3GWLA

Crystal structure of asfv pb119l, a viral sulfhydryl oxidase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
106
structure length
106
Chain Sequence
b'GSHMLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase
molecule tags Oxidoreductase
source organism African swine fever virus ba71v
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
total genus 41
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwlA00
4LDKA 3GWLA 3U2LA 3R7CA 3GWNA 3W4YA 4E0HA 3TD7A 3TK0A 3MBGA 3O55A 3U2MA 1JR8A 3LLKA 2HJ3A 4E0IA 1OQCA 1JRAA 3LLIA 3U5SA
chains in the Genus database with same CATH superfamily
3LNMB 3AQBA 2LD6A 4AE4A 1SF8A 1LE2A 1R5ID 3QZCA 1V55C 1YARO 1WASA 2UUHA 2A0UA 2EILC 4EBKA 4EHPA 1MNDA 3M1CB 4J7TA 3GWLA 4OIOF 1NBBA 1VB5A 1YZCA 1XZQA 3LESA 1NG1A 3ZQVA 4WGZA 2YZSA 5A69A 1Q0DA 4IWBA 2YVKA 3ITFA 3RFYA 3S84A 2NSGA 3O39A 2O9XA 4PJJA 2ZXRA 2Y3BA 1K40A 4J30B 1OCOC 2HV7A 1J8MF 3AJMA 4Z9HA 4XQ1A 2A6HF 2C03A 2XLWA 4NTBA 1CGME 5IY5C 4UDVA 4YT2A 2D4UA 2JD3A 2QNLA 5L0GA 1ZHZA 3K7DA 4QI0A 1K05A 1TWAA 3AG1C 2NSFA 1LE4A 3C8ZA 3W4YA 3C63A 3RQGA 3C8GD 1YZAA 1ZW2A 2JPUA 1EQ1A 2YL0A 3LEVA 4PACA 3UMHA 3RIPA 3LS0A 3UMKA 3U3BA 3HNIA 4EIYA 2KYHA 2YQYA 4AL0A 4BPMA 3U9MA 4XTKA 3WHNA 2BE5F 5DS6A 2Q9AA 3DWWA 1DOVA 3E70C 3R2PA 5DQTA 2Q9BA 5B1BC 3ABMC 5FZTA 1TWCA 3EZHA 5DVWA 3B0VC 3EGDB 4LDRA 4U5CE 3FXHA 3KPHA 3AQCA 2XLHA 3UR3C 3L1MA 3M79A 3JSEO 1MMDA 4JTCB 3ZTZA 3TK0A 3W8HA 4OIQF 1MMNA 2PBEA 2HJ3A 1WGWA 2HUJA 2X51A 1O5HA 3DD7A 3HKKA 4O6NA 1WTYA 2EINC 1D1AA 2NPUA 3Q7GA 2PX3A 1RKEA 1ZHWA 4JEBA 3S29A 2M64A 4OD5A 4CSAC 2OJQA 1YVIA 3ZDLA 1Z63A 1JOGA 2XL6A 3FHDA 3EGXB 2P1AA 4CS9A 2H7OA 3ZWIA 2NUTB 3MBGA 3UMIA 2CW0F 1VLSA 2KSFA 1R4TA 1YAUO 2ASRA 2P6VA 3HTKC 3RKOF 3JZ0A 3L8IA 3HNJA 1YA9A 4XLNF 4J32B 3NKEA 3ZC4A 1U0BB 4H4KC 3HNKA 3RF3A 4OIRF 4DRHB 3G4ZA 1OR3A 1NZEA 1T5OA 2HSBA 3DAFA 1WWPA 2KC3A 3IQ5A 5T3WA 2CNWD 1T9KA 1KTMA 3VF0A 3UGOA 4CSAA 1LM3B 2R9RB 2V3CC 2AWCA 1PV3A 5BQGA 1QQ3A 1DOWA 4JZAA 2P0NA 1S7ZA 3VRCA 4W8PA 2OEXA 2L6HA 5L0CA 1LS4A 4BJTA 4E7ZA 4XPXA 1H9TA 3QTHA 1TKNA 5L3QA 1NU9C 4MVZA 1AEPA 3PCVA 4FWVA 2NUTA 2VCBA 5KYYB 1Q0FA 2OOCA 2R7XA 3JRTA 3ABKC 5JLIA 2A1DD 4DOZA 2L7AA 4JJGA 1LVKA 1RKCA 1D0ZA 2UUIA 2XLDA 3IQ6A 4CX9A 3EZIA 4FESA 3W2VA 5KYNA 2WZLA 4G0HA 1O87A 4LERA 4DBRA 1YJGA 2IOQA 2EPNA 4NC3A 4CS9C 3B0UX 3AG4C 1NU7D 1BDJB 5D92A 3KYJA 4JE9A 1OKKD 1LKXA 4JKVA 4DRJB 3HJCA 3NMKA 2XLVA 1QKRA 3U5SA 4C3BA 5KYUB 5EGYA 4I44A 4CS7A 1H9GA 4LACB 2LIGA 3O55A 3DM5A 5COMA 4DJ9A 2HZ8A 3EPVA 2IYLD 5A6KA 2WZFA 3UNGC 4YT8A 3DE9A 2QTVA 3G50A 4E7SA 2XXAB 3FDQA 4BJ5C 1QPUA 3O6XA 5BUOA 2EPMX 1YA7O 1Z6AA 2F22A 2EIJC 1VMAA 3GWNA 2Q4FA 3CSKA 2XLOA 3T6GB 3H2UA 5DS4A 5HV9A 4WGYA 4N06A 3SYNA 4N4WA 1OCRC 3ZQYA 4JW1A 1NFOA 2R7TA 2AVKA 3DAGA 3V7OA 4IGGA 3ZG1A 5K0IA 2Q00A 4XEFA 1H7IA 4MQ9F 3PHF2 1M57C 1QLEC 2CNWA 1JAFA 1OR2A 2KQ9A 2RSEB 5KYWA 1GQAA 1YYXA 2GDCA 3FVYA 3MFNA 3NYMA 1Z23A 4NQFA 5E3CA 4AL1A 1QZXA 4GEHA 1YYJA 4NTAA 1MQVA 3U8PA 3POVA 1RKEB 2A6EF 2CDQA 2QUPA 2ICWG 1NFNA 2XM0A 3Q7LA 1E86A 1EA8A 3EHMA 4JJFA 4DBQA 3K33A 3HLZA 1RJ9A 1VYIA 2DB4A 2PX0A 4CIPA 2VC9A 4DXWA 3H2VA 2A0BA 1MMGA 5L0HA 1CPQA 3AOUA 3SNHA 2B0HA 2VH3A 1HE1A 2J0XA 2KGOA 4WJ0A 3DKAA 3RYLA 2VCCA 1Q0KA 4ZLCA 5D91A 1J8YF 1TWGA 4OINF 5F28E 3FOPA 3DM9B 4MW3A 1OXBA 5L3VA 4U5DE 2HSQA 4U5FE 1UFBA 5F5FA 3DJNB 4CJOA 4LDQA 2ZD9A 2J8WA 1E84A 1WN0A 3IHUA 4XPYA 4BJ6C 1PD1A 2FAPB 4YN0B 4MTGA 1GM5A 4JEAA 4YT5A 1G8XA 2Y3GA 4N6HA 4IARA 3S0XA 2V26A 1GGQA 5HSWA 4MVSA 4J7YA 2R7SA 3LS1A 1ZZPA 3RQEA 3TJ5A 2YL7A 5DQZA 2B0JA 1I5NA 2P61A 1VOMA 5JP7A 2R7VA 4ZLDA 1TR2A 2CCYA 2XSEA 4MVRA 2XRHA 2E87A 3CZ6A 3G4XA 4IRUA 4WABA 3F46A 3ZVRA 4H54A 1FFTC 5A6BA 2LFDA 1D0XA 3CQZA 1TQGA 4K0DA 4E0HA 3K1HA 3LAYA 4GQHA 2YEVA 1YDIA 1FTSA 4AX2A 3IQTA 2YLDA 4XWJA 1MNEA 2R03A 2DYSC 3FAJA 3QW0A 5JVEA 3GEEA 3EGDA 5F5HA 3A9CA 2Y39A 4A4AA 2YL3A 2ZXPA 4XEVA 2LP4A 1NLXA 1ORYA 5JSLA 1C02A 4G7OF 1E85A 1CPRA 2FFHA 2XS8A 3EG9B 4JTDB 2GA0A 3U2LA 1FR0A 3DMDA 3C18A 1BR4A 2W9YA 3M4BA 3B0PA 1SR2A 3N0TA 4I3MA 1HW2A 1OCCC 4CS8C 4PJMA 1E2XA 3DE8A 3GANA 4R32A 1FNTc 2KW3C 5L0IA 3SXZA 2MHRA 3EHNA 4KBLA 2GAQA 3GM1A 3GODA 3SEOA 2I8BA 2HS5A 3C8GB 4IAOA 1M2VA 1VK5A 1Z3IX 1IW7F 1BR1A 1HW1A 1A7EA 4BJ5A 3US6A 3VYWA 1XZPA 2L6FA 3V5XA 2J46A 1HE9A 4MW8A 3EJNA 4U9EA 3GEHA 4NY3A 2YLIA 1D1BA 2J7PD 2OU6A 1A7VA 2W45A 2Z15A 2ZXWC 3QMKA 1Y6DA 4HE8D 4JVSA 4DVZA 4F4BA 4O6MA 5BQIA 3S27A 2L6GA 2CYDA 2XM4A 3RW0A 1JMWA 1V4AA 1ZU5A 2R25A 5L0FA 2Q9CA 2BL2A 3B29A 3RVZA 1I4YA 4JCZA 4XEKA 4EWCA 5KYXB 1W2WA 1N1CA 1UG7A 3KH2A 1C17M 1G4WR 3ZSUA 3IEEA 2L9JA 4EUKB 5B3IA 4C7OB 4G78A 3I4UA 5E3AA 1OCZC 5COFA 2NUPB 5FCLA 2M4EA 3L0IA 3WG7C 4A2NB 2XL8A 4XLPF 4PJNA 1KNYA 4CBEA 3DXJF 4G7ZF 1G4US 1EI7A 3SXMA 4DRIB 3J06A 1AVOB 1O3UA 2ZXOA 2R7WA 1Y4CA 2PP4A 3IPMO 1BR2A 4U5HA 4E17A 3AG3C 4JIOA 4C3DA 3S90A 1TFOB 3OWTA 1I4ZA 2MWQA 4OIPF 4L6RA 2WB7A 1RCPA 3RVYA 1ZYRF 2FGYA 1LI5A 3EFOA 2J9UA 3QVZA 2WVNA 4Q7CA 1E83A 4YL0A 3T4RA 1L3PA 2QLAA 5CI8A 2TMVP 1VLTA 2P7VA 3ATPA 2YHSA 1LS1A 4YL3A 4O7GA 4ONSA 2Q7RA 3W2WA 3DI5A 2IXOA 3QVYA 1V54C 1ORSC 2R7OA 4KC9A 1Q0GA 4CS8A 4LLEA 3NYJA 3JYYA 4PR9A 4YWQA 2EIMC 4BEJA 4FX5A 3U0CA 1M6TA 4IB4A 2IXNA 2DYRC 1QVXA 2WL8A 3NG1A 2PNOA 1A41A 3I5PA 4DVYP 3NYLA 3SP1A 3Q6NA 1L7CA 2R7UA 2IXMA 1A0BA 2J45A 2EPLX 4G7HF 3AG2C 1LIHA 1B68A 4GYTA 1Z5ZA 3EG9A 2DI3A 3LEOA 1FAPB 4QI2A 4PJLA 5E2QA 1LPEA 3JRMO 1RMVA 3FMSA 3SZRA 4U5EE 3GM2A 4P9TA 4CIHA 1ZHTA 1IZMA 1TFKB 2Y3HA 3CAXA 5CI9A 3KMIA 1FMVA 4X0RA 4P9FA 2OQMA 1ZW3A 3T9OA 2WZGA 4LDKA 4PFPA 3W8IA 3JT1A 1ZU4A 2C04A 256BA 5KYUA 2J9BA 1Z7Qc 4HFKB 4Z9IA 5AC4A 1BBHA 4HFFB 2KJGA 2W4BA 2PFDA 1HMOA 4HEAJ 4RD9A 2KK1A 1EKYA 1TWHA 5A6JA 1T01A 3EH1A 1H6GA 3JTLO 4D4NA 1LI7A 2HFIA 3WAQA 3B9QA 4O79A 1GS9A 5CIVA 5AC5A 1ZVZA 1RXQA 1SYQA 4LLCA 5AGFA 3FAPB 5COGA 5JRAA 3JCUQ 2RD9A 4KNWA 4ULWA 4BJ1A 4ULVA 2Y69C 3PMRA 1OW8A 2H8AA 3EH2A 4BJ6A 2I15A 4KI2A 2HMQA 3EGXA 3NKDA 3I5QA 3LLKA 1XWJA 2EPKX 4C7OA 4YK5A 3VM6A 3LLIA 4YT4A 5JT4A 2G3VA 2Y3DA 1A7DA 4ER9A 1G5ZA 1JPJA 5T3TA 3VAYA 1QSPA 3UGPA 3V5YA 4PK4A 2HV6A 1BZ4A 2CGEA 2J0WA 3DJUB 4EBJA 1ST6A 1D0YA 2EPOA 3NMIA 3C62A 5T1DB 2LSEA 1OQCA 2NG1A 4YL1A 2VCAA 3SXYA 4B6IA 4XPWA 3LNRA 2IM8A 1C03A 3ECSA 3FOOA 4CDVA 1VTMP 4RBNA 3MX3A 4CDAA 3K66A 1M2VB 3AGTA 2LFFA 3O10A 3GORA 3K1IC 3TJ6A 3U8VA 4EBBA 3SXKA 4MVMA 5BQHA 1APCA 3DZAA 1F1MA 5EHHA 2YRFA 4JCHA 3HNLA 1AUEA 5L0DA 4U5GA 1SMYF 1S05A 3KKBA 3R7CA 2IXPA 5KYYA 2ETSA 2J9WA 2LQGA 2H7BA 2G3KA 2PF4E 4MS2A 3N24A 4K7BA 3WODF 3NDBB 4JC7A 2W4MA 4AE4B 3TULA 2YWAA 5A6BD 4MVQA 1OW7A 3X2QC 4D4XA 3C7JA 2IBFA 3NRHA 4BEMJ 1MMAA 3T6JA 4O6YA 2Q3TA 5E33A 2AWYA 5JS5A 3C8GA 3K1IA 3OA1A 3U9JA 4Q5SF 2A68F 1VYKA 3TD7A 2G62A 3PDMP 2XL4A 4I1OB 2OKUA 1M2OA 3B71A 3H65A 3MLGA 2XXAA 2QE9A 3JYHA 2OCCC 2R02A 1D1CA 4KNVA 3TOLA 3MYIA 4JRZA 1JR8A 3ASNC 1HY5A 4Q4ZF 1T6UA 2LK4A 2XS1A 3EQLF 5EK0A 4CDYA 3TOMA 1ORJA 1OXKA 2HJMA 2OJED 1ZHXA 4QDLA 3M15A 2XLEA 3QW1A 3ZIBA 4I1MA 3GEIA 1PCXA 1KU2A 1T6QA 5KYXA 2HKVA 2DGJA 2J7PA 4CJGA 4BG0A 2GFHA 1CGOA 1FMWA 1JPNA 4ANJA 3M4CA 4NTFA 2R7QA 3AGUA 1Q0MA 3A11A 4RDAA 5B3SC 3IQCA 1WOLA 1RJ9B 4EKWA 4IJJA 4PFOA 4C3EA 2OG2A 3TQOA 2BC5A 1PD0A 1HMDA 2KNHA 1OKKA 1ZHYA 1NSGB 1CGNA 3LUTB 3U2MA 3Q6MA 2JX0A 4JTAB 5JUAA 1YLMA 4IAQA 2H7VC 2MYSA 3L8JA 2OEVA 2AU5A 2QY9A 3EFOB 3E9VA 2LCHA 3NMJA 2WVQA 4U5BE 4U9DA 4AK9A 5A6AA 1OW6A 1U6HA 1WATA 1K04A 2AP3A 3ASOC 2VASA 3OEOA 3RQFA 2R7RA 2VB6A 4P6IC 4E18A 1T6IA 5B1AC 5GPGB 4MVOA 3ABLC 3S9OA 4MVUA 3JSZA 5DS5A 3L34A 2A69F 5L0JA 3K6BA 2HMZA 4MTOA 2NUPA 4K1OA 2X0CA 2XLMA 5KYWB 2ZPAA 3CEXA 3U3FA 3RH3A 3ZTMA 4Z9JA 2WVOA 4NCQA 4M63A 4OD4A 3N2ZB 4N6CA 3BRJA 5TJ5E 3GM3A 3X1OA 2L81A 2J9VA 3V5ZA 2YLGA 3KL4A 3F47A 3LJBA 3T6BA 4JURI 3BEHA 2YL1A 2R05A 1M56C 2YKZA 3MYFA 3S28A 1SZIA 1U89A 2D5RB 1V74B 3KYIA 4MTFA 5DLJA 2GWWA 4YJWA 4E0IA 1FFHA 4W8KA 4FAPB 2EIKC 1JRAA 4MNDA
chains in the Genus database with same CATH topology
4LDKA 3GWLA 3U2LA 3R7CA 3GWNA 3W4YA 4E0HA 3TD7A 3TK0A 3MBGA 3O55A 3U2MA 1JR8A 3LLKA 2HJ3A 4E0IA 1OQCA 1JRAA 3LLIA 3U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDK A;  3GWL A;  3U2L A;  3R7C A;  3GWN A;  3W4Y A;  4E0H A;  3TD7 A;  3TK0 A;  3MBG A;  3O55 A;  3U2M A;  1JR8 A;  3LLK A;  2HJ3 A;  4E0I A;  1OQC A;  1JRA A;  3LLI A;  3U5S A; 
#chains in the Genus database with same CATH topology
 3LNM B;  3AQB A;  2LD6 A;  4AE4 A;  1SF8 A;  1LE2 A;  1R5I D;  3QZC A;  1V55 C;  1YAR O;  1WAS A;  2UUH A;  2A0U A;  2EIL C;  4EBK A;  4EHP A;  1MND A;  3M1C B;  4J7T A;  3GWL A;  4OIO F;  1NBB A;  1VB5 A;  1YZC A;  1XZQ A;  3LES A;  1NG1 A;  3ZQV A;  4WGZ A;  2YZS A;  5A69 A;  1Q0D A;  4IWB A;  2YVK A;  3ITF A;  3RFY A;  3S84 A;  2NSG A;  3O39 A;  2O9X A;  4PJJ A;  2ZXR A;  2Y3B A;  1K40 A;  4J30 B;  1OCO C;  2HV7 A;  1J8M F;  3AJM A;  4Z9H A;  4XQ1 A;  2A6H F;  2C03 A;  2XLW A;  4NTB A;  1CGM E;  5IY5 C;  4UDV A;  4YT2 A;  2D4U A;  2JD3 A;  2QNL A;  5L0G A;  1ZHZ A;  3K7D A;  4QI0 A;  1K05 A;  1TWA A;  3AG1 C;  2NSF A;  1LE4 A;  3C8Z A;  3W4Y A;  3C63 A;  3RQG A;  3C8G D;  1YZA A;  1ZW2 A;  2JPU A;  1EQ1 A;  2YL0 A;  3LEV A;  4PAC A;  3UMH A;  3RIP A;  3LS0 A;  3UMK A;  3U3B A;  3HNI A;  4EIY A;  2KYH A;  2YQY A;  4AL0 A;  4BPM A;  3U9M A;  4XTK A;  3WHN A;  2BE5 F;  5DS6 A;  2Q9A A;  3DWW A;  1DOV A;  3E70 C;  3R2P A;  5DQT A;  2Q9B A;  5B1B C;  3ABM C;  5FZT A;  1TWC A;  3EZH A;  5DVW A;  3B0V C;  3EGD B;  4LDR A;  4U5C E;  3FXH A;  3KPH A;  3AQC A;  2XLH A;  3UR3 C;  3L1M A;  3M79 A;  3JSE O;  1MMD A;  4JTC B;  3ZTZ A;  3TK0 A;  3W8H A;  4OIQ F;  1MMN A;  2PBE A;  2HJ3 A;  1WGW A;  2HUJ A;  2X51 A;  1O5H A;  3DD7 A;  3HKK A;  4O6N A;  1WTY A;  2EIN C;  1D1A A;  2NPU A;  3Q7G A;  2PX3 A;  1RKE A;  1ZHW A;  4JEB A;  3S29 A;  2M64 A;  4OD5 A;  4CSA C;  2OJQ A;  1YVI A;  3ZDL A;  1Z63 A;  1JOG A;  2XL6 A;  3FHD A;  3EGX B;  2P1A A;  4CS9 A;  2H7O A;  3ZWI A;  2NUT B;  3MBG A;  3UMI A;  2CW0 F;  1VLS A;  2KSF A;  1R4T A;  1YAU O;  2ASR A;  2P6V A;  3HTK C;  3RKO F;  3JZ0 A;  3L8I A;  3HNJ A;  1YA9 A;  4XLN F;  4J32 B;  3NKE A;  3ZC4 A;  1U0B B;  4H4K C;  3HNK A;  3RF3 A;  4OIR F;  4DRH B;  3G4Z A;  1OR3 A;  1NZE A;  1T5O A;  2HSB A;  3DAF A;  1WWP A;  2KC3 A;  3IQ5 A;  5T3W A;  2CNW D;  1T9K A;  1KTM A;  3VF0 A;  3UGO A;  4CSA A;  1LM3 B;  2R9R B;  2V3C C;  2AWC A;  1PV3 A;  5BQG A;  1QQ3 A;  1DOW A;  4JZA A;  2P0N A;  1S7Z A;  3VRC A;  4W8P A;  2OEX A;  2L6H A;  5L0C A;  1LS4 A;  4BJT A;  4E7Z A;  4XPX A;  1H9T A;  3QTH A;  1TKN A;  5L3Q A;  1NU9 C;  4MVZ A;  1AEP A;  3PCV A;  4FWV A;  2NUT A;  2VCB A;  5KYY B;  1Q0F A;  2OOC A;  2R7X A;  3JRT A;  3ABK C;  5JLI A;  2A1D D;  4DOZ A;  2L7A A;  4JJG A;  1LVK A;  1RKC A;  1D0Z A;  2UUI A;  2XLD A;  3IQ6 A;  4CX9 A;  3EZI A;  4FES A;  3W2V A;  5KYN A;  2WZL A;  4G0H A;  1O87 A;  4LER A;  4DBR A;  1YJG A;  2IOQ A;  2EPN A;  4NC3 A;  4CS9 C;  3B0U X;  3AG4 C;  1NU7 D;  1BDJ B;  5D92 A;  3KYJ A;  4JE9 A;  1OKK D;  1LKX A;  4JKV A;  4DRJ B;  3HJC A;  3NMK A;  2XLV A;  1QKR A;  3U5S A;  4C3B A;  5KYU B;  5EGY A;  4I44 A;  4CS7 A;  1H9G A;  4LAC B;  2LIG A;  3O55 A;  3DM5 A;  5COM A;  4DJ9 A;  2HZ8 A;  3EPV A;  2IYL D;  5A6K A;  2WZF A;  3UNG C;  4YT8 A;  3DE9 A;  2QTV A;  3G50 A;  4E7S A;  2XXA B;  3FDQ A;  4BJ5 C;  1QPU A;  3O6X A;  5BUO A;  2EPM X;  1YA7 O;  1Z6A A;  2F22 A;  2EIJ C;  1VMA A;  3GWN A;  2Q4F A;  3CSK A;  2XLO A;  3T6G B;  3H2U A;  5DS4 A;  5HV9 A;  4WGY A;  4N06 A;  3SYN A;  4N4W A;  1OCR C;  3ZQY A;  4JW1 A;  1NFO A;  2R7T A;  2AVK A;  3DAG A;  3V7O A;  4IGG A;  3ZG1 A;  5K0I A;  2Q00 A;  4XEF A;  1H7I A;  4MQ9 F;  3PHF 2;  1M57 C;  1QLE C;  2CNW A;  1JAF A;  1OR2 A;  2KQ9 A;  2RSE B;  5KYW A;  1GQA A;  1YYX A;  2GDC A;  3FVY A;  3MFN A;  3NYM A;  1Z23 A;  4NQF A;  5E3C A;  4AL1 A;  1QZX A;  4GEH A;  1YYJ A;  4NTA A;  1MQV A;  3U8P A;  3POV A;  1RKE B;  2A6E F;  2CDQ A;  2QUP A;  2ICW G;  1NFN A;  2XM0 A;  3Q7L A;  1E86 A;  1EA8 A;  3EHM A;  4JJF A;  4DBQ A;  3K33 A;  3HLZ A;  1RJ9 A;  1VYI A;  2DB4 A;  2PX0 A;  4CIP A;  2VC9 A;  4DXW A;  3H2V A;  2A0B A;  1MMG A;  5L0H A;  1CPQ A;  3AOU A;  3SNH A;  2B0H A;  2VH3 A;  1HE1 A;  2J0X A;  2KGO A;  4WJ0 A;  3DKA A;  3RYL A;  2VCC A;  1Q0K A;  4ZLC A;  5D91 A;  1J8Y F;  1TWG A;  4OIN F;  5F28 E;  3FOP A;  3DM9 B;  4MW3 A;  1OXB A;  5L3V A;  4U5D E;  2HSQ A;  4U5F E;  1UFB A;  5F5F A;  3DJN B;  4CJO A;  4LDQ A;  2ZD9 A;  2J8W A;  1E84 A;  1WN0 A;  3IHU A;  4XPY A;  4BJ6 C;  1PD1 A;  2FAP B;  4YN0 B;  4MTG A;  1GM5 A;  4JEA A;  4YT5 A;  1G8X A;  2Y3G A;  4N6H A;  4IAR A;  3S0X A;  2V26 A;  1GGQ A;  5HSW A;  4MVS A;  4J7Y A;  2R7S A;  3LS1 A;  1ZZP A;  3RQE A;  3TJ5 A;  2YL7 A;  5DQZ A;  2B0J A;  1I5N A;  2P61 A;  1VOM A;  5JP7 A;  2R7V A;  4ZLD A;  1TR2 A;  2CCY A;  2XSE A;  4MVR A;  2XRH A;  2E87 A;  3CZ6 A;  3G4X A;  4IRU A;  4WAB A;  3F46 A;  3ZVR A;  4H54 A;  1FFT C;  5A6B A;  2LFD A;  1D0X A;  3CQZ A;  1TQG A;  4K0D A;  4E0H A;  3K1H A;  3LAY A;  4GQH A;  2YEV A;  1YDI A;  1FTS A;  4AX2 A;  3IQT A;  2YLD A;  4XWJ A;  1MNE A;  2R03 A;  2DYS C;  3FAJ A;  3QW0 A;  5JVE A;  3GEE A;  3EGD A;  5F5H A;  3A9C A;  2Y39 A;  4A4A A;  2YL3 A;  2ZXP A;  4XEV A;  2LP4 A;  1NLX A;  1ORY A;  5JSL A;  1C02 A;  4G7O F;  1E85 A;  1CPR A;  2FFH A;  2XS8 A;  3EG9 B;  4JTD B;  2GA0 A;  3U2L A;  1FR0 A;  3DMD A;  3C18 A;  1BR4 A;  2W9Y A;  3M4B A;  3B0P A;  1SR2 A;  3N0T A;  4I3M A;  1HW2 A;  1OCC C;  4CS8 C;  4PJM A;  1E2X A;  3DE8 A;  3GAN A;  4R32 A;  1FNT c;  2KW3 C;  5L0I A;  3SXZ A;  2MHR A;  3EHN A;  4KBL A;  2GAQ A;  3GM1 A;  3GOD A;  3SEO A;  2I8B A;  2HS5 A;  3C8G B;  4IAO A;  1M2V A;  1VK5 A;  1Z3I X;  1IW7 F;  1BR1 A;  1HW1 A;  1A7E A;  4BJ5 A;  3US6 A;  3VYW A;  1XZP A;  2L6F A;  3V5X A;  2J46 A;  1HE9 A;  4MW8 A;  3EJN A;  4U9E A;  3GEH A;  4NY3 A;  2YLI A;  1D1B A;  2J7P D;  2OU6 A;  1A7V A;  2W45 A;  2Z15 A;  2ZXW C;  3QMK A;  1Y6D A;  4HE8 D;  4JVS A;  4DVZ A;  4F4B A;  4O6M A;  5BQI A;  3S27 A;  2L6G A;  2CYD A;  2XM4 A;  3RW0 A;  1JMW A;  1V4A A;  1ZU5 A;  2R25 A;  5L0F A;  2Q9C A;  2BL2 A;  3B29 A;  3RVZ A;  1I4Y A;  4JCZ A;  4XEK A;  4EWC A;  5KYX B;  1W2W A;  1N1C A;  1UG7 A;  3KH2 A;  1C17 M;  1G4W R;  3ZSU A;  3IEE A;  2L9J A;  4EUK B;  5B3I A;  4C7O B;  4G78 A;  3I4U A;  5E3A A;  1OCZ C;  5COF A;  2NUP B;  5FCL A;  2M4E A;  3L0I A;  3WG7 C;  4A2N B;  2XL8 A;  4XLP F;  4PJN A;  1KNY A;  4CBE A;  3DXJ F;  4G7Z F;  1G4U S;  1EI7 A;  3SXM A;  4DRI B;  3J06 A;  1AVO B;  1O3U A;  2ZXO A;  2R7W A;  1Y4C A;  2PP4 A;  3IPM O;  1BR2 A;  4U5H A;  4E17 A;  3AG3 C;  4JIO A;  4C3D A;  3S90 A;  1TFO B;  3OWT A;  1I4Z A;  2MWQ A;  4OIP F;  4L6R A;  2WB7 A;  1RCP A;  3RVY A;  1ZYR F;  2FGY A;  1LI5 A;  3EFO A;  2J9U A;  3QVZ A;  2WVN A;  4Q7C A;  1E83 A;  4YL0 A;  3T4R A;  1L3P A;  2QLA A;  5CI8 A;  2TMV P;  1VLT A;  2P7V A;  3ATP A;  2YHS A;  1LS1 A;  4YL3 A;  4O7G A;  4ONS A;  2Q7R A;  3W2W A;  3DI5 A;  2IXO A;  3QVY A;  1V54 C;  1ORS C;  2R7O A;  4KC9 A;  1Q0G A;  4CS8 A;  4LLE A;  3NYJ A;  3JYY A;  4PR9 A;  4YWQ A;  2EIM C;  4BEJ A;  4FX5 A;  3U0C A;  1M6T A;  4IB4 A;  2IXN A;  2DYR C;  1QVX A;  2WL8 A;  3NG1 A;  2PNO A;  1A41 A;  3I5P A;  4DVY P;  3NYL A;  3SP1 A;  3Q6N A;  1L7C A;  2R7U A;  2IXM A;  1A0B A;  2J45 A;  2EPL X;  4G7H F;  3AG2 C;  1LIH A;  1B68 A;  4GYT A;  1Z5Z A;  3EG9 A;  2DI3 A;  3LEO A;  1FAP B;  4QI2 A;  4PJL A;  5E2Q A;  1LPE A;  3JRM O;  1RMV A;  3FMS A;  3SZR A;  4U5E E;  3GM2 A;  4P9T A;  4CIH A;  1ZHT A;  1IZM A;  1TFK B;  2Y3H A;  3CAX A;  5CI9 A;  3KMI A;  1FMV A;  4X0R A;  4P9F A;  2OQM A;  1ZW3 A;  3T9O A;  2WZG A;  4LDK A;  4PFP A;  3W8I A;  3JT1 A;  1ZU4 A;  2C04 A;  256B A;  5KYU A;  2J9B A;  1Z7Q c;  4HFK B;  4Z9I A;  5AC4 A;  1BBH A;  4HFF B;  2KJG A;  2W4B A;  2PFD A;  1HMO A;  4HEA J;  4RD9 A;  2KK1 A;  1EKY A;  1TWH A;  5A6J A;  1T01 A;  3EH1 A;  1H6G A;  3JTL O;  4D4N A;  1LI7 A;  2HFI A;  3WAQ A;  3B9Q A;  4O79 A;  1GS9 A;  5CIV A;  5AC5 A;  1ZVZ A;  1RXQ A;  1SYQ A;  4LLC A;  5AGF A;  3FAP B;  5COG A;  5JRA A;  3JCU Q;  2RD9 A;  4KNW A;  4ULW A;  4BJ1 A;  4ULV A;  2Y69 C;  3PMR A;  1OW8 A;  2H8A A;  3EH2 A;  4BJ6 A;  2I15 A;  4KI2 A;  2HMQ A;  3EGX A;  3NKD A;  3I5Q A;  3LLK A;  1XWJ A;  2EPK X;  4C7O A;  4YK5 A;  3VM6 A;  3LLI A;  4YT4 A;  5JT4 A;  2G3V A;  2Y3D A;  1A7D A;  4ER9 A;  1G5Z A;  1JPJ A;  5T3T A;  3VAY A;  1QSP A;  3UGP A;  3V5Y A;  4PK4 A;  2HV6 A;  1BZ4 A;  2CGE A;  2J0W A;  3DJU B;  4EBJ A;  1ST6 A;  1D0Y A;  2EPO A;  3NMI A;  3C62 A;  5T1D B;  2LSE A;  1OQC A;  2NG1 A;  4YL1 A;  2VCA A;  3SXY A;  4B6I A;  4XPW A;  3LNR A;  2IM8 A;  1C03 A;  3ECS A;  3FOO A;  4CDV A;  1VTM P;  4RBN A;  3MX3 A;  4CDA A;  3K66 A;  1M2V B;  3AGT A;  2LFF A;  3O10 A;  3GOR A;  3K1I C;  3TJ6 A;  3U8V A;  4EBB A;  3SXK A;  4MVM A;  5BQH A;  1APC A;  3DZA A;  1F1M A;  5EHH A;  2YRF A;  4JCH A;  3HNL A;  1AUE A;  5L0D A;  4U5G A;  1SMY F;  1S05 A;  3KKB A;  3R7C A;  2IXP A;  5KYY A;  2ETS A;  2J9W A;  2LQG A;  2H7B A;  2G3K A;  2PF4 E;  4MS2 A;  3N24 A;  4K7B A;  3WOD F;  3NDB B;  4JC7 A;  2W4M A;  4AE4 B;  3TUL A;  2YWA A;  5A6B D;  4MVQ A;  1OW7 A;  3X2Q C;  4D4X A;  3C7J A;  2IBF A;  3NRH A;  4BEM J;  1MMA A;  3T6J A;  4O6Y A;  2Q3T A;  5E33 A;  2AWY A;  5JS5 A;  3C8G A;  3K1I A;  3OA1 A;  3U9J A;  4Q5S F;  2A68 F;  1VYK A;  3TD7 A;  2G62 A;  3PDM P;  2XL4 A;  4I1O B;  2OKU A;  1M2O A;  3B71 A;  3H65 A;  3MLG A;  2XXA A;  2QE9 A;  3JYH A;  2OCC C;  2R02 A;  1D1C A;  4KNV A;  3TOL A;  3MYI A;  4JRZ A;  1JR8 A;  3ASN C;  1HY5 A;  4Q4Z F;  1T6U A;  2LK4 A;  2XS1 A;  3EQL F;  5EK0 A;  4CDY A;  3TOM A;  1ORJ A;  1OXK A;  2HJM A;  2OJE D;  1ZHX A;  4QDL A;  3M15 A;  2XLE A;  3QW1 A;  3ZIB A;  4I1M A;  3GEI A;  1PCX A;  1KU2 A;  1T6Q A;  5KYX A;  2HKV A;  2DGJ A;  2J7P A;  4CJG A;  4BG0 A;  2GFH A;  1CGO A;  1FMW A;  1JPN A;  4ANJ A;  3M4C A;  4NTF A;  2R7Q A;  3AGU A;  1Q0M A;  3A11 A;  4RDA A;  5B3S C;  3IQC A;  1WOL A;  1RJ9 B;  4EKW A;  4IJJ A;  4PFO A;  4C3E A;  2OG2 A;  3TQO A;  2BC5 A;  1PD0 A;  1HMD A;  2KNH A;  1OKK A;  1ZHY A;  1NSG B;  1CGN A;  3LUT B;  3U2M A;  3Q6M A;  2JX0 A;  4JTA B;  5JUA A;  1YLM A;  4IAQ A;  2H7V C;  2MYS A;  3L8J A;  2OEV A;  2AU5 A;  2QY9 A;  3EFO B;  3E9V A;  2LCH A;  3NMJ A;  2WVQ A;  4U5B E;  4U9D A;  4AK9 A;  5A6A A;  1OW6 A;  1U6H A;  1WAT A;  1K04 A;  2AP3 A;  3ASO C;  2VAS A;  3OEO A;  3RQF A;  2R7R A;  2VB6 A;  4P6I C;  4E18 A;  1T6I A;  5B1A C;  5GPG B;  4MVO A;  3ABL C;  3S9O A;  4MVU A;  3JSZ A;  5DS5 A;  3L34 A;  2A69 F;  5L0J A;  3K6B A;  2HMZ A;  4MTO A;  2NUP A;  4K1O A;  2X0C A;  2XLM A;  5KYW B;  2ZPA A;  3CEX A;  3U3F A;  3RH3 A;  3ZTM A;  4Z9J A;  2WVO A;  4NCQ A;  4M63 A;  4OD4 A;  3N2Z B;  4N6C A;  3BRJ A;  5TJ5 E;  3GM3 A;  3X1O A;  2L81 A;  2J9V A;  3V5Z A;  2YLG A;  3KL4 A;  3F47 A;  3LJB A;  3T6B A;  4JUR I;  3BEH A;  2YL1 A;  2R05 A;  1M56 C;  2YKZ A;  3MYF A;  3S28 A;  1SZI A;  1U89 A;  2D5R B;  1V74 B;  3KYI A;  4MTF A;  5DLJ A;  2GWW A;  4YJW A;  4E0I A;  1FFH A;  4W8K A;  4FAP B;  2EIK C;  1JRA A;  4MND A; 
#chains in the Genus database with same CATH homology
 4LDK A;  3GWL A;  3U2L A;  3R7C A;  3GWN A;  3W4Y A;  4E0H A;  3TD7 A;  3TK0 A;  3MBG A;  3O55 A;  3U2M A;  1JR8 A;  3LLK A;  2HJ3 A;  4E0I A;  1OQC A;  1JRA A;  3LLI A;  3U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...