 1E85A 3S84A 1J8MF 2J9VA 1TWAA 3DJUB 4B6IA 1HY5A 1T9KA 1ZHWA 5KYXB 3O6XA 1HMDA 4LDKA 4RBNA 1U6HA 1H6GA 2W45A 3EG9A 2A6EF 3DZAA 4LLCA 5IY5C 3JZ0A 1HE9A 4U5FE 1M56C 3SEOA 3TK0A 4C7OA 1D1AA 3S27A 4AX2A 2XSEA 4MS2A 2R7VA 5AGFA 1UFBA 1ZHZA 3PCVA 2B0JA 2J8WA 1NFOA 2NSGA 2PFDA 2XM4A 2HUJA 3O55A 4JCHA 3TD7A 2V3CC 2LIGA 3V5XA 4FX5A 3HNKA 3NYJA 3CEXA 4JVSA 4G0HA 5KYYA 1CPQA 3Q7LA 1OQCA 4YL1A 5EK0A 4CS8C 1ZHYA 2LCHA 4N6HA 5DS4A 1EI7A 2H7VC 5L0GA 2VB6A 4JC7A 2TMVP 5BUOA 2AU5A 3K1IA 2XLVA 1TWGA 2C03A 2YLGA 4NTBA 3GEHA 4EIYA 4K7BA 2EPKX 5F5HA 5JVEA 4QI2A 1N1CA 1DOVA 2L9JA 2R7QA 4LDRA 2WL8A 3I4UA 1LPEA 2AWYA 2Q00A 3L8JA 4IAQA 3T6BA 3W4YA 2GA0A 2EIKC 4CS8A 1A7EA 3N0TA 4U5DE 4EHPA 1GGQA 2LD6A 3MX3A 3NMKA 2Q4FA 4H54A 1A0BA 3S0XA 3HNJA 1WATA 2P1AA 3HNLA 4PFOA 4CJGA 4KI2A 3ABMC 4U5CE 1ZU4A 1MMGA 3DKAA 5L0FA 4WJ0A 2LK4A 3T6JA 4CDVA 1KU2A 4JKVA 1VTMP 1V4AA 2F22A 3ZTZA 1Q0GA 1M2OA 4KNWA 4HFKB 1AVOB 1K04A 2Y3BA 1RCPA 5JT4A 1MNDA 4JZAA 3DD7A 5KYWA 5B3SC 4CSAC 3RW0A 4DVZA 4DBQA 5HV9A 3SXKA 1CGME 4WABA 3VF0A 2LQGA 3TJ5A 1D0YA 2KQ9A 3MBGA 3IEEA 1QKRA 2HSQA 3K1IC 2L6HA 4LACB 3AGTA 3LUTB 3UNGC 4Q4ZF 2YL1A 2PF4E 3A11A 3NG1A 4JTCB 2HMQA 1LI7A 3TJ6A 4EWCA 4BJ5A 2V26A 2OG2A 256BA 2WZFA 3LS0A 3U8PA 3NRHA 4DOZA 1PV3A 5KYNA 3UGPA 4RDAA 1H9TA 3ABKC 3GEEA 1MNEA 3JYHA 2XLEA 3ECSA 4O79A 2YHSA 3T9OA 2CYDA 4BPMA 2WZLA 1V74B 3EHMA 1TKNA 2XLHA 1B68A 3NKDA 1JMWA 4O7GA 3IHUA 1R5ID 2NG1A 3JSEO 5HSWA 4YK5A 1OW7A 2Q9AA 1VB5A 3EH1A 3MYFA 2PNOA 4N06A 2A0BA 4YT5A 4OD5A 2OKUA 5FCLA 2X0CA 4ANJA 1S7ZA 3ASNC 2LFDA 2LSEA 4Z9IA 2G3VA 4W8PA 1ZZPA 4CDAA 2R7RA 5BQGA 4ZLCA 4DXWA 3IPMO 2H7OA 3TOLA 1OCOC 4YJWA 4XLPF 4P6IC 3X1OA 4ZLDA 1WASA 5E2QA 3TOMA 2I8BA 1I5NA 2WVOA 3FMSA 2RSEB 1YYXA 3OA1A 1Z23A 3IQTA 2YLIA 4JE9A 1ZYRF 2J9BA 3CSKA 3KH2A 3UR3C 1RMVA 4CS9C 4YL3A 4MTOA 1L7CA 5EHHA 3H2UA 1C02A 2R7XA 2YVKA 4HEAJ 3HNIA 4MVUA 1T6UA 2P6VA 2DYRC 2P7VA 2PBEA 3LLIA 2YL7A 4KC9A 4MW3A 5GPGB 2XLDA 3ZQYA 1LVKA 4U5HA 4CJOA 2WVNA 4YT8A 2X51A 3S28A 1QSPA 4AL1A 3U2MA 3CZ6A 4CS7A 4MNDA 2DGJA 3L0IA 1OXKA 2A6HF 2WZGA 2VCAA 1AUEA 3MFNA 4ONSA 3KL4A 1RKEB 3Q6MA 5E3AA 4AE4A 4I1MA 1C17M 1LS4A 3SXMA 4D4XA 1E86A 3J06A 2ASRA 3IQCA 1C03A 2G3KA 3VAYA 3NKEA 3AG2C 4E7ZA 4I1OB 3FOPA 3IQ6A 2NUTB 3SXZA 3LLKA 2JD3A 3AG3C 4JIOA 5A6BD 5BQIA 3JRTA 1H9GA 1RKEA 1QZXA 4U5EE 3ZTMA 2GDCA 2QUPA 4XEFA 5B3IA 1ZVZA 1Z63A 3AG4C 4MTGA 3ZG1A 1FAPB 2IM8A 4NTAA 3AJMA 3EH2A 2ZD9A 1OCRC 3EPVA 4PFPA 4H4KC 3WODF 1VLSA 1GS9A 3BRJA 5L3VA 3E9VA 3AQBA 1XWJA 3G4XA 3GM1A 3IQ5A 3X2QC 1M2VA 3T6GB 1NU7D 3UMIA 4MVRA 3S9OA 2XXAA 5L0CA 3L34A 5F28E 1Y6DA 4LERA 4QDLA 4F4BA 4P9FA 4G7ZF 4Z9HA 4RD9A 1QLEC 3GM3A 4GQHA 5DQTA 5DS5A 4XEKA 2EINC 3EGDA 5COMA 3GM2A 2EPNA 3RYLA 1TR2A 2R25A 1VOMA 2R7SA 1WOLA 3R7CA 1T6QA 2AP3A 3C8ZA 3M79A 2XXAB 4ULVA 2H8AA 1QQ3A 2XRHA 4J7TA 3HTKC 1PCXA 1RJ9B 2CNWA 2EPMX 4JJFA 3U2LA 5L0JA 2J7PA 1O87A 3B29A 5B1AC 3PDMP 4OIRF 2J7PD 2KW3C 3NYLA 4PJMA 3C62A 3I5PA 5FZTA 3UMHA 1M6TA 3ZDLA 4YT4A 1L3PA 3FAPB 4XPXA 1BDJB 1OW8A 1VYKA 2L6GA 2NPUA 2PP4A 3B71A 4N4WA 3UMKA 1V54C 3NMIA 5L0IA 1APCA 4XTKA 5A69A 3TULA 4W8KA 2B0HA 3GWLA 4E7SA 2P0NA 4K1OA 3M15A 1Q0DA 4JJGA 5AC5A 4IB4A 1RXQA 2HJMA 2D5RB 4J7YA 1WN0A 5A6AA 5DLJA 3NYMA 4GEHA 3GORA 1SMYF 5JLIA 4DVYP 1ZHTA 2UUIA 3EZHA 3G4ZA 3GODA 3VYWA 5CIVA 3U8VA 2W4MA 4J32B 1ZHXA 3JYYA 3QZCA 2IXPA 4JTAB 2XLWA 3QW1A 3T4RA 3U9JA 3GEIA 2XS8A 3V5ZA 4CX9A 3L8IA 4DBRA 4MVQA 1FFTC 2HZ8A 1O5HA 1UG7A 3Q6NA 3WHNA 3QMKA 4MVOA 2JPUA 4LLEA 1T5OA 2BL2A 2XL8A 3EGDB 2CNWD 2WB7A 1Z7Qc 4AL0A 5L0HA 4A4AA 2BC5A 2PX3A 3JTLO 4MQ9F 2E87A 2QLAA 3GWNA 3US6A 3LESA 4MW8A 2GWWA 4KNVA 1M2VB 2HS5A 2PX0A 2A68F 4CIHA 1E2XA 2EIMC 1LM3B 2AVKA 4YWQA 1TWHA 3JCUQ 3SP1A 2IXNA 1CPRA 2QY9A 2UUHA 3SZRA 3FDQA 2J46A 3TQOA 5A6KA 1ORSC 3LJBA 1AEPA 3VM6A 3W8IA 2G62A 1MMAA 1PD0A 4PK4A 1YYJA 1NU9C 2WVQA 4EUKB 4OIQF 1ZW2A 5B1BC 1OW6A 4JTDB 3K66A 2NUTA 4LDQA 1SZIA 3W2WA 1BR1A 3LEOA 2Y39A 1J8YF 1ZU5A 2HJ3A 1YA9A 4G7OF 3ZSUA 1LE4A 2KC3A 3KPHA 4R32A 5E3CA 3NDBB 3DM9B 4A2NB 1FTSA 1NG1A 4OINF 4AE4B 4HFFB 1FFHA 4BEJA 3KYIA 4C3EA 1JAFA 3DAFA 4DJ9A 3Q7GA 3B0VC 2J0XA 2YL0A 5EGYA 4IRUA 1FR0A 2L81A 1BR2A 2R05A 4U5GA 1YLMA 4MVSA 5JUAA 1Y4CA 2EPLX 3FAJA 3B9QA 4WGZA 2VASA 1GQAA 1T6IA 4EBBA 2HKVA 3AGUA 4FESA 3V7OA 5CI8A 5TJ5E 3UGOA 3ATPA 4XEVA 4OIPF 2KYHA 3K6BA 2YL3A 3CAXA 1DOWA 4E18A 4YT2A 4O6YA 3RH3A 1VYIA 2Y69C 2YRFA 3C63A 3JSZA 3LEVA 4IGGA 5COGA 5D92A 3U0CA 1A7VA 1V55C 4C7OB 2D4UA 2QNLA 3E70C 2LP4A 3O39A 4JEBA 1LS1A 1D1BA 3DXJF 4EBJA 2YKZA 3CQZA 4U5BE 3MLGA 1IZMA 4BG0A 1OCCC 1Q0MA 3FXHA 2YEVA 4PJLA 1IW7F 5T3WA 4CIPA 3KYJA 2NSFA 2CW0F 4CDYA 1OCZC 2OEXA 3RFYA 4PJNA 1FMWA 5A6BA 4NY3A 5DQZA 4HE8D 2YQYA 3SYNA 4EBKA 2OJED 3SNHA 2Q7RA 2J45A 4QI0A 3RKOF 4BJ6C 5JP7A 3EHNA 1BR4A 1YARO 4OD4A 3M4BA 1D0ZA 3OWTA 2NUPA 3C8GA 4WGYA 5E33A 2KNHA 1NLXA 1ORJA 3RQEA 1G4US 2CDQA 1F1MA 3QVZA 3A9CA 1HW1A 4O6NA 4X0RA 3ZWIA 1OKKD 2MYSA 3ASOC 2HV6A 4Q7CA 2KSFA 4MVMA 3EQLF 4DRJB 3EZIA 1D0XA 1A41A 4IJJA 2L7AA 4XQ1A 1KNYA 1NZEA 4CS9A 1OR2A 1LI5A 1W2WA 3M4CA 4NQFA 2DB4A 2I15A 1VMAA 2ICWG 5KYWB 1OR3A 4D4NA 1MMDA 1EA8A 1VK5A 2QE9A 3M1CB 2R7OA 1Z3IX 2VCCA 1ZW3A 3S90A 2LFFA 4I3MA 3L1MA 5DVWA 2XL6A 4N6CA 1A7DA 1YA7O 2C04A 1Z6AA 5DS6A 3MYIA 2L6FA 4KBLA 4PJJA 3EJNA 3EGXA 4FWVA 3JT1A 5A6JA 2R7TA 2OQMA 1Q0KA 2VH3A 2W9YA 4L6RA 4DRHB 1R4TA 1VLTA 1LIHA 2JX0A 1ORYA 3B0UX 3OEOA 4JURI 4E0IA 2J9UA 3WG7C 2KGOA 1D1CA 4E0HA 3JRMO 2A69F 2M64A 3F47A 1QVXA 4P9TA 1HE1A 4G78A 5T1DB 2RD9A 1RJ9A 2IXMA 3AOUA 3AQCA 1TFKB 3KKBA 4O6MA 4Z9JA 2XL4A 2KJGA 1HW2A 1O3UA 2GFHA 3QTHA 3C8GB 2ZPAA 4MVZA 3VRCA 3NMJA 4ER9A 3PMRA 3C18A 4BJ6A 2AWCA 2XM0A 2ZXRA 2Y3HA 3ZC4A 5L3QA 3LAYA 4BJ1A 3EFOA 3FOOA 2R9RB 2OEVA 1ST6A 3U5SA 4FAPB 4PACA 1WWPA 3DWWA 4C3DA 5AC4A 5JS5A 3EG9B 4GYTA 5T3TA 1XZPA
chains in the Genus database with same CATH topology
3U2LA 3U5SA 3TK0A 3LLKA 3GWLA 4E0IA 3R7CA 4LDKA 3GWNA 3U2MA 4E0HA 3W4YA 2HJ3A 3MBGA 3TD7A 1OQCA 3LLIA 1JR8A 3O55A 1JRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2L A;  3U5S A;  3TK0 A;  3LLK A;  3GWL A;  4E0I A;  3R7C A;  4LDK A;  3GWN A;  3U2M A;  4E0H A;  3W4Y A;  2HJ3 A;  3MBG A;  3TD7 A;  1OQC A;  3LLI A;  1JR8 A;  3O55 A;  1JRA A; 
#chains in the Genus database with same CATH topology
 3AG1 C;  2Z15 A;  4G7H F;  3S29 A;  4NCQ A;  2QTV A;  5D91 A;  3POV A;  4YL0 A;  3QVY A;  1YZC A;  3EFO B;  3DI5 A;  2XLM A;  4ULW A;  1NBB A;  2FGY A;  2IOQ A;  4Q5S F;  3RVY A;  1SYQ A;  2OJQ A;  1YZA A;  3ZQV A;  1TWC A;  4BJ5 C;  3LNM B;  1G4W R;  1NFN A;  3GAN A;  2EPO A;  4JRZ A;  3RVZ A;  1LE2 A;  1JR8 A;  1SR2 A;  4JW1 A;  5K0I A;  1CGO A;  4AK9 A;  2J9W A;  3PHF 2;  1NSG B;  1H7I A;  4CBE A;  5BQH A;  4IAR A;  1Z5Z A;  2KK1 A;  1RKC A;  2FFH A;  2Y3G A;  4BEM J;  1BZ4 A;  2H7B A;  1FNT c;  1OXB A;  3G50 A;  3RF3 A;  3RQG A;  1YJG A;  2IBF A;  4OIO F;  1MMN A;  2O9X A;  4J30 B;  1JPN A;  2IXO A;  3BEH A;  3DAG A;  4XPY A;  1BBH A;  5JSL A;  1XZQ A;  3EGX B;  4PR9 A;  2A0U A;  3RQF A;  4DRI B;  4K0D A;  1S05 A;  2HFI A;  2YWA A;  3K7D A;  1JRA A;  2HV7 A;  2P61 A;  1TQG A;  4CSA A;  2R7U A;  3R2P A;  3FVY A;  5KYX A;  1WTY A;  5COF A;  3N24 A;  1YVI A;  5KYY B;  3ZVR A;  3DJN B;  1LKX A;  5F5F A;  4JCZ A;  1JOG A;  4U9E A;  3KMI A;  1Q0F A;  1GM5 A;  3DM5 A;  2MWQ A;  2XLO A;  5KYU B;  2XS1 A;  2Q9B A;  2CCY A;  3H65 A;  1K40 A;  1PD1 A;  3O10 A;  3WAQ A;  2Q9C A;  3C8G D;  2ETS A;  1YAU O;  4IAO A;  3RIP A;  2EIL C;  2HMZ A;  1MQV A;  1I4Z A;  3DE8 A;  1E84 A;  3U3F A;  1E83 A;  1EKY A;  2DI3 A;  3DE9 A;  4XPW A;  4EKW A;  1I4Y A;  3K1H A;  3N2Z B;  3HLZ A;  2BE5 F;  4JEA A;  2IYL D;  4XLN F;  2VCB A;  1K05 A;  4C3B A;  1U89 A;  2R03 A;  1JPJ A;  3HJC A;  2YLD A;  3DMD A;  3FHD A;  1HMO A;  2M4E A;  3U3B A;  2J0W A;  1G5Z A;  5JRA A;  2NUP B;  2MHR A;  4UDV A;  2YZS A;  4YN0 B;  2Y3D A;  2Q3T A;  1T01 A;  2ZXW C;  3H2V A;  3LS1 A;  4IWB A;  3ABL C;  2ZXP A;  1EQ1 A;  3U9M A;  2HSB A;  1KTM A;  1WGW A;  2EIJ C;  4BJT A;  4NC3 A;  1QPU A;  3F46 A;  2DYS C;  3HKK A;  5L0D A;  5CI9 A;  4M63 A;  2CGE A;  1FMV A;  3ZIB A;  1TFO B;  2A1D D;  2VC9 A;  2R7W A;  1YDI A;  3LNR A;  2ZXO A;  3ITF A;  1CGN A;  4NTF A;  4I44 A;  2R02 A;  1M57 C;  2W4B A;  3V5Y A;  3I5Q A;  4U9D A;  1G8X A;  3SXY A;  4E17 A;  1SF8 A;  3B0P A;  1U0B B;  3QW0 A;  3K33 A;  2FAP B;  4MTF A;  2OU6 A;  2GAQ A;  3W2V A;  3W8H A;  4XWJ A;  2OOC A;  2OCC C;  5KYU A;  1OKK A;  3C7J A;  1E85 A;  3S84 A;  1J8M F;  2J9V A;  1TWA A;  3DJU B;  4B6I A;  1HY5 A;  1T9K A;  1ZHW A;  5KYX B;  3O6X A;  1HMD A;  4LDK A;  4RBN A;  1U6H A;  1H6G A;  2W45 A;  3EG9 A;  2A6E F;  3DZA A;  4LLC A;  5IY5 C;  3JZ0 A;  1HE9 A;  4U5F E;  1M56 C;  3SEO A;  3TK0 A;  4C7O A;  1D1A A;  3S27 A;  4AX2 A;  2XSE A;  4MS2 A;  2R7V A;  5AGF A;  1UFB A;  1ZHZ A;  3PCV A;  2B0J A;  2J8W A;  1NFO A;  2NSG A;  2PFD A;  2XM4 A;  2HUJ A;  3O55 A;  4JCH A;  3TD7 A;  2V3C C;  2LIG A;  3V5X A;  4FX5 A;  3HNK A;  3NYJ A;  3CEX A;  4JVS A;  4G0H A;  5KYY A;  1CPQ A;  3Q7L A;  1OQC A;  4YL1 A;  5EK0 A;  4CS8 C;  1ZHY A;  2LCH A;  4N6H A;  5DS4 A;  1EI7 A;  2H7V C;  5L0G A;  2VB6 A;  4JC7 A;  2TMV P;  5BUO A;  2AU5 A;  3K1I A;  2XLV A;  1TWG A;  2C03 A;  2YLG A;  4NTB A;  3GEH A;  4EIY A;  4K7B A;  2EPK X;  5F5H A;  5JVE A;  4QI2 A;  1N1C A;  1DOV A;  2L9J A;  2R7Q A;  4LDR A;  2WL8 A;  3I4U A;  1LPE A;  2AWY A;  2Q00 A;  3L8J A;  4IAQ A;  3T6B A;  3W4Y A;  2GA0 A;  2EIK C;  4CS8 A;  1A7E A;  3N0T A;  4U5D E;  4EHP A;  1GGQ A;  2LD6 A;  3MX3 A;  3NMK A;  2Q4F A;  4H54 A;  1A0B A;  3S0X A;  3HNJ A;  1WAT A;  2P1A A;  3HNL A;  4PFO A;  4CJG A;  4KI2 A;  3ABM C;  4U5C E;  1ZU4 A;  1MMG A;  3DKA A;  5L0F A;  4WJ0 A;  2LK4 A;  3T6J A;  4CDV A;  1KU2 A;  4JKV A;  1VTM P;  1V4A A;  2F22 A;  3ZTZ A;  1Q0G A;  1M2O A;  4KNW A;  4HFK B;  1AVO B;  1K04 A;  2Y3B A;  1RCP A;  5JT4 A;  1MND A;  4JZA A;  3DD7 A;  5KYW A;  5B3S C;  4CSA C;  3RW0 A;  4DVZ A;  4DBQ A;  5HV9 A;  3SXK A;  1CGM E;  4WAB A;  3VF0 A;  2LQG A;  3TJ5 A;  1D0Y A;  2KQ9 A;  3MBG A;  3IEE A;  1QKR A;  2HSQ A;  3K1I C;  2L6H A;  4LAC B;  3AGT A;  3LUT B;  3UNG C;  4Q4Z F;  2YL1 A;  2PF4 E;  3A11 A;  3NG1 A;  4JTC B;  2HMQ A;  1LI7 A;  3TJ6 A;  4EWC A;  4BJ5 A;  2V26 A;  2OG2 A;  256B A;  2WZF A;  3LS0 A;  3U8P A;  3NRH A;  4DOZ A;  1PV3 A;  5KYN A;  3UGP A;  4RDA A;  1H9T A;  3ABK C;  3GEE A;  1MNE A;  3JYH A;  2XLE A;  3ECS A;  4O79 A;  2YHS A;  3T9O A;  2CYD A;  4BPM A;  2WZL A;  1V74 B;  3EHM A;  1TKN A;  2XLH A;  1B68 A;  3NKD A;  1JMW A;  4O7G A;  3IHU A;  1R5I D;  2NG1 A;  3JSE O;  5HSW A;  4YK5 A;  1OW7 A;  2Q9A A;  1VB5 A;  3EH1 A;  3MYF A;  2PNO A;  4N06 A;  2A0B A;  4YT5 A;  4OD5 A;  2OKU A;  5FCL A;  2X0C A;  4ANJ A;  1S7Z A;  3ASN C;  2LFD A;  2LSE A;  4Z9I A;  2G3V A;  4W8P A;  1ZZP A;  4CDA A;  2R7R A;  5BQG A;  4ZLC A;  4DXW A;  3IPM O;  2H7O A;  3TOL A;  1OCO C;  4YJW A;  4XLP F;  4P6I C;  3X1O A;  4ZLD A;  1WAS A;  5E2Q A;  3TOM A;  2I8B A;  1I5N A;  2WVO A;  3FMS A;  2RSE B;  1YYX A;  3OA1 A;  1Z23 A;  3IQT A;  2YLI A;  4JE9 A;  1ZYR F;  2J9B A;  3CSK A;  3KH2 A;  3UR3 C;  1RMV A;  4CS9 C;  4YL3 A;  4MTO A;  1L7C A;  5EHH A;  3H2U A;  1C02 A;  2R7X A;  2YVK A;  4HEA J;  3HNI A;  4MVU A;  1T6U A;  2P6V A;  2DYR C;  2P7V A;  2PBE A;  3LLI A;  2YL7 A;  4KC9 A;  4MW3 A;  5GPG B;  2XLD A;  3ZQY A;  1LVK A;  4U5H A;  4CJO A;  2WVN A;  4YT8 A;  2X51 A;  3S28 A;  1QSP A;  4AL1 A;  3U2M A;  3CZ6 A;  4CS7 A;  4MND A;  2DGJ A;  3L0I A;  1OXK A;  2A6H F;  2WZG A;  2VCA A;  1AUE A;  3MFN A;  4ONS A;  3KL4 A;  1RKE B;  3Q6M A;  5E3A A;  4AE4 A;  4I1M A;  1C17 M;  1LS4 A;  3SXM A;  4D4X A;  1E86 A;  3J06 A;  2ASR A;  3IQC A;  1C03 A;  2G3K A;  3VAY A;  3NKE A;  3AG2 C;  4E7Z A;  4I1O B;  3FOP A;  3IQ6 A;  2NUT B;  3SXZ A;  3LLK A;  2JD3 A;  3AG3 C;  4JIO A;  5A6B D;  5BQI A;  3JRT A;  1H9G A;  1RKE A;  1QZX A;  4U5E E;  3ZTM A;  2GDC A;  2QUP A;  4XEF A;  5B3I A;  1ZVZ A;  1Z63 A;  3AG4 C;  4MTG A;  3ZG1 A;  1FAP B;  2IM8 A;  4NTA A;  3AJM A;  3EH2 A;  2ZD9 A;  1OCR C;  3EPV A;  4PFP A;  4H4K C;  3WOD F;  1VLS A;  1GS9 A;  3BRJ A;  5L3V A;  3E9V A;  3AQB A;  1XWJ A;  3G4X A;  3GM1 A;  3IQ5 A;  3X2Q C;  1M2V A;  3T6G B;  1NU7 D;  3UMI A;  4MVR A;  3S9O A;  2XXA A;  5L0C A;  3L34 A;  5F28 E;  1Y6D A;  4LER A;  4QDL A;  4F4B A;  4P9F A;  4G7Z F;  4Z9H A;  4RD9 A;  1QLE C;  3GM3 A;  4GQH A;  5DQT A;  5DS5 A;  4XEK A;  2EIN C;  3EGD A;  5COM A;  3GM2 A;  2EPN A;  3RYL A;  1TR2 A;  2R25 A;  1VOM A;  2R7S A;  1WOL A;  3R7C A;  1T6Q A;  2AP3 A;  3C8Z A;  3M79 A;  2XXA B;  4ULV A;  2H8A A;  1QQ3 A;  2XRH A;  4J7T A;  3HTK C;  1PCX A;  1RJ9 B;  2CNW A;  2EPM X;  4JJF A;  3U2L A;  5L0J A;  2J7P A;  1O87 A;  3B29 A;  5B1A C;  3PDM P;  4OIR F;  2J7P D;  2KW3 C;  3NYL A;  4PJM A;  3C62 A;  3I5P A;  5FZT A;  3UMH A;  1M6T A;  3ZDL A;  4YT4 A;  1L3P A;  3FAP B;  4XPX A;  1BDJ B;  1OW8 A;  1VYK A;  2L6G A;  2NPU A;  2PP4 A;  3B71 A;  4N4W A;  3UMK A;  1V54 C;  3NMI A;  5L0I A;  1APC A;  4XTK A;  5A69 A;  3TUL A;  4W8K A;  2B0H A;  3GWL A;  4E7S A;  2P0N A;  4K1O A;  3M15 A;  1Q0D A;  4JJG A;  5AC5 A;  4IB4 A;  1RXQ A;  2HJM A;  2D5R B;  4J7Y A;  1WN0 A;  5A6A A;  5DLJ A;  3NYM A;  4GEH A;  3GOR A;  1SMY F;  5JLI A;  4DVY P;  1ZHT A;  2UUI A;  3EZH A;  3G4Z A;  3GOD A;  3VYW A;  5CIV A;  3U8V A;  2W4M A;  4J32 B;  1ZHX A;  3JYY A;  3QZC A;  2IXP A;  4JTA B;  2XLW A;  3QW1 A;  3T4R A;  3U9J A;  3GEI A;  2XS8 A;  3V5Z A;  4CX9 A;  3L8I A;  4DBR A;  4MVQ A;  1FFT C;  2HZ8 A;  1O5H A;  1UG7 A;  3Q6N A;  3WHN A;  3QMK A;  4MVO A;  2JPU A;  4LLE A;  1T5O A;  2BL2 A;  2XL8 A;  3EGD B;  2CNW D;  2WB7 A;  1Z7Q c;  4AL0 A;  5L0H A;  4A4A A;  2BC5 A;  2PX3 A;  3JTL O;  4MQ9 F;  2E87 A;  2QLA A;  3GWN A;  3US6 A;  3LES A;  4MW8 A;  2GWW A;  4KNV A;  1M2V B;  2HS5 A;  2PX0 A;  2A68 F;  4CIH A;  1E2X A;  2EIM C;  1LM3 B;  2AVK A;  4YWQ A;  1TWH A;  3JCU Q;  3SP1 A;  2IXN A;  1CPR A;  2QY9 A;  2UUH A;  3SZR A;  3FDQ A;  2J46 A;  3TQO A;  5A6K A;  1ORS C;  3LJB A;  1AEP A;  3VM6 A;  3W8I A;  2G62 A;  1MMA A;  1PD0 A;  4PK4 A;  1YYJ A;  1NU9 C;  2WVQ A;  4EUK B;  4OIQ F;  1ZW2 A;  5B1B C;  1OW6 A;  4JTD B;  3K66 A;  2NUT A;  4LDQ A;  1SZI A;  3W2W A;  1BR1 A;  3LEO A;  2Y39 A;  1J8Y F;  1ZU5 A;  2HJ3 A;  1YA9 A;  4G7O F;  3ZSU A;  1LE4 A;  2KC3 A;  3KPH A;  4R32 A;  5E3C A;  3NDB B;  3DM9 B;  4A2N B;  1FTS A;  1NG1 A;  4OIN F;  4AE4 B;  4HFF B;  1FFH A;  4BEJ A;  3KYI A;  4C3E A;  1JAF A;  3DAF A;  4DJ9 A;  3Q7G A;  3B0V C;  2J0X A;  2YL0 A;  5EGY A;  4IRU A;  1FR0 A;  2L81 A;  1BR2 A;  2R05 A;  4U5G A;  1YLM A;  4MVS A;  5JUA A;  1Y4C A;  2EPL X;  3FAJ A;  3B9Q A;  4WGZ A;  2VAS A;  1GQA A;  1T6I A;  4EBB A;  2HKV A;  3AGU A;  4FES A;  3V7O A;  5CI8 A;  5TJ5 E;  3UGO A;  3ATP A;  4XEV A;  4OIP F;  2KYH A;  3K6B A;  2YL3 A;  3CAX A;  1DOW A;  4E18 A;  4YT2 A;  4O6Y A;  3RH3 A;  1VYI A;  2Y69 C;  2YRF A;  3C63 A;  3JSZ A;  3LEV A;  4IGG A;  5COG A;  5D92 A;  3U0C A;  1A7V A;  1V55 C;  4C7O B;  2D4U A;  2QNL A;  3E70 C;  2LP4 A;  3O39 A;  4JEB A;  1LS1 A;  1D1B A;  3DXJ F;  4EBJ A;  2YKZ A;  3CQZ A;  4U5B E;  3MLG A;  1IZM A;  4BG0 A;  1OCC C;  1Q0M A;  3FXH A;  2YEV A;  4PJL A;  1IW7 F;  5T3W A;  4CIP A;  3KYJ A;  2NSF A;  2CW0 F;  4CDY A;  1OCZ C;  2OEX A;  3RFY A;  4PJN A;  1FMW A;  5A6B A;  4NY3 A;  5DQZ A;  4HE8 D;  2YQY A;  3SYN A;  4EBK A;  2OJE D;  3SNH A;  2Q7R A;  2J45 A;  4QI0 A;  3RKO F;  4BJ6 C;  5JP7 A;  3EHN A;  1BR4 A;  1YAR O;  4OD4 A;  3M4B A;  1D0Z A;  3OWT A;  2NUP A;  3C8G A;  4WGY A;  5E33 A;  2KNH A;  1NLX A;  1ORJ A;  3RQE A;  1G4U S;  2CDQ A;  1F1M A;  3QVZ A;  3A9C A;  1HW1 A;  4O6N A;  4X0R A;  3ZWI A;  1OKK D;  2MYS A;  3ASO C;  2HV6 A;  4Q7C A;  2KSF A;  4MVM A;  3EQL F;  4DRJ B;  3EZI A;  1D0X A;  1A41 A;  4IJJ A;  2L7A A;  4XQ1 A;  1KNY A;  1NZE A;  4CS9 A;  1OR2 A;  1LI5 A;  1W2W A;  3M4C A;  4NQF A;  2DB4 A;  2I15 A;  1VMA A;  2ICW G;  5KYW B;  1OR3 A;  4D4N A;  1MMD A;  1EA8 A;  1VK5 A;  2QE9 A;  3M1C B;  2R7O A;  1Z3I X;  2VCC A;  1ZW3 A;  3S90 A;  2LFF A;  4I3M A;  3L1M A;  5DVW A;  2XL6 A;  4N6C A;  1A7D A;  1YA7 O;  2C04 A;  1Z6A A;  5DS6 A;  3MYI A;  2L6F A;  4KBL A;  4PJJ A;  3EJN A;  3EGX A;  4FWV A;  3JT1 A;  5A6J A;  2R7T A;  2OQM A;  1Q0K A;  2VH3 A;  2W9Y A;  4L6R A;  4DRH B;  1R4T A;  1VLT A;  1LIH A;  2JX0 A;  1ORY A;  3B0U X;  3OEO A;  4JUR I;  4E0I A;  2J9U A;  3WG7 C;  2KGO A;  1D1C A;  4E0H A;  3JRM O;  2A69 F;  2M64 A;  3F47 A;  1QVX A;  4P9T A;  1HE1 A;  4G78 A;  5T1D B;  2RD9 A;  1RJ9 A;  2IXM A;  3AOU A;  3AQC A;  1TFK B;  3KKB A;  4O6M A;  4Z9J A;  2XL4 A;  2KJG A;  1HW2 A;  1O3U A;  2GFH A;  3QTH A;  3C8G B;  2ZPA A;  4MVZ A;  3VRC A;  3NMJ A;  4ER9 A;  3PMR A;  3C18 A;  4BJ6 A;  2AWC A;  2XM0 A;  2ZXR A;  2Y3H A;  3ZC4 A;  5L3Q A;  3LAY A;  4BJ1 A;  3EFO A;  3FOO A;  2R9R B;  2OEV A;  1ST6 A;  3U5S A;  4FAP B;  4PAC A;  1WWP A;  3DWW A;  4C3D A;  5AC4 A;  5JS5 A;  3EG9 B;  4GYT A;  5T3T A;  1XZP A; 
#chains in the Genus database with same CATH homology
 3U2L A;  3U5S A;  3TK0 A;  3LLK A;  3GWL A;  4E0I A;  3R7C A;  4LDK A;  3GWN A;  3U2M A;  4E0H A;  3W4Y A;  2HJ3 A;  3MBG A;  3TD7 A;  1OQC A;  3LLI A;  1JR8 A;  3O55 A;  1JRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...