3GWLA

Crystal structure of asfv pb119l, a viral sulfhydryl oxidase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
106
structure length
106
Chain Sequence
GSHMLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimer interface migration in a viral sulfhydryl oxidase
pubmed doi rcsb
source organism African swine fever virus ba71v
molecule tags Oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase
total genus 41
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3gwlA00
3O55A 3U5SA 1JRAA 4LDKA 3R7CA 3LLKA 3TK0A 3U2MA 3TD7A 1JR8A 3GWNA 3W4YA 3U2LA 4E0IA 2HJ3A 1OQCA 4E0HA 3LLIA 3MBGA 3GWLA
chains in the Genus database with same CATH superfamily
4CS9C 3Q6NA 2J9WA 4GYTA 4RDAA 3ZQYA 3MX3A 3C63A 3HLZA 3JSEO 3LEVA 3QVYA 5DS5A 4P6IC 2VCBA 1MNDA 2QE9A 3AG3C 3GODA 1AVOB 5KYNA 1VLTA 1FR0A 3S84A 2GDCA 4MTGA 1LM3B 2HZ8A 4JE9A 4P9FA 3TOMA 3ZTZA 5JP7A 1SF8A 2A6EF 3QW0A 4QI0A 1JPNA 2DYSC 2YL1A 2HKVA 3H2UA 5L0HA 1M56C 2G3VA 1BR4A 1T6IA 3U9MA 3WG7C 5KYYB 2P7VA 1D1AA 4GQHA 1PD0A 1WGWA 3ZG1A 1ORJA 1OXKA 3K1IC 4NY3A 1LVKA 3FAPB 1M2OA 4NTBA 3T6BA 1E85A 1C17M 1VYKA 4BJ5A 2NPUA 2J8WA 4O6NA 3V5YA 2E87A 2A1DD 3GEEA 2ZXRA 4XQ1A 1QVXA 5A6KA 2Q9CA 3QMKA 4I44A 4Q7CA 1OCZC 5COGA 1D1CA 1HW2A 1OW8A 3EJNA 3DAFA 1C03A 1FFHA 4RBNA 2QNLA 1NU7D 1BBHA 1K05A 1RKCA 3LS0A 3RQGA 4D4XA 2X51A 4CDYA 1HE1A 1EKYA 5CI9A 1J8YF 2KSFA 2MYSA 3KL4A 1G8XA 1GQAA 3DD7A 3M15A 3ECSA 3NYMA 1HMOA 4GEHA 3LLIA 4YWQA 2EPLX 2A0UA 1YDIA 1RJ9B 2AWYA 1A7DA 2NSGA 3IHUA 4U5FE 3PDMP 4IWBA 3RKOF 1AEPA 4FAPB 2NUTB 2WZGA 2IXPA 1K40A 1B68A 1Q0GA 4JJFA 4CDVA 1HE9A 5L3QA 3ZTMA 4G0HA 4NQFA 5E3AA 4LERA 3NMJA 4Z9HA 1YARO 2YHSA 1QPUA 4XPXA 1EA8A 1KNYA 1OCOC 4LDRA 2Y3BA 2J9UA 3U3BA 2IXNA 4DBRA 1ZW3A 5KYXB 2DB4A 2XRHA 3HKKA 3RF3A 1FAPB 5FZTA 4YT8A 1OCRC 4Z9JA 4DVYP 1RMVA 3DMDA 1V55C 3C8GA 4CS7A 1YYXA 3GWNA 2XXAB 2R02A 1WASA 1K04A 4LDQA 5TJ5E 3ZSUA 5DQZA 2MWQA 4JKVA 2EIKC 5CI8A 4CS8C 3EGDB 3GEHA 3VF0A 3UMIA 1L7CA 1VOMA 4YK5A 2L7AA 3GEIA 2YWAA 2V26A 2KK1A 4ULVA 3S28A 1VTMP 1ZHTA 2OG2A 3FDQA 3DZAA 3FHDA 4AE4A 4IARA 5JVEA 2FAPB 1FTSA 2H7OA 3AGTA 1ORSC 2HFIA 3EG9B 2R7UA 3CAXA 4E17A 2A6HF 4CSAA 2NG1A 3FVYA 2DGJA 2NUPA 3JSZA 1IZMA 2CYDA 2KJGA 3EHNA 3M4CA 4D4NA 1RKEA 1ST6A 3Q6MA 3EZHA 5K0IA 5L0IA 4Q5SF 2YL7A 5JLIA 4C7OB 2LD6A 4I1MA 5EHHA 2XM0A 2G3KA 2HS5A 2P61A 1DOVA 2HV7A 2ICWG 1XZPA 2QUPA 2Y3DA 2Y3HA 3X2QC 1OW6A 3DWWA 5BQIA 4U5DE 1V74B 2EPOA 3ASOC 3N2ZB 4HE8D 1CPQA 4JRZA 5JSLA 3UMKA 3W8HA 3C18A 2LSEA 3ZDLA 5HV9A 5A6BD 1ZHXA 2CGEA 2XXAA 2W4BA 2H7VC 3TULA 2YEVA 2LQGA 3R2PA 4PK4A 1MMAA 2L6FA 2KQ9A 1A0BA 1MMNA 4CBEA 3CZ6A 1C02A 1CGOA 2C03A 1LE4A 3HJCA 3U9JA 4YN0B 4EBKA 3L8IA 3IQTA 1TWAA 2MHRA 2WZFA 4KNVA 3S27A 4FX5A 2XLDA 2HJ3A 3OEOA 2RD9A 4B6IA 4G7HF 4CS8A 1SZIA 3NYLA 1M6TA 1H7IA 4MVMA 3RH3A 3U5SA 3I5PA 3ATPA 3ZVRA 3ABLC 4AE4B 4U5GA 3VAYA 5D91A 1CGNA 1LS4A 2XL6A 4I3MA 1PV3A 2R7RA 3SEOA 1O87A 1ZHYA 2CNWD 2LFDA 1VB5A 3LNMB 2P6VA 1CPRA 2YLGA 1UG7A 4IAOA 1E2XA 1VYIA 2L6HA 3B29A 5A69A 1R4TA 1OCCC 3FOOA 3QZCA 3POVA 3LLKA 3KH2A 1G4WR 3ITFA 4N06A 3WODF 4KBLA 2Q00A 1Z63A 2OQMA 2EIMC 2LIGA 5JUAA 1UFBA 2XS8A 4U5HA 1QZXA 3GM1A 3OWTA 3U2LA 1T5OA 3K33A 2G62A 1QLEC 3UGPA 2XSEA 4U5EE 2KNHA 3L0IA 4C3DA 1M2VA 1JRAA 2WVNA 3FXHA 2IBFA 4MVUA 3W2VA 2WB7A 4P9TA 4XEKA 4MVOA 3MLGA 3C8ZA 1SMYF 2FGYA 4MNDA 1JMWA 4CIPA 3B0VC 2R7WA 2YZSA 2XLHA 1Y6DA 5FCLA 1E86A 3IQ6A 1RCPA 3JYYA 1NBBA 1YA7O 2J7PA 3ASNC 2B0JA 3E9VA 3DAGA 3SXMA 1D0ZA 3NMIA 4J7TA 1DOWA 3L34A 1T6QA 1JR8A 3Q7LA 3KMIA 1Z6AA 1QKRA 4KI2A 3O39A 2CNWA 1TFKB 3N24A 1NU9C 1Q0DA 2XS1A 2YKZA 2AP3A 3IQCA 4J32B 2CDQA 2P0NA 4XEVA 4O6YA 3UMHA 1NFOA 3SXYA 4BJTA 5E33A 4BEJA 3Q7GA 1WATA 1FFTC 1TKNA 4WGZA 4OD4A 2L81A 2OEXA 4YT5A 2DI3A 1BR1A 4N4WA 4CJGA 4OIPF 4JVSA 3K7DA 4MTFA 2HSQA 3ZQVA 1Q0KA 1O3UA 1JAFA 1YZCA 1MQVA 2PP4A 4MS2A 5KYUA 1Z7Qc 4U9DA 2WL8A 3SZRA 2R7VA 4EBJA 4A2NB 4E0HA 5COMA 1WOLA 3OA1A 1GM5A 1T6UA 3R7CA 5JS5A 2QLAA 3HNLA 4JCHA 4E18A 3PCVA 3LESA 1HMDA 4WABA 2PNOA 4M63A 5COFA 1MMGA 1FMWA 5A6AA 3F46A 2OEVA 3JYHA 2CCYA 4YL3A 2Q3TA 3C7JA 4EHPA 3PHF2 3ZWIA 3FAJA 5EK0A 3M4BA 4JEAA 1TFOB 3H2VA 2R7TA 2OOCA 2ZPAA 3TK0A 5B3SC 3EFOB 2LK4A 3K1HA 2ZXOA 5L0CA 1WWPA 2X0CA 1PCXA 2Y39A 1QSPA 3NMKA 2NSFA 3X1OA 2YLDA 2A69F 1V4AA 1ZVZA 1YYJA 3G4ZA 3GORA 4N6HA 3ZIBA 3U0CA 3NKEA 4HFKB 4X0RA 2J0WA 4CIHA 4C3BA 1EQ1A 3EQLF 4WJ0A 4YT2A 1KTMA 4LACB 2DYRC 3B71A 4JCZA 4MQ9F 3ABKC 3NRHA 4QDLA 1E84A 1D0YA 2JX0A 2Q9BA 3WAQA 3LUTB 4HEAJ 1PD1A 3CEXA 4JTAB 1I4ZA 2BE5F 2PX0A 4KC9A 5DQTA 3NKDA 1GS9A 2B0HA 3A11A 4E7ZA 4MW3A 1TQGA 2A0BA 2ZXPA 3ABMC 2R7QA 1RJ9A 3H65A 3MYIA 3W4YA 2R7XA 4OIRF 4MVSA 1LE2A 2R05A 3L1MA 2PBEA 1MMDA 2XM4A 3F47A 3NG1A 3DJNB 3T9OA 5DS6A 4IJJA 3RQEA 3IQ5A 3RYLA 2YL0A 1HW1A 2FFHA 4JTDB 3T4RA 3LS1A 3MBGA 1WN0A 2L9JA 3CSKA 4PJJA 3U2MA 4DOZA 1EI7A 1GGQA 2HMQA 4BJ6A 3TQOA 4E7SA 2O9XA 3W2WA 1A7VA 4C3EA 4Q4ZF 4JTCB 4NTFA 4AK9A 4PJNA 3TJ6A 2GAQA 2IXMA 2EPNA 3EG9A 1M57C 3JRTA 3AJMA 4DBQA 1TWHA 4U5CE 2NUPB 4IGGA 1MNEA 1OR2A 4PR9A 3RFYA 4K1OA 3M1CB 4OINF 1RKEB 2AVKA 3J06A 2GA0A 4LDKA 5AGFA 3RVZA 3EZIA 4EIYA 3EGDA 4F4BA 2BC5A 4BEMJ 1FNTc 2VCAA 1N1CA 3JZ0A 3MYFA 3JT1A 1ZHZA 2PX3A 2R7OA 3HTKC 4I1OB 2UUIA 5BQGA 4DRHB 2KW3C 5EGYA 2IOQA 4DXWA 2PF4E 1OW7A 1APCA 2ZD9A 3DE9A 3DJUB 3K1IA 2H7BA 4ZLDA 4OD5A 1FMVA 3LEOA 4XLNF 4CX9A 4LLCA 5CIVA 2R7SA 1T9KA 2D5RB 5KYYA 1G4US 2L6GA 2OJQA 5DS4A 2CW0F 2H8AA 3EH1A 4C7OA 2I15A 2JPUA 2J9VA 1TWCA 1CGME 3HNIA 256BA 3NDBB 2RSEB 4G78A 4IRUA 3KYIA 2EILC 1BZ4A 4CS9A 1ZHWA 5F28E 3GM3A 2QY9A 1D0XA 1H9TA 2R9RB 4CSAC 4ANJA 1I5NA 2PFDA 1SR2A 3UNGC 4YT4A 2J46A 2XLMA 1ZZPA 1U89A 1YJGA 2XLVA 1OR3A 2J7PD 1U6HA 2GFHA 4JEBA 2VB6A 3AGUA 2EPKX 5B3IA 4XLPF 1Z3IX 2BL2A 2QTVA 4NTAA 3UGOA 1O5HA 4J30B 2P1AA 1NG1A 1L3PA 1TWGA 4U5BE 4CDAA 5KYXA 3HNJA 3TD7A 5IY5C 5F5FA 1A41A 1OKKA 1H6GA 3UR3C 1XWJA 3LAYA 5DVWA 1HY5A 1G5ZA 3QVZA 5KYWB 1LS1A 2W4MA 4PJLA 3RQFA 4E0IA 2XL4A 2LFFA 2HJMA 5JT4A 1TR2A 2HMZA 2J0XA 1LPEA 4JIOA 5L3VA 2OJED 4DRJB 2Q9AA 3V5ZA 1RXQA 3O55A 4YJWA 2XLEA 1LI7A 2YRFA 1M2VB 3W8IA 2NUTA 3AQCA 3RW0A 2HV6A 1I4YA 5L0DA 1ZW2A 3RVYA 2IXOA 1QQ3A 1SYQA 3B9QA 3E70C 3I5QA 4OIOF 1YLMA 3GANA 2AU5A 3T6JA 3AG1C 3V5XA 3S90A 1U0BB 1D1BA 1AUEA 3IPMO 4N6CA 1Q0MA 3DE8A 3VRCA 2LP4A 1ZU5A 2GWWA 2J45A 2Y3GA 4MTOA 5BUOA 3I4UA 4ER9A 3DM9B 4FWVA 3EPVA 3C8GB 2TMVP 1VLSA 4U9EA 3GM2A 4IB4A 5JRAA 4ULWA 3QTHA 1OXBA 3HNKA 1Z5ZA 2WVOA 2VASA 3SXZA 5L0JA 4MVZA 4WGYA 4W8PA 1H9GA 2VC9A 2Z15A 4H54A 4K7BA 4LLEA 1YAUO 2LCHA 3ZC4A 5DLJA 2R25A 3EH2A 4NC3A 1NSGB 1W2WA 3EHMA 3DM5A 3SNHA 5KYUB 3S29A 2OKUA 1LKXA 3T6GB 1S05A 4JC7A 1S7ZA 2D4UA 3EGXA 5L0GA 4PFPA 1XZQA 4CJOA 2OCCC 4ONSA 4O7GA 3VYWA 2VH3A 4EKWA 3G50A 2YLIA 2YL3A 3FMSA 3SXKA 2HUJA 1NZEA 2Y69C 1Q0FA 2Q4FA 3DXJF 3JCUQ 1NLXA 2IM8A 3WHNA 5KYWA 3B0UX 2M4EA 5AC5A 4UDVA 5E2QA 1F1MA 3BEHA 5T3TA 4G7OF 4JJGA 3SP1A 1A7EA 4W8KA 3AG2C 4HFFB 3JTLO 2XLWA 4NCQA 5HSWA 2J9BA 4XTKA 1Z23A 1OKKD 1E83A 4Z9IA 5B1AC 2VCCA 4JZAA 4O79A 4PJMA 2KC3A 1VMAA 1WTYA 3U8VA 4G7ZF 2YVKA 1KU2A 1Y4CA 1LIHA 4IAQA 5A6BA 1JOGA 1T01A 5E3CA 4EUKB 2HSBA 1ZU4A 3AG4C 1BDJB 4K0DA 2KGOA 2WZLA 3JRMO 1J8MF 2UUHA 4JURI 5D92A 1JPJA 4YL0A 3EFOA 3SYNA 3G4XA 4A4AA 1ZYRF 3TJ5A 3GWLA 3U8PA 3EGXB 1VK5A 2IYLD 2XLOA 3DKAA 4KNWA 3MFNA 4R32A 4MVRA 2XL8A 4PACA 3FOPA 3CQZA 2F22A 3N0TA 5T1DB 3TOLA 1ORYA 3PMRA 3QW1A 3AOUA 3DI5A 4DRIB 5L0FA 3S9OA 3U3FA 3O6XA 2WVQA 5GPGB 3AQBA 2KYHA 1LI5A 2C04A 4MVQA 4O6MA 3VM6A 4L6RA 3V7OA 4BJ5C 5F5HA 4BPMA 2M64A 2JD3A 3IEEA 1V54C 2AWCA 4EBBA 4AL0A 3M79A 1YA9A 5T3WA 4YL1A 1BR2A 1YZAA 3KYJA 4DVZA 3S0XA 2EINC 3KKBA 2ASRA 2I8BA 4JW1A 4ZLCA 2V3CC 2ZXWC 3A9CA 4BG0A 1OQCA 3BRJA 3C8GD 2OU6A 4XPWA 1YVIA 3K66A 2A68F 3C62A 3K6BA 2YQYA 3KPHA 4RD9A 3US6A 4AX2A 4OIQF 3NYJA 4DJ9A 4AL1A 3B0PA 1NFNA 5B1BC 5AC4A 4J7YA 4XPYA 4QI2A 2W45A 3O10A 4XWJA 1IW7F 5BQHA 2EIJC 3L8JA 5A6JA 2Q7RA 4XEFA 4FESA 3LNRA 4MW8A 2W9YA 4EWCA 2EPMX 4BJ1A 3RIPA 2R03A 4H4KC 4BJ6C 2ETSA 1R5ID 4PFOA 3LJBA
chains in the Genus database with same CATH topology
3O55A 3U5SA 1JRAA 4LDKA 3R7CA 3LLKA 3TK0A 3U2MA 3TD7A 1JR8A 3GWNA 3W4YA 3U2LA 4E0IA 2HJ3A 1OQCA 4E0HA 3LLIA 3MBGA 3GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O55 A;  3U5S A;  1JRA A;  4LDK A;  3R7C A;  3LLK A;  3TK0 A;  3U2M A;  3TD7 A;  1JR8 A;  3GWN A;  3W4Y A;  3U2L A;  4E0I A;  2HJ3 A;  1OQC A;  4E0H A;  3LLI A;  3MBG A;  3GWL A; 
#chains in the Genus database with same CATH topology
 4CS9 C;  3Q6N A;  2J9W A;  4GYT A;  4RDA A;  3ZQY A;  3MX3 A;  3C63 A;  3HLZ A;  3JSE O;  3LEV A;  3QVY A;  5DS5 A;  4P6I C;  2VCB A;  1MND A;  2QE9 A;  3AG3 C;  3GOD A;  1AVO B;  5KYN A;  1VLT A;  1FR0 A;  3S84 A;  2GDC A;  4MTG A;  1LM3 B;  2HZ8 A;  4JE9 A;  4P9F A;  3TOM A;  3ZTZ A;  5JP7 A;  1SF8 A;  2A6E F;  3QW0 A;  4QI0 A;  1JPN A;  2DYS C;  2YL1 A;  2HKV A;  3H2U A;  5L0H A;  1M56 C;  2G3V A;  1BR4 A;  1T6I A;  3U9M A;  3WG7 C;  5KYY B;  2P7V A;  1D1A A;  4GQH A;  1PD0 A;  1WGW A;  3ZG1 A;  1ORJ A;  1OXK A;  3K1I C;  4NY3 A;  1LVK A;  3FAP B;  1M2O A;  4NTB A;  3T6B A;  1E85 A;  1C17 M;  1VYK A;  4BJ5 A;  2NPU A;  2J8W A;  4O6N A;  3V5Y A;  2E87 A;  2A1D D;  3GEE A;  2ZXR A;  4XQ1 A;  1QVX A;  5A6K A;  2Q9C A;  3QMK A;  4I44 A;  4Q7C A;  1OCZ C;  5COG A;  1D1C A;  1HW2 A;  1OW8 A;  3EJN A;  3DAF A;  1C03 A;  1FFH A;  4RBN A;  2QNL A;  1NU7 D;  1BBH A;  1K05 A;  1RKC A;  3LS0 A;  3RQG A;  4D4X A;  2X51 A;  4CDY A;  1HE1 A;  1EKY A;  5CI9 A;  1J8Y F;  2KSF A;  2MYS A;  3KL4 A;  1G8X A;  1GQA A;  3DD7 A;  3M15 A;  3ECS A;  3NYM A;  1HMO A;  4GEH A;  3LLI A;  4YWQ A;  2EPL X;  2A0U A;  1YDI A;  1RJ9 B;  2AWY A;  1A7D A;  2NSG A;  3IHU A;  4U5F E;  3PDM P;  4IWB A;  3RKO F;  1AEP A;  4FAP B;  2NUT B;  2WZG A;  2IXP A;  1K40 A;  1B68 A;  1Q0G A;  4JJF A;  4CDV A;  1HE9 A;  5L3Q A;  3ZTM A;  4G0H A;  4NQF A;  5E3A A;  4LER A;  3NMJ A;  4Z9H A;  1YAR O;  2YHS A;  1QPU A;  4XPX A;  1EA8 A;  1KNY A;  1OCO C;  4LDR A;  2Y3B A;  2J9U A;  3U3B A;  2IXN A;  4DBR A;  1ZW3 A;  5KYX B;  2DB4 A;  2XRH A;  3HKK A;  3RF3 A;  1FAP B;  5FZT A;  4YT8 A;  1OCR C;  4Z9J A;  4DVY P;  1RMV A;  3DMD A;  1V55 C;  3C8G A;  4CS7 A;  1YYX A;  3GWN A;  2XXA B;  2R02 A;  1WAS A;  1K04 A;  4LDQ A;  5TJ5 E;  3ZSU A;  5DQZ A;  2MWQ A;  4JKV A;  2EIK C;  5CI8 A;  4CS8 C;  3EGD B;  3GEH A;  3VF0 A;  3UMI A;  1L7C A;  1VOM A;  4YK5 A;  2L7A A;  3GEI A;  2YWA A;  2V26 A;  2KK1 A;  4ULV A;  3S28 A;  1VTM P;  1ZHT A;  2OG2 A;  3FDQ A;  3DZA A;  3FHD A;  4AE4 A;  4IAR A;  5JVE A;  2FAP B;  1FTS A;  2H7O A;  3AGT A;  1ORS C;  2HFI A;  3EG9 B;  2R7U A;  3CAX A;  4E17 A;  2A6H F;  4CSA A;  2NG1 A;  3FVY A;  2DGJ A;  2NUP A;  3JSZ A;  1IZM A;  2CYD A;  2KJG A;  3EHN A;  3M4C A;  4D4N A;  1RKE A;  1ST6 A;  3Q6M A;  3EZH A;  5K0I A;  5L0I A;  4Q5S F;  2YL7 A;  5JLI A;  4C7O B;  2LD6 A;  4I1M A;  5EHH A;  2XM0 A;  2G3K A;  2HS5 A;  2P61 A;  1DOV A;  2HV7 A;  2ICW G;  1XZP A;  2QUP A;  2Y3D A;  2Y3H A;  3X2Q C;  1OW6 A;  3DWW A;  5BQI A;  4U5D E;  1V74 B;  2EPO A;  3ASO C;  3N2Z B;  4HE8 D;  1CPQ A;  4JRZ A;  5JSL A;  3UMK A;  3W8H A;  3C18 A;  2LSE A;  3ZDL A;  5HV9 A;  5A6B D;  1ZHX A;  2CGE A;  2XXA A;  2W4B A;  2H7V C;  3TUL A;  2YEV A;  2LQG A;  3R2P A;  4PK4 A;  1MMA A;  2L6F A;  2KQ9 A;  1A0B A;  1MMN A;  4CBE A;  3CZ6 A;  1C02 A;  1CGO A;  2C03 A;  1LE4 A;  3HJC A;  3U9J A;  4YN0 B;  4EBK A;  3L8I A;  3IQT A;  1TWA A;  2MHR A;  2WZF A;  4KNV A;  3S27 A;  4FX5 A;  2XLD A;  2HJ3 A;  3OEO A;  2RD9 A;  4B6I A;  4G7H F;  4CS8 A;  1SZI A;  3NYL A;  1M6T A;  1H7I A;  4MVM A;  3RH3 A;  3U5S A;  3I5P A;  3ATP A;  3ZVR A;  3ABL C;  4AE4 B;  4U5G A;  3VAY A;  5D91 A;  1CGN A;  1LS4 A;  2XL6 A;  4I3M A;  1PV3 A;  2R7R A;  3SEO A;  1O87 A;  1ZHY A;  2CNW D;  2LFD A;  1VB5 A;  3LNM B;  2P6V A;  1CPR A;  2YLG A;  1UG7 A;  4IAO A;  1E2X A;  1VYI A;  2L6H A;  3B29 A;  5A69 A;  1R4T A;  1OCC C;  3FOO A;  3QZC A;  3POV A;  3LLK A;  3KH2 A;  1G4W R;  3ITF A;  4N06 A;  3WOD F;  4KBL A;  2Q00 A;  1Z63 A;  2OQM A;  2EIM C;  2LIG A;  5JUA A;  1UFB A;  2XS8 A;  4U5H A;  1QZX A;  3GM1 A;  3OWT A;  3U2L A;  1T5O A;  3K33 A;  2G62 A;  1QLE C;  3UGP A;  2XSE A;  4U5E E;  2KNH A;  3L0I A;  4C3D A;  1M2V A;  1JRA A;  2WVN A;  3FXH A;  2IBF A;  4MVU A;  3W2V A;  2WB7 A;  4P9T A;  4XEK A;  4MVO A;  3MLG A;  3C8Z A;  1SMY F;  2FGY A;  4MND A;  1JMW A;  4CIP A;  3B0V C;  2R7W A;  2YZS A;  2XLH A;  1Y6D A;  5FCL A;  1E86 A;  3IQ6 A;  1RCP A;  3JYY A;  1NBB A;  1YA7 O;  2J7P A;  3ASN C;  2B0J A;  3E9V A;  3DAG A;  3SXM A;  1D0Z A;  3NMI A;  4J7T A;  1DOW A;  3L34 A;  1T6Q A;  1JR8 A;  3Q7L A;  3KMI A;  1Z6A A;  1QKR A;  4KI2 A;  3O39 A;  2CNW A;  1TFK B;  3N24 A;  1NU9 C;  1Q0D A;  2XS1 A;  2YKZ A;  2AP3 A;  3IQC A;  4J32 B;  2CDQ A;  2P0N A;  4XEV A;  4O6Y A;  3UMH A;  1NFO A;  3SXY A;  4BJT A;  5E33 A;  4BEJ A;  3Q7G A;  1WAT A;  1FFT C;  1TKN A;  4WGZ A;  4OD4 A;  2L81 A;  2OEX A;  4YT5 A;  2DI3 A;  1BR1 A;  4N4W A;  4CJG A;  4OIP F;  4JVS A;  3K7D A;  4MTF A;  2HSQ A;  3ZQV A;  1Q0K A;  1O3U A;  1JAF A;  1YZC A;  1MQV A;  2PP4 A;  4MS2 A;  5KYU A;  1Z7Q c;  4U9D A;  2WL8 A;  3SZR A;  2R7V A;  4EBJ A;  4A2N B;  4E0H A;  5COM A;  1WOL A;  3OA1 A;  1GM5 A;  1T6U A;  3R7C A;  5JS5 A;  2QLA A;  3HNL A;  4JCH A;  4E18 A;  3PCV A;  3LES A;  1HMD A;  4WAB A;  2PNO A;  4M63 A;  5COF A;  1MMG A;  1FMW A;  5A6A A;  3F46 A;  2OEV A;  3JYH A;  2CCY A;  4YL3 A;  2Q3T A;  3C7J A;  4EHP A;  3PHF 2;  3ZWI A;  3FAJ A;  5EK0 A;  3M4B A;  4JEA A;  1TFO B;  3H2V A;  2R7T A;  2OOC A;  2ZPA A;  3TK0 A;  5B3S C;  3EFO B;  2LK4 A;  3K1H A;  2ZXO A;  5L0C A;  1WWP A;  2X0C A;  1PCX A;  2Y39 A;  1QSP A;  3NMK A;  2NSF A;  3X1O A;  2YLD A;  2A69 F;  1V4A A;  1ZVZ A;  1YYJ A;  3G4Z A;  3GOR A;  4N6H A;  3ZIB A;  3U0C A;  3NKE A;  4HFK B;  4X0R A;  2J0W A;  4CIH A;  4C3B A;  1EQ1 A;  3EQL F;  4WJ0 A;  4YT2 A;  1KTM A;  4LAC B;  2DYR C;  3B71 A;  4JCZ A;  4MQ9 F;  3ABK C;  3NRH A;  4QDL A;  1E84 A;  1D0Y A;  2JX0 A;  2Q9B A;  3WAQ A;  3LUT B;  4HEA J;  1PD1 A;  3CEX A;  4JTA B;  1I4Z A;  2BE5 F;  2PX0 A;  4KC9 A;  5DQT A;  3NKD A;  1GS9 A;  2B0H A;  3A11 A;  4E7Z A;  4MW3 A;  1TQG A;  2A0B A;  2ZXP A;  3ABM C;  2R7Q A;  1RJ9 A;  3H65 A;  3MYI A;  3W4Y A;  2R7X A;  4OIR F;  4MVS A;  1LE2 A;  2R05 A;  3L1M A;  2PBE A;  1MMD A;  2XM4 A;  3F47 A;  3NG1 A;  3DJN B;  3T9O A;  5DS6 A;  4IJJ A;  3RQE A;  3IQ5 A;  3RYL A;  2YL0 A;  1HW1 A;  2FFH A;  4JTD B;  3T4R A;  3LS1 A;  3MBG A;  1WN0 A;  2L9J A;  3CSK A;  4PJJ A;  3U2M A;  4DOZ A;  1EI7 A;  1GGQ A;  2HMQ A;  4BJ6 A;  3TQO A;  4E7S A;  2O9X A;  3W2W A;  1A7V A;  4C3E A;  4Q4Z F;  4JTC B;  4NTF A;  4AK9 A;  4PJN A;  3TJ6 A;  2GAQ A;  2IXM A;  2EPN A;  3EG9 A;  1M57 C;  3JRT A;  3AJM A;  4DBQ A;  1TWH A;  4U5C E;  2NUP B;  4IGG A;  1MNE A;  1OR2 A;  4PR9 A;  3RFY A;  4K1O A;  3M1C B;  4OIN F;  1RKE B;  2AVK A;  3J06 A;  2GA0 A;  4LDK A;  5AGF A;  3RVZ A;  3EZI A;  4EIY A;  3EGD A;  4F4B A;  2BC5 A;  4BEM J;  1FNT c;  2VCA A;  1N1C A;  3JZ0 A;  3MYF A;  3JT1 A;  1ZHZ A;  2PX3 A;  2R7O A;  3HTK C;  4I1O B;  2UUI A;  5BQG A;  4DRH B;  2KW3 C;  5EGY A;  2IOQ A;  4DXW A;  2PF4 E;  1OW7 A;  1APC A;  2ZD9 A;  3DE9 A;  3DJU B;  3K1I A;  2H7B A;  4ZLD A;  4OD5 A;  1FMV A;  3LEO A;  4XLN F;  4CX9 A;  4LLC A;  5CIV A;  2R7S A;  1T9K A;  2D5R B;  5KYY A;  1G4U S;  2L6G A;  2OJQ A;  5DS4 A;  2CW0 F;  2H8A A;  3EH1 A;  4C7O A;  2I15 A;  2JPU A;  2J9V A;  1TWC A;  1CGM E;  3HNI A;  256B A;  3NDB B;  2RSE B;  4G78 A;  4IRU A;  3KYI A;  2EIL C;  1BZ4 A;  4CS9 A;  1ZHW A;  5F28 E;  3GM3 A;  2QY9 A;  1D0X A;  1H9T A;  2R9R B;  4CSA C;  4ANJ A;  1I5N A;  2PFD A;  1SR2 A;  3UNG C;  4YT4 A;  2J46 A;  2XLM A;  1ZZP A;  1U89 A;  1YJG A;  2XLV A;  1OR3 A;  2J7P D;  1U6H A;  2GFH A;  4JEB A;  2VB6 A;  3AGU A;  2EPK X;  5B3I A;  4XLP F;  1Z3I X;  2BL2 A;  2QTV A;  4NTA A;  3UGO A;  1O5H A;  4J30 B;  2P1A A;  1NG1 A;  1L3P A;  1TWG A;  4U5B E;  4CDA A;  5KYX A;  3HNJ A;  3TD7 A;  5IY5 C;  5F5F A;  1A41 A;  1OKK A;  1H6G A;  3UR3 C;  1XWJ A;  3LAY A;  5DVW A;  1HY5 A;  1G5Z A;  3QVZ A;  5KYW B;  1LS1 A;  2W4M A;  4PJL A;  3RQF A;  4E0I A;  2XL4 A;  2LFF A;  2HJM A;  5JT4 A;  1TR2 A;  2HMZ A;  2J0X A;  1LPE A;  4JIO A;  5L3V A;  2OJE D;  4DRJ B;  2Q9A A;  3V5Z A;  1RXQ A;  3O55 A;  4YJW A;  2XLE A;  1LI7 A;  2YRF A;  1M2V B;  3W8I A;  2NUT A;  3AQC A;  3RW0 A;  2HV6 A;  1I4Y A;  5L0D A;  1ZW2 A;  3RVY A;  2IXO A;  1QQ3 A;  1SYQ A;  3B9Q A;  3E70 C;  3I5Q A;  4OIO F;  1YLM A;  3GAN A;  2AU5 A;  3T6J A;  3AG1 C;  3V5X A;  3S90 A;  1U0B B;  1D1B A;  1AUE A;  3IPM O;  4N6C A;  1Q0M A;  3DE8 A;  3VRC A;  2LP4 A;  1ZU5 A;  2GWW A;  2J45 A;  2Y3G A;  4MTO A;  5BUO A;  3I4U A;  4ER9 A;  3DM9 B;  4FWV A;  3EPV A;  3C8G B;  2TMV P;  1VLS A;  4U9E A;  3GM2 A;  4IB4 A;  5JRA A;  4ULW A;  3QTH A;  1OXB A;  3HNK A;  1Z5Z A;  2WVO A;  2VAS A;  3SXZ A;  5L0J A;  4MVZ A;  4WGY A;  4W8P A;  1H9G A;  2VC9 A;  2Z15 A;  4H54 A;  4K7B A;  4LLE A;  1YAU O;  2LCH A;  3ZC4 A;  5DLJ A;  2R25 A;  3EH2 A;  4NC3 A;  1NSG B;  1W2W A;  3EHM A;  3DM5 A;  3SNH A;  5KYU B;  3S29 A;  2OKU A;  1LKX A;  3T6G B;  1S05 A;  4JC7 A;  1S7Z A;  2D4U A;  3EGX A;  5L0G A;  4PFP A;  1XZQ A;  4CJO A;  2OCC C;  4ONS A;  4O7G A;  3VYW A;  2VH3 A;  4EKW A;  3G50 A;  2YLI A;  2YL3 A;  3FMS A;  3SXK A;  2HUJ A;  1NZE A;  2Y69 C;  1Q0F A;  2Q4F A;  3DXJ F;  3JCU Q;  1NLX A;  2IM8 A;  3WHN A;  5KYW A;  3B0U X;  2M4E A;  5AC5 A;  4UDV A;  5E2Q A;  1F1M A;  3BEH A;  5T3T A;  4G7O F;  4JJG A;  3SP1 A;  1A7E A;  4W8K A;  3AG2 C;  4HFF B;  3JTL O;  2XLW A;  4NCQ A;  5HSW A;  2J9B A;  4XTK A;  1Z23 A;  1OKK D;  1E83 A;  4Z9I A;  5B1A C;  2VCC A;  4JZA A;  4O79 A;  4PJM A;  2KC3 A;  1VMA A;  1WTY A;  3U8V A;  4G7Z F;  2YVK A;  1KU2 A;  1Y4C A;  1LIH A;  4IAQ A;  5A6B A;  1JOG A;  1T01 A;  5E3C A;  4EUK B;  2HSB A;  1ZU4 A;  3AG4 C;  1BDJ B;  4K0D A;  2KGO A;  2WZL A;  3JRM O;  1J8M F;  2UUH A;  4JUR I;  5D92 A;  1JPJ A;  4YL0 A;  3EFO A;  3SYN A;  3G4X A;  4A4A A;  1ZYR F;  3TJ5 A;  3GWL A;  3U8P A;  3EGX B;  1VK5 A;  2IYL D;  2XLO A;  3DKA A;  4KNW A;  3MFN A;  4R32 A;  4MVR A;  2XL8 A;  4PAC A;  3FOP A;  3CQZ A;  2F22 A;  3N0T A;  5T1D B;  3TOL A;  1ORY A;  3PMR A;  3QW1 A;  3AOU A;  3DI5 A;  4DRI B;  5L0F A;  3S9O A;  3U3F A;  3O6X A;  2WVQ A;  5GPG B;  3AQB A;  2KYH A;  1LI5 A;  2C04 A;  4MVQ A;  4O6M A;  3VM6 A;  4L6R A;  3V7O A;  4BJ5 C;  5F5H A;  4BPM A;  2M64 A;  2JD3 A;  3IEE A;  1V54 C;  2AWC A;  4EBB A;  4AL0 A;  3M79 A;  1YA9 A;  5T3W A;  4YL1 A;  1BR2 A;  1YZA A;  3KYJ A;  4DVZ A;  3S0X A;  2EIN C;  3KKB A;  2ASR A;  2I8B A;  4JW1 A;  4ZLC A;  2V3C C;  2ZXW C;  3A9C A;  4BG0 A;  1OQC A;  3BRJ A;  3C8G D;  2OU6 A;  4XPW A;  1YVI A;  3K66 A;  2A68 F;  3C62 A;  3K6B A;  2YQY A;  3KPH A;  4RD9 A;  3US6 A;  4AX2 A;  4OIQ F;  3NYJ A;  4DJ9 A;  4AL1 A;  3B0P A;  1NFN A;  5B1B C;  5AC4 A;  4J7Y A;  4XPY A;  4QI2 A;  2W45 A;  3O10 A;  4XWJ A;  1IW7 F;  5BQH A;  2EIJ C;  3L8J A;  5A6J A;  2Q7R A;  4XEF A;  4FES A;  3LNR A;  4MW8 A;  2W9Y A;  4EWC A;  2EPM X;  4BJ1 A;  3RIP A;  2R03 A;  4H4K C;  4BJ6 C;  2ETS A;  1R5I D;  4PFO A;  3LJB A; 
#chains in the Genus database with same CATH homology
 3O55 A;  3U5S A;  1JRA A;  4LDK A;  3R7C A;  3LLK A;  3TK0 A;  3U2M A;  3TD7 A;  1JR8 A;  3GWN A;  3W4Y A;  3U2L A;  4E0I A;  2HJ3 A;  1OQC A;  4E0H A;  3LLI A;  3MBG A;  3GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...