3GX4X

Crystal structure analysis of s. pombe atl in complex with dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyltransferase-like protein 1
publication title Flipping of alkylated DNA damage bridges base and nucleotide excision repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gx4X00
4P55A 3KEQA 3NRVA 5DUKA 3GFIA 2NNYA 1QBJA 3SZTA 5FD6A 4CZZA 4IHTA 3RIRA 5A2QK 1WRJA 1X3UA 3KEOA 1RUNA 3GWZA 4KA4A 4RS8A 5E1ZB 2M30A 3ERED 3BOQA 1CF7B 1UFMA 1HW2A 2GA2A 3HTUA 3C3WA 1TQIA 4N9IA 1SD5A 5K5QA 4HLXA 2EV5A 2W84A 3TOAA 1G3SA 1RZ4A 4KN4X 1B1BA 3CJNA 4BHBA 2JPBA 3FXQA 2EFQA 3VOEA 1RUOA 3LA7A 1FOKA 3LWFA 3FF5A 3FMQA 4R8HA 3HRMA 2F5EA 5J8FA 2ISZA 2A69F 1P4WA 2FSWA 3CLOA 4RB2C 3C18A 1BOAA 2XAGA 2Y48A 1Z1DA 3HSEA 1D5VA 5CYVA 3TO7A 2OAZA 1XN7A 1JE8A 1GXPA 3FXRA 2DK8A 4LB6B 4ESJA 3WTZA 4EJOA 5K1YA 1EH6A 3I59B 2ZKZA 4IJAA 1REPC 4MTEA 5D8KB 4JK1X 1IRGA 3DFGA 3D5LA 1FWZA 1XSDA 3U1DA 3LAPA 1IN4A 1PDNC 2BE5F 2ZO4A 3MEXA 1ZGAA 2MD5A 4L9JA 4M9SA 3K2ZA 4AIJA 5FFXA 5F64A 2GZWA 4PGHA 4I2OA 3E97A 1CGPA 1HKQA 4WX9A 3HRTA 1KU9A 3FM3A 1LDKB 1G3WA 4U7DA 1JHFA 3HHHA 5IT9Z 3K9TA 4L5IA 3ZMVA 4ZYGA 3SHFA 4EJTA 2BGCA 3BROA 3LSTA 4I09A 2OA4A 3WGGA 5LHGA 2P4WA 2KRFA 4PZJA 4LLGF 3R60A 1T6SA 1UHMA 5L3GA 2M1BA 1U5TC 4ESBA 1IW7F 3KZZA 2H6BA 1G3TA 1SAXA 4XLNF 2EB7A 2P6TA 3RPQA 5LHHA 3H3UA 4KUMA 1T98A 1O7FA 3TDUC 5LEKA 3KP5A 4HX7A 3EUHA 3FZVA 2O61A 4U0YA 3I54A 4GXOA 5HDKA 4ENNA 2HFHA 4IVNA 3GW2A 2HQNA 2XV4S 3CTAA 4OMZA 4O5VA 1E17A 3W6KB 1BN5A 1IN8A 4O6JA 2FF4A 4CO8A 3GYHX 1RIOH 3LFKA 3GZ5A 5JHUA 4Q47A 2NYXA 1IUYA 2L4AA 2DW4A 5EEGA 3G73A 1IZ1A 3HRUA 3GO5A 1BI2A 4MEXF 1BM9A 3F8CA 1HQCA 3BDDA 1WSUA 2R7DA 3F22A 3T1BA 2UXXA 2K86A 4DQ2A 2G7UA 3TO9A 1FSHA 4OIQF 2ADUA 1KYZA 5ERIA 4LK1F 2ZMEA 3ECOA 2FEZA 1SFUA 2W25A 1ZRDA 1B9MA 2PMHA 1BC8C 3HOTA 3F72A 4HQMA 1R58A 3R0AA 1FNNA 2QZ8A 3FWEA 2XASA 3N97A 2ZJ2A 3ZMTA 2G9WA 3ZPLA 3QPHA 4M72A 1STZA 1YQAA 4EJVA 4M74A 2V1XA 2YR2A 4I0BA 3E5UA 5H6QA 2VE8A 2FE3A 2QUFA 3VEPA 1ZLKA 2F5FA 1FSEA 5HS8A 1BBYA 4BYYA 3C1DA 3IWFA 1KU7A 4RB1A 3BJAA 2RN7A 1O3SA 1H0MA 3M8EA 4IF4A 4LB5A 2Y75A 3CO6C 4M9XA 2Z33A 1U3EM 3MZYA 3SFZA 3NQOA 2R7FA 3QU6A 5H20A 3KP4A 1IXCA 3BJOA 5HDGA 3EYIA 1TW2A 2MH9A 1D3YA 1HW5A 2EA4A 5HVQC 2P5KA 4HZFA 1TLHB 4G6QA 4XSXF 1HSTA 2CFXA 2DO7A 2H6CA 1JGSA 5BS6A 2G7HA 4ZYEA 5K5RA 3JW4A 4M6XA 4RGXA 1DUXC 1B9NA 1WI9A 1T39A 3J80Z 2VOOA 4OOIA 3WTXC 5JI6A 2VOPA 2IT0A 1YYVA 3F8MA 1ZG5A 1DPRA 2JTVA 3HTSB 5HLGA 3R6SA 2HDCA 2QWWA 2K7LA 2DAOA 2VN2A 3E6MA 5FGMA 2OU2A 2E1NA 2P8TA 3FMSA 2DFIA 3F21A 3F8FA 5D5XB 1LNWA 3JAMZ 4NB5A 5LGNA 1XDUA 4H0EA 2Z99A 3WODF 2IRFG 3FHZA 3MAJA 4S04A 2KIFA 1S6LA 2P5LC 4KICA 2Q0OA 1VTNC 4AIKA 3MZHA 3LQRA 3ECHA 1W7PA 1F5TA 1SMTA 4XBFA 4YFXF 1FYMA 1O7LA 3I58A 4ZYDA 3V8JA 4Q4ZF 2V1DA 2CW0F 4BH9A 3COAC 3CUQC 3S2WA 1LEBA 4A6DA 5D6FA 3IC7A 3SQNA 1ZRFA 5TRDA 2HQRA 3GFJA 5ED4A 5D5UB 4P9FA 5LLQA 5A2QZ 3I64A 2XROA 4IHSA 3G3ZA 4ENMA 1UHWA 2FXAA 3JTGA 4UVBA 4CXFA 1F4KA 2J5PA 2YPRA 1XMKA 1ON2A 1OYIA 1F9NA 2HTSA 3IRRA 3MQ0A 3IL2A 4B09A 2NS0A 2X4HA 3WTVC 3P9CA 2R3SA 3RJPA 4HBLA 4UV8A 4EM1A 1YS7A 4OINF 5E20A 5ICCA 3DQVC 2AXLA 3ABUA 1SD6A 2GWRA 1LQ1A 4LJZF 3K1PA 3REOA 3ZMUA 2LF7A 4JQFA 2RKHA 1NHAA 2V6CA 2IPQX 1W5SA 2DTRA 3RTRA 4BAYA 2Z5UA 1LDJA 1U78A 2FMLA 2Q8KA 2HOEA 1DDNA 1J2XA 3QP5A 2ELHA 2K4JA 2DU9A 3Q9SA 4EQQA 2K27A 3KCCA 1ZREA 3WTUC 1GXQA 1O3TA 4MHGA 2ZMEB 3DXJF 1FZPB 2KIMA 1R00A 1FBQA 4IXAA 2J5OA 1ZG3A 3FXUA 5AIPA 1K78A 4WCGA 4QLCU 4A5NA 2FNPA 3EYYA 3F6VA 4U7BA 1T38A 2XGXA 4Z2YA 2GIVA 1FX7A 3U9GA 2RNJA 1OPCA 5HS9A 2HTJA 1OR7A 4R1HA 5LEJA 1TNTA 4P96A 3E5QA 4OU0A 4KIFA 1ZG1A 5HDNA 2L3DA 4RGUA 3B73A 5DCMA 1MGTA 5D4RA 4LFUA 2V9VA 1QZZA 2O0YA 3N4MA 4WF2A 2CYYA 1S7AA 4IRIA 1YO5C 1ZAOA 4WXCA 2WV0A 2DQRA 2HYFA 4FX4A 3MFKA 4YFKF 1I27A 4PDKA 3BWGA 2CG4A 3B02A 2KKOA 5E17F 5E1XA 3T8RA 1KA8A 4MTDA 4IRHA 1OYYA 5F1RA 1QPMA 2Z3YA 2MBFA 3R4KA 2IA0A 4A6EA 3V7SA 1USTA 3ZP5A 1TW3A 2IVMA 2PMUA 3GEZA 2V79A 4ZZDA 3F6OA 3I0TA 5LGTA 2A5YB 4MQVA 4M73A 1LJ9A 2NNNA 1XSVA 3JTHA 4EJUA 5ILUA 1YS6A 3PQJA 5CVIA 1EH7A 2JZYA 2RGVA 2FBIA 3FM5A 4LLLA 3ISPA 3V8KA 1YFHA 4UXNA 2M5WA 2ZBKA 5CVUA 2FNAA 3QP6A 5BPDA 2GAUA 1TQPA 3EETA 5L3DA 5DV5A 4MNUA 1W7PB 4BHPA 1YIOA 3I71A 4A0YA 4EM0B 1ZARA 2EK5A 3LAJA 2PFBA 1QGPA 2XAHA 3QRFF 4WK8F 2A6EF 4AIHA 1S8NA 4GO1A 1R36A 5FFZA 1W4MA 4P5OA 2PBIA 2YX4A 5FB2A 2DPUA 1ZH5A 2RV8A 1KU3A 1XDSA 3EDPA 2JPCA 2EFWA 5D5VB 2DK5A 3DP7A 1U8RA 4BNCA 3IHUA 3RKXA 2GA1A 2VT2A 3Q5FA 2PEXA 5JVTA 1MDMA 3E6DA 1XB4A 2XKOA 2VT3A 2VBWA 4A2UA 1G6NA 2E7WA 3L09A 3GXOA 2A61A 3R0JA 1FYLA 3OV8A 3ZMZA 3RKWA 2RVCA 2GXBA 3F8NA 2EJRA 3GF2A 4GCVA 2VODA 4HX8A 5CVJA 4A12A 3TDZC 2VXZA 4ZZLA 3T0YA 4L5JA 4NHJA 2HKOA 1I1GA 5D5WB 2F5CA 2C6YA 3TGNA 4KIGA 2OZUA 5LHIA 4KNYA 2OQRA 4Q48A 4G6DA 1T2KA 5FLXK 4B8XA 5LGUA 3CUQA 1H9GA 4EGYA 4AWXB 1Z05A 4OMYA 1RNLA 1U6GA 2DI3A 2OQGA 2HYGD 3BPXA 1SFXA 5JFRA 2QQAA 2STWA 4Y15A 5ICGA 1KU2A 2XAJA 4RAYA 4MGRA 3KFWX 1XD7A 4UHTA 4LD5A 1G3YA 3KLNA 3C7JA 4XLPF 4G7HF 5D4SA 3VFZA 4GYIA 2P5VA 3M8FA 2H09A 2BYVE 2EA2A 2DPDA 1D8KA 3NEUA 5ILSA 2CWEA 4I01A 5DYMA 3HOSA 5TJJA 1L0OC 3HYIA 3GUDA 3HUGA 1IN6A 2MH2A 2IW5A 1I1SA 2E7XA 1XGMA 3GFLA 4BHCA 5L3FA 1B6AA 3Q9VA 4O3MA 2LSOA 2XVCA 1LDDA 2M87A 1IF1A 2GXGA 4G94A 4KMUX 3KP3A 1EH8A 1OMIA 1J7KA 1YW7A 1HW1A 1S7OA 1F1ZA 4YIIA 1LB2A 3IKTA 1QO0D 4OIOF 2ESHA 2XAFA 4MQ9F 4G8XA 1LEAA 4YG2F 3JSOA 4M6YA 3LQQA 2LF8A 2ZFWA 2MA3A 3CDHA 3K1NA 1FBUA 4AVPA 3KLOA 5D8LB 1W7PD 4S05A 2QVOA 4LG0A 3IWZA 3QAHA 3K69A 5H6RA 5DUIA 5HLIA 5HOOA 4YFNF 2QQ9A 1L3LA 1Z91A 4HOBA 4ESFA 1TTYA 2KIUA 3DPTA 3DKWA 2LKPA 1Z7UA 1ODDA 1BJAA 3QU3A 5ILVA 3SXYA 3WU1B 1ULYA 4G7OF 3RYRA 2MLKA 1BI0A 5DD8A 3VODA 5KVRA 2ETHA 3RKYA 5CVRA 1S3JA 1GHCA 5L3BA 4RGSA 2XUBA 3LA3A 4EJWA 2UZKA 4OIPF 1HXDA 3RI4A 2EFPA 2M8EA 2D1VA 4UUVA 5JR3A 2PI0A 1R1VA 5L3EA 3GLXA 4UV9A 5CJ9A 2HS5A 4CDGA 3PFIA 3E5XA 1JXSA 4LK0F 3P9KA 2EFNA 1P4AA 4EM2A 2F2EA 3O6BB 3WG9A 1MJBA 2PQ8A 3IRQA 4EMSA 1P4XA 4L9NA 1UB9A 3TO6A 2E1CA 5BQTA 2HKXA 2NAZA 4HA8A 2O8XA 2STTA 4NQWA 2H27A 3ZMDA 2A68F 1ON1A 4L9TA 1MJ9A 1U5TA 3GX4X 4CYDA 4BQAA 3HRSA 3FMRA 4U0VA 2AS5F 1MDMB 5DDGA 2BV6A 4LMYA 1OYWA 3ABTA 3I4PA 1R5GA 4U0WA 1SD4A 2VBYA 3AAFA 3R61A 3H92A 4HW0A 3L9FA 4HAMA 3DV8A 1G4DA 4KT5C 1B4AA 1FLIA 1ZN2A 2A6HF 5BOXA 1RI7A 1KQ8A 5HLHA 4KFCA 3V7CA 2M45A 4L0ZB 2D45A 1A04A 2VBZA 4ETSA 2HGCA 4Q5SF 2HZTA 2IA2A 4UNOA 1ZLJA 3L2CA 1Z9CA 2W24A 4KMFA 3KZYA 3WGIA 1YLFA 3HSFA 3QOPA 1BIAA 2QBYA 2QQBA 4HLYA 3O2PE 4A0XA 3CUQB 4GGGA 2YX7A 4ENKA 5ICEA 2HEOA 3TQNA 2P7VB 2O3FA 2BEOA 3WTYC 1AOYA 2OZ6A 1P6RA 1O57A 2D1HA 5FO5A 1KQ0A 2DT5A 3QPTA 5J6XA 1R1UA 4HDVA 2WC2A 4HV6A 3SZPA 1DP7P 1R7JA 2K02A 1FBSA 3V8LA 3WGHA 1SMYF 1HKTA 4XSZF 3BZ6A 1S29A 1WKMA 4L0YB 4RAZA 1WQ2A 4FHTA 3GFMA 2KJBA 1USSA 5DEQA 2FU4A 4IRGA 4CHUA 5BPIA 3J7AO 2ZNYA 3E3VA 2EFOA 1TQMA 4HF1A 3MWMA 4I98B 4M71A 3DPLC 2FBKA 1XGNA 1R22A 2A3SA 1FY7A 1I5ZA 4LGWA 3J81Z 1B59A 2MC3A 2UWMA 4ON0A 3ROUA 2KJCA 1HBXG 2QENA 2IA1A 5LRRA 1O3QA 5IT3A 1J75A 2P7CB 1IN7A 3ML6A 1FYKA 4Y13A 5CLSA 2FBHA 4ENJA 2JRTA 3HSRA 3KE2A 4XRFA 2XRNA 1MKMA 1BIBA 2L02A 4FX0A 4QWQA 1W5TA 2O6GE 4RGRA 2OBPA 4HYEA 2NRAC 3T8TA 1SD7A 3CO7C 2WWYA 5D6EA 3ULQB 2L54A 1R23A 3WTTC 2QYOA 1KYWA 5KK1A 4N0BA 1FPQA 3F3XA 4LG0B 5CVVA 2VC1A 3I5UA 4MEYF 5IT9K 2FMYA 5FLXZ 3K1MA 4K2EA 1MZBA 2Q2EA 5DCFA 5AIQA 2YSRA 3J81K 2VC0A 4I7HA 5DD4A 1ONVA 1QNTA 3BY6A 4L9VA 4UVCA 3E6BA 2XAQA 2HWVA 2RQPA 4KIBA 3PQKA 1Z6RA 2B0LA 1JHHA 2CSOA 2P6SA 3ZN1A 3HIFA 1CF7A 2A07F 1TNSA 3KP7A 2GQQA 5HS7A 3KP2A 2ESNA 3RPUA 3TKYA 1V4RA 2RC4A 4HV5A 4I0AA 3V7RA 1PUEE 2L4MA 2IP2A 2MLGA 2DLLA 3WTWC 4N9HA 3M1EA 3JSPA 3KP6A 2FRHA 4PGGA 1FP1D 1PP7U 3WTSC 4RB3C 1XCBA 2Y0MA 1U2WA 2CQKA 5EEHA 1ZRCA 3P9IA 3MCZA 4HX4A 3BJ6A 4ASNA 3ELKA 3U2RA 4Y17A 3O3KA 1Z6TA 3WE2A 5LRSA 2JT1A 1J59A 3ZMSA 3HHGA 2TDXA 3RDIA 3IKVA 1K79A 1TBXA 4E70A 5FD5A 1HSJA 2ISYA 3I59A 2FA5A 4YIFA 5LBQA 5AONA 1U5TB 1QQIA 2L01A 4HDUA 2PN6A 5J8CA 4R79A 2CGPA 4HF2A 2ZCWA 5E1WA 1YTYA 2VE9A 3H3ZA 4EV0A 3VB2A 2F5DA 1YW8A 3WU0A 3EQLF 2Z9OA 5E8IA 3DEUA 4IPAA 3M9AA 1YG2A 3M7GA 1IN5A 1K78B 1J0RA 2FOKA 5ICFA 1D8JA 5L3CA 1HKSA 2CO5A 2WTEA 3KETA 4LLNA 4UVAA 3D0SA 2UXNA 1LVAA 1IXSB 3OOPA 4A5MA 2XHKA 1PP8F 4D0PA 1FC3A 2W85A 2X0LA 1MJAA 1YW9A 3CUOA 4F7ZA 2QBYB 5DCMB 1IRFA 4KDPA 1BC7C 1XCVA 2RDPA 4ZH4F 4AD9A 1XGSA 4JBAA 1SFEA 2ZXJA 1BI1A 3L00A 2EWNA 3ZQ7A 2DQLA 2EV0A 4EGZA 1IXRC 1O3RA 2PJPA 4GYGA 1KGSA 4RB0A 3T5XA 1IAWA 3WE3A 2BBYA 3RYPA 5K5OA 2FQ3A 1R5HA 4WXHA 1UCRA 2JSCA 3GVAA 3BP8A 3J80K 1ZGJA 4PCQA 2XIGA 3K0LA 2IJLA 1ZHFA 1J9IA 2QM3A 2K4BA 2YU3A 1FP2A 1J5YA 3F23A 2XKPA 1C0WA 4DNCA 4BXUA 2V1UA 1MD0A 4WWCA 5F6FA 2ZNZA 1EV7A 1XMAA 3E6CC 1R1TA 1BI3A 2O03A 4L18B 1GVJA 2COMA 4A0ZA 2OD5A 1K7AA 3ZN0A 1Y0UA 6PAXA 1AWCA 4KN7X 1KQ9A 3GZ6A 1E2XA 3V4GA 1DPUA 1I6XA 2LDUA 5E8GA 4P9UA 1V3FA 4OIRF 1K6OA 1T0FA 1P92A 4KYWA 3DF8A 1QZYA 3JAMK 2DBBA 5BMZA 2PG4A 3I53A 2W57A 4I02A 3W6JB 2ACJA 2HR3A 2VBXA 2EV6A 2VONA 4G7ZF 1FT9A 4FT8A 4EVIA 2PLYA 1H9TA 3TOBA 2LNBA 4CICA 3LA2A 2D2WA 1XGOA 3P7NA 3L7WA 4G9YA 1P2FA 4U88A 1ZYRF 3F8BA 4TV7A 2H94A 1OKRA 3BPVA 1WWXA 4CGZA 1Q1HA 4ZYHA 5E18F 2QLZA 4HQEA 3FX3A 4HF0A 4M9ZA 1XSXA 4WXDA
chains in the Genus database with same CATH superfamily
5FKOA 4ZDOA 3BCAA 1YRNA 4P55A 5E3OA 3KEQA 1MBEA 1RC9A 2CQXA 3NRVA 3GCMA 5DUKA 3GFIA 2NNYA 1QBJA 3SZTA 5FD6A 1QVUA 4CZZA 1E3PA 1VQ6I 5C4XJ 3HPHA 4IHTA 3LL7A 3CCYA 3RIRA 3I56I 4HNVA 2Q1ZB 5GADJ 5A2QK 4XQFA 1WRJA 1X3UA 3KEOA 1RUNA 3GWZA 4JOMA 3S3OA 3BZKA 2HVRA 2E19A 4Y52J 3H9QA 3RSNA 2XF5A 4KA4A 1XC5A 4RS8A 3OYNA 4YIRX 3H36A 5E1ZB 2M30A 2HDWA 3ERED 5FLVA 3BOQA 3LSRA 1UFMA 1CF7B 1HW2A 2HOSA 2GA2A 1N77A 4CCMA 5GTIC 1G59A 5C3EJ 2R7VA 3HTUA 3C3WA 1TQIA 4N9IA 4FTHA 1SD5A 5K5QA 4HLXA 3CCEI 1V54H 2EV5A 4BJTA 2W84A 3TOAA 1G3SA 1RZ4A 1QA6A 4KN4X 1B1BA 4BE2A 2KIQA 1PYVA 3CJNA 4BEHA 2VPRA 4BHBA 2JPBA 2GIZA 3HXLA 3JCUC 3FXQA 2EFQA 3VOEA 3H5NA 2K40A 1RUOA 4XM3A 2DYRH 2AQEA 1NG6A 3LA7A 1FOKA 1Y1VJ 3I9V2 3LWFA 3FF5A 3FMQA 5DS9A 3CC4I 4R8HA 3A03A 3HRMA 4D5FA 2F5EA 3SDGA 3VWBA 1RKTA 5J8FA 2ISZA 2A69F 1DU6A 1P4WA 2VKVA 4PSWA 2FSWA 4MFEA 4E7HA 3CLOA 4RB2C 4NBQA 5IOZA 3C18A 1BOAA 2IGMA 3RCOA 2XAGA 2Y48A 1Z1DA 3HSEA 4XOTA 1D5VA 5CYVA 3TO7A 4CCOA 2QSHX 4DZPA 2OAZA 1XN7A 1JE8A 1GXPA 3FXRA 1QPIA 2DK8A 4IHXA 3BG3A 3H3VK 5CQGA 4LB6B 4ESJA 3WTZA 3LNQA 5GTHC 1NK3P 1OFCX 4EJOA 5K1YA 1EH6A 3I59B 2ZKZA 4IJAA 1REPC 3RQ4A 2DN0A 4MTEA 1VQOI 3M07A 5D8KB 4JK1X 2XB0X 1IRGA 1UJ8A 3DFGA 2X6XA 5J4YA 3Q0UA 3D5LA 2JA8J 2NVXJ 1FWZA 1XSDA 3G1LA 3U1DA 3Q0WA 3OL3A 3LAPA 1IN4A 3QPLA 1PDNC 3RZOJ 2BE5F 1VI0A 2X6YA 2ZO4A 4BDYA 2CV0A 3MEXA 1ZGAA 5EG0A 2MD5A 4L9JA 4M9SA 3BQZA 3K2ZA 4AIJA 3IAM2 5FFXA 5F64A 2GZWA 3OYKA 1IG7A 3CJQB 4PGHA 2X9DA 4I2OA 3E97A 1CGPA 1HKQA 4CCJA 4WX9A 4BY1J 3HRTA 1KU9A 3FM3A 1LDKB 2ZXWH 1G3WA 4U7DA 3K6GA 2CV2A 4C2TA 1JHFA 3HHHA 3QYFA 5E79C 2XPUA 2NVUB 1VQMI 4ITVA 2ZJQF 5IT9Z 3K9TA 3ZQHA 1P9QC 3C2BA 4L5IA 3ZMVA 4ZYGA 3V42A 4CA0A 4XOPA 2ELKA 3GZNB 4IHWA 3SHFA 4EJTA 3M3YJ 2BGCA 3BROA 3LSTA 4FCYA 4I09A 3M4OJ 2OA4A 3WGGA 5LHGA 1LPQA 2I5UA 4V2GA 3K4MA 3OIQA 2P4WA 2XGEA 2ZXIA 1XX5A 2KRFA 1OCPA 4PZJA 3VYUB 2HQ5A 1ETQA 2O5RA 4LLGF 3R60A 1T6SA 1UHMA 2CW8A 5L3GA 2M1BA 1U5TC 4HSTA 5K7FA 2QKMB 2CUFA 4ESBA 1IW7F 2DA1A 4D7MA 3KZZA 5GAHJ 2H6BA 5K7ZA 1G3TA 1SAXA 1Z77A 4ZDLA 4XLNF 2EB7A 2P6TA 2NVYJ 4DOZA 3RPQA 5CKTA 5LHHA 1PJRA 4M3BA 5B1AH 3H3UA 4G12A 4KUMA 1X3WB 4D9JA 4XLAA 1T98A 2GXAA 1SVLA 1O7FA 5J1RA 3W2AA 3TDUC 5LEKA 3KP5A 2OF7A 2OV7A 4M6VA 2M0MA 4HX7A 2E36A 3EUHA 3FZVA 3CMAI 3DEWA 2O61A 2NOJB 3RKQA 4U0YA 2DTZA 3I54A 4GXOA 5HDKA 4ENNA 2OTLI 3D5RC 1LFPA 2HFHA 4IVNA 3CC7I 3BLYA 2JVGA 3GW2A 2EZLA 2HQNA 2XV4S 3CTAA 1WJAA 2QSGX 2R7UA 2OUMA 1ETXA 4O5VA 4OMZA 2EH3A 5F1JA 2D5VA 1OR7C 2LREA 1E17A 3W6KB 1BN5A 1IN8A 4O6JA 1VQNI 2FF4A 4CO8A 3GYHX 3MN2A 2I8DA 3LFKA 1RIOH 4A3LJ 1POGA 3PNTA 3GZ5A 3HDDA 5JHUA 1EJ9A 3CC2I 1IDZA 1BW5A 4Q47A 2NYXA 1IUYA 3AG1H 3DLAA 2L4AA 2DW4A 3CJTB 3PIOF 5EEGA 3G73A 3K7AJ 3BG7A 1IZ1A 3HRUA 3GO5A 1BI2A 4MEXF 1VQLI 1BM9A 4XR6A 4IOCF 3UKGA 3F8CA 2JVHA 2DT6A 3S2HJ 3S1QJ 4XRSA 3TP0A 1HQCA 3BDDA 4IEJA 1WSUA 2R7DA 3F22A 3T1BA 2BVLA 2UXXA 2K86A 1GDTA 4CYCB 3S16J 4J00A 4DQ2A 1WJEA 2G7UA 3ASNH 1V5GA 2VUMJ 3TO9A 1FSHA 4OIQF 3I4NJ 3QWLA 2ADUA 1KYZA 3N05A 5JHFA 5ERIA 3GTOJ 1P7IA 4LK1F 3PUFA 4KISA 1ZK8A 2ZMEA 3A0BC 3ECOA 4AIDA 3H1CA 1WH5A 2FEZA 1SFUA 2W25A 1ZRDA 1B9MA 2PMHA 1BC8C 2ID6A 2L9SA 1IO2A 2E60A 3HOTA 3F72A 4HQMA 3HOVJ 1R58A 3R0AA 2DDBA 1FNNA 1N75A 2EPFA 3RPUD 4NC8A 2QZ8A 3FWEA 2XASA 4HSRA 2ZC2A 4QIWN 3BR1A 4E6KG 1EKEA 3D5SC 2CUEA 2ZJ2A 3N97A 3ZMTA 3S15J 2G9WA 3ZPLA 3QPHA 4EEFG 1BR1A 4M72A 1MSEC 2VB6A 4XRMA 1DGWY 4MFDA 2DCEA 1STZA 1YQAA 4EJVA 2R5YB 4M74A 2V1XA 3VSLA 2YR2A 4H4KC 4I0BA 1FTZA 3E5UA 4L5EA 3G4SI 5H6QA 3BG6A 2KFDA 1VQPI 3E7LA 2FOWA 4YELA 3L1PA 1XPXA 4I6ZA 2VE8A 2FE3A 2QUFA 2KT0A 3SDBA 1WPKA 3VEPA 5DM6F 2BXZA 1ZLKA 2F5FA 1FSEA 5HS8A 1BBYA 4XN0A 4BYYA 4NQWB 1S72I 3IH2A 3C1DA 2BZTA 3OSGA 2JUCA 3IWFA 4A3EJ 1KU7A 2ZB9A 3CF5F 1ZKGA 4RAGA 4RB1A 3BJAA 2RN7A 3X2QH 1MMGA 1O3SA 1IGNA 2NXNB 1H0MA 1Q1VA 1RR8C 3M8EA 1ETYA 4IF4A 1DGRM 4LB5A 2DOFA 2Y75A 1PUFA 1MW7A 3CO6C 4M9XA 2Z33A 2DJIA 1U3EM 3MZYA 3SFZA 3NQOA 2R7FA 3QU6A 2V26A 3K10A 3KP4A 5H20A 1JUPA 1IXCA 3BJOA 2K85A 5HDGA 3EYIA 1VQ4I 1JJ6C 4KJZA 2K9LA 1TW2A 3QPSA 2MH9A 3QYEA 1D3YA 3JRHA 1HW5A 2EA4A 5HVQC 2P5KA 4HZFA 1TLHB 1R4NB 3CP2A 4G6QA 3BZCA 4XSXF 1R4MB 1HSTA 2CFXA 2DO7A 2H6CA 1JGSA 5C44J 2M34A 5BS6A 3FXMA 2G7HA 4ZYEA 5LFAA 2ECBA 5K5RA 2K9QA 3JW4A 2UUZA 4M6XA 4RGXA 2VKEA 4BEHB 1HOMA 2LP0A 2XF7A 1DUXC 2E1MC 1B9NA 1WI9A 1T39A 4A3GJ 3KIOA 2VL8A 3J80Z 3OYDA 2VOOA 4OOIA 3WTXC 5JI6A 2L9NA 1HF0A 2VOPA 2IT0A 2M3AA 3LSGA 1YYVA 3F8MA 4RBOA 3RQIA 3TP3A 2JK3A 1DPRA 1ZG5A 1A36A 1FJLA 3CMYA 4CCNA 5M5XJ 2JTVA 3HTSB 1TC3C 5HLGA 1MMAA 3R6SA 5KNLA 2HDCA 3GTLJ 2QWWA 2K7LA 2JWTA 3CD6I 2JRMA 1YIJI 2DAOA 1CQTA 2CU7A 3O8GA 2VN2A 4XONA 3BR2A 3E6MA 1X1DA 2L7ZA 1D0XA 5FGMA 2OU2A 1VFCA 2E1NA 1D0ZA 2P8TA 3FMSA 2DFIA 3F21A 4XICA 3F8FA 5D5XB 1LNWA 2K9MA 3JAMZ 4BBSJ 4NB5A 5LGNA 1XDUA 3IH4A 4H0EA 2Z99A 3BC8A 5E3MA 1Y1WJ 3WODF 2IRFG 1BOBA 3FHZA 3MAJA 3SEQA 2WB1A 4E7LA 4XN3A 4S04A 4A93J 2VJ4A 4C3JJ 2KIFA 1S6LA 2P5LC 4KICA 3LSMA 2Q0OA 1VTNC 4AIKA 3MZHA 3LQRA 2MFZA 3MMYB 3ECHA 3QQAA 1W7PA 3ZRGA 1F5TA 2V6EA 3EPZA 1SMTA 4XBFA 2VQHA 4YFXF 5EG0B 1LFUP 1FYMA 4M3DA 1O7LA 2ME0A 3I58A 2IGOA 3MKYB 4ZYDA 4YRVA 3V8JA 3H0DA 3OYMA 1Y8RB 5EGOA 5JVGF 4GDFA 4CZCA 4Q4ZF 2X1CA 2V1DA 2CW0F 4B4CA 4BH9A 3FIWA 3COAC 3CUQC 3S2WA 4UUTA 5GAEJ 1LEBA 4A6DA 3DBLB 5D6FA 4FQGA 3IC7A 4W97A 3SQNA 3ZQIA 1ZRFA 3CCQI 2NOGA 5TRDA 2VQLA 2HQRA 2XC7A 3GFJA 5ED4A 1I6HJ 1B8IB 3NWSA 5D5UB 2P0WA 2H8RA 4PJJA 1MBFA 2JA7J 2JMWA 4P9FA 2L5QA 1T95A 5LLQA 3OMYA 5A2QZ 4BE1A 3S8PA 3I64A 2XROA 4DZJA 4IHSA 2Y9YA 3G3ZA 3PO2J 2DMPA 4ENMA 4DJAA 3OIPA 2HI3A 2ICWG 1UHWA 2FXAA 3JTGA 1VZ0A 4UVBA 4CXFA 4BACA 1F4KA 2J5PA 2YPRA 1YJNI 1A31A 1W1WE 2MABA 1XMKA 1ON2A 3MKLA 1OYIA 4MLOA 4ZDPA 2BHZA 4B1RA 1F9NA 3HBLA 2HTSA 1IV6A 2I10A 2F48A 3IRRA 3MQ0A 5IPAA 3IL2A 4B09A 5M3FJ 4XKBA 1ETVA 3Q3SA 2NS0A 2X4HA 4DGWB 3WTVC 3VPRA 4IQJA 1ZGWA 3P9CA 4DBRA 2UV1A 2R3SA 3RJPA 4HBLA 1QRYA 4UV8A 4EM1A 1YS7A 4A3IJ 4OINF 1A35A 3HOYJ 3DLLF 2Z2SB 1WZ2A 4XIDA 1WHUA 5E20A 5ICCA 3BR0A 2EINH 3DQVC 2AXLA 3ABUA 1SD6A 1P7JA 2F4MB 1KONA 2ZSIB 5IOYA 2OJED 3A4CA 3FHNA 1JGGA 4II3A 1F43A 3ZXSA 1YOVB 1VNDA 2ID3A 2GWRA 4S0HB 1LQ1A 2Q2EB 3MVPA 3ABKH 4LJZF 3K1PA 4BKXA 2WY8Q 3REOA 1T33A 4ANJA 3ZMUA 1D5YA 2LF7A 3PFYA 4JQFA 2RKHA 1NHAA 3OYAA 2V6CA 2IPQX 4D7NA 4FISA 3W2WA 1RR7A 1W5SA 2DTRA 3RTRA 4BAYA 2Z5UA 4RDUA 3PNVA 2R7WA 2VKHA 2XSJC 1LDJA 1U78A 2FMLA 1BR2A 2Q8KA 2DMTA 2HOEA 5IP6A 2X6OA 4IHVA 2HXOA 3ONQA 1ZELA 1DDNA 1WJ5A 4XORA 2VIXA 1J2XA 3DBHB 3QP5A 4IZZA 2ELHA 2K4JA 2DU9A 3Q9SA 3SZGA 4EQQA 9ANTA 2K27A 3S17J 3KCCA 1ZREA 4PK4A 3WTUC 1GXQA 1IRZA 1O3TA 2KPMA 4MHGA 2ZMEB 3DXJF 4ZJZA 1FZPB 2R7ZJ 5F0HA 5J1YA 2KIMA 1R00A 3KEYA 2OC6A 1FBQA 4IXAA 5M3MJ 2J5OA 1YX3A 1ZG3A 2ZSHB 1Z0XA 3BR5A 3FXUA 4BBRJ 3OYCA 2JN6A 5AIPA 1K78A 4WCGA 4QLCU 4A5NA 4IKFA 5EF6A 2FNPA 2BY3A 3EYYA 3F6VA 4HEA2 1XTAA 3HPGA 5JLWA 4GRIA 4U7BA 1T38A 5HODA 2XGXA 4Z2YA 2HVSA 2GIVA 5E3LA 1FX7A 2IBDA 3U9GA 4HNUA 2L7MP 4X1EA 2RNJA 2EZIA 1OPCA 3BT9A 5HS9A 2NS7A 2HTJA 2X51A 3ZQQA 3TEDA 2RQQA 1OR7A 1R5ID 4R1HA 3RZDJ 5LEJA 5TGTA 4A69C 1TNTA 4P96A 5HLTA 2FX0A 1IC8A 2H1LA 3E5QA 1AKHA 4OU0A 4KIFA 1ETOA 4A3BJ 1ZG1A 2DT7B 1X4PA 2A5WA 3BG9A 5HDNA 2L3DA 4RGUA 5F0FA 3B73A 5DCMA 1MGTA 5D4RA 3DBRB 2V9VA 1QZZA 4LFUA 2O0YA 1X2MA 3N4MA 4WF2A 3AFHA 2CYYA 1S7AA 4IRIA 4OWRB 1YO5C 1ERDA 5M5WJ 1ZAOA 2R4GA 4FE7A 2WV0A 4WXCA 2XGDA 4QSHA 1QHGA 1IRXA 2Y31A 1T0FC 2DQRA 2HYFA 4FX4A 3MFKA 1WJBA 4YFKF 1I27A 4RMNA 1TT0A 1YE9A 3LSKA 3DU6A 2LKXA 1U9OA 3OL4A 2QA4I 2IS6A 4PDKA 3BWGA 2CG4A 1NH3A 4BUPA 2F4IA 2R5ZB 3B02A 3DEEA 3LMMA 2KKOA 1D0YA 2NS8A 5IYCJ 5E17F 3SYTA 5E1XA 3T8RA 1KA8A 4MTDA 2CUJA 4IRHA 1LFBA 4XLFA 2DMUA 1OYYA 3MKWB 4NC7A 3PM1A 5F1RA 2AQFA 1QPMA 1U8BA 3HL2A 2KL4A 2Y2ZA 1WJFA 4E7JA 3JREA 1UELB 2Z3YA 3HEFA 2MBFA 3R4KA 5KAFC 1DQUA 2IA0A 1UHSA 4A6EA 1F36A 3V7SA 3ZQFA 3BQYA 3CCVI 1USTA 1V5FA 3ZP5A 2YU9J 1TW3A 2IVMA 2PMUA 3GEZA 4BXFA 2V79A 3FXOA 4BQQA 4ZZDA 3F6OA 3FK7A 3I0TA 1K6YA 3GLLA 2IGKA 1RESA 5LGTA 1Y56A 4IX7A 1ITYA 2A5YB 4MQVA 4M73A 1OCCH 1QVTA 1LJ9A 4IHYA 2NNNA 2EZKA 4C3HJ 1XSVA 2PMZN 3JTHA 4EJUA 1HDDC 5ILUA 1YS6A 3JRBA 2L0KA 1MIJA 1OISA 3PQJA 1T8IA 5CVIA 1EH7A 2JZYA 2RGVA 2FBIA 4HPQA 4CCKA 1YHQI 2DOEA 3FM5A 4LLLA 2WAEA 3CCJI 4BS9A 2PX9A 3ISPA 3V8KA 1YFHA 4UXNA 1SAUA 1MBGA 2CV1A 2M5WA 2ZBKA 4C2MJ 3M1CA 5B5EC 2EIJH 3OYHA 5CVUA 2XAUA 2FNAA 3QP6A 2H1KA 3K2AA 2DOAA 5BPDA 2GAUA 1B72A 3C2HA 1TQPA 3EETA 2AO9A 1ACIA 1EF4A 2R7RA 4LIVA 1GV5A 5DV5A 4MNUA 5L3DA 4B3AA 1H88C 2R92J 1W7PB 2G0EA 1UMQA 2DFFA 4BHPA 1YIOA 1JUSA 1Z67A 3I71A 4FE4A 4A0YA 1ENHA 4EM0B 2KZVA 2XB5A 5B3SH 1ZARA 3ZGKA 1RETA 2EK5A 3CDLA 1E3OC 3LAJA 2PFBA 1QGPA 2XAHA 1OJLA 3A1YA 2JSPA 3QRFF 2V9PA 1LUJB 2A6EF 4AIHA 5EGOB 4WK8F 3HKZN 2W1OA 1S8NA 4GO1A 1R36A 3DKYA 3KYLA 3AL0C 2VQCA 1W4MA 5FFZA 4ZYAA 4Z6YA 4P5OA 3GBGA 3VSKA 1K83J 2PBIA 2VI6A 2YX4A 2GBYA 5FB2A 2DPUA 2BXYA 1ZH5A 2RV8A 1KU3A 1XDSA 3EDPA 3FDYA 2JPCA 1SC7A 2EFWA 2LOOA 4B47A 2DK5A 4F55A 5D5VB 4KITB 1OCZH 2KDZA 4PJ0C 5EDNA 2HPIA 1OLTA 2GLOA 3DP7A 1U8RA 4BNCA 4RM3A 3JR9A 3IHUA 3DTEA 3RKXA 3OS2A 2GA1A 2VT2A 4A3FJ 3Q5FA 5FKNA 2PEXA 5JVTA 2K3PA 1MDMA 3E6DA 1XB4A 3D1NI 3CCLI 2EZHA 2XKOA 2MYSA 2VBWA 2VT3A 4A2UA 1G6NA 1I3AA 2V4JC 4M3FA 2B9SA 2E7WA 3L09A 4D5CA 1N78A 2FD5A 3GXOA 3CQZJ 2A61A 2LY2A 4UUSB 3DU5A 3R0JA 3JRIA 1FYLA 3OV8A 2K9SA 3H35A 3ZMZA 3RKWA 2RVCA 2GXBA 3F8NA 5FKKA 1Z3XA 3FISA 2EJRA 3F0CA 3GF2A 2JUGA 3ABMH 4GCVA 3OSFA 4HX8A 4OAYA 2VODA 5CVJA 3LSIA 4PJNA 4A12A 3TDZC 2VXZA 1JI8A 4ZZLA 1G2HA 3T0YA 4L5JA 4NHJA 2HKOA 1BW6A 3MKZA 2LBFB 2R7TA 1I1GA 4MIMA 3S32A 4AC0A 2VJJA 5D5WB 4X6AJ 2F5CA 2C6YA 3TGNA 4KIGA 2OZUA 5LHIA 4KNYA 2KZGA 2OQRA 4Q48A 1PVEA 3K4NA 1S7EA 2WADA 2XF6A 2QSFX 3G1MA 2PJRA 2WA0A 2M4GA 4G6DA 1BA5A 4E7SA 1T2KA 5FLXK 4XNFA 3LSHA 4B8XA 1YRNB 5LGUA 3CUQA 1TWGJ 1H9GA 1ZTRA 5J47A 2CQNA 2B7EA 4EGYA 1SFOJ 1G8XA 4J19A 1SEUA 2R7XA 4AWXB 1NG7A 1Z05A 1VQ9I 1HLVA 4OMYA 1RNLA 1U6GA 2DI3A 2OQGA 2HYGD 1R9TJ 4E4HA 1S5LC 2MW8A 2DMNA 3BPXA 1SFXA 5JFRA 2QQAA 4NNJA 2STWA 3BR6A 4Y15A 5ICGA 1KU2A 4Y3OA 3HG9A 2W7NA 2XAJA 4RAYA 4MGRA 1RKWA 3KFWX 1XD7A 4UHTA 2KRCA 4LD5A 1DU0A 1G3YA 3KLNA 3HGGA 4C2UA 3C7JA 3DTKA 2LG4A 4XLPF 4G7HF 4X0GA 1ORKA 4BQNA 2IXSA 2HZDA 5D4SA 3DWLE 3VFZA 4GYIA 4BU2A 2P5VA 3M8FA 1SVMA 4AM3A 3JRCA 2IS1A 2IEKA 3B6AA 3FBNB 2O7OA 4BGDA 2H09A 3CCUI 2BYVE 1ETWA 2EA2A 2DPDA 1D8KA 3NEUA 5ILSA 1QZEA 2CWEA 1GV2A 1FEXA 2GM4A 4I01A 5DYMA 3HOSA 5TJJA 3OYEA 1JKQC 1GLNA 2OCEA 1L0OC 3HYIA 3W3CA 3GUDA 3KX2A 3JRGA 3HUGA 1IN6A 2MH2A 4AU7A 2IW5A 1I1SA 2E7XA 1I50J 2ZFUA 1XGMA 3DKXA 3GFLA 3NAUA 1Y6IA 2XPVA 5GPAA 4BHCA 4BE0A 2LC2A 1WJDA 5L3FA 4JX5A 1B6AA 3Q9VA 2KP6A 1RPWA 4ZTFA 2E2HJ 2HQAA 3UNGC 2ECCA 2LSOA 2QGUA 2XVCA 2KISA 4O3MA 2L9RA 1LDDA 2M87A 1IF1A 2GXGA 2DJNA 2HDDA 1U9NA 4G94A 4KMUX 3KP3A 1EH8A 1OCRH 4XLHA 4A3CJ 3H5AA 2LR8A 1OMIA 3SJMA 2L9VA 2R7OA 1J7KA 1YW7A 3ZQGA 1XMXA 2RREA 1HW1A 1S7OA 4AUXA 1F1ZA 4YIIA 2LH9A 3U21A 2XGCA 1LB2A 2WY7Q 3BTJA 4LOCA 1WFXA 3IKTA 1I39A 1QO0D 5J1UA 1W36D 4OIOF 2ESHA 2IGNA 2XAFA 2O8KA 4MQ9F 1VQKI 5K7HA 4G8XA 4DYRA 2ZMEC 3K4JA 5EJCA 4XKWA 4BXXJ 3PJRA 2EIKH 1LEAA 4YG2F 2HU9A 3JSOA 2BW3A 2X6WA 4M6YA 3LQQA 4I76A 4D1QA 2LF8A 2ZFWA 2YS9A 2Y9ZA 3L2WA 4CH7A 3S3MA 2MA3A 3CDHA 3K1NA 1FBUA 1JTXA 4HRIA 4AVPA 4E7KA 2Y0SN 3KLOA 4CUGA 5D8LB 4AYBN 1WH7A 3BTIA 1W7PD 4S05A 2QVOA 4LG0A 1W0TA 2E35A 2L2OA 3IWZA 3CP8A 3ESWB 4OAZA 1N25A 1NK2P 3QAHA 3L2RA 4AVZA 2ELJA 3K69A 5H6RA 1MBJA 5DUIA 2CUZA 2X1DA 1TWFJ 5HLIA 5HOOA 4YFNF 3FXJA 2QQ9A 1L3LA 1RRJA 3CDIA 1QHHD 1SANA 2DYSH 1Z91A 2K5CA 4LIUA 5TISC 4HOBA 1TWHJ 4ESFA 1TTYA 2KIUA 3DPTA 3DKWA 2CQQA 2LKPA 1JUMA 2DA4A 1Z7UA 2FUG2 1ODDA 1H89C 4JYKA 1BJAA 1XG1A 3QU3A 1OQYA 2OPTA 5BNGA 1K61A 1BL0A 5ILVA 3SXYA 2NVQJ 3FBIB 3TBIA 5M5YJ 3WU1B 1ULYA 1MSFC 3RYRA 2MLKA 1BI0A 5DD8A 3VODA 4G7OF 4BQOA 5KVRA 2ETHA 3RKYA 1FTTA 3NARA 5CVRA 1S3JA 2CMPA 1GHCA 1UAAA 5L3BA 4RGSA 4BL0B 2XUBA 3LA3A 4N4OB 1E3HA 4EJWA 2UZKA 1T56A 3S93A 4OIPF 1X1BA 2VQGA 5DM7F 1HXDA 1VQ7I 3RI4A 2EFPA 5FRMA 2M8EA 2D1VA 4Y4RA 4UUVA 5JR3A 2IS4A 2XRLA 2PI0A 1R1VA 5L3EA 3GLXA 1B72B 1JTYA 4UV9A 5GP9A 5CJ9A 2M7AA 2HS5A 4CDGA 3I4MJ 3PFIA 3E5XA 1JXSA 3ZQCA 4LK0F 2L7FP 3P9KA 3A2KA 2EFNA 2V7FA 1P4AA 3HOWJ 4EM2A 2F2EA 1MNMC 3O6BB 3OWTA 3WG9A 4M3GA 2MD0A 1DP3A 3GTKJ 1MJBA 2KHMA 3DPUA 3TW6A 2PQ8A 3IRQA 2R5YA 1IV8A 1HCRA 3IUOA 2VPLA 4EMSA 1APLC 1P4XA 4L9NA 1HDPA 1UB9A 3S1MJ 3TO6A 5FJ8J 2E1CA 3H0GJ 5BQTA 2HKXA 2NAZA 3BTLA 4HA8A 2LY1A 2O8XA 1BJZA 1I3QJ 3AG3H 2STTA 4NQWA 5C4JJ 2H27A 3ZMDA 1VF9A 3G6EI 3HC7A 3K70D 1JJ8C 2R93J 2A68F 1ON1A 3LSPA 4L9TA 2M0CA 1W36C 2E71A 1MJ9A 3VDXA 1U5TA 2MC4A 3HGYA 3VYTB 2XDVA 5EEAA 2V9KA 3GX4X 4CYDA 4XRSG 4BQAA 3HRSA 1MNDA 2CW7A 3S1NJ 3FMRA 4U0VA 2LTPA 3SFIA 2AS5F 2E2JJ 2BY2A 3L2VA 4ZTJA 4QPOA 5KCMA 1MDMB 1YX5A 5DDGA 4BY7J 5FROA 5HNFA 2BV6A 2E34A 4LMYA 3GTGJ 1OYWA 3ABTA 3I4PA 1R5GA 4U0WA 1SD4A 2VBYA 4Y7NJ 3AAFA 2DFHA 4UY8I 3R61A 3H9JA 1IDYA 2MSYA 3H92A 4HW0A 3L9FA 1JKRC 1X2NA 1X4OA 4HAMA 1MNEA 2WAQN 4V19K 3CMEI 3DV8A 2BY1A 2E5NA 4KT5C 4PJMA 1G4DA 1B4AA 1FLIA 1ZN2A 3PSIA 2A6HF 5BOXA 1RI7A 1A6IA 3CLQA 2CH0A 1FOWA 5HLHA 1KQ8A 2E2IJ 4XKVA 3MZ8A 1TP4A 2X1EA 4KFCA 3G1OA 3V7CA 2DDAA 2K9NA 2M45A 2R0QC 1JKOC 3S2DJ 1R49A 4L0ZB 2D45A 1A04A 2VBZA 4ETSA 3GTPJ 2KQRA 3OR1C 2HGCA 1TWAJ 2QF7A 4Q5SF 2HZTA 3PL8A 2IA2A 4UNOA 1ZLJA 3L2CA 2QCOA 3BR3A 1Z9CA 2W24A 4KMFA 3KZYA 3WGIA 1YLFA 1IUFA 2PJRB 3EUKL 2JQ7A 1MMDA 3HSFA 2HVQA 3QOPA 4ABZA 1BIAA 2QBYA 2QQBA 2DFEA 1R71A 4HLYA 3GMEA 3O2PE 3OR2C 4A0XA 2V1NA 3CUQB 4B44A 4I99C 3DCFA 4GGGA 2YX7A 4ENKA 5ICEA 2HEOA 2M9HA 3TQNA 5FRNA 2P7VB 4BDZA 3OYGA 2O3FA 5E3NA 3JRDA 3FKIJ 2BEOA 3AG4H 3QOEA 2M4KA 2AXTC 2DODA 3AG2H 5DTDA 2XSDC 3WTYC 4CCLA 4ZC3A 1AOYA 2RNGA 2YUSA 2H8WA 2OZ6A 2KDOA 1P6RA 1O57A 2LKSA 2D1HA 1PUFB 5FO5A 1A5JA 2LD5A 1KQ0A 1W5CC 2E1OA 2K3FA 2WBMA 2WAQA 5F27A 4IO9F 2DT5A 3QPTA 5J6XA 4JX6A 1ZR2A 4C3IJ 5H2FC 3J7YJ 5CQEA 1R1UA 3JRAA 1H8AC 4HDVA 2AHQA 1UG2A 2WC2A 2MGQA 3HZJA 4XLEA 4HV6A 1X1PA 2LMDA 3SZPA 1DP7P 1R7JA 1J09A 2K02A 3LOCA 1FBSA 3OYLA 5F0CA 2VKDA 3V8LA 2O9LA 2Y30A 3CCSI 3WGHA 1SMYF 1HKTA 3CF2A 4XSZF 3BZ6A 1AHDP 1S29A 2M8GX 1WKMA 4L0YB 4RAZA 1WQ2A 3IAS2 3PNYA 4FHTA 3FXLA 3A01A 1ZQ3P 3GFMA 3HUGB 2HPMA 2KJBA 1USSA 5DEQA 2FU4A 4DW6A 4IRGA 4NDLA 1X1CA 4CHUA 2X48A 5BPIA 3J7AO 4BJ5C 2W00A 4PUSA 1GUUA 1WJCA 2JA5J 3A0HC 4IOAF 2ZNYA 3E3VA 4XMYA 2A6TA 2EFOA 2VXDA 3ERMA 3K70C 4NC6A 1TQMA 4HF1A 2LK2A 4JX4A 2QKLB 4A3DJ 3MWMA 2MG4A 4UB8C 1BR4A 4I98B 4M71A 3DPLC 2FBKA 2TCTA 5KAIC 5IYBJ 2N8GA 4W1UA 5HNHA 1XGNA 1R22A 4C30A 3ASOH 1LE8A 2R7SA 2A3SA 1FY7A 1I5ZA 4LGWA 3J81Z 1B8IA 1B59A 3K4LA 2KLOA 3B6CA 1S9HA 1T08B 5B66C 2MC3A 2UWMA 4ON0A 1WI3A 3FK6A 3ROUA 3OS0A 4M3EA 3WU2C 3U1KA 2KJCA 1HBXG 3S3NA 2M7BA 2QENA 2IA1A 4PFOA 5LRRA 4II2A 4U87A 5FKLA 2HXIA 4EATA 1O3QA 5IT3A 5B1BH 1J75A 2P7CB 1AA7A 1IN7A 3ML6A 3E1SA 1FYKA 4Y13A 5CLSA 2DA3A 2Z1DA 1MMNA 2FBHA 1LVKA 1Y8QB 4ENJA 2JRTA 3HSRA 5EYRA 3OYJA 3KE2A 4XRFA 2XRNA 1FMVA 1MKMA 1BIBA 2F6CA 2DMQA 2L02A 4MO7A 4FX0A 4QWQA 1W5TA 2O6GE 2BW3B 3CJRB 4RGRA 4JP0A 2OBPA 4RAFA 2IAIA 4HYEA 2NRAC 3T8TA 1SD7A 3CO7C 2WWYA 5D6EA 3ULQB 2L54A 1R23A 3WTTC 2QYOA 1KYWA 5KK1A 4N0BA 2ZJPF 3FXKA 2HOAA 1FPQA 1VQ5I 3F3XA 4LG0B 5CVVA 1X1AA 2VC1A 3I5UA 1UZCA 2PMZA 4IL6C 3G2BA 4MEYF 4YEJA 5IT9K 5GPCA 2FMYA 2EILH 3ZQLA 5FLXZ 4A3MJ 5CPRB 3K1MA 1TWCJ 4N4NB 4K2EA 2BY0A 1MZBA 2Q2EA 3M8JA 5DCFA 4NUBA 5AIQA 5EZHA 3DTIA 2BOLA 2YSRA 3J81K 2VC0A 3BCBA 4I7HA 5DD4A 3UR3C 1ONVA 1QNTA 3BY6A 4L9VA 4UVCA 2GOMA 3E6BA 2XAQA 1D1CA 1MBHA 2HWVA 3OIOA 2RQPA 3KZIC 4KIBA 3WG7H 1FMWA 4QTRA 3PQKA 1Z6RA 3ZR8X 3GTMJ 2OTJI 2B0LA 3HM5A 3W6VA 1JHHA 2CSOA 4FETA 2P6SA 4DBQA 3ZN1A 3HIFA 1MBKA 3HB9A 1QU3A 1CF7A 2A07F 1TNSA 3KP7A 2GQQA 5HS7A 1X19A 2LVSA 3S14J 2QQ8A 3KP2A 2ESNA 3RPUA 3TKYA 1V4RA 2RC4A 4HV5A 4I0AA 3V7RA 1PUEE 4XK4A 2W48A 2L4MA 2IP2A 2MLGA 4CSWA 4B48A 3J7AY 2DLLA 3O8HA 3KYCB 1JKPC 3HKZA 3WTWC 4N9HA 3M1EA 1WGXA 3JSPA 1WCMJ 2RAEA 3KP6A 4PFPA 3FKJA 3K4KA 2FRHA 4PGGA 1FP1D 1PP7U 4PJLA 3WTSC 4F93B 4RB3C 3TW7A 3IH3A 3OYFA 1XCBA 2Y0MA 3BG5A 5IY5H 3IV5A 3HOZJ 3E0JB 1U2WA 2F5VA 2CQKA 2EBIA 5EEHA 1HC8A 3OY9A 3P9IA 5J40A 1ZRCA 1V55H 3MCZA 4IQ4A 3CCMI 4HX4A 3BJ6A 4ASNA 2LRDA 1IJWC 1JT0A 3ELKA 3U2RA 3OS1A 2LFBA 2DA5A 4Y17A 3W2VA 3O3KA 1Z6TA 2DA2A 3WE2A 5LRSA 4QPQA 1D1AA 2JT1A 1J59A 3ZMSA 4XKCA 3H9GA 3HHGA 2TDXA 2L7KA 3LFUA 3RDIA 2BVMA 2LLKA 3IKVA 1K79A 2CQ7A 1TBXA 4V2FA 4E70A 5FD5A 1HSJA 2EQRA 2A05A 4HNTA 3L2QA 2ISYA 5FLMJ 3I59A 2FA5A 2E5ZA 4YIFA 3GTQJ 2XPWA 5LBQA 2DA6A 2TRTA 3K4BA 3NWTA 2CRGA 4E7IA 1TT5B 5AONA 1U5TB 2EIMH 5F04A 2WV1A 1OCTC 3PUBA 1QQIA 2L01A 2PN6A 4HDUA 5J8CA 4R79A 1FIAA 2Y69H 2CGPA 4HF2A 2ZCWA 5E1WA 3WHCA 1YTYA 4PSXA 2VE9A 1FIPA 3H3ZA 1M1EB 2ZJRF 4EV0A 3EUHC 3VB2A 3OYBA 2F5DA 1YW8A 3WU0A 3EQLF 2R5ZA 2Z9OA 2LY9A 5E8IA 3MD2A 3DEUA 2M2EA 4IPAA 3M9AA 1YG2A 3M7GA 1IN5A 1K78B 1R6RA 1J0RA 3QYBA 2FOKA 2CS3A 5ICFA 4G6TB 4C9YA 1D8JA 4RM2A 3C2GA 3KPHA 5L3CA 2WB1N 1HKSA 1LKXA 2CO5A 2WTEA 5J3LA 3KETA 4LLNA 3PO3J 3S1RJ 3OOUA 4UVAA 3D0SA 2UXNA 4FASD 1LVAA 2FJ1A 3QODA 1IXSB 2JJ7A 3OOPA 1UG0A 4A5MA 4F91B 2W4SA 2XHKA 1AKHB 1PP8F 3EUAA 4D0PA 1FC3A 2W85A 3IP4B 4XL9A 2OCCH 2X0LA 2DXIA 1MH3A 1MJAA 1YW9A 3CUOA 4F7ZA 5JLXA 3AL0B 2QBYB 1TZLA 4B43A 1MMSA 4E7ZA 5DCMB 1IRFA 4KDPA 3GTJJ 1BC7C 4F92B 1XCVA 2COBA 2RDPA 2QEXI 4ZH4F 3SEZA 4AD9A 1XGSA 5IP9J 2VLAA 3HJEA 3G71I 2NVTJ 4JBAA 4A3JJ 1SFEA 2ZXJA 1BI1A 3ABLH 3L00A 1YI2I 2EWNA 3KYDB 3ZQ7A 2DQLA 3ZCOA 2JA6J 4LITA 3I3LA 2EV0A 4EGZA 1IXRC 3CCRI 1O3RA 2HNHA 2PJPA 4GYGA 2VJ5A 1KGSA 4RB0A 3T5XA 4B3XA 3WE3A 1IAWA 2BBYA 3RYPA 1GT0C 5K5OA 3J7ZI 2IS2A 2FQ3A 4Y33A 1R5HA 4WXHA 5EZGA 3TMOA 3CESA 4KT6A 2VASA 1KZHA 4DYCA 3P5JA 1HA8A 1UCRA 1OCOH 2JSCA 1O4XA 2KMUA 3GVAA 4F3QA 4RLQA 1Z3YA 3BP8A 1Y39A 3J80K 4UB6C 1ZGJA 1Z21A 1ETKA 1YJWI 3H5RA 3A01B 4PCQA 1FOYA 2R7QA 2XIGA 3K0LA 2IJLA 1ZHFA 1Z7LA 1YITI 3WHBA 1J9IA 2QM3A 2K4BA 2CJJA 2YU3A 1FP2A 1U0JA 4DYQA 3K4CA 1J5YA 3F23A 2XKPA 3AKZA 3A02A 1JT6A 1X3ZB 1C0WA 1SVOA 4A3KJ 5LD2C 2F4OB 1ZR4A 1K4TA 4DNCA 4BXUA 2V1UA 1YJ9I 1VQ8I 1MD0A 4WWCA 3PIPF 5F6FA 2ZNZA 1EV7A 1XMAA 3BTCA 3JRFA 1X58A 3E6CC 4HG2A 1R1TA 5F08A 1BI3A 2O03A 4L18B 1GVJA 1WVRA 2COMA 4A0ZA 2OD5A 3F9KA 1K7AA 1NTCA 3VYSB 3ZN0A 4CYCA 2HOTA 1Y0UA 6PAXA 2WAFA 1LE8B 2KRHA 2FQ4A 3I55I 1W0UA 1AWCA 4KN7X 1KQ9A 1E2XA 3GZ6A 3V4GA 1DPUA 1I6XA 3ZOBA 2LDUA 5E8GA 4P9UA 1V3FA 4OIRF 1K6OA 1T0FA 1P92A 3CMMA 4KYWA 4DIQA 3DF8A 5FKMA 1QZYA 3JAMK 2LYCA 2DBBA 1D1BA 1EA3A 5BMZA 2PG4A 3I53A 2W57A 4I02A 3W6JB 1TL8A 2ACJA 1XS9A 2Y0SA 2HR3A 1MH4A 2VBXA 4XLCA 2EV6A 4RA2A 4AYBA 1E0EA 2BHYA 2VONA 1V5EA 4G7ZF 4UUSA 1FT9A 2DA7A 3LSJA 3HOXJ 3CZ6A 4RLFA 2X85A 4FT8A 4EVIA 2ZXHA 2P81A 2PLYA 2CFOA 1SFKA 3HOUJ 1AU7A 1H9TA 4F52A 5KHDA 3TOBA 2LNBA 4CICA 2B63J 5IP7J 3LA2A 1A6QA 3PSFA 3TL4X 2D2WA 1XGOA 3P7NA 3L7WA 4G9YA 5GAGJ 1P2FA 4J01A 2HYJA 4U88A 3L2UA 2LBFA 3OYIA 1ZYRF 3VYRB 4GFBA 1FOXA 5IYDJ 2E1MB 3F8BA 5J4VA 4TV7A 2H94A 1GVDA 1OKRA 3BPVA 4P1WA 1WWXA 2ME6A 1K4SA 4CGZA 2GOXB 4BJ6C 1Q1HA 4ZYHA 5E18F 2QLZA 2Z16A 4HQEA 2VJIA 3FX3A 4HF0A 4M9ZA 3Q0VA 1Y0NA 4LG3A 1XSXA 4WXDA 2W82A 2JA2A
chains in the Genus database with same CATH topology
4P55A 3KEQA 3NRVA 5DUKA 3GFIA 2NNYA 1QBJA 3SZTA 5FD6A 4CZZA 4IHTA 3RIRA 5A2QK 1WRJA 1X3UA 3KEOA 1RUNA 3GWZA 4KA4A 4RS8A 5E1ZB 2M30A 3ERED 3BOQA 1CF7B 1UFMA 1HW2A 2GA2A 3HTUA 3C3WA 1TQIA 4N9IA 1SD5A 5K5QA 4HLXA 2EV5A 2W84A 3TOAA 1G3SA 1RZ4A 4KN4X 1B1BA 3CJNA 4BHBA 2JPBA 3FXQA 2EFQA 3VOEA 1RUOA 3LA7A 1FOKA 3LWFA 3FF5A 3FMQA 4R8HA 3HRMA 2F5EA 5J8FA 2ISZA 2A69F 1P4WA 2FSWA 3CLOA 4RB2C 3C18A 1BOAA 2XAGA 2Y48A 1Z1DA 3HSEA 1D5VA 5CYVA 3TO7A 2OAZA 1XN7A 1JE8A 1GXPA 3FXRA 2DK8A 4LB6B 4ESJA 3WTZA 4EJOA 5K1YA 1EH6A 3I59B 2ZKZA 4IJAA 1REPC 4MTEA 5D8KB 4JK1X 1IRGA 3DFGA 3D5LA 1FWZA 1XSDA 3U1DA 3LAPA 1IN4A 1PDNC 2BE5F 2ZO4A 3MEXA 1ZGAA 2MD5A 4L9JA 4M9SA 3K2ZA 4AIJA 5FFXA 5F64A 2GZWA 4PGHA 4I2OA 3E97A 1CGPA 1HKQA 4WX9A 3HRTA 1KU9A 3FM3A 1LDKB 1G3WA 4U7DA 1JHFA 3HHHA 5IT9Z 3K9TA 4L5IA 3ZMVA 4ZYGA 3SHFA 4EJTA 2BGCA 3BROA 3LSTA 4I09A 2OA4A 3WGGA 5LHGA 2P4WA 2KRFA 4PZJA 4LLGF 3R60A 1T6SA 1UHMA 5L3GA 2M1BA 1U5TC 4ESBA 1IW7F 3KZZA 2H6BA 1G3TA 1SAXA 4XLNF 2EB7A 2P6TA 3RPQA 5LHHA 3H3UA 4KUMA 1T98A 1O7FA 3TDUC 5LEKA 3KP5A 4HX7A 3EUHA 3FZVA 2O61A 4U0YA 3I54A 4GXOA 5HDKA 4ENNA 2HFHA 4IVNA 3GW2A 2HQNA 2XV4S 3CTAA 4OMZA 4O5VA 1E17A 3W6KB 1BN5A 1IN8A 4O6JA 2FF4A 4CO8A 3GYHX 1RIOH 3LFKA 3GZ5A 5JHUA 4Q47A 2NYXA 1IUYA 2L4AA 2DW4A 5EEGA 3G73A 1IZ1A 3HRUA 3GO5A 1BI2A 4MEXF 1BM9A 3F8CA 1HQCA 3BDDA 1WSUA 2R7DA 3F22A 3T1BA 2UXXA 2K86A 4DQ2A 2G7UA 3TO9A 1FSHA 4OIQF 2ADUA 1KYZA 5ERIA 4LK1F 2ZMEA 3ECOA 2FEZA 1SFUA 2W25A 1ZRDA 1B9MA 2PMHA 1BC8C 3HOTA 3F72A 4HQMA 1R58A 3R0AA 1FNNA 2QZ8A 3FWEA 2XASA 3N97A 2ZJ2A 3ZMTA 2G9WA 3ZPLA 3QPHA 4M72A 1STZA 1YQAA 4EJVA 4M74A 2V1XA 2YR2A 4I0BA 3E5UA 5H6QA 2VE8A 2FE3A 2QUFA 3VEPA 1ZLKA 2F5FA 1FSEA 5HS8A 1BBYA 4BYYA 3C1DA 3IWFA 1KU7A 4RB1A 3BJAA 2RN7A 1O3SA 1H0MA 3M8EA 4IF4A 4LB5A 2Y75A 3CO6C 4M9XA 2Z33A 1U3EM 3MZYA 3SFZA 3NQOA 2R7FA 3QU6A 5H20A 3KP4A 1IXCA 3BJOA 5HDGA 3EYIA 1TW2A 2MH9A 1D3YA 1HW5A 2EA4A 5HVQC 2P5KA 4HZFA 1TLHB 4G6QA 4XSXF 1HSTA 2CFXA 2DO7A 2H6CA 1JGSA 5BS6A 2G7HA 4ZYEA 5K5RA 3JW4A 4M6XA 4RGXA 1DUXC 1B9NA 1WI9A 1T39A 3J80Z 2VOOA 4OOIA 3WTXC 5JI6A 2VOPA 2IT0A 1YYVA 3F8MA 1ZG5A 1DPRA 2JTVA 3HTSB 5HLGA 3R6SA 2HDCA 2QWWA 2K7LA 2DAOA 2VN2A 3E6MA 5FGMA 2OU2A 2E1NA 2P8TA 3FMSA 2DFIA 3F21A 3F8FA 5D5XB 1LNWA 3JAMZ 4NB5A 5LGNA 1XDUA 4H0EA 2Z99A 3WODF 2IRFG 3FHZA 3MAJA 4S04A 2KIFA 1S6LA 2P5LC 4KICA 2Q0OA 1VTNC 4AIKA 3MZHA 3LQRA 3ECHA 1W7PA 1F5TA 1SMTA 4XBFA 4YFXF 1FYMA 1O7LA 3I58A 4ZYDA 3V8JA 4Q4ZF 2V1DA 2CW0F 4BH9A 3COAC 3CUQC 3S2WA 1LEBA 4A6DA 5D6FA 3IC7A 3SQNA 1ZRFA 5TRDA 2HQRA 3GFJA 5ED4A 5D5UB 4P9FA 5LLQA 5A2QZ 3I64A 2XROA 4IHSA 3G3ZA 4ENMA 1UHWA 2FXAA 3JTGA 4UVBA 4CXFA 1F4KA 2J5PA 2YPRA 1XMKA 1ON2A 1OYIA 1F9NA 2HTSA 3IRRA 3MQ0A 3IL2A 4B09A 2NS0A 2X4HA 3WTVC 3P9CA 2R3SA 3RJPA 4HBLA 4UV8A 4EM1A 1YS7A 4OINF 5E20A 5ICCA 3DQVC 2AXLA 3ABUA 1SD6A 2GWRA 1LQ1A 4LJZF 3K1PA 3REOA 3ZMUA 2LF7A 4JQFA 2RKHA 1NHAA 2V6CA 2IPQX 1W5SA 2DTRA 3RTRA 4BAYA 2Z5UA 1LDJA 1U78A 2FMLA 2Q8KA 2HOEA 1DDNA 1J2XA 3QP5A 2ELHA 2K4JA 2DU9A 3Q9SA 4EQQA 2K27A 3KCCA 1ZREA 3WTUC 1GXQA 1O3TA 4MHGA 2ZMEB 3DXJF 1FZPB 2KIMA 1R00A 1FBQA 4IXAA 2J5OA 1ZG3A 3FXUA 5AIPA 1K78A 4WCGA 4QLCU 4A5NA 2FNPA 3EYYA 3F6VA 4U7BA 1T38A 2XGXA 4Z2YA 2GIVA 1FX7A 3U9GA 2RNJA 1OPCA 5HS9A 2HTJA 1OR7A 4R1HA 5LEJA 1TNTA 4P96A 3E5QA 4OU0A 4KIFA 1ZG1A 5HDNA 2L3DA 4RGUA 3B73A 5DCMA 1MGTA 5D4RA 4LFUA 2V9VA 1QZZA 2O0YA 3N4MA 4WF2A 2CYYA 1S7AA 4IRIA 1YO5C 1ZAOA 4WXCA 2WV0A 2DQRA 2HYFA 4FX4A 3MFKA 4YFKF 1I27A 4PDKA 3BWGA 2CG4A 3B02A 2KKOA 5E17F 5E1XA 3T8RA 1KA8A 4MTDA 4IRHA 1OYYA 5F1RA 1QPMA 2Z3YA 2MBFA 3R4KA 2IA0A 4A6EA 3V7SA 1USTA 3ZP5A 1TW3A 2IVMA 2PMUA 3GEZA 2V79A 4ZZDA 3F6OA 3I0TA 5LGTA 2A5YB 4MQVA 4M73A 1LJ9A 2NNNA 1XSVA 3JTHA 4EJUA 5ILUA 1YS6A 3PQJA 5CVIA 1EH7A 2JZYA 2RGVA 2FBIA 3FM5A 4LLLA 3ISPA 3V8KA 1YFHA 4UXNA 2M5WA 2ZBKA 5CVUA 2FNAA 3QP6A 5BPDA 2GAUA 1TQPA 3EETA 5L3DA 5DV5A 4MNUA 1W7PB 4BHPA 1YIOA 3I71A 4A0YA 4EM0B 1ZARA 2EK5A 3LAJA 2PFBA 1QGPA 2XAHA 3QRFF 4WK8F 2A6EF 4AIHA 1S8NA 4GO1A 1R36A 5FFZA 1W4MA 4P5OA 2PBIA 2YX4A 5FB2A 2DPUA 1ZH5A 2RV8A 1KU3A 1XDSA 3EDPA 2JPCA 2EFWA 5D5VB 2DK5A 3DP7A 1U8RA 4BNCA 3IHUA 3RKXA 2GA1A 2VT2A 3Q5FA 2PEXA 5JVTA 1MDMA 3E6DA 1XB4A 2XKOA 2VT3A 2VBWA 4A2UA 1G6NA 2E7WA 3L09A 3GXOA 2A61A 3R0JA 1FYLA 3OV8A 3ZMZA 3RKWA 2RVCA 2GXBA 3F8NA 2EJRA 3GF2A 4GCVA 2VODA 4HX8A 5CVJA 4A12A 3TDZC 2VXZA 4ZZLA 3T0YA 4L5JA 4NHJA 2HKOA 1I1GA 5D5WB 2F5CA 2C6YA 3TGNA 4KIGA 2OZUA 5LHIA 4KNYA 2OQRA 4Q48A 4G6DA 1T2KA 5FLXK 4B8XA 5LGUA 3CUQA 1H9GA 4EGYA 4AWXB 1Z05A 4OMYA 1RNLA 1U6GA 2DI3A 2OQGA 2HYGD 3BPXA 1SFXA 5JFRA 2QQAA 2STWA 4Y15A 5ICGA 1KU2A 2XAJA 4RAYA 4MGRA 3KFWX 1XD7A 4UHTA 4LD5A 1G3YA 3KLNA 3C7JA 4XLPF 4G7HF 5D4SA 3VFZA 4GYIA 2P5VA 3M8FA 2H09A 2BYVE 2EA2A 2DPDA 1D8KA 3NEUA 5ILSA 2CWEA 4I01A 5DYMA 3HOSA 5TJJA 1L0OC 3HYIA 3GUDA 3HUGA 1IN6A 2MH2A 2IW5A 1I1SA 2E7XA 1XGMA 3GFLA 4BHCA 5L3FA 1B6AA 3Q9VA 4O3MA 2LSOA 2XVCA 1LDDA 2M87A 1IF1A 2GXGA 4G94A 4KMUX 3KP3A 1EH8A 1OMIA 1J7KA 1YW7A 1HW1A 1S7OA 1F1ZA 4YIIA 1LB2A 3IKTA 1QO0D 4OIOF 2ESHA 2XAFA 4MQ9F 4G8XA 1LEAA 4YG2F 3JSOA 4M6YA 3LQQA 2LF8A 2ZFWA 2MA3A 3CDHA 3K1NA 1FBUA 4AVPA 3KLOA 5D8LB 1W7PD 4S05A 2QVOA 4LG0A 3IWZA 3QAHA 3K69A 5H6RA 5DUIA 5HLIA 5HOOA 4YFNF 2QQ9A 1L3LA 1Z91A 4HOBA 4ESFA 1TTYA 2KIUA 3DPTA 3DKWA 2LKPA 1Z7UA 1ODDA 1BJAA 3QU3A 5ILVA 3SXYA 3WU1B 1ULYA 4G7OF 3RYRA 2MLKA 1BI0A 5DD8A 3VODA 5KVRA 2ETHA 3RKYA 5CVRA 1S3JA 1GHCA 5L3BA 4RGSA 2XUBA 3LA3A 4EJWA 2UZKA 4OIPF 1HXDA 3RI4A 2EFPA 2M8EA 2D1VA 4UUVA 5JR3A 2PI0A 1R1VA 5L3EA 3GLXA 4UV9A 5CJ9A 2HS5A 4CDGA 3PFIA 3E5XA 1JXSA 4LK0F 3P9KA 2EFNA 1P4AA 4EM2A 2F2EA 3O6BB 3WG9A 1MJBA 2PQ8A 3IRQA 4EMSA 1P4XA 4L9NA 1UB9A 3TO6A 2E1CA 5BQTA 2HKXA 2NAZA 4HA8A 2O8XA 2STTA 4NQWA 2H27A 3ZMDA 2A68F 1ON1A 4L9TA 1MJ9A 1U5TA 3GX4X 4CYDA 4BQAA 3HRSA 3FMRA 4U0VA 2AS5F 1MDMB 5DDGA 2BV6A 4LMYA 1OYWA 3ABTA 3I4PA 1R5GA 4U0WA 1SD4A 2VBYA 3AAFA 3R61A 3H92A 4HW0A 3L9FA 4HAMA 3DV8A 1G4DA 4KT5C 1B4AA 1FLIA 1ZN2A 2A6HF 5BOXA 1RI7A 1KQ8A 5HLHA 4KFCA 3V7CA 2M45A 4L0ZB 2D45A 1A04A 2VBZA 4ETSA 2HGCA 4Q5SF 2HZTA 2IA2A 4UNOA 1ZLJA 3L2CA 1Z9CA 2W24A 4KMFA 3KZYA 3WGIA 1YLFA 3HSFA 3QOPA 1BIAA 2QBYA 2QQBA 4HLYA 3O2PE 4A0XA 3CUQB 4GGGA 2YX7A 4ENKA 5ICEA 2HEOA 3TQNA 2P7VB 2O3FA 2BEOA 3WTYC 1AOYA 2OZ6A 1P6RA 1O57A 2D1HA 5FO5A 1KQ0A 2DT5A 3QPTA 5J6XA 1R1UA 4HDVA 2WC2A 4HV6A 3SZPA 1DP7P 1R7JA 2K02A 1FBSA 3V8LA 3WGHA 1SMYF 1HKTA 4XSZF 3BZ6A 1S29A 1WKMA 4L0YB 4RAZA 1WQ2A 4FHTA 3GFMA 2KJBA 1USSA 5DEQA 2FU4A 4IRGA 4CHUA 5BPIA 3J7AO 2ZNYA 3E3VA 2EFOA 1TQMA 4HF1A 3MWMA 4I98B 4M71A 3DPLC 2FBKA 1XGNA 1R22A 2A3SA 1FY7A 1I5ZA 4LGWA 3J81Z 1B59A 2MC3A 2UWMA 4ON0A 3ROUA 2KJCA 1HBXG 2QENA 2IA1A 5LRRA 1O3QA 5IT3A 1J75A 2P7CB 1IN7A 3ML6A 1FYKA 4Y13A 5CLSA 2FBHA 4ENJA 2JRTA 3HSRA 3KE2A 4XRFA 2XRNA 1MKMA 1BIBA 2L02A 4FX0A 4QWQA 1W5TA 2O6GE 4RGRA 2OBPA 4HYEA 2NRAC 3T8TA 1SD7A 3CO7C 2WWYA 5D6EA 3ULQB 2L54A 1R23A 3WTTC 2QYOA 1KYWA 5KK1A 4N0BA 1FPQA 3F3XA 4LG0B 5CVVA 2VC1A 3I5UA 4MEYF 5IT9K 2FMYA 5FLXZ 3K1MA 4K2EA 1MZBA 2Q2EA 5DCFA 5AIQA 2YSRA 3J81K 2VC0A 4I7HA 5DD4A 1ONVA 1QNTA 3BY6A 4L9VA 4UVCA 3E6BA 2XAQA 2HWVA 2RQPA 4KIBA 3PQKA 1Z6RA 2B0LA 1JHHA 2CSOA 2P6SA 3ZN1A 3HIFA 1CF7A 2A07F 1TNSA 3KP7A 2GQQA 5HS7A 3KP2A 2ESNA 3RPUA 3TKYA 1V4RA 2RC4A 4HV5A 4I0AA 3V7RA 1PUEE 2L4MA 2IP2A 2MLGA 2DLLA 3WTWC 4N9HA 3M1EA 3JSPA 3KP6A 2FRHA 4PGGA 1FP1D 1PP7U 3WTSC 4RB3C 1XCBA 2Y0MA 1U2WA 2CQKA 5EEHA 1ZRCA 3P9IA 3MCZA 4HX4A 3BJ6A 4ASNA 3ELKA 3U2RA 4Y17A 3O3KA 1Z6TA 3WE2A 5LRSA 2JT1A 1J59A 3ZMSA 3HHGA 2TDXA 3RDIA 3IKVA 1K79A 1TBXA 4E70A 5FD5A 1HSJA 2ISYA 3I59A 2FA5A 4YIFA 5LBQA 5AONA 1U5TB 1QQIA 2L01A 4HDUA 2PN6A 5J8CA 4R79A 2CGPA 4HF2A 2ZCWA 5E1WA 1YTYA 2VE9A 3H3ZA 4EV0A 3VB2A 2F5DA 1YW8A 3WU0A 3EQLF 2Z9OA 5E8IA 3DEUA 4IPAA 3M9AA 1YG2A 3M7GA 1IN5A 1K78B 1J0RA 2FOKA 5ICFA 1D8JA 5L3CA 1HKSA 2CO5A 2WTEA 3KETA 4LLNA 4UVAA 3D0SA 2UXNA 1LVAA 1IXSB 3OOPA 4A5MA 2XHKA 1PP8F 4D0PA 1FC3A 2W85A 2X0LA 1MJAA 1YW9A 3CUOA 4F7ZA 2QBYB 5DCMB 1IRFA 4KDPA 1BC7C 1XCVA 2RDPA 4ZH4F 4AD9A 1XGSA 4JBAA 1SFEA 2ZXJA 1BI1A 3L00A 2EWNA 3ZQ7A 2DQLA 2EV0A 4EGZA 1IXRC 1O3RA 2PJPA 4GYGA 1KGSA 4RB0A 3T5XA 1IAWA 3WE3A 2BBYA 3RYPA 5K5OA 2FQ3A 1R5HA 4WXHA 1UCRA 2JSCA 3GVAA 3BP8A 3J80K 1ZGJA 4PCQA 2XIGA 3K0LA 2IJLA 1ZHFA 1J9IA 2QM3A 2K4BA 2YU3A 1FP2A 1J5YA 3F23A 2XKPA 1C0WA 4DNCA 4BXUA 2V1UA 1MD0A 4WWCA 5F6FA 2ZNZA 1EV7A 1XMAA 3E6CC 1R1TA 1BI3A 2O03A 4L18B 1GVJA 2COMA 4A0ZA 2OD5A 1K7AA 3ZN0A 1Y0UA 6PAXA 1AWCA 4KN7X 1KQ9A 3GZ6A 1E2XA 3V4GA 1DPUA 1I6XA 2LDUA 5E8GA 4P9UA 1V3FA 4OIRF 1K6OA 1T0FA 1P92A 4KYWA 3DF8A 1QZYA 3JAMK 2DBBA 5BMZA 2PG4A 3I53A 2W57A 4I02A 3W6JB 2ACJA 2HR3A 2VBXA 2EV6A 2VONA 4G7ZF 1FT9A 4FT8A 4EVIA 2PLYA 1H9TA 3TOBA 2LNBA 4CICA 3LA2A 2D2WA 1XGOA 3P7NA 3L7WA 4G9YA 1P2FA 4U88A 1ZYRF 3F8BA 4TV7A 2H94A 1OKRA 3BPVA 1WWXA 4CGZA 1Q1HA 4ZYHA 5E18F 2QLZA 4HQEA 3FX3A 4HF0A 4M9ZA 1XSXA 4WXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P55 A;  3KEQ A;  3NRV A;  5DUK A;  3GFI A;  2NNY A;  1QBJ A;  3SZT A;  5FD6 A;  4CZZ A;  4IHT A;  3RIR A;  5A2Q K;  1WRJ A;  1X3U A;  3KEO A;  1RUN A;  3GWZ A;  4KA4 A;  4RS8 A;  5E1Z B;  2M30 A;  3ERE D;  3BOQ A;  1CF7 B;  1UFM A;  1HW2 A;  2GA2 A;  3HTU A;  3C3W A;  1TQI A;  4N9I A;  1SD5 A;  5K5Q A;  4HLX A;  2EV5 A;  2W84 A;  3TOA A;  1G3S A;  1RZ4 A;  4KN4 X;  1B1B A;  3CJN A;  4BHB A;  2JPB A;  3FXQ A;  2EFQ A;  3VOE A;  1RUO A;  3LA7 A;  1FOK A;  3LWF A;  3FF5 A;  3FMQ A;  4R8H A;  3HRM A;  2F5E A;  5J8F A;  2ISZ A;  2A69 F;  1P4W A;  2FSW A;  3CLO A;  4RB2 C;  3C18 A;  1BOA A;  2XAG A;  2Y48 A;  1Z1D A;  3HSE A;  1D5V A;  5CYV A;  3TO7 A;  2OAZ A;  1XN7 A;  1JE8 A;  1GXP A;  3FXR A;  2DK8 A;  4LB6 B;  4ESJ A;  3WTZ A;  4EJO A;  5K1Y A;  1EH6 A;  3I59 B;  2ZKZ A;  4IJA A;  1REP C;  4MTE A;  5D8K B;  4JK1 X;  1IRG A;  3DFG A;  3D5L A;  1FWZ A;  1XSD A;  3U1D A;  3LAP A;  1IN4 A;  1PDN C;  2BE5 F;  2ZO4 A;  3MEX A;  1ZGA A;  2MD5 A;  4L9J A;  4M9S A;  3K2Z A;  4AIJ A;  5FFX A;  5F64 A;  2GZW A;  4PGH A;  4I2O A;  3E97 A;  1CGP A;  1HKQ A;  4WX9 A;  3HRT A;  1KU9 A;  3FM3 A;  1LDK B;  1G3W A;  4U7D A;  1JHF A;  3HHH A;  5IT9 Z;  3K9T A;  4L5I A;  3ZMV A;  4ZYG A;  3SHF A;  4EJT A;  2BGC A;  3BRO A;  3LST A;  4I09 A;  2OA4 A;  3WGG A;  5LHG A;  2P4W A;  2KRF A;  4PZJ A;  4LLG F;  3R60 A;  1T6S A;  1UHM A;  5L3G A;  2M1B A;  1U5T C;  4ESB A;  1IW7 F;  3KZZ A;  2H6B A;  1G3T A;  1SAX A;  4XLN F;  2EB7 A;  2P6T A;  3RPQ A;  5LHH A;  3H3U A;  4KUM A;  1T98 A;  1O7F A;  3TDU C;  5LEK A;  3KP5 A;  4HX7 A;  3EUH A;  3FZV A;  2O61 A;  4U0Y A;  3I54 A;  4GXO A;  5HDK A;  4ENN A;  2HFH A;  4IVN A;  3GW2 A;  2HQN A;  2XV4 S;  3CTA A;  4OMZ A;  4O5V A;  1E17 A;  3W6K B;  1BN5 A;  1IN8 A;  4O6J A;  2FF4 A;  4CO8 A;  3GYH X;  1RIO H;  3LFK A;  3GZ5 A;  5JHU A;  4Q47 A;  2NYX A;  1IUY A;  2L4A A;  2DW4 A;  5EEG A;  3G73 A;  1IZ1 A;  3HRU A;  3GO5 A;  1BI2 A;  4MEX F;  1BM9 A;  3F8C A;  1HQC A;  3BDD A;  1WSU A;  2R7D A;  3F22 A;  3T1B A;  2UXX A;  2K86 A;  4DQ2 A;  2G7U A;  3TO9 A;  1FSH A;  4OIQ F;  2ADU A;  1KYZ A;  5ERI A;  4LK1 F;  2ZME A;  3ECO A;  2FEZ A;  1SFU A;  2W25 A;  1ZRD A;  1B9M A;  2PMH A;  1BC8 C;  3HOT A;  3F72 A;  4HQM A;  1R58 A;  3R0A A;  1FNN A;  2QZ8 A;  3FWE A;  2XAS A;  3N97 A;  2ZJ2 A;  3ZMT A;  2G9W A;  3ZPL A;  3QPH A;  4M72 A;  1STZ A;  1YQA A;  4EJV A;  4M74 A;  2V1X A;  2YR2 A;  4I0B A;  3E5U A;  5H6Q A;  2VE8 A;  2FE3 A;  2QUF A;  3VEP A;  1ZLK A;  2F5F A;  1FSE A;  5HS8 A;  1BBY A;  4BYY A;  3C1D A;  3IWF A;  1KU7 A;  4RB1 A;  3BJA A;  2RN7 A;  1O3S A;  1H0M A;  3M8E A;  4IF4 A;  4LB5 A;  2Y75 A;  3CO6 C;  4M9X A;  2Z33 A;  1U3E M;  3MZY A;  3SFZ A;  3NQO A;  2R7F A;  3QU6 A;  5H20 A;  3KP4 A;  1IXC A;  3BJO A;  5HDG A;  3EYI A;  1TW2 A;  2MH9 A;  1D3Y A;  1HW5 A;  2EA4 A;  5HVQ C;  2P5K A;  4HZF A;  1TLH B;  4G6Q A;  4XSX F;  1HST A;  2CFX A;  2DO7 A;  2H6C A;  1JGS A;  5BS6 A;  2G7H A;  4ZYE A;  5K5R A;  3JW4 A;  4M6X A;  4RGX A;  1DUX C;  1B9N A;  1WI9 A;  1T39 A;  3J80 Z;  2VOO A;  4OOI A;  3WTX C;  5JI6 A;  2VOP A;  2IT0 A;  1YYV A;  3F8M A;  1ZG5 A;  1DPR A;  2JTV A;  3HTS B;  5HLG A;  3R6S A;  2HDC A;  2QWW A;  2K7L A;  2DAO A;  2VN2 A;  3E6M A;  5FGM A;  2OU2 A;  2E1N A;  2P8T A;  3FMS A;  2DFI A;  3F21 A;  3F8F A;  5D5X B;  1LNW A;  3JAM Z;  4NB5 A;  5LGN A;  1XDU A;  4H0E A;  2Z99 A;  3WOD F;  2IRF G;  3FHZ A;  3MAJ A;  4S04 A;  2KIF A;  1S6L A;  2P5L C;  4KIC A;  2Q0O A;  1VTN C;  4AIK A;  3MZH A;  3LQR A;  3ECH A;  1W7P A;  1F5T A;  1SMT A;  4XBF A;  4YFX F;  1FYM A;  1O7L A;  3I58 A;  4ZYD A;  3V8J A;  4Q4Z F;  2V1D A;  2CW0 F;  4BH9 A;  3COA C;  3CUQ C;  3S2W A;  1LEB A;  4A6D A;  5D6F A;  3IC7 A;  3SQN A;  1ZRF A;  5TRD A;  2HQR A;  3GFJ A;  5ED4 A;  5D5U B;  4P9F A;  5LLQ A;  5A2Q Z;  3I64 A;  2XRO A;  4IHS A;  3G3Z A;  4ENM A;  1UHW A;  2FXA A;  3JTG A;  4UVB A;  4CXF A;  1F4K A;  2J5P A;  2YPR A;  1XMK A;  1ON2 A;  1OYI A;  1F9N A;  2HTS A;  3IRR A;  3MQ0 A;  3IL2 A;  4B09 A;  2NS0 A;  2X4H A;  3WTV C;  3P9C A;  2R3S A;  3RJP A;  4HBL A;  4UV8 A;  4EM1 A;  1YS7 A;  4OIN F;  5E20 A;  5ICC A;  3DQV C;  2AXL A;  3ABU A;  1SD6 A;  2GWR A;  1LQ1 A;  4LJZ F;  3K1P A;  3REO A;  3ZMU A;  2LF7 A;  4JQF A;  2RKH A;  1NHA A;  2V6C A;  2IPQ X;  1W5S A;  2DTR A;  3RTR A;  4BAY A;  2Z5U A;  1LDJ A;  1U78 A;  2FML A;  2Q8K A;  2HOE A;  1DDN A;  1J2X A;  3QP5 A;  2ELH A;  2K4J A;  2DU9 A;  3Q9S A;  4EQQ A;  2K27 A;  3KCC A;  1ZRE A;  3WTU C;  1GXQ A;  1O3T A;  4MHG A;  2ZME B;  3DXJ F;  1FZP B;  2KIM A;  1R00 A;  1FBQ A;  4IXA A;  2J5O A;  1ZG3 A;  3FXU A;  5AIP A;  1K78 A;  4WCG A;  4QLC U;  4A5N A;  2FNP A;  3EYY A;  3F6V A;  4U7B A;  1T38 A;  2XGX A;  4Z2Y A;  2GIV A;  1FX7 A;  3U9G A;  2RNJ A;  1OPC A;  5HS9 A;  2HTJ A;  1OR7 A;  4R1H A;  5LEJ A;  1TNT A;  4P96 A;  3E5Q A;  4OU0 A;  4KIF A;  1ZG1 A;  5HDN A;  2L3D A;  4RGU A;  3B73 A;  5DCM A;  1MGT A;  5D4R A;  4LFU A;  2V9V A;  1QZZ A;  2O0Y A;  3N4M A;  4WF2 A;  2CYY A;  1S7A A;  4IRI A;  1YO5 C;  1ZAO A;  4WXC A;  2WV0 A;  2DQR A;  2HYF A;  4FX4 A;  3MFK A;  4YFK F;  1I27 A;  4PDK A;  3BWG A;  2CG4 A;  3B02 A;  2KKO A;  5E17 F;  5E1X A;  3T8R A;  1KA8 A;  4MTD A;  4IRH A;  1OYY A;  5F1R A;  1QPM A;  2Z3Y A;  2MBF A;  3R4K A;  2IA0 A;  4A6E A;  3V7S A;  1UST A;  3ZP5 A;  1TW3 A;  2IVM A;  2PMU A;  3GEZ A;  2V79 A;  4ZZD A;  3F6O A;  3I0T A;  5LGT A;  2A5Y B;  4MQV A;  4M73 A;  1LJ9 A;  2NNN A;  1XSV A;  3JTH A;  4EJU A;  5ILU A;  1YS6 A;  3PQJ A;  5CVI A;  1EH7 A;  2JZY A;  2RGV A;  2FBI A;  3FM5 A;  4LLL A;  3ISP A;  3V8K A;  1YFH A;  4UXN A;  2M5W A;  2ZBK A;  5CVU A;  2FNA A;  3QP6 A;  5BPD A;  2GAU A;  1TQP A;  3EET A;  5L3D A;  5DV5 A;  4MNU A;  1W7P B;  4BHP A;  1YIO A;  3I71 A;  4A0Y A;  4EM0 B;  1ZAR A;  2EK5 A;  3LAJ A;  2PFB A;  1QGP A;  2XAH A;  3QRF F;  4WK8 F;  2A6E F;  4AIH A;  1S8N A;  4GO1 A;  1R36 A;  5FFZ A;  1W4M A;  4P5O A;  2PBI A;  2YX4 A;  5FB2 A;  2DPU A;  1ZH5 A;  2RV8 A;  1KU3 A;  1XDS A;  3EDP A;  2JPC A;  2EFW A;  5D5V B;  2DK5 A;  3DP7 A;  1U8R A;  4BNC A;  3IHU A;  3RKX A;  2GA1 A;  2VT2 A;  3Q5F A;  2PEX A;  5JVT A;  1MDM A;  3E6D A;  1XB4 A;  2XKO A;  2VT3 A;  2VBW A;  4A2U A;  1G6N A;  2E7W A;  3L09 A;  3GXO A;  2A61 A;  3R0J A;  1FYL A;  3OV8 A;  3ZMZ A;  3RKW A;  2RVC A;  2GXB A;  3F8N A;  2EJR A;  3GF2 A;  4GCV A;  2VOD A;  4HX8 A;  5CVJ A;  4A12 A;  3TDZ C;  2VXZ A;  4ZZL A;  3T0Y A;  4L5J A;  4NHJ A;  2HKO A;  1I1G A;  5D5W B;  2F5C A;  2C6Y A;  3TGN A;  4KIG A;  2OZU A;  5LHI A;  4KNY A;  2OQR A;  4Q48 A;  4G6D A;  1T2K A;  5FLX K;  4B8X A;  5LGU A;  3CUQ A;  1H9G A;  4EGY A;  4AWX B;  1Z05 A;  4OMY A;  1RNL A;  1U6G A;  2DI3 A;  2OQG A;  2HYG D;  3BPX A;  1SFX A;  5JFR A;  2QQA A;  2STW A;  4Y15 A;  5ICG A;  1KU2 A;  2XAJ A;  4RAY A;  4MGR A;  3KFW X;  1XD7 A;  4UHT A;  4LD5 A;  1G3Y A;  3KLN A;  3C7J A;  4XLP F;  4G7H F;  5D4S A;  3VFZ A;  4GYI A;  2P5V A;  3M8F A;  2H09 A;  2BYV E;  2EA2 A;  2DPD A;  1D8K A;  3NEU A;  5ILS A;  2CWE A;  4I01 A;  5DYM A;  3HOS A;  5TJJ A;  1L0O C;  3HYI A;  3GUD A;  3HUG A;  1IN6 A;  2MH2 A;  2IW5 A;  1I1S A;  2E7X A;  1XGM A;  3GFL A;  4BHC A;  5L3F A;  1B6A A;  3Q9V A;  4O3M A;  2LSO A;  2XVC A;  1LDD A;  2M87 A;  1IF1 A;  2GXG A;  4G94 A;  4KMU X;  3KP3 A;  1EH8 A;  1OMI A;  1J7K A;  1YW7 A;  1HW1 A;  1S7O A;  1F1Z A;  4YII A;  1LB2 A;  3IKT A;  1QO0 D;  4OIO F;  2ESH A;  2XAF A;  4MQ9 F;  4G8X A;  1LEA A;  4YG2 F;  3JSO A;  4M6Y A;  3LQQ A;  2LF8 A;  2ZFW A;  2MA3 A;  3CDH A;  3K1N A;  1FBU A;  4AVP A;  3KLO A;  5D8L B;  1W7P D;  4S05 A;  2QVO A;  4LG0 A;  3IWZ A;  3QAH A;  3K69 A;  5H6R A;  5DUI A;  5HLI A;  5HOO A;  4YFN F;  2QQ9 A;  1L3L A;  1Z91 A;  4HOB A;  4ESF A;  1TTY A;  2KIU A;  3DPT A;  3DKW A;  2LKP A;  1Z7U A;  1ODD A;  1BJA A;  3QU3 A;  5ILV A;  3SXY A;  3WU1 B;  1ULY A;  4G7O F;  3RYR A;  2MLK A;  1BI0 A;  5DD8 A;  3VOD A;  5KVR A;  2ETH A;  3RKY A;  5CVR A;  1S3J A;  1GHC A;  5L3B A;  4RGS A;  2XUB A;  3LA3 A;  4EJW A;  2UZK A;  4OIP F;  1HXD A;  3RI4 A;  2EFP A;  2M8E A;  2D1V A;  4UUV A;  5JR3 A;  2PI0 A;  1R1V A;  5L3E A;  3GLX A;  4UV9 A;  5CJ9 A;  2HS5 A;  4CDG A;  3PFI A;  3E5X A;  1JXS A;  4LK0 F;  3P9K A;  2EFN A;  1P4A A;  4EM2 A;  2F2E A;  3O6B B;  3WG9 A;  1MJB A;  2PQ8 A;  3IRQ A;  4EMS A;  1P4X A;  4L9N A;  1UB9 A;  3TO6 A;  2E1C A;  5BQT A;  2HKX A;  2NAZ A;  4HA8 A;  2O8X A;  2STT A;  4NQW A;  2H27 A;  3ZMD A;  2A68 F;  1ON1 A;  4L9T A;  1MJ9 A;  1U5T A;  3GX4 X;  4CYD A;  4BQA A;  3HRS A;  3FMR A;  4U0V A;  2AS5 F;  1MDM B;  5DDG A;  2BV6 A;  4LMY A;  1OYW A;  3ABT A;  3I4P A;  1R5G A;  4U0W A;  1SD4 A;  2VBY A;  3AAF A;  3R61 A;  3H92 A;  4HW0 A;  3L9F A;  4HAM A;  3DV8 A;  1G4D A;  4KT5 C;  1B4A A;  1FLI A;  1ZN2 A;  2A6H F;  5BOX A;  1RI7 A;  1KQ8 A;  5HLH A;  4KFC A;  3V7C A;  2M45 A;  4L0Z B;  2D45 A;  1A04 A;  2VBZ A;  4ETS A;  2HGC A;  4Q5S F;  2HZT A;  2IA2 A;  4UNO A;  1ZLJ A;  3L2C A;  1Z9C A;  2W24 A;  4KMF A;  3KZY A;  3WGI A;  1YLF A;  3HSF A;  3QOP A;  1BIA A;  2QBY A;  2QQB A;  4HLY A;  3O2P E;  4A0X A;  3CUQ B;  4GGG A;  2YX7 A;  4ENK A;  5ICE A;  2HEO A;  3TQN A;  2P7V B;  2O3F A;  2BEO A;  3WTY C;  1AOY A;  2OZ6 A;  1P6R A;  1O57 A;  2D1H A;  5FO5 A;  1KQ0 A;  2DT5 A;  3QPT A;  5J6X A;  1R1U A;  4HDV A;  2WC2 A;  4HV6 A;  3SZP A;  1DP7 P;  1R7J A;  2K02 A;  1FBS A;  3V8L A;  3WGH A;  1SMY F;  1HKT A;  4XSZ F;  3BZ6 A;  1S29 A;  1WKM A;  4L0Y B;  4RAZ A;  1WQ2 A;  4FHT A;  3GFM A;  2KJB A;  1USS A;  5DEQ A;  2FU4 A;  4IRG A;  4CHU A;  5BPI A;  3J7A O;  2ZNY A;  3E3V A;  2EFO A;  1TQM A;  4HF1 A;  3MWM A;  4I98 B;  4M71 A;  3DPL C;  2FBK A;  1XGN A;  1R22 A;  2A3S A;  1FY7 A;  1I5Z A;  4LGW A;  3J81 Z;  1B59 A;  2MC3 A;  2UWM A;  4ON0 A;  3ROU A;  2KJC A;  1HBX G;  2QEN A;  2IA1 A;  5LRR A;  1O3Q A;  5IT3 A;  1J75 A;  2P7C B;  1IN7 A;  3ML6 A;  1FYK A;  4Y13 A;  5CLS A;  2FBH A;  4ENJ A;  2JRT A;  3HSR A;  3KE2 A;  4XRF A;  2XRN A;  1MKM A;  1BIB A;  2L02 A;  4FX0 A;  4QWQ A;  1W5T A;  2O6G E;  4RGR A;  2OBP A;  4HYE A;  2NRA C;  3T8T A;  1SD7 A;  3CO7 C;  2WWY A;  5D6E A;  3ULQ B;  2L54 A;  1R23 A;  3WTT C;  2QYO A;  1KYW A;  5KK1 A;  4N0B A;  1FPQ A;  3F3X A;  4LG0 B;  5CVV A;  2VC1 A;  3I5U A;  4MEY F;  5IT9 K;  2FMY A;  5FLX Z;  3K1M A;  4K2E A;  1MZB A;  2Q2E A;  5DCF A;  5AIQ A;  2YSR A;  3J81 K;  2VC0 A;  4I7H A;  5DD4 A;  1ONV A;  1QNT A;  3BY6 A;  4L9V A;  4UVC A;  3E6B A;  2XAQ A;  2HWV A;  2RQP A;  4KIB A;  3PQK A;  1Z6R A;  2B0L A;  1JHH A;  2CSO A;  2P6S A;  3ZN1 A;  3HIF A;  1CF7 A;  2A07 F;  1TNS A;  3KP7 A;  2GQQ A;  5HS7 A;  3KP2 A;  2ESN A;  3RPU A;  3TKY A;  1V4R A;  2RC4 A;  4HV5 A;  4I0A A;  3V7R A;  1PUE E;  2L4M A;  2IP2 A;  2MLG A;  2DLL A;  3WTW C;  4N9H A;  3M1E A;  3JSP A;  3KP6 A;  2FRH A;  4PGG A;  1FP1 D;  1PP7 U;  3WTS C;  4RB3 C;  1XCB A;  2Y0M A;  1U2W A;  2CQK A;  5EEH A;  1ZRC A;  3P9I A;  3MCZ A;  4HX4 A;  3BJ6 A;  4ASN A;  3ELK A;  3U2R A;  4Y17 A;  3O3K A;  1Z6T A;  3WE2 A;  5LRS A;  2JT1 A;  1J59 A;  3ZMS A;  3HHG A;  2TDX A;  3RDI A;  3IKV A;  1K79 A;  1TBX A;  4E70 A;  5FD5 A;  1HSJ A;  2ISY A;  3I59 A;  2FA5 A;  4YIF A;  5LBQ A;  5AON A;  1U5T B;  1QQI A;  2L01 A;  4HDU A;  2PN6 A;  5J8C A;  4R79 A;  2CGP A;  4HF2 A;  2ZCW A;  5E1W A;  1YTY A;  2VE9 A;  3H3Z A;  4EV0 A;  3VB2 A;  2F5D A;  1YW8 A;  3WU0 A;  3EQL F;  2Z9O A;  5E8I A;  3DEU A;  4IPA A;  3M9A A;  1YG2 A;  3M7G A;  1IN5 A;  1K78 B;  1J0R A;  2FOK A;  5ICF A;  1D8J A;  5L3C A;  1HKS A;  2CO5 A;  2WTE A;  3KET A;  4LLN A;  4UVA A;  3D0S A;  2UXN A;  1LVA A;  1IXS B;  3OOP A;  4A5M A;  2XHK A;  1PP8 F;  4D0P A;  1FC3 A;  2W85 A;  2X0L A;  1MJA A;  1YW9 A;  3CUO A;  4F7Z A;  2QBY B;  5DCM B;  1IRF A;  4KDP A;  1BC7 C;  1XCV A;  2RDP A;  4ZH4 F;  4AD9 A;  1XGS A;  4JBA A;  1SFE A;  2ZXJ A;  1BI1 A;  3L00 A;  2EWN A;  3ZQ7 A;  2DQL A;  2EV0 A;  4EGZ A;  1IXR C;  1O3R A;  2PJP A;  4GYG A;  1KGS A;  4RB0 A;  3T5X A;  1IAW A;  3WE3 A;  2BBY A;  3RYP A;  5K5O A;  2FQ3 A;  1R5H A;  4WXH A;  1UCR A;  2JSC A;  3GVA A;  3BP8 A;  3J80 K;  1ZGJ A;  4PCQ A;  2XIG A;  3K0L A;  2IJL A;  1ZHF A;  1J9I A;  2QM3 A;  2K4B A;  2YU3 A;  1FP2 A;  1J5Y A;  3F23 A;  2XKP A;  1C0W A;  4DNC A;  4BXU A;  2V1U A;  1MD0 A;  4WWC A;  5F6F A;  2ZNZ A;  1EV7 A;  1XMA A;  3E6C C;  1R1T A;  1BI3 A;  2O03 A;  4L18 B;  1GVJ A;  2COM A;  4A0Z A;  2OD5 A;  1K7A A;  3ZN0 A;  1Y0U A;  6PAX A;  1AWC A;  4KN7 X;  1KQ9 A;  3GZ6 A;  1E2X A;  3V4G A;  1DPU A;  1I6X A;  2LDU A;  5E8G A;  4P9U A;  1V3F A;  4OIR F;  1K6O A;  1T0F A;  1P92 A;  4KYW A;  3DF8 A;  1QZY A;  3JAM K;  2DBB A;  5BMZ A;  2PG4 A;  3I53 A;  2W57 A;  4I02 A;  3W6J B;  2ACJ A;  2HR3 A;  2VBX A;  2EV6 A;  2VON A;  4G7Z F;  1FT9 A;  4FT8 A;  4EVI A;  2PLY A;  1H9T A;  3TOB A;  2LNB A;  4CIC A;  3LA2 A;  2D2W A;  1XGO A;  3P7N A;  3L7W A;  4G9Y A;  1P2F A;  4U88 A;  1ZYR F;  3F8B A;  4TV7 A;  2H94 A;  1OKR A;  3BPV A;  1WWX A;  4CGZ A;  1Q1H A;  4ZYH A;  5E18 F;  2QLZ A;  4HQE A;  3FX3 A;  4HF0 A;  4M9Z A;  1XSX A;  4WXD A; 
#chains in the Genus database with same CATH topology
 5FKO A;  4ZDO A;  3BCA A;  1YRN A;  4P55 A;  5E3O A;  3KEQ A;  1MBE A;  1RC9 A;  2CQX A;  3NRV A;  3GCM A;  5DUK A;  3GFI A;  2NNY A;  1QBJ A;  3SZT A;  5FD6 A;  1QVU A;  4CZZ A;  1E3P A;  1VQ6 I;  5C4X J;  3HPH A;  4IHT A;  3LL7 A;  3CCY A;  3RIR A;  3I56 I;  4HNV A;  2Q1Z B;  5GAD J;  5A2Q K;  4XQF A;  1WRJ A;  1X3U A;  3KEO A;  1RUN A;  3GWZ A;  4JOM A;  3S3O A;  3BZK A;  2HVR A;  2E19 A;  4Y52 J;  3H9Q A;  3RSN A;  2XF5 A;  4KA4 A;  1XC5 A;  4RS8 A;  3OYN A;  4YIR X;  3H36 A;  5E1Z B;  2M30 A;  2HDW A;  3ERE D;  5FLV A;  3BOQ A;  3LSR A;  1UFM A;  1CF7 B;  1HW2 A;  2HOS A;  2GA2 A;  1N77 A;  4CCM A;  5GTI C;  1G59 A;  5C3E J;  2R7V A;  3HTU A;  3C3W A;  1TQI A;  4N9I A;  4FTH A;  1SD5 A;  5K5Q A;  4HLX A;  3CCE I;  1V54 H;  2EV5 A;  4BJT A;  2W84 A;  3TOA A;  1G3S A;  1RZ4 A;  1QA6 A;  4KN4 X;  1B1B A;  4BE2 A;  2KIQ A;  1PYV A;  3CJN A;  4BEH A;  2VPR A;  4BHB A;  2JPB A;  2GIZ A;  3HXL A;  3JCU C;  3FXQ A;  2EFQ A;  3VOE A;  3H5N A;  2K40 A;  1RUO A;  4XM3 A;  2DYR H;  2AQE A;  1NG6 A;  3LA7 A;  1FOK A;  1Y1V J;  3I9V 2;  3LWF A;  3FF5 A;  3FMQ A;  5DS9 A;  3CC4 I;  4R8H A;  3A03 A;  3HRM A;  4D5F A;  2F5E A;  3SDG A;  3VWB A;  1RKT A;  5J8F A;  2ISZ A;  2A69 F;  1DU6 A;  1P4W A;  2VKV A;  4PSW A;  2FSW A;  4MFE A;  4E7H A;  3CLO A;  4RB2 C;  4NBQ A;  5IOZ A;  3C18 A;  1BOA A;  2IGM A;  3RCO A;  2XAG A;  2Y48 A;  1Z1D A;  3HSE A;  4XOT A;  1D5V A;  5CYV A;  3TO7 A;  4CCO A;  2QSH X;  4DZP A;  2OAZ A;  1XN7 A;  1JE8 A;  1GXP A;  3FXR A;  1QPI A;  2DK8 A;  4IHX A;  3BG3 A;  3H3V K;  5CQG A;  4LB6 B;  4ESJ A;  3WTZ A;  3LNQ A;  5GTH C;  1NK3 P;  1OFC X;  4EJO A;  5K1Y A;  1EH6 A;  3I59 B;  2ZKZ A;  4IJA A;  1REP C;  3RQ4 A;  2DN0 A;  4MTE A;  1VQO I;  3M07 A;  5D8K B;  4JK1 X;  2XB0 X;  1IRG A;  1UJ8 A;  3DFG A;  2X6X A;  5J4Y A;  3Q0U A;  3D5L A;  2JA8 J;  2NVX J;  1FWZ A;  1XSD A;  3G1L A;  3U1D A;  3Q0W A;  3OL3 A;  3LAP A;  1IN4 A;  3QPL A;  1PDN C;  3RZO J;  2BE5 F;  1VI0 A;  2X6Y A;  2ZO4 A;  4BDY A;  2CV0 A;  3MEX A;  1ZGA A;  5EG0 A;  2MD5 A;  4L9J A;  4M9S A;  3BQZ A;  3K2Z A;  4AIJ A;  3IAM 2;  5FFX A;  5F64 A;  2GZW A;  3OYK A;  1IG7 A;  3CJQ B;  4PGH A;  2X9D A;  4I2O A;  3E97 A;  1CGP A;  1HKQ A;  4CCJ A;  4WX9 A;  4BY1 J;  3HRT A;  1KU9 A;  3FM3 A;  1LDK B;  2ZXW H;  1G3W A;  4U7D A;  3K6G A;  2CV2 A;  4C2T A;  1JHF A;  3HHH A;  3QYF A;  5E79 C;  2XPU A;  2NVU B;  1VQM I;  4ITV A;  2ZJQ F;  5IT9 Z;  3K9T A;  3ZQH A;  1P9Q C;  3C2B A;  4L5I A;  3ZMV A;  4ZYG A;  3V42 A;  4CA0 A;  4XOP A;  2ELK A;  3GZN B;  4IHW A;  3SHF A;  4EJT A;  3M3Y J;  2BGC A;  3BRO A;  3LST A;  4FCY A;  4I09 A;  3M4O J;  2OA4 A;  3WGG A;  5LHG A;  1LPQ A;  2I5U A;  4V2G A;  3K4M A;  3OIQ A;  2P4W A;  2XGE A;  2ZXI A;  1XX5 A;  2KRF A;  1OCP A;  4PZJ A;  3VYU B;  2HQ5 A;  1ETQ A;  2O5R A;  4LLG F;  3R60 A;  1T6S A;  1UHM A;  2CW8 A;  5L3G A;  2M1B A;  1U5T C;  4HST A;  5K7F A;  2QKM B;  2CUF A;  4ESB A;  1IW7 F;  2DA1 A;  4D7M A;  3KZZ A;  5GAH J;  2H6B A;  5K7Z A;  1G3T A;  1SAX A;  1Z77 A;  4ZDL A;  4XLN F;  2EB7 A;  2P6T A;  2NVY J;  4DOZ A;  3RPQ A;  5CKT A;  5LHH A;  1PJR A;  4M3B A;  5B1A H;  3H3U A;  4G12 A;  4KUM A;  1X3W B;  4D9J A;  4XLA A;  1T98 A;  2GXA A;  1SVL A;  1O7F A;  5J1R A;  3W2A A;  3TDU C;  5LEK A;  3KP5 A;  2OF7 A;  2OV7 A;  4M6V A;  2M0M A;  4HX7 A;  2E36 A;  3EUH A;  3FZV A;  3CMA I;  3DEW A;  2O61 A;  2NOJ B;  3RKQ A;  4U0Y A;  2DTZ A;  3I54 A;  4GXO A;  5HDK A;  4ENN A;  2OTL I;  3D5R C;  1LFP A;  2HFH A;  4IVN A;  3CC7 I;  3BLY A;  2JVG A;  3GW2 A;  2EZL A;  2HQN A;  2XV4 S;  3CTA A;  1WJA A;  2QSG X;  2R7U A;  2OUM A;  1ETX A;  4O5V A;  4OMZ A;  2EH3 A;  5F1J A;  2D5V A;  1OR7 C;  2LRE A;  1E17 A;  3W6K B;  1BN5 A;  1IN8 A;  4O6J A;  1VQN I;  2FF4 A;  4CO8 A;  3GYH X;  3MN2 A;  2I8D A;  3LFK A;  1RIO H;  4A3L J;  1POG A;  3PNT A;  3GZ5 A;  3HDD A;  5JHU A;  1EJ9 A;  3CC2 I;  1IDZ A;  1BW5 A;  4Q47 A;  2NYX A;  1IUY A;  3AG1 H;  3DLA A;  2L4A A;  2DW4 A;  3CJT B;  3PIO F;  5EEG A;  3G73 A;  3K7A J;  3BG7 A;  1IZ1 A;  3HRU A;  3GO5 A;  1BI2 A;  4MEX F;  1VQL I;  1BM9 A;  4XR6 A;  4IOC F;  3UKG A;  3F8C A;  2JVH A;  2DT6 A;  3S2H J;  3S1Q J;  4XRS A;  3TP0 A;  1HQC A;  3BDD A;  4IEJ A;  1WSU A;  2R7D A;  3F22 A;  3T1B A;  2BVL A;  2UXX A;  2K86 A;  1GDT A;  4CYC B;  3S16 J;  4J00 A;  4DQ2 A;  1WJE A;  2G7U A;  3ASN H;  1V5G A;  2VUM J;  3TO9 A;  1FSH A;  4OIQ F;  3I4N J;  3QWL A;  2ADU A;  1KYZ A;  3N05 A;  5JHF A;  5ERI A;  3GTO J;  1P7I A;  4LK1 F;  3PUF A;  4KIS A;  1ZK8 A;  2ZME A;  3A0B C;  3ECO A;  4AID A;  3H1C A;  1WH5 A;  2FEZ A;  1SFU A;  2W25 A;  1ZRD A;  1B9M A;  2PMH A;  1BC8 C;  2ID6 A;  2L9S A;  1IO2 A;  2E60 A;  3HOT A;  3F72 A;  4HQM A;  3HOV J;  1R58 A;  3R0A A;  2DDB A;  1FNN A;  1N75 A;  2EPF A;  3RPU D;  4NC8 A;  2QZ8 A;  3FWE A;  2XAS A;  4HSR A;  2ZC2 A;  4QIW N;  3BR1 A;  4E6K G;  1EKE A;  3D5S C;  2CUE A;  2ZJ2 A;  3N97 A;  3ZMT A;  3S15 J;  2G9W A;  3ZPL A;  3QPH A;  4EEF G;  1BR1 A;  4M72 A;  1MSE C;  2VB6 A;  4XRM A;  1DGW Y;  4MFD A;  2DCE A;  1STZ A;  1YQA A;  4EJV A;  2R5Y B;  4M74 A;  2V1X A;  3VSL A;  2YR2 A;  4H4K C;  4I0B A;  1FTZ A;  3E5U A;  4L5E A;  3G4S I;  5H6Q A;  3BG6 A;  2KFD A;  1VQP I;  3E7L A;  2FOW A;  4YEL A;  3L1P A;  1XPX A;  4I6Z A;  2VE8 A;  2FE3 A;  2QUF A;  2KT0 A;  3SDB A;  1WPK A;  3VEP A;  5DM6 F;  2BXZ A;  1ZLK A;  2F5F A;  1FSE A;  5HS8 A;  1BBY A;  4XN0 A;  4BYY A;  4NQW B;  1S72 I;  3IH2 A;  3C1D A;  2BZT A;  3OSG A;  2JUC A;  3IWF A;  4A3E J;  1KU7 A;  2ZB9 A;  3CF5 F;  1ZKG A;  4RAG A;  4RB1 A;  3BJA A;  2RN7 A;  3X2Q H;  1MMG A;  1O3S A;  1IGN A;  2NXN B;  1H0M A;  1Q1V A;  1RR8 C;  3M8E A;  1ETY A;  4IF4 A;  1DGR M;  4LB5 A;  2DOF A;  2Y75 A;  1PUF A;  1MW7 A;  3CO6 C;  4M9X A;  2Z33 A;  2DJI A;  1U3E M;  3MZY A;  3SFZ A;  3NQO A;  2R7F A;  3QU6 A;  2V26 A;  3K10 A;  3KP4 A;  5H20 A;  1JUP A;  1IXC A;  3BJO A;  2K85 A;  5HDG A;  3EYI A;  1VQ4 I;  1JJ6 C;  4KJZ A;  2K9L A;  1TW2 A;  3QPS A;  2MH9 A;  3QYE A;  1D3Y A;  3JRH A;  1HW5 A;  2EA4 A;  5HVQ C;  2P5K A;  4HZF A;  1TLH B;  1R4N B;  3CP2 A;  4G6Q A;  3BZC A;  4XSX F;  1R4M B;  1HST A;  2CFX A;  2DO7 A;  2H6C A;  1JGS A;  5C44 J;  2M34 A;  5BS6 A;  3FXM A;  2G7H A;  4ZYE A;  5LFA A;  2ECB A;  5K5R A;  2K9Q A;  3JW4 A;  2UUZ A;  4M6X A;  4RGX A;  2VKE A;  4BEH B;  1HOM A;  2LP0 A;  2XF7 A;  1DUX C;  2E1M C;  1B9N A;  1WI9 A;  1T39 A;  4A3G J;  3KIO A;  2VL8 A;  3J80 Z;  3OYD A;  2VOO A;  4OOI A;  3WTX C;  5JI6 A;  2L9N A;  1HF0 A;  2VOP A;  2IT0 A;  2M3A A;  3LSG A;  1YYV A;  3F8M A;  4RBO A;  3RQI A;  3TP3 A;  2JK3 A;  1DPR A;  1ZG5 A;  1A36 A;  1FJL A;  3CMY A;  4CCN A;  5M5X J;  2JTV A;  3HTS B;  1TC3 C;  5HLG A;  1MMA A;  3R6S A;  5KNL A;  2HDC A;  3GTL J;  2QWW A;  2K7L A;  2JWT A;  3CD6 I;  2JRM A;  1YIJ I;  2DAO A;  1CQT A;  2CU7 A;  3O8G A;  2VN2 A;  4XON A;  3BR2 A;  3E6M A;  1X1D A;  2L7Z A;  1D0X A;  5FGM A;  2OU2 A;  1VFC A;  2E1N A;  1D0Z A;  2P8T A;  3FMS A;  2DFI A;  3F21 A;  4XIC A;  3F8F A;  5D5X B;  1LNW A;  2K9M A;  3JAM Z;  4BBS J;  4NB5 A;  5LGN A;  1XDU A;  3IH4 A;  4H0E A;  2Z99 A;  3BC8 A;  5E3M A;  1Y1W J;  3WOD F;  2IRF G;  1BOB A;  3FHZ A;  3MAJ A;  3SEQ A;  2WB1 A;  4E7L A;  4XN3 A;  4S04 A;  4A93 J;  2VJ4 A;  4C3J J;  2KIF A;  1S6L A;  2P5L C;  4KIC A;  3LSM A;  2Q0O A;  1VTN C;  4AIK A;  3MZH A;  3LQR A;  2MFZ A;  3MMY B;  3ECH A;  3QQA A;  1W7P A;  3ZRG A;  1F5T A;  2V6E A;  3EPZ A;  1SMT A;  4XBF A;  2VQH A;  4YFX F;  5EG0 B;  1LFU P;  1FYM A;  4M3D A;  1O7L A;  2ME0 A;  3I58 A;  2IGO A;  3MKY B;  4ZYD A;  4YRV A;  3V8J A;  3H0D A;  3OYM A;  1Y8R B;  5EGO A;  5JVG F;  4GDF A;  4CZC A;  4Q4Z F;  2X1C A;  2V1D A;  2CW0 F;  4B4C A;  4BH9 A;  3FIW A;  3COA C;  3CUQ C;  3S2W A;  4UUT A;  5GAE J;  1LEB A;  4A6D A;  3DBL B;  5D6F A;  4FQG A;  3IC7 A;  4W97 A;  3SQN A;  3ZQI A;  1ZRF A;  3CCQ I;  2NOG A;  5TRD A;  2VQL A;  2HQR A;  2XC7 A;  3GFJ A;  5ED4 A;  1I6H J;  1B8I B;  3NWS A;  5D5U B;  2P0W A;  2H8R A;  4PJJ A;  1MBF A;  2JA7 J;  2JMW A;  4P9F A;  2L5Q A;  1T95 A;  5LLQ A;  3OMY A;  5A2Q Z;  4BE1 A;  3S8P A;  3I64 A;  2XRO A;  4DZJ A;  4IHS A;  2Y9Y A;  3G3Z A;  3PO2 J;  2DMP A;  4ENM A;  4DJA A;  3OIP A;  2HI3 A;  2ICW G;  1UHW A;  2FXA A;  3JTG A;  1VZ0 A;  4UVB A;  4CXF A;  4BAC A;  1F4K A;  2J5P A;  2YPR A;  1YJN I;  1A31 A;  1W1W E;  2MAB A;  1XMK A;  1ON2 A;  3MKL A;  1OYI A;  4MLO A;  4ZDP A;  2BHZ A;  4B1R A;  1F9N A;  3HBL A;  2HTS A;  1IV6 A;  2I10 A;  2F48 A;  3IRR A;  3MQ0 A;  5IPA A;  3IL2 A;  4B09 A;  5M3F J;  4XKB A;  1ETV A;  3Q3S A;  2NS0 A;  2X4H A;  4DGW B;  3WTV C;  3VPR A;  4IQJ A;  1ZGW A;  3P9C A;  4DBR A;  2UV1 A;  2R3S A;  3RJP A;  4HBL A;  1QRY A;  4UV8 A;  4EM1 A;  1YS7 A;  4A3I J;  4OIN F;  1A35 A;  3HOY J;  3DLL F;  2Z2S B;  1WZ2 A;  4XID A;  1WHU A;  5E20 A;  5ICC A;  3BR0 A;  2EIN H;  3DQV C;  2AXL A;  3ABU A;  1SD6 A;  1P7J A;  2F4M B;  1KON A;  2ZSI B;  5IOY A;  2OJE D;  3A4C A;  3FHN A;  1JGG A;  4II3 A;  1F43 A;  3ZXS A;  1YOV B;  1VND A;  2ID3 A;  2GWR A;  4S0H B;  1LQ1 A;  2Q2E B;  3MVP A;  3ABK H;  4LJZ F;  3K1P A;  4BKX A;  2WY8 Q;  3REO A;  1T33 A;  4ANJ A;  3ZMU A;  1D5Y A;  2LF7 A;  3PFY A;  4JQF A;  2RKH A;  1NHA A;  3OYA A;  2V6C A;  2IPQ X;  4D7N A;  4FIS A;  3W2W A;  1RR7 A;  1W5S A;  2DTR A;  3RTR A;  4BAY A;  2Z5U A;  4RDU A;  3PNV A;  2R7W A;  2VKH A;  2XSJ C;  1LDJ A;  1U78 A;  2FML A;  1BR2 A;  2Q8K A;  2DMT A;  2HOE A;  5IP6 A;  2X6O A;  4IHV A;  2HXO A;  3ONQ A;  1ZEL A;  1DDN A;  1WJ5 A;  4XOR A;  2VIX A;  1J2X A;  3DBH B;  3QP5 A;  4IZZ A;  2ELH A;  2K4J A;  2DU9 A;  3Q9S A;  3SZG A;  4EQQ A;  9ANT A;  2K27 A;  3S17 J;  3KCC A;  1ZRE A;  4PK4 A;  3WTU C;  1GXQ A;  1IRZ A;  1O3T A;  2KPM A;  4MHG A;  2ZME B;  3DXJ F;  4ZJZ A;  1FZP B;  2R7Z J;  5F0H A;  5J1Y A;  2KIM A;  1R00 A;  3KEY A;  2OC6 A;  1FBQ A;  4IXA A;  5M3M J;  2J5O A;  1YX3 A;  1ZG3 A;  2ZSH B;  1Z0X A;  3BR5 A;  3FXU A;  4BBR J;  3OYC A;  2JN6 A;  5AIP A;  1K78 A;  4WCG A;  4QLC U;  4A5N A;  4IKF A;  5EF6 A;  2FNP A;  2BY3 A;  3EYY A;  3F6V A;  4HEA 2;  1XTA A;  3HPG A;  5JLW A;  4GRI A;  4U7B A;  1T38 A;  5HOD A;  2XGX A;  4Z2Y A;  2HVS A;  2GIV A;  5E3L A;  1FX7 A;  2IBD A;  3U9G A;  4HNU A;  2L7M P;  4X1E A;  2RNJ A;  2EZI A;  1OPC A;  3BT9 A;  5HS9 A;  2NS7 A;  2HTJ A;  2X51 A;  3ZQQ A;  3TED A;  2RQQ A;  1OR7 A;  1R5I D;  4R1H A;  3RZD J;  5LEJ A;  5TGT A;  4A69 C;  1TNT A;  4P96 A;  5HLT A;  2FX0 A;  1IC8 A;  2H1L A;  3E5Q A;  1AKH A;  4OU0 A;  4KIF A;  1ETO A;  4A3B J;  1ZG1 A;  2DT7 B;  1X4P A;  2A5W A;  3BG9 A;  5HDN A;  2L3D A;  4RGU A;  5F0F A;  3B73 A;  5DCM A;  1MGT A;  5D4R A;  3DBR B;  2V9V A;  1QZZ A;  4LFU A;  2O0Y A;  1X2M A;  3N4M A;  4WF2 A;  3AFH A;  2CYY A;  1S7A A;  4IRI A;  4OWR B;  1YO5 C;  1ERD A;  5M5W J;  1ZAO A;  2R4G A;  4FE7 A;  2WV0 A;  4WXC A;  2XGD A;  4QSH A;  1QHG A;  1IRX A;  2Y31 A;  1T0F C;  2DQR A;  2HYF A;  4FX4 A;  3MFK A;  1WJB A;  4YFK F;  1I27 A;  4RMN A;  1TT0 A;  1YE9 A;  3LSK A;  3DU6 A;  2LKX A;  1U9O A;  3OL4 A;  2QA4 I;  2IS6 A;  4PDK A;  3BWG A;  2CG4 A;  1NH3 A;  4BUP A;  2F4I A;  2R5Z B;  3B02 A;  3DEE A;  3LMM A;  2KKO A;  1D0Y A;  2NS8 A;  5IYC J;  5E17 F;  3SYT A;  5E1X A;  3T8R A;  1KA8 A;  4MTD A;  2CUJ A;  4IRH A;  1LFB A;  4XLF A;  2DMU A;  1OYY A;  3MKW B;  4NC7 A;  3PM1 A;  5F1R A;  2AQF A;  1QPM A;  1U8B A;  3HL2 A;  2KL4 A;  2Y2Z A;  1WJF A;  4E7J A;  3JRE A;  1UEL B;  2Z3Y A;  3HEF A;  2MBF A;  3R4K A;  5KAF C;  1DQU A;  2IA0 A;  1UHS A;  4A6E A;  1F36 A;  3V7S A;  3ZQF A;  3BQY A;  3CCV I;  1UST A;  1V5F A;  3ZP5 A;  2YU9 J;  1TW3 A;  2IVM A;  2PMU A;  3GEZ A;  4BXF A;  2V79 A;  3FXO A;  4BQQ A;  4ZZD A;  3F6O A;  3FK7 A;  3I0T A;  1K6Y A;  3GLL A;  2IGK A;  1RES A;  5LGT A;  1Y56 A;  4IX7 A;  1ITY A;  2A5Y B;  4MQV A;  4M73 A;  1OCC H;  1QVT A;  1LJ9 A;  4IHY A;  2NNN A;  2EZK A;  4C3H J;  1XSV A;  2PMZ N;  3JTH A;  4EJU A;  1HDD C;  5ILU A;  1YS6 A;  3JRB A;  2L0K A;  1MIJ A;  1OIS A;  3PQJ A;  1T8I A;  5CVI A;  1EH7 A;  2JZY A;  2RGV A;  2FBI A;  4HPQ A;  4CCK A;  1YHQ I;  2DOE A;  3FM5 A;  4LLL A;  2WAE A;  3CCJ I;  4BS9 A;  2PX9 A;  3ISP A;  3V8K A;  1YFH A;  4UXN A;  1SAU A;  1MBG A;  2CV1 A;  2M5W A;  2ZBK A;  4C2M J;  3M1C A;  5B5E C;  2EIJ H;  3OYH A;  5CVU A;  2XAU A;  2FNA A;  3QP6 A;  2H1K A;  3K2A A;  2DOA A;  5BPD A;  2GAU A;  1B72 A;  3C2H A;  1TQP A;  3EET A;  2AO9 A;  1ACI A;  1EF4 A;  2R7R A;  4LIV A;  1GV5 A;  5DV5 A;  4MNU A;  5L3D A;  4B3A A;  1H88 C;  2R92 J;  1W7P B;  2G0E A;  1UMQ A;  2DFF A;  4BHP A;  1YIO A;  1JUS A;  1Z67 A;  3I71 A;  4FE4 A;  4A0Y A;  1ENH A;  4EM0 B;  2KZV A;  2XB5 A;  5B3S H;  1ZAR A;  3ZGK A;  1RET A;  2EK5 A;  3CDL A;  1E3O C;  3LAJ A;  2PFB A;  1QGP A;  2XAH A;  1OJL A;  3A1Y A;  2JSP A;  3QRF F;  2V9P A;  1LUJ B;  2A6E F;  4AIH A;  5EGO B;  4WK8 F;  3HKZ N;  2W1O A;  1S8N A;  4GO1 A;  1R36 A;  3DKY A;  3KYL A;  3AL0 C;  2VQC A;  1W4M A;  5FFZ A;  4ZYA A;  4Z6Y A;  4P5O A;  3GBG A;  3VSK A;  1K83 J;  2PBI A;  2VI6 A;  2YX4 A;  2GBY A;  5FB2 A;  2DPU A;  2BXY A;  1ZH5 A;  2RV8 A;  1KU3 A;  1XDS A;  3EDP A;  3FDY A;  2JPC A;  1SC7 A;  2EFW A;  2LOO A;  4B47 A;  2DK5 A;  4F55 A;  5D5V B;  4KIT B;  1OCZ H;  2KDZ A;  4PJ0 C;  5EDN A;  2HPI A;  1OLT A;  2GLO A;  3DP7 A;  1U8R A;  4BNC A;  4RM3 A;  3JR9 A;  3IHU A;  3DTE A;  3RKX A;  3OS2 A;  2GA1 A;  2VT2 A;  4A3F J;  3Q5F A;  5FKN A;  2PEX A;  5JVT A;  2K3P A;  1MDM A;  3E6D A;  1XB4 A;  3D1N I;  3CCL I;  2EZH A;  2XKO A;  2MYS A;  2VBW A;  2VT3 A;  4A2U A;  1G6N A;  1I3A A;  2V4J C;  4M3F A;  2B9S A;  2E7W A;  3L09 A;  4D5C A;  1N78 A;  2FD5 A;  3GXO A;  3CQZ J;  2A61 A;  2LY2 A;  4UUS B;  3DU5 A;  3R0J A;  3JRI A;  1FYL A;  3OV8 A;  2K9S A;  3H35 A;  3ZMZ A;  3RKW A;  2RVC A;  2GXB A;  3F8N A;  5FKK A;  1Z3X A;  3FIS A;  2EJR A;  3F0C A;  3GF2 A;  2JUG A;  3ABM H;  4GCV A;  3OSF A;  4HX8 A;  4OAY A;  2VOD A;  5CVJ A;  3LSI A;  4PJN A;  4A12 A;  3TDZ C;  2VXZ A;  1JI8 A;  4ZZL A;  1G2H A;  3T0Y A;  4L5J A;  4NHJ A;  2HKO A;  1BW6 A;  3MKZ A;  2LBF B;  2R7T A;  1I1G A;  4MIM A;  3S32 A;  4AC0 A;  2VJJ A;  5D5W B;  4X6A J;  2F5C A;  2C6Y A;  3TGN A;  4KIG A;  2OZU A;  5LHI A;  4KNY A;  2KZG A;  2OQR A;  4Q48 A;  1PVE A;  3K4N A;  1S7E A;  2WAD A;  2XF6 A;  2QSF X;  3G1M A;  2PJR A;  2WA0 A;  2M4G A;  4G6D A;  1BA5 A;  4E7S A;  1T2K A;  5FLX K;  4XNF A;  3LSH A;  4B8X A;  1YRN B;  5LGU A;  3CUQ A;  1TWG J;  1H9G A;  1ZTR A;  5J47 A;  2CQN A;  2B7E A;  4EGY A;  1SFO J;  1G8X A;  4J19 A;  1SEU A;  2R7X A;  4AWX B;  1NG7 A;  1Z05 A;  1VQ9 I;  1HLV A;  4OMY A;  1RNL A;  1U6G A;  2DI3 A;  2OQG A;  2HYG D;  1R9T J;  4E4H A;  1S5L C;  2MW8 A;  2DMN A;  3BPX A;  1SFX A;  5JFR A;  2QQA A;  4NNJ A;  2STW A;  3BR6 A;  4Y15 A;  5ICG A;  1KU2 A;  4Y3O A;  3HG9 A;  2W7N A;  2XAJ A;  4RAY A;  4MGR A;  1RKW A;  3KFW X;  1XD7 A;  4UHT A;  2KRC A;  4LD5 A;  1DU0 A;  1G3Y A;  3KLN A;  3HGG A;  4C2U A;  3C7J A;  3DTK A;  2LG4 A;  4XLP F;  4G7H F;  4X0G A;  1ORK A;  4BQN A;  2IXS A;  2HZD A;  5D4S A;  3DWL E;  3VFZ A;  4GYI A;  4BU2 A;  2P5V A;  3M8F A;  1SVM A;  4AM3 A;  3JRC A;  2IS1 A;  2IEK A;  3B6A A;  3FBN B;  2O7O A;  4BGD A;  2H09 A;  3CCU I;  2BYV E;  1ETW A;  2EA2 A;  2DPD A;  1D8K A;  3NEU A;  5ILS A;  1QZE A;  2CWE A;  1GV2 A;  1FEX A;  2GM4 A;  4I01 A;  5DYM A;  3HOS A;  5TJJ A;  3OYE A;  1JKQ C;  1GLN A;  2OCE A;  1L0O C;  3HYI A;  3W3C A;  3GUD A;  3KX2 A;  3JRG A;  3HUG A;  1IN6 A;  2MH2 A;  4AU7 A;  2IW5 A;  1I1S A;  2E7X A;  1I50 J;  2ZFU A;  1XGM A;  3DKX A;  3GFL A;  3NAU A;  1Y6I A;  2XPV A;  5GPA A;  4BHC A;  4BE0 A;  2LC2 A;  1WJD A;  5L3F A;  4JX5 A;  1B6A A;  3Q9V A;  2KP6 A;  1RPW A;  4ZTF A;  2E2H J;  2HQA A;  3UNG C;  2ECC A;  2LSO A;  2QGU A;  2XVC A;  2KIS A;  4O3M A;  2L9R A;  1LDD A;  2M87 A;  1IF1 A;  2GXG A;  2DJN A;  2HDD A;  1U9N A;  4G94 A;  4KMU X;  3KP3 A;  1EH8 A;  1OCR H;  4XLH A;  4A3C J;  3H5A A;  2LR8 A;  1OMI A;  3SJM A;  2L9V A;  2R7O A;  1J7K A;  1YW7 A;  3ZQG A;  1XMX A;  2RRE A;  1HW1 A;  1S7O A;  4AUX A;  1F1Z A;  4YII A;  2LH9 A;  3U21 A;  2XGC A;  1LB2 A;  2WY7 Q;  3BTJ A;  4LOC A;  1WFX A;  3IKT A;  1I39 A;  1QO0 D;  5J1U A;  1W36 D;  4OIO F;  2ESH A;  2IGN A;  2XAF A;  2O8K A;  4MQ9 F;  1VQK I;  5K7H A;  4G8X A;  4DYR A;  2ZME C;  3K4J A;  5EJC A;  4XKW A;  4BXX J;  3PJR A;  2EIK H;  1LEA A;  4YG2 F;  2HU9 A;  3JSO A;  2BW3 A;  2X6W A;  4M6Y A;  3LQQ A;  4I76 A;  4D1Q A;  2LF8 A;  2ZFW A;  2YS9 A;  2Y9Z A;  3L2W A;  4CH7 A;  3S3M A;  2MA3 A;  3CDH A;  3K1N A;  1FBU A;  1JTX A;  4HRI A;  4AVP A;  4E7K A;  2Y0S N;  3KLO A;  4CUG A;  5D8L B;  4AYB N;  1WH7 A;  3BTI A;  1W7P D;  4S05 A;  2QVO A;  4LG0 A;  1W0T A;  2E35 A;  2L2O A;  3IWZ A;  3CP8 A;  3ESW B;  4OAZ A;  1N25 A;  1NK2 P;  3QAH A;  3L2R A;  4AVZ A;  2ELJ A;  3K69 A;  5H6R A;  1MBJ A;  5DUI A;  2CUZ A;  2X1D A;  1TWF J;  5HLI A;  5HOO A;  4YFN F;  3FXJ A;  2QQ9 A;  1L3L A;  1RRJ A;  3CDI A;  1QHH D;  1SAN A;  2DYS H;  1Z91 A;  2K5C A;  4LIU A;  5TIS C;  4HOB A;  1TWH J;  4ESF A;  1TTY A;  2KIU A;  3DPT A;  3DKW A;  2CQQ A;  2LKP A;  1JUM A;  2DA4 A;  1Z7U A;  2FUG 2;  1ODD A;  1H89 C;  4JYK A;  1BJA A;  1XG1 A;  3QU3 A;  1OQY A;  2OPT A;  5BNG A;  1K61 A;  1BL0 A;  5ILV A;  3SXY A;  2NVQ J;  3FBI B;  3TBI A;  5M5Y J;  3WU1 B;  1ULY A;  1MSF C;  3RYR A;  2MLK A;  1BI0 A;  5DD8 A;  3VOD A;  4G7O F;  4BQO A;  5KVR A;  2ETH A;  3RKY A;  1FTT A;  3NAR A;  5CVR A;  1S3J A;  2CMP A;  1GHC A;  1UAA A;  5L3B A;  4RGS A;  4BL0 B;  2XUB A;  3LA3 A;  4N4O B;  1E3H A;  4EJW A;  2UZK A;  1T56 A;  3S93 A;  4OIP F;  1X1B A;  2VQG A;  5DM7 F;  1HXD A;  1VQ7 I;  3RI4 A;  2EFP A;  5FRM A;  2M8E A;  2D1V A;  4Y4R A;  4UUV A;  5JR3 A;  2IS4 A;  2XRL A;  2PI0 A;  1R1V A;  5L3E A;  3GLX A;  1B72 B;  1JTY A;  4UV9 A;  5GP9 A;  5CJ9 A;  2M7A A;  2HS5 A;  4CDG A;  3I4M J;  3PFI A;  3E5X A;  1JXS A;  3ZQC A;  4LK0 F;  2L7F P;  3P9K A;  3A2K A;  2EFN A;  2V7F A;  1P4A A;  3HOW J;  4EM2 A;  2F2E A;  1MNM C;  3O6B B;  3OWT A;  3WG9 A;  4M3G A;  2MD0 A;  1DP3 A;  3GTK J;  1MJB A;  2KHM A;  3DPU A;  3TW6 A;  2PQ8 A;  3IRQ A;  2R5Y A;  1IV8 A;  1HCR A;  3IUO A;  2VPL A;  4EMS A;  1APL C;  1P4X A;  4L9N A;  1HDP A;  1UB9 A;  3S1M J;  3TO6 A;  5FJ8 J;  2E1C A;  3H0G J;  5BQT A;  2HKX A;  2NAZ A;  3BTL A;  4HA8 A;  2LY1 A;  2O8X A;  1BJZ A;  1I3Q J;  3AG3 H;  2STT A;  4NQW A;  5C4J J;  2H27 A;  3ZMD A;  1VF9 A;  3G6E I;  3HC7 A;  3K70 D;  1JJ8 C;  2R93 J;  2A68 F;  1ON1 A;  3LSP A;  4L9T A;  2M0C A;  1W36 C;  2E71 A;  1MJ9 A;  3VDX A;  1U5T A;  2MC4 A;  3HGY A;  3VYT B;  2XDV A;  5EEA A;  2V9K A;  3GX4 X;  4CYD A;  4XRS G;  4BQA A;  3HRS A;  1MND A;  2CW7 A;  3S1N J;  3FMR A;  4U0V A;  2LTP A;  3SFI A;  2AS5 F;  2E2J J;  2BY2 A;  3L2V A;  4ZTJ A;  4QPO A;  5KCM A;  1MDM B;  1YX5 A;  5DDG A;  4BY7 J;  5FRO A;  5HNF A;  2BV6 A;  2E34 A;  4LMY A;  3GTG J;  1OYW A;  3ABT A;  3I4P A;  1R5G A;  4U0W A;  1SD4 A;  2VBY A;  4Y7N J;  3AAF A;  2DFH A;  4UY8 I;  3R61 A;  3H9J A;  1IDY A;  2MSY A;  3H92 A;  4HW0 A;  3L9F A;  1JKR C;  1X2N A;  1X4O A;  4HAM A;  1MNE A;  2WAQ N;  4V19 K;  3CME I;  3DV8 A;  2BY1 A;  2E5N A;  4KT5 C;  4PJM A;  1G4D A;  1B4A A;  1FLI A;  1ZN2 A;  3PSI A;  2A6H F;  5BOX A;  1RI7 A;  1A6I A;  3CLQ A;  2CH0 A;  1FOW A;  5HLH A;  1KQ8 A;  2E2I J;  4XKV A;  3MZ8 A;  1TP4 A;  2X1E A;  4KFC A;  3G1O A;  3V7C A;  2DDA A;  2K9N A;  2M45 A;  2R0Q C;  1JKO C;  3S2D J;  1R49 A;  4L0Z B;  2D45 A;  1A04 A;  2VBZ A;  4ETS A;  3GTP J;  2KQR A;  3OR1 C;  2HGC A;  1TWA J;  2QF7 A;  4Q5S F;  2HZT A;  3PL8 A;  2IA2 A;  4UNO A;  1ZLJ A;  3L2C A;  2QCO A;  3BR3 A;  1Z9C A;  2W24 A;  4KMF A;  3KZY A;  3WGI A;  1YLF A;  1IUF A;  2PJR B;  3EUK L;  2JQ7 A;  1MMD A;  3HSF A;  2HVQ A;  3QOP A;  4ABZ A;  1BIA A;  2QBY A;  2QQB A;  2DFE A;  1R71 A;  4HLY A;  3GME A;  3O2P E;  3OR2 C;  4A0X A;  2V1N A;  3CUQ B;  4B44 A;  4I99 C;  3DCF A;  4GGG A;  2YX7 A;  4ENK A;  5ICE A;  2HEO A;  2M9H A;  3TQN A;  5FRN A;  2P7V B;  4BDZ A;  3OYG A;  2O3F A;  5E3N A;  3JRD A;  3FKI J;  2BEO A;  3AG4 H;  3QOE A;  2M4K A;  2AXT C;  2DOD A;  3AG2 H;  5DTD A;  2XSD C;  3WTY C;  4CCL A;  4ZC3 A;  1AOY A;  2RNG A;  2YUS A;  2H8W A;  2OZ6 A;  2KDO A;  1P6R A;  1O57 A;  2LKS A;  2D1H A;  1PUF B;  5FO5 A;  1A5J A;  2LD5 A;  1KQ0 A;  1W5C C;  2E1O A;  2K3F A;  2WBM A;  2WAQ A;  5F27 A;  4IO9 F;  2DT5 A;  3QPT A;  5J6X A;  4JX6 A;  1ZR2 A;  4C3I J;  5H2F C;  3J7Y J;  5CQE A;  1R1U A;  3JRA A;  1H8A C;  4HDV A;  2AHQ A;  1UG2 A;  2WC2 A;  2MGQ A;  3HZJ A;  4XLE A;  4HV6 A;  1X1P A;  2LMD A;  3SZP A;  1DP7 P;  1R7J A;  1J09 A;  2K02 A;  3LOC A;  1FBS A;  3OYL A;  5F0C A;  2VKD A;  3V8L A;  2O9L A;  2Y30 A;  3CCS I;  3WGH A;  1SMY F;  1HKT A;  3CF2 A;  4XSZ F;  3BZ6 A;  1AHD P;  1S29 A;  2M8G X;  1WKM A;  4L0Y B;  4RAZ A;  1WQ2 A;  3IAS 2;  3PNY A;  4FHT A;  3FXL A;  3A01 A;  1ZQ3 P;  3GFM A;  3HUG B;  2HPM A;  2KJB A;  1USS A;  5DEQ A;  2FU4 A;  4DW6 A;  4IRG A;  4NDL A;  1X1C A;  4CHU A;  2X48 A;  5BPI A;  3J7A O;  4BJ5 C;  2W00 A;  4PUS A;  1GUU A;  1WJC A;  2JA5 J;  3A0H C;  4IOA F;  2ZNY A;  3E3V A;  4XMY A;  2A6T A;  2EFO A;  2VXD A;  3ERM A;  3K70 C;  4NC6 A;  1TQM A;  4HF1 A;  2LK2 A;  4JX4 A;  2QKL B;  4A3D J;  3MWM A;  2MG4 A;  4UB8 C;  1BR4 A;  4I98 B;  4M71 A;  3DPL C;  2FBK A;  2TCT A;  5KAI C;  5IYB J;  2N8G A;  4W1U A;  5HNH A;  1XGN A;  1R22 A;  4C30 A;  3ASO H;  1LE8 A;  2R7S A;  2A3S A;  1FY7 A;  1I5Z A;  4LGW A;  3J81 Z;  1B8I A;  1B59 A;  3K4L A;  2KLO A;  3B6C A;  1S9H A;  1T08 B;  5B66 C;  2MC3 A;  2UWM A;  4ON0 A;  1WI3 A;  3FK6 A;  3ROU A;  3OS0 A;  4M3E A;  3WU2 C;  3U1K A;  2KJC A;  1HBX G;  3S3N A;  2M7B A;  2QEN A;  2IA1 A;  4PFO A;  5LRR A;  4II2 A;  4U87 A;  5FKL A;  2HXI A;  4EAT A;  1O3Q A;  5IT3 A;  5B1B H;  1J75 A;  2P7C B;  1AA7 A;  1IN7 A;  3ML6 A;  3E1S A;  1FYK A;  4Y13 A;  5CLS A;  2DA3 A;  2Z1D A;  1MMN A;  2FBH A;  1LVK A;  1Y8Q B;  4ENJ A;  2JRT A;  3HSR A;  5EYR A;  3OYJ A;  3KE2 A;  4XRF A;  2XRN A;  1FMV A;  1MKM A;  1BIB A;  2F6C A;  2DMQ A;  2L02 A;  4MO7 A;  4FX0 A;  4QWQ A;  1W5T A;  2O6G E;  2BW3 B;  3CJR B;  4RGR A;  4JP0 A;  2OBP A;  4RAF A;  2IAI A;  4HYE A;  2NRA C;  3T8T A;  1SD7 A;  3CO7 C;  2WWY A;  5D6E A;  3ULQ B;  2L54 A;  1R23 A;  3WTT C;  2QYO A;  1KYW A;  5KK1 A;  4N0B A;  2ZJP F;  3FXK A;  2HOA A;  1FPQ A;  1VQ5 I;  3F3X A;  4LG0 B;  5CVV A;  1X1A A;  2VC1 A;  3I5U A;  1UZC A;  2PMZ A;  4IL6 C;  3G2B A;  4MEY F;  4YEJ A;  5IT9 K;  5GPC A;  2FMY A;  2EIL H;  3ZQL A;  5FLX Z;  4A3M J;  5CPR B;  3K1M A;  1TWC J;  4N4N B;  4K2E A;  2BY0 A;  1MZB A;  2Q2E A;  3M8J A;  5DCF A;  4NUB A;  5AIQ A;  5EZH A;  3DTI A;  2BOL A;  2YSR A;  3J81 K;  2VC0 A;  3BCB A;  4I7H A;  5DD4 A;  3UR3 C;  1ONV A;  1QNT A;  3BY6 A;  4L9V A;  4UVC A;  2GOM A;  3E6B A;  2XAQ A;  1D1C A;  1MBH A;  2HWV A;  3OIO A;  2RQP A;  3KZI C;  4KIB A;  3WG7 H;  1FMW A;  4QTR A;  3PQK A;  1Z6R A;  3ZR8 X;  3GTM J;  2OTJ I;  2B0L A;  3HM5 A;  3W6V A;  1JHH A;  2CSO A;  4FET A;  2P6S A;  4DBQ A;  3ZN1 A;  3HIF A;  1MBK A;  3HB9 A;  1QU3 A;  1CF7 A;  2A07 F;  1TNS A;  3KP7 A;  2GQQ A;  5HS7 A;  1X19 A;  2LVS A;  3S14 J;  2QQ8 A;  3KP2 A;  2ESN A;  3RPU A;  3TKY A;  1V4R A;  2RC4 A;  4HV5 A;  4I0A A;  3V7R A;  1PUE E;  4XK4 A;  2W48 A;  2L4M A;  2IP2 A;  2MLG A;  4CSW A;  4B48 A;  3J7A Y;  2DLL A;  3O8H A;  3KYC B;  1JKP C;  3HKZ A;  3WTW C;  4N9H A;  3M1E A;  1WGX A;  3JSP A;  1WCM J;  2RAE A;  3KP6 A;  4PFP A;  3FKJ A;  3K4K A;  2FRH A;  4PGG A;  1FP1 D;  1PP7 U;  4PJL A;  3WTS C;  4F93 B;  4RB3 C;  3TW7 A;  3IH3 A;  3OYF A;  1XCB A;  2Y0M A;  3BG5 A;  5IY5 H;  3IV5 A;  3HOZ J;  3E0J B;  1U2W A;  2F5V A;  2CQK A;  2EBI A;  5EEH A;  1HC8 A;  3OY9 A;  3P9I A;  5J40 A;  1ZRC A;  1V55 H;  3MCZ A;  4IQ4 A;  3CCM I;  4HX4 A;  3BJ6 A;  4ASN A;  2LRD A;  1IJW C;  1JT0 A;  3ELK A;  3U2R A;  3OS1 A;  2LFB A;  2DA5 A;  4Y17 A;  3W2V A;  3O3K A;  1Z6T A;  2DA2 A;  3WE2 A;  5LRS A;  4QPQ A;  1D1A A;  2JT1 A;  1J59 A;  3ZMS A;  4XKC A;  3H9G A;  3HHG A;  2TDX A;  2L7K A;  3LFU A;  3RDI A;  2BVM A;  2LLK A;  3IKV A;  1K79 A;  2CQ7 A;  1TBX A;  4V2F A;  4E70 A;  5FD5 A;  1HSJ A;  2EQR A;  2A05 A;  4HNT A;  3L2Q A;  2ISY A;  5FLM J;  3I59 A;  2FA5 A;  2E5Z A;  4YIF A;  3GTQ J;  2XPW A;  5LBQ A;  2DA6 A;  2TRT A;  3K4B A;  3NWT A;  2CRG A;  4E7I A;  1TT5 B;  5AON A;  1U5T B;  2EIM H;  5F04 A;  2WV1 A;  1OCT C;  3PUB A;  1QQI A;  2L01 A;  2PN6 A;  4HDU A;  5J8C A;  4R79 A;  1FIA A;  2Y69 H;  2CGP A;  4HF2 A;  2ZCW A;  5E1W A;  3WHC A;  1YTY A;  4PSX A;  2VE9 A;  1FIP A;  3H3Z A;  1M1E B;  2ZJR F;  4EV0 A;  3EUH C;  3VB2 A;  3OYB A;  2F5D A;  1YW8 A;  3WU0 A;  3EQL F;  2R5Z A;  2Z9O A;  2LY9 A;  5E8I A;  3MD2 A;  3DEU A;  2M2E A;  4IPA A;  3M9A A;  1YG2 A;  3M7G A;  1IN5 A;  1K78 B;  1R6R A;  1J0R A;  3QYB A;  2FOK A;  2CS3 A;  5ICF A;  4G6T B;  4C9Y A;  1D8J A;  4RM2 A;  3C2G A;  3KPH A;  5L3C A;  2WB1 N;  1HKS A;  1LKX A;  2CO5 A;  2WTE A;  5J3L A;  3KET A;  4LLN A;  3PO3 J;  3S1R J;  3OOU A;  4UVA A;  3D0S A;  2UXN A;  4FAS D;  1LVA A;  2FJ1 A;  3QOD A;  1IXS B;  2JJ7 A;  3OOP A;  1UG0 A;  4A5M A;  4F91 B;  2W4S A;  2XHK A;  1AKH B;  1PP8 F;  3EUA A;  4D0P A;  1FC3 A;  2W85 A;  3IP4 B;  4XL9 A;  2OCC H;  2X0L A;  2DXI A;  1MH3 A;  1MJA A;  1YW9 A;  3CUO A;  4F7Z A;  5JLX A;  3AL0 B;  2QBY B;  1TZL A;  4B43 A;  1MMS A;  4E7Z A;  5DCM B;  1IRF A;  4KDP A;  3GTJ J;  1BC7 C;  4F92 B;  1XCV A;  2COB A;  2RDP A;  2QEX I;  4ZH4 F;  3SEZ A;  4AD9 A;  1XGS A;  5IP9 J;  2VLA A;  3HJE A;  3G71 I;  2NVT J;  4JBA A;  4A3J J;  1SFE A;  2ZXJ A;  1BI1 A;  3ABL H;  3L00 A;  1YI2 I;  2EWN A;  3KYD B;  3ZQ7 A;  2DQL A;  3ZCO A;  2JA6 J;  4LIT A;  3I3L A;  2EV0 A;  4EGZ A;  1IXR C;  3CCR I;  1O3R A;  2HNH A;  2PJP A;  4GYG A;  2VJ5 A;  1KGS A;  4RB0 A;  3T5X A;  4B3X A;  3WE3 A;  1IAW A;  2BBY A;  3RYP A;  1GT0 C;  5K5O A;  3J7Z I;  2IS2 A;  2FQ3 A;  4Y33 A;  1R5H A;  4WXH A;  5EZG A;  3TMO A;  3CES A;  4KT6 A;  2VAS A;  1KZH A;  4DYC A;  3P5J A;  1HA8 A;  1UCR A;  1OCO H;  2JSC A;  1O4X A;  2KMU A;  3GVA A;  4F3Q A;  4RLQ A;  1Z3Y A;  3BP8 A;  1Y39 A;  3J80 K;  4UB6 C;  1ZGJ A;  1Z21 A;  1ETK A;  1YJW I;  3H5R A;  3A01 B;  4PCQ A;  1FOY A;  2R7Q A;  2XIG A;  3K0L A;  2IJL A;  1ZHF A;  1Z7L A;  1YIT I;  3WHB A;  1J9I A;  2QM3 A;  2K4B A;  2CJJ A;  2YU3 A;  1FP2 A;  1U0J A;  4DYQ A;  3K4C A;  1J5Y A;  3F23 A;  2XKP A;  3AKZ A;  3A02 A;  1JT6 A;  1X3Z B;  1C0W A;  1SVO A;  4A3K J;  5LD2 C;  2F4O B;  1ZR4 A;  1K4T A;  4DNC A;  4BXU A;  2V1U A;  1YJ9 I;  1VQ8 I;  1MD0 A;  4WWC A;  3PIP F;  5F6F A;  2ZNZ A;  1EV7 A;  1XMA A;  3BTC A;  3JRF A;  1X58 A;  3E6C C;  4HG2 A;  1R1T A;  5F08 A;  1BI3 A;  2O03 A;  4L18 B;  1GVJ A;  1WVR A;  2COM A;  4A0Z A;  2OD5 A;  3F9K A;  1K7A A;  1NTC A;  3VYS B;  3ZN0 A;  4CYC A;  2HOT A;  1Y0U A;  6PAX A;  2WAF A;  1LE8 B;  2KRH A;  2FQ4 A;  3I55 I;  1W0U A;  1AWC A;  4KN7 X;  1KQ9 A;  1E2X A;  3GZ6 A;  3V4G A;  1DPU A;  1I6X A;  3ZOB A;  2LDU A;  5E8G A;  4P9U A;  1V3F A;  4OIR F;  1K6O A;  1T0F A;  1P92 A;  3CMM A;  4KYW A;  4DIQ A;  3DF8 A;  5FKM A;  1QZY A;  3JAM K;  2LYC A;  2DBB A;  1D1B A;  1EA3 A;  5BMZ A;  2PG4 A;  3I53 A;  2W57 A;  4I02 A;  3W6J B;  1TL8 A;  2ACJ A;  1XS9 A;  2Y0S A;  2HR3 A;  1MH4 A;  2VBX A;  4XLC A;  2EV6 A;  4RA2 A;  4AYB A;  1E0E A;  2BHY A;  2VON A;  1V5E A;  4G7Z F;  4UUS A;  1FT9 A;  2DA7 A;  3LSJ A;  3HOX J;  3CZ6 A;  4RLF A;  2X85 A;  4FT8 A;  4EVI A;  2ZXH A;  2P81 A;  2PLY A;  2CFO A;  1SFK A;  3HOU J;  1AU7 A;  1H9T A;  4F52 A;  5KHD A;  3TOB A;  2LNB A;  4CIC A;  2B63 J;  5IP7 J;  3LA2 A;  1A6Q A;  3PSF A;  3TL4 X;  2D2W A;  1XGO A;  3P7N A;  3L7W A;  4G9Y A;  5GAG J;  1P2F A;  4J01 A;  2HYJ A;  4U88 A;  3L2U A;  2LBF A;  3OYI A;  1ZYR F;  3VYR B;  4GFB A;  1FOX A;  5IYD J;  2E1M B;  3F8B A;  5J4V A;  4TV7 A;  2H94 A;  1GVD A;  1OKR A;  3BPV A;  4P1W A;  1WWX A;  2ME6 A;  1K4S A;  4CGZ A;  2GOX B;  4BJ6 C;  1Q1H A;  4ZYH A;  5E18 F;  2QLZ A;  2Z16 A;  4HQE A;  2VJI A;  3FX3 A;  4HF0 A;  4M9Z A;  3Q0V A;  1Y0N A;  4LG3 A;  1XSX A;  4WXD A;  2W82 A;  2JA2 A; 
#chains in the Genus database with same CATH homology
 4P55 A;  3KEQ A;  3NRV A;  5DUK A;  3GFI A;  2NNY A;  1QBJ A;  3SZT A;  5FD6 A;  4CZZ A;  4IHT A;  3RIR A;  5A2Q K;  1WRJ A;  1X3U A;  3KEO A;  1RUN A;  3GWZ A;  4KA4 A;  4RS8 A;  5E1Z B;  2M30 A;  3ERE D;  3BOQ A;  1CF7 B;  1UFM A;  1HW2 A;  2GA2 A;  3HTU A;  3C3W A;  1TQI A;  4N9I A;  1SD5 A;  5K5Q A;  4HLX A;  2EV5 A;  2W84 A;  3TOA A;  1G3S A;  1RZ4 A;  4KN4 X;  1B1B A;  3CJN A;  4BHB A;  2JPB A;  3FXQ A;  2EFQ A;  3VOE A;  1RUO A;  3LA7 A;  1FOK A;  3LWF A;  3FF5 A;  3FMQ A;  4R8H A;  3HRM A;  2F5E A;  5J8F A;  2ISZ A;  2A69 F;  1P4W A;  2FSW A;  3CLO A;  4RB2 C;  3C18 A;  1BOA A;  2XAG A;  2Y48 A;  1Z1D A;  3HSE A;  1D5V A;  5CYV A;  3TO7 A;  2OAZ A;  1XN7 A;  1JE8 A;  1GXP A;  3FXR A;  2DK8 A;  4LB6 B;  4ESJ A;  3WTZ A;  4EJO A;  5K1Y A;  1EH6 A;  3I59 B;  2ZKZ A;  4IJA A;  1REP C;  4MTE A;  5D8K B;  4JK1 X;  1IRG A;  3DFG A;  3D5L A;  1FWZ A;  1XSD A;  3U1D A;  3LAP A;  1IN4 A;  1PDN C;  2BE5 F;  2ZO4 A;  3MEX A;  1ZGA A;  2MD5 A;  4L9J A;  4M9S A;  3K2Z A;  4AIJ A;  5FFX A;  5F64 A;  2GZW A;  4PGH A;  4I2O A;  3E97 A;  1CGP A;  1HKQ A;  4WX9 A;  3HRT A;  1KU9 A;  3FM3 A;  1LDK B;  1G3W A;  4U7D A;  1JHF A;  3HHH A;  5IT9 Z;  3K9T A;  4L5I A;  3ZMV A;  4ZYG A;  3SHF A;  4EJT A;  2BGC A;  3BRO A;  3LST A;  4I09 A;  2OA4 A;  3WGG A;  5LHG A;  2P4W A;  2KRF A;  4PZJ A;  4LLG F;  3R60 A;  1T6S A;  1UHM A;  5L3G A;  2M1B A;  1U5T C;  4ESB A;  1IW7 F;  3KZZ A;  2H6B A;  1G3T A;  1SAX A;  4XLN F;  2EB7 A;  2P6T A;  3RPQ A;  5LHH A;  3H3U A;  4KUM A;  1T98 A;  1O7F A;  3TDU C;  5LEK A;  3KP5 A;  4HX7 A;  3EUH A;  3FZV A;  2O61 A;  4U0Y A;  3I54 A;  4GXO A;  5HDK A;  4ENN A;  2HFH A;  4IVN A;  3GW2 A;  2HQN A;  2XV4 S;  3CTA A;  4OMZ A;  4O5V A;  1E17 A;  3W6K B;  1BN5 A;  1IN8 A;  4O6J A;  2FF4 A;  4CO8 A;  3GYH X;  1RIO H;  3LFK A;  3GZ5 A;  5JHU A;  4Q47 A;  2NYX A;  1IUY A;  2L4A A;  2DW4 A;  5EEG A;  3G73 A;  1IZ1 A;  3HRU A;  3GO5 A;  1BI2 A;  4MEX F;  1BM9 A;  3F8C A;  1HQC A;  3BDD A;  1WSU A;  2R7D A;  3F22 A;  3T1B A;  2UXX A;  2K86 A;  4DQ2 A;  2G7U A;  3TO9 A;  1FSH A;  4OIQ F;  2ADU A;  1KYZ A;  5ERI A;  4LK1 F;  2ZME A;  3ECO A;  2FEZ A;  1SFU A;  2W25 A;  1ZRD A;  1B9M A;  2PMH A;  1BC8 C;  3HOT A;  3F72 A;  4HQM A;  1R58 A;  3R0A A;  1FNN A;  2QZ8 A;  3FWE A;  2XAS A;  3N97 A;  2ZJ2 A;  3ZMT A;  2G9W A;  3ZPL A;  3QPH A;  4M72 A;  1STZ A;  1YQA A;  4EJV A;  4M74 A;  2V1X A;  2YR2 A;  4I0B A;  3E5U A;  5H6Q A;  2VE8 A;  2FE3 A;  2QUF A;  3VEP A;  1ZLK A;  2F5F A;  1FSE A;  5HS8 A;  1BBY A;  4BYY A;  3C1D A;  3IWF A;  1KU7 A;  4RB1 A;  3BJA A;  2RN7 A;  1O3S A;  1H0M A;  3M8E A;  4IF4 A;  4LB5 A;  2Y75 A;  3CO6 C;  4M9X A;  2Z33 A;  1U3E M;  3MZY A;  3SFZ A;  3NQO A;  2R7F A;  3QU6 A;  5H20 A;  3KP4 A;  1IXC A;  3BJO A;  5HDG A;  3EYI A;  1TW2 A;  2MH9 A;  1D3Y A;  1HW5 A;  2EA4 A;  5HVQ C;  2P5K A;  4HZF A;  1TLH B;  4G6Q A;  4XSX F;  1HST A;  2CFX A;  2DO7 A;  2H6C A;  1JGS A;  5BS6 A;  2G7H A;  4ZYE A;  5K5R A;  3JW4 A;  4M6X A;  4RGX A;  1DUX C;  1B9N A;  1WI9 A;  1T39 A;  3J80 Z;  2VOO A;  4OOI A;  3WTX C;  5JI6 A;  2VOP A;  2IT0 A;  1YYV A;  3F8M A;  1ZG5 A;  1DPR A;  2JTV A;  3HTS B;  5HLG A;  3R6S A;  2HDC A;  2QWW A;  2K7L A;  2DAO A;  2VN2 A;  3E6M A;  5FGM A;  2OU2 A;  2E1N A;  2P8T A;  3FMS A;  2DFI A;  3F21 A;  3F8F A;  5D5X B;  1LNW A;  3JAM Z;  4NB5 A;  5LGN A;  1XDU A;  4H0E A;  2Z99 A;  3WOD F;  2IRF G;  3FHZ A;  3MAJ A;  4S04 A;  2KIF A;  1S6L A;  2P5L C;  4KIC A;  2Q0O A;  1VTN C;  4AIK A;  3MZH A;  3LQR A;  3ECH A;  1W7P A;  1F5T A;  1SMT A;  4XBF A;  4YFX F;  1FYM A;  1O7L A;  3I58 A;  4ZYD A;  3V8J A;  4Q4Z F;  2V1D A;  2CW0 F;  4BH9 A;  3COA C;  3CUQ C;  3S2W A;  1LEB A;  4A6D A;  5D6F A;  3IC7 A;  3SQN A;  1ZRF A;  5TRD A;  2HQR A;  3GFJ A;  5ED4 A;  5D5U B;  4P9F A;  5LLQ A;  5A2Q Z;  3I64 A;  2XRO A;  4IHS A;  3G3Z A;  4ENM A;  1UHW A;  2FXA A;  3JTG A;  4UVB A;  4CXF A;  1F4K A;  2J5P A;  2YPR A;  1XMK A;  1ON2 A;  1OYI A;  1F9N A;  2HTS A;  3IRR A;  3MQ0 A;  3IL2 A;  4B09 A;  2NS0 A;  2X4H A;  3WTV C;  3P9C A;  2R3S A;  3RJP A;  4HBL A;  4UV8 A;  4EM1 A;  1YS7 A;  4OIN F;  5E20 A;  5ICC A;  3DQV C;  2AXL A;  3ABU A;  1SD6 A;  2GWR A;  1LQ1 A;  4LJZ F;  3K1P A;  3REO A;  3ZMU A;  2LF7 A;  4JQF A;  2RKH A;  1NHA A;  2V6C A;  2IPQ X;  1W5S A;  2DTR A;  3RTR A;  4BAY A;  2Z5U A;  1LDJ A;  1U78 A;  2FML A;  2Q8K A;  2HOE A;  1DDN A;  1J2X A;  3QP5 A;  2ELH A;  2K4J A;  2DU9 A;  3Q9S A;  4EQQ A;  2K27 A;  3KCC A;  1ZRE A;  3WTU C;  1GXQ A;  1O3T A;  4MHG A;  2ZME B;  3DXJ F;  1FZP B;  2KIM A;  1R00 A;  1FBQ A;  4IXA A;  2J5O A;  1ZG3 A;  3FXU A;  5AIP A;  1K78 A;  4WCG A;  4QLC U;  4A5N A;  2FNP A;  3EYY A;  3F6V A;  4U7B A;  1T38 A;  2XGX A;  4Z2Y A;  2GIV A;  1FX7 A;  3U9G A;  2RNJ A;  1OPC A;  5HS9 A;  2HTJ A;  1OR7 A;  4R1H A;  5LEJ A;  1TNT A;  4P96 A;  3E5Q A;  4OU0 A;  4KIF A;  1ZG1 A;  5HDN A;  2L3D A;  4RGU A;  3B73 A;  5DCM A;  1MGT A;  5D4R A;  4LFU A;  2V9V A;  1QZZ A;  2O0Y A;  3N4M A;  4WF2 A;  2CYY A;  1S7A A;  4IRI A;  1YO5 C;  1ZAO A;  4WXC A;  2WV0 A;  2DQR A;  2HYF A;  4FX4 A;  3MFK A;  4YFK F;  1I27 A;  4PDK A;  3BWG A;  2CG4 A;  3B02 A;  2KKO A;  5E17 F;  5E1X A;  3T8R A;  1KA8 A;  4MTD A;  4IRH A;  1OYY A;  5F1R A;  1QPM A;  2Z3Y A;  2MBF A;  3R4K A;  2IA0 A;  4A6E A;  3V7S A;  1UST A;  3ZP5 A;  1TW3 A;  2IVM A;  2PMU A;  3GEZ A;  2V79 A;  4ZZD A;  3F6O A;  3I0T A;  5LGT A;  2A5Y B;  4MQV A;  4M73 A;  1LJ9 A;  2NNN A;  1XSV A;  3JTH A;  4EJU A;  5ILU A;  1YS6 A;  3PQJ A;  5CVI A;  1EH7 A;  2JZY A;  2RGV A;  2FBI A;  3FM5 A;  4LLL A;  3ISP A;  3V8K A;  1YFH A;  4UXN A;  2M5W A;  2ZBK A;  5CVU A;  2FNA A;  3QP6 A;  5BPD A;  2GAU A;  1TQP A;  3EET A;  5L3D A;  5DV5 A;  4MNU A;  1W7P B;  4BHP A;  1YIO A;  3I71 A;  4A0Y A;  4EM0 B;  1ZAR A;  2EK5 A;  3LAJ A;  2PFB A;  1QGP A;  2XAH A;  3QRF F;  4WK8 F;  2A6E F;  4AIH A;  1S8N A;  4GO1 A;  1R36 A;  5FFZ A;  1W4M A;  4P5O A;  2PBI A;  2YX4 A;  5FB2 A;  2DPU A;  1ZH5 A;  2RV8 A;  1KU3 A;  1XDS A;  3EDP A;  2JPC A;  2EFW A;  5D5V B;  2DK5 A;  3DP7 A;  1U8R A;  4BNC A;  3IHU A;  3RKX A;  2GA1 A;  2VT2 A;  3Q5F A;  2PEX A;  5JVT A;  1MDM A;  3E6D A;  1XB4 A;  2XKO A;  2VT3 A;  2VBW A;  4A2U A;  1G6N A;  2E7W A;  3L09 A;  3GXO A;  2A61 A;  3R0J A;  1FYL A;  3OV8 A;  3ZMZ A;  3RKW A;  2RVC A;  2GXB A;  3F8N A;  2EJR A;  3GF2 A;  4GCV A;  2VOD A;  4HX8 A;  5CVJ A;  4A12 A;  3TDZ C;  2VXZ A;  4ZZL A;  3T0Y A;  4L5J A;  4NHJ A;  2HKO A;  1I1G A;  5D5W B;  2F5C A;  2C6Y A;  3TGN A;  4KIG A;  2OZU A;  5LHI A;  4KNY A;  2OQR A;  4Q48 A;  4G6D A;  1T2K A;  5FLX K;  4B8X A;  5LGU A;  3CUQ A;  1H9G A;  4EGY A;  4AWX B;  1Z05 A;  4OMY A;  1RNL A;  1U6G A;  2DI3 A;  2OQG A;  2HYG D;  3BPX A;  1SFX A;  5JFR A;  2QQA A;  2STW A;  4Y15 A;  5ICG A;  1KU2 A;  2XAJ A;  4RAY A;  4MGR A;  3KFW X;  1XD7 A;  4UHT A;  4LD5 A;  1G3Y A;  3KLN A;  3C7J A;  4XLP F;  4G7H F;  5D4S A;  3VFZ A;  4GYI A;  2P5V A;  3M8F A;  2H09 A;  2BYV E;  2EA2 A;  2DPD A;  1D8K A;  3NEU A;  5ILS A;  2CWE A;  4I01 A;  5DYM A;  3HOS A;  5TJJ A;  1L0O C;  3HYI A;  3GUD A;  3HUG A;  1IN6 A;  2MH2 A;  2IW5 A;  1I1S A;  2E7X A;  1XGM A;  3GFL A;  4BHC A;  5L3F A;  1B6A A;  3Q9V A;  4O3M A;  2LSO A;  2XVC A;  1LDD A;  2M87 A;  1IF1 A;  2GXG A;  4G94 A;  4KMU X;  3KP3 A;  1EH8 A;  1OMI A;  1J7K A;  1YW7 A;  1HW1 A;  1S7O A;  1F1Z A;  4YII A;  1LB2 A;  3IKT A;  1QO0 D;  4OIO F;  2ESH A;  2XAF A;  4MQ9 F;  4G8X A;  1LEA A;  4YG2 F;  3JSO A;  4M6Y A;  3LQQ A;  2LF8 A;  2ZFW A;  2MA3 A;  3CDH A;  3K1N A;  1FBU A;  4AVP A;  3KLO A;  5D8L B;  1W7P D;  4S05 A;  2QVO A;  4LG0 A;  3IWZ A;  3QAH A;  3K69 A;  5H6R A;  5DUI A;  5HLI A;  5HOO A;  4YFN F;  2QQ9 A;  1L3L A;  1Z91 A;  4HOB A;  4ESF A;  1TTY A;  2KIU A;  3DPT A;  3DKW A;  2LKP A;  1Z7U A;  1ODD A;  1BJA A;  3QU3 A;  5ILV A;  3SXY A;  3WU1 B;  1ULY A;  4G7O F;  3RYR A;  2MLK A;  1BI0 A;  5DD8 A;  3VOD A;  5KVR A;  2ETH A;  3RKY A;  5CVR A;  1S3J A;  1GHC A;  5L3B A;  4RGS A;  2XUB A;  3LA3 A;  4EJW A;  2UZK A;  4OIP F;  1HXD A;  3RI4 A;  2EFP A;  2M8E A;  2D1V A;  4UUV A;  5JR3 A;  2PI0 A;  1R1V A;  5L3E A;  3GLX A;  4UV9 A;  5CJ9 A;  2HS5 A;  4CDG A;  3PFI A;  3E5X A;  1JXS A;  4LK0 F;  3P9K A;  2EFN A;  1P4A A;  4EM2 A;  2F2E A;  3O6B B;  3WG9 A;  1MJB A;  2PQ8 A;  3IRQ A;  4EMS A;  1P4X A;  4L9N A;  1UB9 A;  3TO6 A;  2E1C A;  5BQT A;  2HKX A;  2NAZ A;  4HA8 A;  2O8X A;  2STT A;  4NQW A;  2H27 A;  3ZMD A;  2A68 F;  1ON1 A;  4L9T A;  1MJ9 A;  1U5T A;  3GX4 X;  4CYD A;  4BQA A;  3HRS A;  3FMR A;  4U0V A;  2AS5 F;  1MDM B;  5DDG A;  2BV6 A;  4LMY A;  1OYW A;  3ABT A;  3I4P A;  1R5G A;  4U0W A;  1SD4 A;  2VBY A;  3AAF A;  3R61 A;  3H92 A;  4HW0 A;  3L9F A;  4HAM A;  3DV8 A;  1G4D A;  4KT5 C;  1B4A A;  1FLI A;  1ZN2 A;  2A6H F;  5BOX A;  1RI7 A;  1KQ8 A;  5HLH A;  4KFC A;  3V7C A;  2M45 A;  4L0Z B;  2D45 A;  1A04 A;  2VBZ A;  4ETS A;  2HGC A;  4Q5S F;  2HZT A;  2IA2 A;  4UNO A;  1ZLJ A;  3L2C A;  1Z9C A;  2W24 A;  4KMF A;  3KZY A;  3WGI A;  1YLF A;  3HSF A;  3QOP A;  1BIA A;  2QBY A;  2QQB A;  4HLY A;  3O2P E;  4A0X A;  3CUQ B;  4GGG A;  2YX7 A;  4ENK A;  5ICE A;  2HEO A;  3TQN A;  2P7V B;  2O3F A;  2BEO A;  3WTY C;  1AOY A;  2OZ6 A;  1P6R A;  1O57 A;  2D1H A;  5FO5 A;  1KQ0 A;  2DT5 A;  3QPT A;  5J6X A;  1R1U A;  4HDV A;  2WC2 A;  4HV6 A;  3SZP A;  1DP7 P;  1R7J A;  2K02 A;  1FBS A;  3V8L A;  3WGH A;  1SMY F;  1HKT A;  4XSZ F;  3BZ6 A;  1S29 A;  1WKM A;  4L0Y B;  4RAZ A;  1WQ2 A;  4FHT A;  3GFM A;  2KJB A;  1USS A;  5DEQ A;  2FU4 A;  4IRG A;  4CHU A;  5BPI A;  3J7A O;  2ZNY A;  3E3V A;  2EFO A;  1TQM A;  4HF1 A;  3MWM A;  4I98 B;  4M71 A;  3DPL C;  2FBK A;  1XGN A;  1R22 A;  2A3S A;  1FY7 A;  1I5Z A;  4LGW A;  3J81 Z;  1B59 A;  2MC3 A;  2UWM A;  4ON0 A;  3ROU A;  2KJC A;  1HBX G;  2QEN A;  2IA1 A;  5LRR A;  1O3Q A;  5IT3 A;  1J75 A;  2P7C B;  1IN7 A;  3ML6 A;  1FYK A;  4Y13 A;  5CLS A;  2FBH A;  4ENJ A;  2JRT A;  3HSR A;  3KE2 A;  4XRF A;  2XRN A;  1MKM A;  1BIB A;  2L02 A;  4FX0 A;  4QWQ A;  1W5T A;  2O6G E;  4RGR A;  2OBP A;  4HYE A;  2NRA C;  3T8T A;  1SD7 A;  3CO7 C;  2WWY A;  5D6E A;  3ULQ B;  2L54 A;  1R23 A;  3WTT C;  2QYO A;  1KYW A;  5KK1 A;  4N0B A;  1FPQ A;  3F3X A;  4LG0 B;  5CVV A;  2VC1 A;  3I5U A;  4MEY F;  5IT9 K;  2FMY A;  5FLX Z;  3K1M A;  4K2E A;  1MZB A;  2Q2E A;  5DCF A;  5AIQ A;  2YSR A;  3J81 K;  2VC0 A;  4I7H A;  5DD4 A;  1ONV A;  1QNT A;  3BY6 A;  4L9V A;  4UVC A;  3E6B A;  2XAQ A;  2HWV A;  2RQP A;  4KIB A;  3PQK A;  1Z6R A;  2B0L A;  1JHH A;  2CSO A;  2P6S A;  3ZN1 A;  3HIF A;  1CF7 A;  2A07 F;  1TNS A;  3KP7 A;  2GQQ A;  5HS7 A;  3KP2 A;  2ESN A;  3RPU A;  3TKY A;  1V4R A;  2RC4 A;  4HV5 A;  4I0A A;  3V7R A;  1PUE E;  2L4M A;  2IP2 A;  2MLG A;  2DLL A;  3WTW C;  4N9H A;  3M1E A;  3JSP A;  3KP6 A;  2FRH A;  4PGG A;  1FP1 D;  1PP7 U;  3WTS C;  4RB3 C;  1XCB A;  2Y0M A;  1U2W A;  2CQK A;  5EEH A;  1ZRC A;  3P9I A;  3MCZ A;  4HX4 A;  3BJ6 A;  4ASN A;  3ELK A;  3U2R A;  4Y17 A;  3O3K A;  1Z6T A;  3WE2 A;  5LRS A;  2JT1 A;  1J59 A;  3ZMS A;  3HHG A;  2TDX A;  3RDI A;  3IKV A;  1K79 A;  1TBX A;  4E70 A;  5FD5 A;  1HSJ A;  2ISY A;  3I59 A;  2FA5 A;  4YIF A;  5LBQ A;  5AON A;  1U5T B;  1QQI A;  2L01 A;  4HDU A;  2PN6 A;  5J8C A;  4R79 A;  2CGP A;  4HF2 A;  2ZCW A;  5E1W A;  1YTY A;  2VE9 A;  3H3Z A;  4EV0 A;  3VB2 A;  2F5D A;  1YW8 A;  3WU0 A;  3EQL F;  2Z9O A;  5E8I A;  3DEU A;  4IPA A;  3M9A A;  1YG2 A;  3M7G A;  1IN5 A;  1K78 B;  1J0R A;  2FOK A;  5ICF A;  1D8J A;  5L3C A;  1HKS A;  2CO5 A;  2WTE A;  3KET A;  4LLN A;  4UVA A;  3D0S A;  2UXN A;  1LVA A;  1IXS B;  3OOP A;  4A5M A;  2XHK A;  1PP8 F;  4D0P A;  1FC3 A;  2W85 A;  2X0L A;  1MJA A;  1YW9 A;  3CUO A;  4F7Z A;  2QBY B;  5DCM B;  1IRF A;  4KDP A;  1BC7 C;  1XCV A;  2RDP A;  4ZH4 F;  4AD9 A;  1XGS A;  4JBA A;  1SFE A;  2ZXJ A;  1BI1 A;  3L00 A;  2EWN A;  3ZQ7 A;  2DQL A;  2EV0 A;  4EGZ A;  1IXR C;  1O3R A;  2PJP A;  4GYG A;  1KGS A;  4RB0 A;  3T5X A;  1IAW A;  3WE3 A;  2BBY A;  3RYP A;  5K5O A;  2FQ3 A;  1R5H A;  4WXH A;  1UCR A;  2JSC A;  3GVA A;  3BP8 A;  3J80 K;  1ZGJ A;  4PCQ A;  2XIG A;  3K0L A;  2IJL A;  1ZHF A;  1J9I A;  2QM3 A;  2K4B A;  2YU3 A;  1FP2 A;  1J5Y A;  3F23 A;  2XKP A;  1C0W A;  4DNC A;  4BXU A;  2V1U A;  1MD0 A;  4WWC A;  5F6F A;  2ZNZ A;  1EV7 A;  1XMA A;  3E6C C;  1R1T A;  1BI3 A;  2O03 A;  4L18 B;  1GVJ A;  2COM A;  4A0Z A;  2OD5 A;  1K7A A;  3ZN0 A;  1Y0U A;  6PAX A;  1AWC A;  4KN7 X;  1KQ9 A;  3GZ6 A;  1E2X A;  3V4G A;  1DPU A;  1I6X A;  2LDU A;  5E8G A;  4P9U A;  1V3F A;  4OIR F;  1K6O A;  1T0F A;  1P92 A;  4KYW A;  3DF8 A;  1QZY A;  3JAM K;  2DBB A;  5BMZ A;  2PG4 A;  3I53 A;  2W57 A;  4I02 A;  3W6J B;  2ACJ A;  2HR3 A;  2VBX A;  2EV6 A;  2VON A;  4G7Z F;  1FT9 A;  4FT8 A;  4EVI A;  2PLY A;  1H9T A;  3TOB A;  2LNB A;  4CIC A;  3LA2 A;  2D2W A;  1XGO A;  3P7N A;  3L7W A;  4G9Y A;  1P2F A;  4U88 A;  1ZYR F;  3F8B A;  4TV7 A;  2H94 A;  1OKR A;  3BPV A;  1WWX A;  4CGZ A;  1Q1H A;  4ZYH A;  5E18 F;  2QLZ A;  4HQE A;  3FX3 A;  4HF0 A;  4M9Z A;  1XSX A;  4WXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...