3GX4X

Crystal structure analysis of s. pombe atl in complex with dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKDRLEEEGVEIYQTSLGEYKLNLPEYMWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flipping of alkylated DNA damage bridges base and nucleotide excision repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
molecule keywords Alkyltransferase-like protein 1
total genus 36
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gx4X00
2FE3A 4XRFA 4U0WA 2QWWA 4A6EA 5DD8A 1YFHA 4LK0F 3F8NA 1FYMA 1UHWA 1SD5A 3KP4A 5F6FA 2DFIA 3M7GA 5BMZA 5A2QZ 2FA5A 4M9ZA 1ZG1A 4L5IA 1FY7A 3FZVA 1KQ8A 1ULYA 3MZHA 3KEOA 3CJNA 3GLXA 2DQLA 4YFKF 4G7HF 3GZ5A 4A6DA 5E17F 3V7CA 2QYOA 4KFCA 3VEPA 4HF0A 1SMYF 1YQAA 3DXJF 1YLFA 4WXHA 3IL2A 2EB7A 2Z5UA 3IKVA 5CVIA 2AS5F 1G4DA 4GO1A 1MGTA 4AIHA 1K78B 1Y0UA 3RDIA 2XAQA 2V1XA 3RJPA 2L02A 4KUMA 1IN6A 3BPXA 4OU0A 4EJWA 2F5EA 3IWZA 3OV8A 4XSXF 5E1ZB 1KU7A 4N0BA 1ZHFA 2H6BA 2JPCA 4A2UA 1YW9A 2D1VA 3OOPA 4L18B 2BEOA 3TGNA 2FSWA 4L9JA 3E6DA 3JTGA 5EEGA 2XKPA 3HRUA 1B9NA 4AIJA 3ZN1A 2H27A 1IXCA 1B6AA 3LA3A 1CF7A 3FF5A 4LD5A 3T0YA 1G6NA 4HAMA 3JTHA 3MZYA 1FC3A 4GGGA 1YW8A 5LGTA 3HRMA 1PDNC 1IZ1A 4WXDA 1E17A 1QNTA 2ZXJA 3J80Z 1REPC 4CYDA 5D5VB 3M8FA 3I59B 2HGCA 1D3YA 3GFJA 3KP2A 2HKXA 2P6TA 1KA8A 3HSEA 1LDKB 3RTRA 4MGRA 1FBSA 3FMQA 2GA1A 2P5VA 3FMSA 1ZREA 3K0LA 1ODDA 2V79A 2STTA 3WGGA 1P4WA 4GCVA 3I54A 1YS7A 2LDUA 4K2EA 1FNNA 1O7FA 1MJBA 5DYMA 4CZZA 5D6FA 3TKYA 3K1MA 1GXQA 4JBAA 4RB2C 1LNWA 4BNCA 3DV8A 3JAMZ 2OQRA 2XHKA 4S04A 2IRFG 4UV9A 2VBZA 3ZMSA 1FSEA 1MZBA 3F8CA 3WE3A 4A5MA 1QO0D 1CGPA 1IRGA 4LLNA 2ZNYA 3E6MA 4MQ9F 1QGPA 5FLXK 1R1TA 2BGCA 1UFMA 1HBXG 4UUVA 3QRFF 3QAHA 4HDUA 3LQRA 4IPAA 2A6HF 4KMFA 1ZH5A 3Q5FA 3KLOA 2IPQX 4JQFA 2EFOA 1O3RA 3GEZA 1E2XA 2L01A 5LHHA 4ZYDA 1WRJA 2A68F 4HV6A 2DK8A 3T8TA 5BOXA 4G7OF 2PN6A 3JAMK 4I0AA 4BYYA 2JZYA 2W85A 2G9WA 3U1DA 3FWEA 3WU1B 2ELHA 1XSVA 3RYPA 2L4MA 4S05A 4KIGA 1DDNA 2MLKA 3CLOA 3C18A 2CSOA 2XAFA 4E70A 1SAXA 3B02A 3KEQA 1W7PD 4EM0B 3JSPA 2LF8A 1STZA 3SXYA 4BHBA 3HSFA 2XRNA 3IKTA 2ADUA 2R7DA 3WTVC 3WTSC 4LK1F 1R1VA 1USSA 4FHTA 3P9CA 1T2KA 1FSHA 2MLGA 1R1UA 3GO5A 4N9HA 2IA1A 1KQ9A 3TOBA 3ZMTA 3PFIA 3MQ0A 3E97A 1XMAA 1B59A 2IT0A 4KA4A 4LGWA 2F2EA 4ENJA 1U5TB 1I1GA 2CG4A 4ZYGA 4AIKA 1ON2A 1LVAA 2P5LC 5D5XB 4NHJA 3C3WA 3KP7A 3DPLC 4KICA 4OIOF 3ZMDA 2PG4A 2EFWA 2O03A 2Y75A 2HR3A 3SQNA 2TDXA 4M74A 2JSCA 4U0YA 4Y13A 1XN7A 2GIVA 1T38A 3SFZA 2QQ9A 5HVQC 1HKTA 4LLLA 2HOEA 4NB5A 3KE2A 1ZYRF 2JT1A 3SHFA 4Q4ZF 4WWCA 3C1DA 5CVUA 4OIQF 4FX4A 4EVIA 3HIFA 1T98A 4OMZA 1U78A 2P6SA 2NRAC 2RV8A 2FF4A 3GFLA 2JRTA 3ECHA 3SZTA 2WWYA 3EQLF 3BY6A 2HS5A 2G7HA 3T8RA 1W4MA 4YIFA 3E6BA 3VODA 2F5CA 4OIPF 3TO6A 2QBYB 1WKMA 1JXSA 5DD4A 3EYIA 2PLYA 2RNJA 2IA0A 3KP5A 2VBXA 3IWFA 4MTDA 4LJZF 1I27A 1S7AA 5J8CA 5LLQA 4GYIA 4A0XA 2KRFA 1SFUA 2DW4A 2IJLA 3IHUA 3RKXA 3VB2A 1U5TA 2HFHA 4RB1A 2QZ8A 1J59A 3WU0A 3MFKA 1S7OA 2FBIA 2RC4A 1HSJA 1Z05A 2M8EA 4BQAA 2RVCA 4HQEA 1ONVA 3W6KB 4EJOA 4PGHA 1UHMA 2CO5A 3HHGA 4A0YA 2K86A 3E5XA 5FO5A 3CO7C 3HOTA 1TQPA 4R8HA 1JHFA 3K1PA 5CLSA 1KYZA 2HWVA 5D5WB 4Q48A 1V4RA 4BXUA 4UVAA 4HLXA 1LDDA 4HX7A 3ZQ7A 5K5RA 5E8IA 2YR2A 3TO9A 4BHCA 1JHHA 1Z7UA 2UXNA 5FB2A 3QPHA 4EJUA 2P7VB 2QQBA 1BI2A 3O6BB 2W57A 3WGIA 3KZZA 2DTRA 5ILSA 2QVOA 5H20A 1D5VA 2XAHA 3QU3A 1HXDA 1H9GA 1H9TA 2MA3A 5IT9K 1W5TA 3CUOA 2P4WA 6PAXA 3V8LA 5L3BA 1SD7A 4CICA 4HX4A 2W84A 5HDGA 1ZG5A 2HYFA 4L0YB 4P5OA 3VOEA 1FLIA 5DDGA 4IJAA 4ESJA 2FRHA 5AIPA 3DF8A 5DEQA 4QLCU 5FLXZ 3ERED 5DV5A 1X3UA 2OD5A 3S2WA 4L9TA 1RIOH 3ZMZA 3LA2A 1XGMA 5CVJA 3GVAA 2EWNA 1O3SA 5D4SA 5ICGA 1Q1HA 2EFQA 3F8MA 2EV5A 1TQMA 3HHHA 1FP2A 5DCMB 4KIFA 5D8LB 2OQGA 4KT5C 3TQNA 1OPCA 2WV0A 5K5QA 1NHAA 5HLHA 2J5PA 2RDPA 3L7WA 4EM2A 2LSOA 5ILUA 4RGSA 1LJ9A 4IVNA 5KVRA 4G94A 4UV8A 3Q9SA 5J8FA 4R79A 5FFXA 3HUGA 1BI1A 1D8JA 4ZZDA 3FMRA 3V7RA 1O7LA 2DK5A 4I98B 5DCFA 4RGXA 2COMA 4EQQA 1IAWA 1OYWA 4WK8F 3ELKA 1FX7A 4IRGA 4IF4A 1XCVA 4LFUA 5E1WA 1P4AA 5ED4A 5HS8A 1RUNA 5FD6A 1WWXA 3FHZA 4CDGA 3ULQB 2L3DA 4L5JA 1IW7F 2V1DA 1ZGAA 1XSXA 4ASNA 2HEOA 1HW2A 3TDUC 2MBFA 4U88A 4MHGA 3KFWX 2CFXA 3MCZA 1BI0A 1MDMB 1S6LA 1S3JA 2RKHA 3CO6C 2VT3A 4MEYF 5L3FA 4A0ZA 5KK1A 3CUQA 1XDSA 1J9IA 2RN7A 3QP6A 1BM9A 1RZ4A 5TJJA 3J81K 2OAZA 3GZ6A 1U3EM 3GUDA 1T0FA 4P9FA 2MH2A 3F6OA 2DAOA 3ZMUA 1I5ZA 3EDPA 2V6CA 4M72A 4L9NA 1FZPB 3RI4A 5HS9A 2E7XA 4HF1A 2FBKA 2A5YB 2FOKA 3F6VA 3B73A 1SMTA 1OMIA 1EH7A 3NRVA 2EV6A 1L3LA 1YYVA 2CQKA 3L00A 5ILVA 2PMUA 1OKRA 3LAPA 2HZTA 4RB0A 3ZN0A 1XGNA 1ZLKA 2R3SA 4LB5A 1ZRCA 1R58A 1HKQA 3W6JB 4ETSA 1H0MA 3FXQA 3E6CC 3F8BA 1XGSA 1W5SA 2PEXA 5D8KB 2KIUA 1UB9A 2UXXA 5H6RA 4KYWA 1OYYA 4Y17A 4HF2A 1AWCA 1FBQA 1OR7A 2BV6A 4ZYEA 3REOA 3PQJA 3L9FA 2RQPA 4U7BA 2W24A 2OZUA 4HOBA 3BPVA 2A69F 4KIBA 3HRTA 2FBHA 3R4KA 1TNSA 5BQTA 3LFKA 1G3YA 1P4XA 3RPQA 3BZ6A 2JTVA 1U5TC 3F22A 3J81Z 3C7JA 1U2WA 2CWEA 4QWQA 1WQ2A 1F4KA 4TV7A 2EK5A 2NNNA 5D5UB 1YO5C 3FM3A 2BE5F 1J2XA 4RAYA 5ICFA 5JR3A 3NEUA 4ENKA 4KNYA 3GXOA 2VC0A 4CHUA 1HW1A 2ZO4A 2EA4A 3COAC 1K79A 4ESBA 2ZFWA 3MWMA 2ZNZA 4H0EA 1R5HA 1KGSA 1R5GA 4LLGF 3LQQA 4I0BA 2B0LA 5A2QK 3HSRA 3DFGA 3H3UA 5ICEA 3ML6A 4DNCA 4OOIA 4RB3C 4OMYA 2YPRA 3WE2A 2LF7A 1BOAA 2XASA 3F23A 2VBWA 4KDPA 2HDCA 2FEZA 3ROUA 4M71A 3NQOA 4CXFA 2DBBA 2Z99A 3V8KA 2KIMA 5FGMA 1R23A 4EM1A 2M87A 1G3SA 3GWZA 2A6EF 3V7SA 5J6XA 3T1BA 4BH9A 3GFMA 2IVMA 2HYGD 4EV0A 3FXUA 3HYIA 1B1BA 1TNTA 2BBYA 4UVCA 5HLIA 1J0RA 4LMYA 2WC2A 1YG2A 2CYYA 3SZPA 2VXZA 1EV7A 1FT9A 2J5OA 1Z91A 2HQRA 2XGXA 3ISPA 2YU3A 4UHTA 3CDHA 1T6SA 2OU2A 5BPDA 3P9IA 4WF2A 3U9GA 1XD7A 5IT9Z 4PDKA 2DU9A 3BOQA 3R0JA 5BS6A 5AONA 1T39A 4N9IA 1EH6A 2GXGA 5HDKA 1YIOA 3I64A 3TOAA 3ABUA 2XKOA 1XDUA 1J7KA 3BJOA 3H3ZA 1L0OC 2STWA 3V8JA 4ENMA 2NYXA 4M6XA 3HRSA 3J80K 2MC3A 1LB2A 2DO7A 4LG0A 5L3EA 3L2CA 1KYWA 4P55A 5E8GA 3FM5A 2VONA 4XLPF 2FMLA 3H92A 2YSRA 4FX0A 1IUYA 1RNLA 1XCBA 3CTAA 3M9AA 1TW2A 4HLYA 3K1NA 3T5XA 2E1CA 1W7PA 1I1SA 2A3SA 1KU9A 3WTTC 4CO8A 4LB6B 4I09A 2FNAA 3GF2A 4EJVA 4RGUA 1SD4A 1G3WA 3QU6A 2HTJA 2HQNA 2OBPA 5HLGA 3O3KA 1R36A 3CUQB 2M45A 4JK1X 5BPIA 3GX4X 2K27A 3BP8A 3F8FA 2JPBA 5LHGA 4EGZA 2XIGA 5LBQA 1BC8C 2M1BA 3MEXA 2ZJ2A 4O5VA 2E7WA 2VT2A 2C6YA 4B8XA 2VE9A 3EUHA 1DPRA 2VC1A 1MKMA 4YFXF 5K1YA 2O6GE 5HDNA 3I4PA 3R0AA 4BAYA 3WTXC 4NQWA 2VN2A 2D45A 2QLZA 3I53A 2CW0F 1GHCA 1P6RA 5CVRA 1G3TA 3VFZA 3E3VA 4Q5SF 2K02A 5IT3A 3JSOA 2YX4A 5LEJA 1XSDA 1FYKA 4GYGA 4XLNF 3R6SA 5ICCA 4L0ZB 2FU4A 4HQMA 4R1HA 3J7AO 3R60A 1FPQA 2ETHA 1GVJA 1LDJA 3L09A 2UZKA 3M1EA 1YS6A 1Z1DA 5F64A 2EFNA 1U8RA 4HA8A 2X4HA 2Z33A 1FYLA 3D0SA 3GYHX 1RUOA 4Y15A 4EJTA 1OYIA 2NNYA 2DPDA 4FT8A 1LQ1A 1JE8A 5LGNA 4O3MA 2E1NA 3KETA 3M8EA 1BJAA 2XAGA 2DI3A 1WI9A 4YFNF 1ZARA 2EJRA 4I2OA 1HSTA 5L3CA 3I58A 4P96A 2IW5A 2P5KA 2LKPA 3I0TA 3JW4A 1C0WA 3HTUA 5JVTA 1P2FA 2V9VA 1VTNC 4IXAA 1XGOA 2UWMA 4D0PA 5DUKA 4G7ZF 2EV0A 3WTUC 2QENA 2F5FA 4HV5A 4F7ZA 2K4JA 4O6JA 5D6EA 2ZCWA 2Y48A 4EGYA 3I59A 3DP7A 2ZMEB 2AXLA 2R7FA 4HYEA 1U6GA 1O57A 3F21A 2O8XA 3Q9VA 4ESFA 2PJPA 3E5QA 2DQRA 2ZBKA 4HBLA 1R22A 1W7PB 3ABTA 4P9UA 4IHSA 5LHIA 4U7DA 3DEUA 4A5NA 3ZP5A 1XMKA 2Z9OA 2QQAA 4KMUX 2M30A 4DQ2A 4Q47A 1S29A 2XVCA 1B4AA 1P92A 3TDZC 1JGSA 2OZ6A 1PP8F 3LWFA 1ZAOA 1KU3A 1FBUA 1DP7P 5LEKA 5E20A 2M5WA 2GAUA 4ENNA 2EFPA 5K5OA 2PFBA 2OA4A 3IC7A 4OINF 3K9TA 3KZYA 2KJCA 3BJAA 1ZN2A 2XROA 1MD0A 5CVVA 2Q8KA 1QQIA 1PUEE 3KLNA 2GZWA 2ISZA 4WCGA 2NS0A 5TRDA 1R7JA 5E18F 3RYRA 1F9NA 4G6DA 1MJAA 3RPUA 1BC7C 1IN4A 3DKWA 1EH8A 4RAZA 1O3TA 4WX9A 2D2WA 2O0YA 1BI3A 2P7CB 1IRFA 5DUIA 3IRRA 4WXCA 1K7AA 3ECOA 3U2RA 1AOYA 2HTSA 1A04A 4ZH4F 1ZRFA 1FWZA 3EYYA 3BDDA 5ERIA 4OIRF 2ESHA 5HS7A 1IN5A 3D5LA 4BHPA 2NAZA 2WTEA 4U0VA 4I7HA 3O2PE 1V3FA 2ACJA 5FD5A 1FOKA 3DQVC 1LEBA 1BIBA 2H6CA 4ZZLA 4IRHA 4ON0A 1TW3A 4YIIA 3WG9A 2KIFA 2PI0A 1UCRA 5AIQA 2KJBA 4MTEA 2VE8A 2KKOA 3QOPA 4G8XA 3ZMVA 1CF7B 1B9MA 2MH9A 2VOPA 3K69A 5LGUA 1Z9CA 5H6QA 3MAJA 1SFXA 2MD5A 5JI6A 2VBYA 1D8KA 2X0LA 3I5UA 3P7NA 1PP7U 1IXRC 4M9XA 3PQKA 3TO7A 3BROA 1QBJA 1ON1A 1SD6A 3I71A 3LSTA 1R00A 4PCQA 1TLHB 5HOOA 1K6OA 4IRIA 2DPUA 1YTYA 2V1UA 4XSZF 2IP2A 4HZFA 2IA2A 2Z3YA 4RS8A 2FNPA 1HQCA 1IN7A 2RGVA 1QZZA 1XB4A 2FMYA 2QM3A 2HKOA 2A61A 3LA7A 2Q0OA 3V4GA 4G6QA 3CUQC 2PQ8A 1BIAA 4KN4X 1DPUA 2GWRA 3WTZA 4RGRA 3LAJA 1J75A 1IN8A 1GXPA 3GW2A 2QBYA 2K7LA 1DUXC 2H09A 1QPMA 2ESNA 1J5YA 2LNBA 3GFIA 2L54A 5D4RA 5DCMA 2F5DA 3F3XA 2G7UA 1F5TA 2H94A 4UVBA 2ZMEA 3WTWC 3QP5A 2Q2EA 5FFZA 1MDMA 4UNOA 5F1RA 2YX7A 3IRQA 4XBFA 2O3FA 4IHTA 4EMSA 1I6XA 1S8NA 4GXOA 2W25A 2XV4S 4HX8A 5L3DA 2Y0MA 3KP3A 2PBIA 1ZLJA 3ZPLA 3FX3A 2VOOA 3QPTA 1RI7A 1ZRDA 4ZYHA 4B09A 4HDVA 1HW5A 2QUFA 4M6YA 3HOSA 3KCCA 3RIRA 3FXRA 3WTYC 3WGHA 3R61A 1LEAA 3RKWA 2A07F 1TTYA 2BYVE 1QZYA 4YG2F 3DPTA 3EETA 4UXNA 4I02A 3KP6A 1BN5A 2ZKZA 3P9KA 2K4BA 2XAJA 4AWXB 4MQVA 2L4AA 4KN7X 1WSUA 3HTSB 1IF1A 2CGPA 2DT5A 1KU2A 5JHUA 1F1ZA 4HW0A 4PZJA 3E5UA 4G9YA 4I01A 4AD9A 1FP1D 2O61A 1O3QA 1USTA 1TBXA 4L9VA 3RKYA 1Z6RA 4M9SA 4LG0B 3BJ6A 5CJ9A 5EEHA 3N4MA 4CGZA 3F72A 1IXSB 4M73A 5CYVA 5LRRA 3G73A 5JFRA 3WODF 2P8TA 2VODA 5L3GA 3BWGA 3AAFA 1MJ9A 2GA2A 1ZG3A 5E1XA 1SFEA 3G3ZA 2GQQA 1KQ0A 2D1HA 2XUBA 1HKSA 2FXAA 2ISYA 1K78A 5LRSA 2FQ3A 4PGGA 2EA2A 4MEXF 4MNUA 4A12A 1Z6TA 2PMHA 1BBYA 4Z2YA 1TQIA 4AVPA 3K2ZA 2GXBA 2DLLA 1YW7A 1ZGJA 3N97A
chains in the Genus database with same CATH superfamily
2FE3A 1OFCX 4XRFA 4U0WA 1FMWA 5DM7F 2QWWA 4A6EA 5DD8A 2N8GA 1YFHA 2X6XA 1LE8B 2R7SA 1V5EA 4LK0F 3CJRB 3F8NA 3I56I 3K2AA 1FYMA 1UHWA 5CQEA 1SD5A 3KP4A 5FKLA 3OWTA 5F6FA 1HLVA 4IOAF 1Y1VJ 3BR3A 2DFIA 3M7GA 5BMZA 5A2QZ 4W97A 4II3A 2FA5A 4M9ZA 5F0HA 1ZG1A 4L5IA 4D7MA 1FY7A 2R7RA 3FZVA 1KQ8A 1ULYA 2JVGA 4I76A 3JRCA 1X1DA 4P1WA 3MZHA 3KEOA 4DBQA 4PJ0C 3CJNA 3TP0A 1SC7A 4BS9A 2BY0A 2DMNA 5DS9A 3GLXA 2DQLA 3KEYA 4YFKF 4G7HF 4FE7A 3GZ5A 3NARA 2QSHX 4A6DA 3DBLB 5E17F 2X51A 1VQ4I 3V7CA 2W00A 2QYOA 3JR9A 3S8PA 3CMEI 3ASOH 2NVXJ 3K4MA 4KFCA 3VEPA 4HF0A 1OQYA 1SMYF 1JJ6C 2D5VA 1FOXA 2DFHA 1YQAA 3KPHA 3LL7A 3DXJF 4CCNA 1YLFA 4WXHA 3IL2A 2EB7A 2Z5UA 3IKVA 4B3XA 2EIJH 3LSPA 5CVIA 3ERMA 2XPWA 2AS5F 1G4DA 1EA3A 2O5RA 4GO1A 5J40A 3GZNB 1AA7A 1MGTA 4AIHA 3BLYA 2OTLI 2LP0A 2HZDA 3BCBA 1K78B 2K85A 1Y0UA 2JUCA 3RDIA 3ASNH 3FKIJ 2DDBA 2XAQA 2V1XA 2FOWA 3RJPA 3UNGC 2L02A 4KUMA 1IN6A 3BPXA 4OU0A 1D0XA 1OCZH 3D5RC 4EJWA 3HL2A 4HEA2 2LR8A 3PSIA 1TWAJ 3CC4I 3CF2A 2F5EA 2XDVA 2NOGA 3IWZA 3OV8A 2FD5A 3DTKA 4XSXF 5E1ZB 2XSJC 1KU7A 4N0BA 1ZHFA 2H6BA 2JPCA 4A2UA 4IZZA 1YW9A 2D1VA 1P7JA 3OOPA 2E36A 4DBRA 5J4YA 2LFBA 1JTYA 3HGGA 4L18B 2BEOA 1Y56A 3MKLA 4QPOA 3TGNA 2FSWA 1JGGA 4L9JA 4RMNA 3SYTA 3E6DA 3JTGA 5EEGA 2LREA 1S5LC 2XKPA 3CQZJ 1Z77A 4HRIA 3HRUA 1B72B 1AHDP 2R4GA 1R6RA 1B9NA 4AIJA 2K5CA 3ZN1A 5F0FA 1DU6A 2H27A 1IXCA 2PJRB 1RETA 1B6AA 3BZCA 3LA3A 1CF7A 3FF5A 4LD5A 5J1UA 3PJRA 2GM4A 3T0YA 2M0CA 1LFBA 2M8GX 1G6NA 3MMYB 1A5JA 3PIOF 1OISA 4HAMA 3JTHA 2CUEA 3MZYA 1FC3A 2OCCH 4GGGA 3RKQA 1YW8A 2E60A 5LGTA 2QF7A 3HRMA 2OC6A 1PDNC 1IZ1A 4WXDA 1E17A 4U87A 1QNTA 2ZXJA 2EILH 4F91B 1MNEA 3SZGA 4FCYA 3J80Z 1KZHA 4BQOA 4J00A 3Q0UA 1REPC 4CYDA 5D5VB 3G4SI 4ABZA 3TW7A 3S17J 4CYCA 3BR6A 2DCEA 1GV5A 3M8FA 3ZXSA 2DMUA 3I59B 3AL0B 2HGCA 1D3YA 3GFJA 2Y0SA 3KP2A 2HKXA 2P6TA 3A0HC 1KA8A 3HSEA 1LDKB 3RTRA 4B44A 3S2DJ 4MGRA 1FBSA 3FMQA 2GA1A 2P5VA 3FMSA 3SJMA 1ZREA 1ACIA 3K0LA 3VYUB 1ODDA 2F4OB 1YJNI 3CLQA 2V79A 2STTA 3RCOA 2F6CA 3WGGA 1JT0A 4B47A 2CW7A 3DU5A 4V2GA 4B4CA 1P4WA 3DEEA 1JKQC 2FQ4A 2LD5A 4GCVA 4ZJZA 3A2KA 3I54A 1YS7A 2LDUA 1VQMI 4FASD 4ZDOA 4K2EA 1FNNA 2XF7A 1O7FA 1MJBA 1IRXA 3CDLA 5DYMA 4CZZA 5D6FA 3ABMH 5BNGA 3ZQLA 2CU7A 2OCEA 3TKYA 3K1MA 2QSFX 2HPIA 1GXQA 4JBAA 5IP7J 4RB2C 4F93B 1LNWA 4BNCA 3DV8A 3CMAI 3IUOA 3CJQB 3JAMZ 3DLAA 3VSKA 3QQAA 2OQRA 2XHKA 4S04A 2IRFG 4UV9A 1MBJA 2VBZA 3ZMSA 3L2VA 1FSEA 4XORA 1IG7A 3CZ6A 5IYDJ 1MZBA 3F8CA 3WE3A 4A5MA 1QO0D 1CGPA 1IRGA 4LLNA 5H2FC 2Q1ZB 2ZNYA 3E6MA 2UUZA 4MQ9F 1QGPA 5FLXK 1R1TA 2BGCA 3PSFA 3DTEA 1UFMA 4S0HB 1HBXG 4UUVA 3QRFF 3QAHA 2E2JJ 4HDUA 1K61A 1X4OA 1FOYA 3LQRA 4IPAA 1BW5A 1IV6A 3L2QA 2A6HF 4KMFA 1ZH5A 2JA5J 3Q5FA 3W2AA 1WJ5A 2V7FA 3KLOA 2HVRA 1SVOA 2H1LA 4KT6A 3G6EI 4GFBA 1TL8A 2IPQX 4JQFA 2EFOA 1O3RA 2JA8J 1MSFC 3GEZA 3VPRA 1OCRH 3RPUD 4XKCA 4B48A 4AYBA 1E2XA 1UAAA 2L01A 5LHHA 2IGMA 4DOZA 4NDLA 1WRJA 4ZYDA 4IOCF 3S32A 2VKDA 2A68F 3K4BA 3HOZJ 2FX0A 2DK8A 2I8DA 2L7FP 4HV6A 3T8TA 2R5YA 1ENHA 1OCTC 5E3MA 5BOXA 4G7OF 2PN6A 3JAMK 4I0AA 3KYCB 2BHZA 1W1WE 4BYYA 1MMNA 2LMDA 2JZYA 2W85A 2ZC2A 2G9WA 1JKRC 3S14J 3U1DA 3FWEA 3WU1B 2ELHA 1XSVA 2L7ZA 3RYPA 5GADJ 1RRJA 2L4MA 1JUSA 4IHWA 4S05A 4KIGA 1DDNA 3VYSB 4DZPA 2MLKA 3M1CA 1J09A 2R93J 5C3EJ 3CLOA 5E3LA 2VKEA 3C18A 2CSOA 2XAFA 4E70A 1SAXA 4DZJA 3B02A 4F55A 1XMXA 3IH3A 3KEQA 1W7PD 3S1QJ 1ETVA 2X48A 4EM0B 3DU6A 3JSPA 2LF8A 1STZA 2HQ5A 3F9KA 3SXYA 4BHBA 1JUPA 3HSFA 3ABKH 2BY3A 3ZQHA 2XRNA 3CF5F 3IKTA 3BR1A 1TP4A 4LG3A 1UG2A 2ADUA 2R7DA 3WTVC 1EJ9A 2BZTA 1N78A 3OYIA 3WTSC 3JCUC 4A3MJ 3DTIA 1W0TA 4LK1F 1R1VA 1USSA 3FDYA 4FHTA 1VQOI 3P9CA 1T2KA 1FSHA 1IUFA 2K9SA 2LC2A 4LIVA 2MLGA 1R1UA 3GO5A 3WHBA 2LG4A 3KYLA 4RA2A 1YJWI 5GP9A 3CD6I 4N9HA 4XICA 2WB1N 4Y7NJ 4PJJA 2IA1A 1WVRA 2JJ7A 1KQ9A 2GXAA 3CMYA 3TOBA 1TWGJ 3ZMTA 3PUBA 3PFIA 2DXIA 2X1DA 3JRFA 2HOTA 3MQ0A 3E97A 2M9HA 1XMAA 5LD2C 1B59A 3DWLE 4UY8I 2IT0A 4KA4A 2XGEA 4LGWA 2F2EA 4ENJA 2JSPA 1W36D 1ZR4A 1U5TB 1I1GA 2CG4A 2LY1A 4D5CA 4M3EA 2WAFA 4ZYGA 2W1OA 1MMGA 4AIKA 1ON2A 1LVAA 4JX6A 3NWSA 2WBMA 2P5LC 1V55H 3U1KA 3TP3A 5D5XB 4NHJA 2JK3A 4OWRB 3C3WA 2KP6A 3KP7A 5FRMA 3DPLC 2M7BA 4KICA 4OIOF 1AU7A 2XB5A 3ZMDA 5C4JJ 2PG4A 2A5WA 2EFWA 2R7QA 3S3MA 2PJRA 2O03A 2Y75A 2HR3A 3SQNA 2TDXA 3PIPF 4M74A 2DT7B 3BG5A 1OCCH 2JSCA 4U0YA 1K6YA 4Y13A 4XQFA 1XN7A 3BT9A 2L2OA 2GIVA 3DPUA 1T38A 3HGYA 3M4OJ 2COBA 3KX2A 3SFZA 1WCMJ 2QQ9A 5HVQC 1HKTA 4W1UA 2CJJA 3AG2H 4LLLA 3I55I 5M3MJ 2HOEA 3MN2A 4NB5A 3TMOA 3KE2A 2PX9A 2KIQA 1ZYRF 2JT1A 4A69C 3SHFA 4Q4ZF 1JKPC 4WWCA 3C1DA 5CVUA 3GTOJ 1ETKA 4FX4A 2K9MA 4CCOA 4OIQF 3JREA 4EVIA 2E34A 3HIFA 1T98A 3LSJA 3V42A 4OMZA 2AO9A 5K7HA 5EGOA 1U78A 2IS1A 4XKBA 4IQJA 2P6SA 4ZDPA 2NRAC 2RV8A 2FF4A 3GFLA 3CCVI 2JRTA 3ECHA 4AUXA 3SZTA 2WWYA 3A01A 4DJAA 2R7VA 3EQLF 3BY6A 3H36A 2HS5A 1R71A 2ECCA 2G7HA 3T8RA 1W4MA 2DA4A 3OYNA 3RQ4A 4PK4A 4YIFA 3E6BA 2VL8A 5KCMA 3VODA 3FXLA 3H9QA 3I4NJ 2F5CA 3HG9A 4OIPF 3TO6A 2QBYB 1WKMA 2RNGA 1JXSA 5DD4A 3BG3A 3EYIA 2PLYA 1D1BA 2WB1A 2RNJA 2HYJA 2IA0A 2JWTA 3KP5A 5IOYA 4FISA 2VBXA 2GIZA 4CH7A 5EJCA 3IWFA 4MTDA 4LJZF 1I27A 1S7AA 5J8CA 2EIMH 5LLQA 4GYIA 3ESWB 2P81A 1VQKI 4A0XA 2KRFA 1SFUA 1E3PA 4D9JA 2DW4A 2JVHA 1D1AA 2IJLA 4JX5A 4A3FJ 2F5VA 3IHUA 4DYRA 5EG0B 5F1JA 2ZSHB 3RKXA 3VB2A 1U5TA 2HFHA 2EZKA 4RB1A 2CMPA 1MSEC 2QZ8A 1J59A 2EIKH 3WU0A 3FIWA 3CCJI 3MFKA 1PUFB 1BR1A 4EEFG 1S7OA 5B1BH 2JA2A 2FBIA 2RC4A 2WADA 1P9QC 1HSJA 2X6YA 3CC2I 3K70C 1Z05A 1UG0A 3ZQFA 2M8EA 1TT0A 3CJTB 1YX5A 2AQEA 4BQAA 2RVCA 4HQEA 3OYDA 1XG1A 1MNDA 1ONVA 2AQFA 5EZGA 4BY1J 4A93J 3K4LA 1ZELA 5FKMA 3W6KB 1A31A 4EJOA 4PGHA 1UHMA 3RZDJ 2E19A 3LSHA 1R5ID 2CO5A 3HHGA 4A0YA 2K86A 3E5XA 3PO3J 5FO5A 3CO7C 3HOTA 2XB0X 1TQPA 4R8HA 1ZQ3P 3UKGA 1A6QA 1JHFA 3ZRGA 3K1PA 1WPKA 1KYZA 5CLSA 2DA2A 2HWVA 5D5WB 4B1RA 1P7IA 3GTQJ 3FKJA 4Q48A 3LOCA 1V4RA 4BXUA 4IHXA 4UVAA 1M1EB 4HLXA 2E1MC 1LDDA 4HX7A 3BCAA 1BOBA 2ID3A 3ZQ7A 5K5RA 2VIXA 3KYDB 2YR2A 3TO9A 4BHCA 5E8IA 4XR6A 1JHHA 2VXDA 3K4JA 3RSNA 5HODA 1K83J 4PSWA 1Z7UA 3TL4X 2UXNA 4F3QA 5FB2A 3QPHA 2P0WA 2P7VB 4NNJA 3WHCA 2QQBA 4EJUA 1BI2A 3O6BB 1WJFA 2W57A 3WGIA 2PMZN 3KZZA 2DTRA 3JRDA 5ILSA 2QVOA 5H20A 3OYEA 3CCUI 1D5VA 2ZJQF 2XAHA 2VB6A 3QU3A 1HXDA 1WJBA 2BY2A 4AIDA 4AC0A 1H9GA 3CC7I 2KZVA 2KFDA 1H9TA 1BJZA 2MA3A 1WI3A 1ZKGA 1GUUA 5IT9K 3FK7A 1ETOA 1W5TA 1D1CA 2P4WA 3CUOA 3W2VA 6PAXA 3V8LA 3OYCA 2DODA 5L3BA 5F0CA 4BL0B 1SD7A 3LSKA 4CICA 4HX4A 2W84A 1S9HA 5HDGA 1VI0A 1IC8A 1VQNI 1ZG5A 2HYFA 2LKXA 4L0YB 4P5OA 1QZEA 3VOEA 2HDDA 1FLIA 2LOOA 1Z67A 2JN6A 1APLC 5DDGA 4IJAA 4ESJA 4BBSJ 2FRHA 4V19K 1IO2A 5AIPA 2H8WA 3S1RJ 3DF8A 4UB8C 5DEQA 4QLCU 5FLXZ 3ERED 5DV5A 1X3UA 2R7WA 3AKZA 1FTTA 2OD5A 3S2WA 4L9TA 4UUSA 4ANJA 3BTJA 1W36C 3ABLH 5C4XJ 3FXMA 1RIOH 3ZMZA 3LA2A 1XGMA 1GV2A 4BEHA 3OOUA 3HPGA 5CVJA 3GVAA 3ONQA 2EWNA 3O8HA 4H4KC 2ZJRF 1O3SA 5FRNA 1Q1HA 3F8MA 2EFQA 3HB9A 1T56A 5D4SA 2EV5A 5ICGA 1TQMA 3HHHA 1FP2A 3W3CA 5DCMB 2W4SA 4KIFA 3PNVA 2QCOA 3EUHC 5D8LB 3JRHA 2OQGA 3FBIB 4KT5C 3TQNA 1OPCA 2WV0A 3OMYA 5K5QA 1NHAA 1HC8A 5HLHA 2XF5A 2J5PA 3Q0WA 4II2A 1X1AA 1V5GA 2RDPA 2I10A 3L7WA 2A6TA 4EM2A 2Z16A 2LSOA 2DOFA 4N4OB 5ILUA 5LFAA 1UJ8A 4BKXA 4BXXJ 2IGKA 4RGSA 1LJ9A 4IVNA 4RAGA 5KVRA 4G94A 4UV8A 3Q9SA 2DN0A 5J8FA 3L2UA 2DMQA 4R79A 5FFXA 3RQIA 4MIMA 5GPCA 3HUGA 5F27A 1BI1A 1D8JA 2DA7A 2VPRA 3FMRA 3IAM2 4ZZDA 4E7HA 1G2HA 3V7RA 1ORKA 1O7LA 2DK5A 4RM2A 2M7AA 2IBDA 4I98B 5DCFA 4RGXA 2COMA 4EQQA 2DA3A 2GLOA 2DTZA 1IAWA 1OYWA 1EKEA 4PUSA 4WK8F 5KAIC 3FISA 2Y9YA 3ELKA 2ME6A 1FX7A 4QIWN 4IRGA 4IF4A 1XCVA 3MZ8A 4LFUA 1P4AA 5E1WA 5KNLA 2GBYA 2TRTA 5ED4A 5HS8A 3A4CA 4RAFA 2YUSA 5FD6A 3TEDA 1RUNA 2XF6A 1WWXA 4XOPA 3FHZA 4CDGA 4D5FA 5GAHJ 2ZJPF 1KONA 3ULQB 2L3DA 4L5JA 5EZHA 1IW7F 4RBOA 1WHUA 2V1DA 4D7NA 1ZGAA 1XSXA 4ASNA 2HEOA 3S93A 1HW2A 4AYBN 3TDUC 2MBFA 4C3HJ 1AKHA 2DMTA 4U88A 4MHGA 3A03A 5M3FJ 2CUFA 2RREA 1YRNA 4X6AJ 4XNFA 2ICWG 3KFWX 2CFXA 2MABA 3MCZA 2Q2EB 1OJLA 4C2TA 5JVGF 1BI0A 1MDMB 3WG7H 1VQ5I 4IEJA 1S6LA 4LOCA 3MKZA 1S3JA 2RKHA 3CO6C 2CQNA 2VT3A 5J1RA 4MEYF 1NTCA 5L3FA 1YIJI 3CCQI 1WH5A 4A0ZA 5KK1A 1MH4A 3CUQA 3CESA 2W82A 4QPQA 1XDSA 1GVDA 1YOVB 1J9IA 3GTGJ 2RN7A 3QP6A 1BM9A 1SEUA 1RZ4A 1T8IA 2HI3A 5TJJA 3J81K 3N97A 2OAZA 3GZ6A 2GOXB 1UHSA 1U3EM 3GUDA 2ZFUA 1T0FA 4P9FA 2MH2A 3F6OA 2DAOA 4HSRA 1ZR2A 3ZMUA 1I5ZA 3U21A 3EDPA 2V6CA 4GRIA 4M72A 2KT0A 1B8IB 4L9NA 1I3QJ 1FZPB 4A3EJ 1PYVA 2MC4A 4XL9A 2IS6A 3RI4A 5HS9A 2E7XA 3L1PA 4HF1A 2FBKA 2A5YB 2OF7A 2Y9ZA 1UMQA 2FOKA 2WV1A 3I3LA 3F6VA 3B73A 1SMTA 2ZXWH 1OMIA 1EH7A 3NRVA 1YX3A 2EV6A 1L3LA 1X2MA 1YYVA 2CQKA 3L00A 3CP2A 5EYRA 5ILVA 2PMUA 1ZK8A 2O8KA 3VDXA 4YEJA 1HA8A 4BUPA 1OKRA 2R7OA 3LAPA 2HZTA 4RB0A 3S15J 4JP0A 3ZR8X 4ZTJA 3PO2J 3ZN0A 1XGNA 1TWHJ 1ZLKA 3IH2A 2R3SA 4NC8A 4LB5A 1ZRCA 1R58A 3HJEA 1HKQA 1POGA 3W6JB 4ETSA 1RC9A 1VZ0A 3FXQA 2KRCA 3CDIA 3F8BA 3BZKA 3E6CC 1H0MA 1XGSA 1W5SA 2PEXA 5D8KB 2E5NA 2KIUA 1UB9A 2Z1DA 4RLFA 2UXXA 4PJNA 5H6RA 4YIRX 4E7SA 3HOUJ 3B6CA 2L9NA 4KYWA 1R4MB 1OYYA 4Y17A 1RR7A 2CUZA 3FXOA 3HM5A 4HF2A 1AWCA 1FBQA 1OR7A 4HSTA 2BV6A 4ZYEA 3REOA 3A01B 1SFKA 3PQJA 5E3OA 3D5SC 1UELB 4BGDA 2KRHA 2WAEA 3L9FA 1QVTA 3HC7A 4CSWA 1MBEA 2RQPA 3FHNA 4U7BA 2W24A 1EF4A 4LITA 2OZUA 3CP8A 4HOBA 3BPVA 2A69F 4KIBA 3HRTA 2FBHA 3R4KA 1TNSA 5BQTA 3LFKA 1G3YA 1P4XA 3RPQA 2YU9J 3X2QH 2X6WA 4FTHA 4BACA 1JTXA 3BZ6A 2JTVA 1U5TC 3F22A 3J81Z 3G1LA 2L9SA 3C7JA 1U2WA 4RLQA 1ETYA 4D1QA 2CWEA 1HDPA 5FKNA 5J3LA 2R7ZJ 2JMWA 2LTPA 4QWQA 2NXNB 1WQ2A 1F4KA 1X19A 1D0YA 4C2MJ 2R5ZA 4TV7A 1S7EA 2EK5A 2NNNA 3HKZN 5D5UB 2RQQA 4AU7A 3FM3A 1YO5C 3H0GJ 2NVUB 1A6IA 2BE5F 1Q1VA 3S1MJ 1J2XA 2IXSA 1NG6A 4RAYA 4RDUA 1H88C 3PFYA 4A3JJ 5ICFA 5JR3A 3OL4A 1PUFA 3L2WA 3NEUA 2HVSA 2X1EA 5HLTA 4ENKA 4KNYA 2VJJA 1W5CC 2MW8A 2E2HJ 1U0JA 3AG1H 3G1MA 3GXOA 4IL6C 1MIJA 3GBGA 2VC0A 3Q0VA 4IX7A 1JI8A 5IOZA 4CHUA 1HW1A 3BQYA 2ZO4A 4XRSG 1I50J 2EA4A 3W6VA 2K3PA 1D0ZA 3DKYA 3COAC 5EF6A 3W2WA 2WY8Q 1GDTA 1K79A 4ESBA 2ZFWA 3MWMA 3SDBA 3GTMJ 2NS8A 2DOEA 1R5HA 2ZNZA 3AG3H 4MFEA 4H0EA 4G12A 1KGSA 3ZQCA 1R5GA 1T08B 4JX4A 1JJ8C 5IP9J 1Y39A 2F48A 1F36A 3LQQA 4I0BA 4LLGF 2B0LA 5A2QK 3J7AY 3A0BC 2LLKA 3HSRA 3DFGA 5HNHA 3H3UA 2TCTA 3H5NA 2LRDA 4Y52J 5ICEA 3OS1A 3ML6A 4DNCA 1X4PA 4ZTFA 4OOIA 4RB3C 5IYCJ 4OMYA 2YPRA 3WE2A 2AHQA 2LF7A 1BOAA 2XASA 3F23A 1BL0A 2VBWA 1RR8C 3H5RA 4KITB 2A05A 3PNTA 4KDPA 2HDCA 2VKHA 5K7FA 4A3CJ 2FEZA 5CPRB 3ROUA 4M71A 1RKWA 3NQOA 2DA5A 5DTDA 2W7NA 5EG0A 4CXFA 3DKXA 4BXFA 2DBBA 5GPAA 2LBFB 5FKKA 2Z99A 3V8KA 4CZCA 1ERDA 2KIMA 5FGMA 4Z6YA 1N77A 1XPXA 4PFPA 4E7ZA 1R23A 3CCEI 4EM1A 5JHFA 4CA0A 4I6ZA 2M87A 1G3SA 3GWZA 4CCLA 2A6EF 3V7SA 4B3AA 5J6XA 2HPMA 3T1BA 2VPLA 3LNQA 3TW6A 2JUGA 4BH9A 3GFMA 2I5UA 2IVMA 2HYGD 4EV0A 4ZYAA 3FXUA 3HYIA 1WJCA 2VJ5A 3HOWJ 1B1BA 3BTLA 4XKVA 1TNTA 2L9RA 2BBYA 2ZMEC 1O4XA 2L7KA 4UVCA 5HLIA 1J0RA 4LMYA 1R9TJ 2WC2A 3OR1C 1YG2A 2ID6A 3L2RA 2CYYA 3SZPA 2Y2ZA 2VXZA 1EV7A 1FT9A 3QPSA 2J5OA 3AG4H 1Z91A 2HQRA 3GCMA 4A3DJ 2XGXA 2BXZA 3G71I 4BEHB 1WZ2A 3ISPA 2YU3A 4UHTA 2CQXA 2VI6A 3CDHA 2V9PA 1T6SA 2X6OA 2CFOA 4PJMA 2R92J 2OU2A 4IKFA 1WJEA 3HKZA 3FBNB 2NOJB 5BPDA 3P9IA 1NG7A 4WF2A 3ZQIA 4AM3A 2MSYA 2EZLA 1QVUA 3U9GA 2DFFA 1XD7A 4CYCB 1IDZA 3K6GA 3FK6A 1SAUA 1ZGWA 5IT9Z 4XLEA 3S16J 2HU9A 2L0KA 4PDKA 2DU9A 1A35A 3BOQA 3R0JA 5FJ8J 2Z2SB 1DU0A 2KHMA 5BS6A 5AONA 1T39A 4N9IA 3H0DA 1EH6A 2CV2A 2GXGA 4F52A 1GLNA 4M3FA 5HDKA 2ECBA 1YIOA 3CCYA 2CUJA 1RPWA 3I64A 3TOAA 5IY5H 4L5EA 3ABUA 2V9KA 2XKOA 1XDUA 2OUMA 1J7KA 1TWCJ 3BJOA 3H3ZA 2FUG2 1L0OC 2STWA 3V8JA 4ENMA 3DLLF 2NYXA 4M6XA 3HRSA 3OYGA 3J80K 2MC3A 1LB2A 2DO7A 4LG0A 5L3EA 3L2CA 3D1NI 1KYWA 4P55A 4DYQA 5E8GA 3FM5A 2JA6J 2VONA 4XLPF 2IGOA 1FJLA 2FJ1A 1QHGA 1YE9A 2ELKA 2E1OA 2FMLA 3H92A 5FLMJ 3HXLA 2YSRA 1S72I 1WH7A 4FX0A 2CQQA 1RNLA 4DYCA 5M5XJ 1IUYA 1XCBA 3CTAA 3M9AA 1E0EA 4XLAA 4KISA 2ME0A 1X58A 3GTLJ 3H9JA 1TW2A 4HLYA 2X85A 1WJDA 3K1NA 2KISA 3T5XA 2E1CA 4MLOA 4MFDA 1W7PA 1I1SA 4N4NB 2A3SA 1KU9A 3WTTC 1T0FC 4XRSA 1LFPA 4CO8A 3FXKA 4LB6B 1SFOJ 4B43A 1YRNB 2OTJI 4I09A 2FNAA 4XM3A 4MO7A 4HNVA 3GF2A 4NUBA 4EJVA 4RGUA 1SD4A 1G3WA 3QU6A 3VWBA 2HTJA 1XC5A 1H89C 4F92B 2HQNA 2OBPA 4IQ4A 1T95A 5HLGA 3O3KA 3G1OA 2CRGA 2VQCA 3OYJA 1FEXA 3G2BA 1R36A 2DYSH 3H35A 4RM3A 3CUQB 1GT0C 1V5FA 2M45A 4PJLA 1BR4A 4JK1X 5BPIA 4XONA 4YRVA 4XN3A 1LUJB 4KJZA 2M0MA 2LY2A 2BOLA 4J01A 2KMUA 2IGNA 3C2GA 3HEFA 3GX4X 5KHDA 2K27A 3BP8A 3F8FA 2JPBA 5LHGA 4EGZA 2JRMA 2K9QA 2XIGA 5LBQA 1BC8C 2M1BA 3OYHA 3MEXA 2ZJ2A 4O5VA 2E7WA 3AFHA 2VT2A 2C6YA 2DT6A 1X3ZB 4B8XA 3OYLA 1HOMA 2JQ7A 2EQRA 3EUHA 2VE9A 1DPRA 4M3DA 5GTIC 2V26A 2XGDA 2VC1A 1MKMA 4QSHA 4YFXF 5K1YA 3KZIC 5FKOA 2E2IJ 2H1KA 2O6GE 5HDNA 3K4NA 3N05A 4BQNA 2QKMB 3I4PA 3R0AA 1MMAA 1WGXA 4BAYA 3WTXC 4NQWA 1MMSA 2VN2A 2D45A 4AVZA 2HVQA 2QLZA 3I53A 5IPAA 2CW0F 2DFEA 1GHCA 3DBHB 1DP3A 1G8XA 1P6RA 5CVRA 1ETQA 3QPLA 3IH4A 2QEXI 1G3TA 2LY9A 3VFZA 3E3VA 2LYCA 2BVLA 3HZJA 3I4MJ 4Q5SF 2M4KA 3H3VK 1R4NB 2K02A 5IT3A 3JSOA 2YX4A 5LEJA 1XSDA 1FYKA 4GYGA 4XLNF 3R6SA 3LMMA 1FOWA 5ICCA 1X3WB 2QQ8A 4L0ZB 2FU4A 2O9LA 3KIOA 1VQ8I 4HQMA 2KQRA 4R1HA 3GTKJ 2KZGA 3EUAA 2NVTJ 3J7AO 3OIQA 3DBRB 3R60A 1FPQA 2ETHA 2NVQJ 1GVJA 1DQUA 1X2NA 1LDJA 3L09A 4A3LJ 2UZKA 1QRYA 4XLHA 2XGCA 1Z21A 3M1EA 4A3GJ 2R5YB 1YS6A 2DJNA 1Z1DA 2HDWA 5F64A 1RKTA 2EFNA 3OSFA 4BY7J 4UB6C 2ZXHA 1Z3YA 3S3NA 2BHYA 4NBQA 4CUGA 3J7ZI 1U8RA 2V6EA 4HA8A 2X4HA 2Z33A 1FYLA 2B9SA 3D0SA 2LKSA 2VASA 2MG4A 3LSIA 3GYHX 1WJAA 2OJED 1B72A 3M8JA 1RUOA 1QU3A 4Y15A 3K4CA 4EJTA 4JOMA 1OYIA 2NNYA 2IS2A 1K4TA 5FLVA 2DPDA 4FT8A 3GMEA 3E1SA 1LQ1A 3QYEA 5LGNA 1JE8A 2F4MB 4O3MA 2E1NA 5IP6A 3OL3A 3WU2C 3M07A 3M8EA 3KETA 2ELJA 5TISC 3BQZA 1BJAA 5J1YA 4OAZA 1Z7LA 3BG6A 1Y6IA 2XAGA 2DI3A 2DA1A 1WI9A 3TBIA 1ZARA 4YFNF 4Y33A 4E7JA 2EJRA 2Y30A 3VYTB 4I2OA 1HSTA 3UR3C 3BG9A 5L3CA 1DGWY 1MH3A 3I58A 4P96A 4BBRJ 4BJ6C 2IW5A 2P5KA 2LKPA 3I0TA 2KDOA 3JW4A 1C0WA 3HTUA 5JVTA 1P2FA 5K7ZA 3E0JB 3OYBA 2V9VA 1VTNC 4IXAA 1U9OA 1XGOA 2UWMA 5B3SH 4D0PA 1MW7A 5DUKA 4G7ZF 2EV0A 3WTUC 3BR0A 1YHQI 5EDNA 2QENA 2L7MP 2XPVA 2F5FA 4CCJA 4HV5A 4F7ZA 4IO9F 2K4JA 4O6JA 5D6EA 3HDDA 2ZCWA 3K4KA 1VQ6I 2Y48A 4EGYA 3I59A 3DP7A 2ZMEB 3EUKL 2AXLA 1VQLI 2LK2A 2R7FA 3HUGB 2MYSA 1HCRA 4J19A 1E3OC 3IP4B 4M3BA 4HYEA 1U6GA 1O57A 3F21A 3BG7A 3H9GA 3A02A 2O8XA 3B6AA 3Q9VA 3QYBA 4Y4RA 1LVKA 4BJTA 4ESFA 2H8RA 1MBHA 2PJPA 2V1NA 2VQLA 2DQRA 3E5QA 2ZBKA 2WY7Q 4HBLA 1OR7C 4E7LA 3BTCA 1R22A 1U8BA 1W7PB 3ABTA 4P9UA 4IHSA 5LHIA 4FETA 2IEKA 4U7DA 3H5AA 3DEUA 4A5NA 3ZP5A 1XMKA 4C9YA 2XAUA 4HG2A 2Z9OA 2B7EA 2QQAA 4KMUX 2M30A 4DQ2A 4UUSB 1TT5B 4XLFA 4Q47A 1S29A 2XVCA 1JUMA 1B4AA 1P92A 3TDZC 1JGSA 2DYRH 2HOSA 2QA4I 2OZ6A 1PP8F 3LWFA 1MBFA 3S1NJ 4ZDLA 1ZAOA 3QODA 1AKHB 1KU3A 1FBUA 1DP7P 3M3YJ 5LEKA 5E20A 2M5WA 3HOVJ 2GAUA 1VF9A 1Z3XA 4ENNA 1LE8A 3LSGA 1XS9A 2Y69H 2EFPA 1Z0XA 1BA5A 1V54H 5K5OA 2PFBA 5F08A 2ZB9A 3LFUA 2BXYA 2OA4A 3IC7A 4XMYA 3HOXJ 3S2HJ 4OINF 3K9TA 5J47A 3OYKA 2WA0A 2G0EA 2MGQA 1HF0A 3GLLA 3KZYA 2KJCA 1Y8RB 4BE1A 3BJAA 3MD2A 1ZN2A 2XROA 1MD0A 1I39A 2QGUA 3K7AJ 5CVVA 2Q8KA 1QQIA 1VQ7I 1PUEE 3KLNA 2GZWA 1VFCA 5GAEJ 2ISZA 5M5WJ 3SEZA 4OAYA 1PJRA 4WCGA 2NS0A 1IGNA 5TRDA 1NK3P 1CQTA 1R7JA 3OSGA 4A3IJ 5E18F 1SVMA 5B5EC 2E5ZA 3OIPA 1XX5A 3RYRA 4BU2A 4X1EA 3SDGA 3JRGA 1F9NA 4G6DA 1MJAA 4XK4A 4XRMA 1IJWC 3E7LA 3RPUA 1BC7C 4A3BJ 1FMVA 1JKOC 1IN4A 3DKWA 1EH8A 4RAZA 3AL0C 2EZIA 1O3TA 9ANTA 4WX9A 2BW3A 2IS4A 2NVYJ 3J7YJ 1FIAA 2CH0A 3QOEA 2D2WA 2O0YA 2VQHA 1T33A 4PFOA 1BI3A 2P7CB 1IRFA 5DUIA 3IRRA 3OYMA 4HNTA 4WXCA 2R7XA 1K7AA 3ECOA 3U2RA 1H8AC 1AOYA 1X1PA 2HTSA 1A04A 1ETWA 2M4GA 4ZH4F 1ZRFA 1FWZA 3EYYA 3BDDA 5ERIA 3QYFA 4OIRF 2ESHA 5HS7A 2K40A 1IN5A 1QHHD 5JLXA 3A1YA 3D5LA 2LBFA 4BHPA 4XIDA 2NAZA 2WTEA 2EINH 5HNFA 2M2EA 2XC7A 2R7UA 2L9VA 4FQGA 4I7HA 4U0VA 4CCMA 3CCLI 3RZOJ 3O2PE 2LH9A 3C2HA 1V3FA 2R7TA 2ACJA 5FD5A 1FOKA 1K4SA 3VSLA 3DQVC 1HDDC 5KAFC 4E7KA 4X0GA 1LEBA 1BIBA 2H6CA 4ZZLA 4IRHA 4ON0A 1X1BA 1TW3A 4PSXA 3Q3SA 5E79C 3OR2C 4XN0A 4YIIA 2LVSA 2WAQN 3JRIA 5EGOB 3LSMA 2F4IA 2M3AA 2AXTC 4GDFA 3WG9A 4BDZA 2DDAA 3OS0A 2KIFA 3ZGKA 5FROA 2DA6A 2HOAA 4A3KJ 2PI0A 1UCRA 5C44J 2YS9A 3PUFA 5AIQA 2KJBA 1SANA 4MTEA 2VE8A 4XOTA 1ITYA 2KKOA 3QOPA 4G8XA 3ZMVA 1CF7B 1B9MA 2MH9A 4M3GA 1FTZA 2VOPA 2UV1A 3K69A 4C30A 5LGUA 3K10A 2OPTA 1Z9CA 5H6QA 3NAUA 4I99C 1Y1WJ 1W0UA 2PMZA 3HOYJ 1U9NA 3MAJA 1SFXA 2MD5A 5JI6A 4XKWA 5E3NA 2VBYA 1D8KA 4C3JJ 2X0LA 2ZSIB 3I5UA 4E7IA 5B1AH 3P7NA 1PP7U 4ITVA 4BE2A 4NC6A 1IXRC 2R5ZB 4M9XA 3H1CA 3PQKA 2CW8A 3TO7A 4LIUA 2Y31A 2CS3A 5TGTA 4FE4A 1TZLA 3BROA 2CQ7A 2K3FA 1QBJA 1ON1A 2K9NA 2NS7A 1SD6A 3I71A 3LSTA 1R00A 4PCQA 1TLHB 4HPQA 5HOOA 1K6OA 2EZHA 5B66C 4IRIA 3OS2A 3PM1A 2DPUA 3ZQGA 1YTYA 2DOAA 2V1UA 2V4JC 4XSZF 1FIPA 2IP2A 4HZFA 2IA2A 2Z3YA 2VQGA 3LSRA 4RS8A 2FNPA 1HQCA 2EPFA 1IN7A 2CV0A 2RGVA 1QZZA 1XB4A 2O7OA 2QSGX 4CCKA 2FMYA 2DMPA 1UZCA 2QM3A 2HKOA 2A61A 3ZOBA 3I9V2 4DW6A 1G59A 3LA7A 2Q0OA 2RAEA 3V4GA 4G6QA 3CUQC 2WAQA 3C2BA 2PQ8A 4BE0A 2M34A 3OYFA 1BIAA 4KN4X 1QPIA 3QWLA 3EPZA 1DPUA 2GWRA 3WTZA 4RGRA 5J4VA 3LAJA 1J75A 1IN8A 3CMMA 2HXOA 1GXPA 2HNHA 2OV7A 2VKVA 3GTPJ 3PNYA 3GW2A 2QBYA 2XRLA 2K7LA 2XPUA 5CQGA 3ZCOA 1DUXC 2H09A 1QPMA 1E3HA 2ESNA 1J5YA 3CCRI 1ETXA 3DEWA 4QTRA 1LPQA 2LNBA 3GFIA 2L54A 5D4RA 1I6HJ 4HNUA 5DCMA 3MKWB 5M5YJ 5JLWA 2F5DA 4IHYA 3F3XA 2G7UA 1F5TA 2H94A 1A36A 4UVBA 4C3IJ 2ZMEA 3WTWC 5CKTA 1TWFJ 2JA7J 3QP5A 2Q2EA 5FFZA 1MDMA 2QKLB 2L5QA 4UNOA 5F1RA 2YX7A 1VQ9I 3IRQA 4XBFA 3K70D 1NK2P 1XTAA 2O3FA 4IHTA 5EEAA 3ZQQA 4EMSA 3P5JA 1I6XA 1S8NA 4GXOA 4DIQA 2W25A 5IYBJ 4E6KG 1LKXA 2XV4S 4NC7A 4EATA 2B63J 4HX8A 5L3DA 2Y0MA 3HBLA 3DCFA 3KP3A 2PBIA 1ZLJA 4NQWB 3ZPLA 3FX3A 3JRAA 2VOOA 3QPTA 2X9DA 4IHVA 1RI7A 2VLAA 1ZRDA 2KPMA 3MKYB 4YELA 2CV1A 1IDYA 2ZXIA 1RESA 4ZYHA 4B09A 4HDVA 1HW5A 2QUFA 4M6YA 3CCMI 3HOSA 2GOMA 2R0QC 3OYAA 2E71A 2KL4A 4ZC3A 3PL8A 3KCCA 3VYRB 3RIRA 3FXRA 2HXIA 1Y8QB 3MVPA 3WGHA 1BR2A 3WTYC 1BW6A 2DJIA 3R61A 2XSDC 1B8IA 1LEAA 3IAS2 3RKWA 2A07F 1MBGA 1TTYA 2E1MB 2BYVE 1QZYA 4YG2F 3DPTA 3EETA 4UXNA 4I02A 3KP6A 1BN5A 2ZKZA 3P9KA 4V2FA 4BDYA 3OIOA 2K4BA 2XAJA 1PVEA 1YITI 1Y0NA 3BC8A 2VJIA 1VQPI 3IV5A 2HQAA 4AWXB 3BR2A 3HPHA 4MQVA 1F43A 2MD0A 1MBKA 2L4AA 3OY9A 5DM6F 4KN7X 4Y3OA 5GAGJ 4BQQA 1WSUA 2VJ4A 3HTSB 1IF1A 2CGPA 4E4HA 2DT5A 1YJ9I 1KU2A 5JHUA 1F1ZA 4HW0A 4PZJA 3E5UA 4G9YA 5GTHC 4I01A 4AD9A 3GTJJ 1NH3A 1QA6A 1FP1D 2VUMJ 4DGWB 1WFXA 1O3QA 2O61A 1USTA 4XLCA 1TBXA 4L9VA 3RKYA 1X1CA 1Z6RA 1LFUP 4M9SA 1ZTRA 4LG0B 2BVMA 2X1CA 4BJ5C 2K9LA 3BJ6A 3CCSI 2KLOA 5CJ9A 5EEHA 1MMDA 3BR5A 3N4MA 4CGZA 1IRZA 3F72A 1IXSB 4M73A 2W48A 5CYVA 5LRRA 1D5YA 3G73A 3S3OA 3BTIA 5JFRA 3WODF 1I3AA 2P8TA 3JRBA 2KDZA 5L3GA 2VODA 3BWGA 1JT6A 3AAFA 1OCPA 2EBIA 1YI2I 1MJ9A 2GA2A 1ZG3A 5E1XA 1SFEA 3FXJA 3G3ZA 3F0CA 2BW3B 2GQQA 1KQ0A 1N75A 2D1HA 2IAIA 2XUBA 4UUTA 4JYKA 3O8GA 2MFZA 1HKSA 3SEQA 2FXAA 2ISYA 1OLTA 3NWTA 1K78A 5LRSA 2FQ3A 4PGGA 2EA2A 4MEXF 4MNUA 5F04A 4A12A 1IV8A 1Z6TA 1TC3C 1MNMC 1N25A 1VNDA 2EH3A 3SFIA 1R49A 2PMHA 2E35A 4C2UA 1BBYA 4Z2YA 1DGRM 2Y0SN 1TQIA 4AVPA 3K2ZA 2GXBA 2DLLA 2BY1A 1OCOH 1YW7A 1ZGJA 4G6TB 1SVLA 4M6VA
chains in the Genus database with same CATH topology
2FE3A 4XRFA 4U0WA 2QWWA 4A6EA 5DD8A 1YFHA 4LK0F 3F8NA 1FYMA 1UHWA 1SD5A 3KP4A 5F6FA 2DFIA 3M7GA 5BMZA 5A2QZ 2FA5A 4M9ZA 1ZG1A 4L5IA 1FY7A 3FZVA 1KQ8A 1ULYA 3MZHA 3KEOA 3CJNA 3GLXA 2DQLA 4YFKF 4G7HF 3GZ5A 4A6DA 5E17F 3V7CA 2QYOA 4KFCA 3VEPA 4HF0A 1SMYF 1YQAA 3DXJF 1YLFA 4WXHA 3IL2A 2EB7A 2Z5UA 3IKVA 5CVIA 2AS5F 1G4DA 4GO1A 1MGTA 4AIHA 1K78B 1Y0UA 3RDIA 2XAQA 2V1XA 3RJPA 2L02A 4KUMA 1IN6A 3BPXA 4OU0A 4EJWA 2F5EA 3IWZA 3OV8A 4XSXF 5E1ZB 1KU7A 4N0BA 1ZHFA 2H6BA 2JPCA 4A2UA 1YW9A 2D1VA 3OOPA 4L18B 2BEOA 3TGNA 2FSWA 4L9JA 3E6DA 3JTGA 5EEGA 2XKPA 3HRUA 1B9NA 4AIJA 3ZN1A 2H27A 1IXCA 1B6AA 3LA3A 1CF7A 3FF5A 4LD5A 3T0YA 1G6NA 4HAMA 3JTHA 3MZYA 1FC3A 4GGGA 1YW8A 5LGTA 3HRMA 1PDNC 1IZ1A 4WXDA 1E17A 1QNTA 2ZXJA 3J80Z 1REPC 4CYDA 5D5VB 3M8FA 3I59B 2HGCA 1D3YA 3GFJA 3KP2A 2HKXA 2P6TA 1KA8A 3HSEA 1LDKB 3RTRA 4MGRA 1FBSA 3FMQA 2GA1A 2P5VA 3FMSA 1ZREA 3K0LA 1ODDA 2V79A 2STTA 3WGGA 1P4WA 4GCVA 3I54A 1YS7A 2LDUA 4K2EA 1FNNA 1O7FA 1MJBA 5DYMA 4CZZA 5D6FA 3TKYA 3K1MA 1GXQA 4JBAA 4RB2C 1LNWA 4BNCA 3DV8A 3JAMZ 2OQRA 2XHKA 4S04A 2IRFG 4UV9A 2VBZA 3ZMSA 1FSEA 1MZBA 3F8CA 3WE3A 4A5MA 1QO0D 1CGPA 1IRGA 4LLNA 2ZNYA 3E6MA 4MQ9F 1QGPA 5FLXK 1R1TA 2BGCA 1UFMA 1HBXG 4UUVA 3QRFF 3QAHA 4HDUA 3LQRA 4IPAA 2A6HF 4KMFA 1ZH5A 3Q5FA 3KLOA 2IPQX 4JQFA 2EFOA 1O3RA 3GEZA 1E2XA 2L01A 5LHHA 4ZYDA 1WRJA 2A68F 4HV6A 2DK8A 3T8TA 5BOXA 4G7OF 2PN6A 3JAMK 4I0AA 4BYYA 2JZYA 2W85A 2G9WA 3U1DA 3FWEA 3WU1B 2ELHA 1XSVA 3RYPA 2L4MA 4S05A 4KIGA 1DDNA 2MLKA 3CLOA 3C18A 2CSOA 2XAFA 4E70A 1SAXA 3B02A 3KEQA 1W7PD 4EM0B 3JSPA 2LF8A 1STZA 3SXYA 4BHBA 3HSFA 2XRNA 3IKTA 2ADUA 2R7DA 3WTVC 3WTSC 4LK1F 1R1VA 1USSA 4FHTA 3P9CA 1T2KA 1FSHA 2MLGA 1R1UA 3GO5A 4N9HA 2IA1A 1KQ9A 3TOBA 3ZMTA 3PFIA 3MQ0A 3E97A 1XMAA 1B59A 2IT0A 4KA4A 4LGWA 2F2EA 4ENJA 1U5TB 1I1GA 2CG4A 4ZYGA 4AIKA 1ON2A 1LVAA 2P5LC 5D5XB 4NHJA 3C3WA 3KP7A 3DPLC 4KICA 4OIOF 3ZMDA 2PG4A 2EFWA 2O03A 2Y75A 2HR3A 3SQNA 2TDXA 4M74A 2JSCA 4U0YA 4Y13A 1XN7A 2GIVA 1T38A 3SFZA 2QQ9A 5HVQC 1HKTA 4LLLA 2HOEA 4NB5A 3KE2A 1ZYRF 2JT1A 3SHFA 4Q4ZF 4WWCA 3C1DA 5CVUA 4OIQF 4FX4A 4EVIA 3HIFA 1T98A 4OMZA 1U78A 2P6SA 2NRAC 2RV8A 2FF4A 3GFLA 2JRTA 3ECHA 3SZTA 2WWYA 3EQLF 3BY6A 2HS5A 2G7HA 3T8RA 1W4MA 4YIFA 3E6BA 3VODA 2F5CA 4OIPF 3TO6A 2QBYB 1WKMA 1JXSA 5DD4A 3EYIA 2PLYA 2RNJA 2IA0A 3KP5A 2VBXA 3IWFA 4MTDA 4LJZF 1I27A 1S7AA 5J8CA 5LLQA 4GYIA 4A0XA 2KRFA 1SFUA 2DW4A 2IJLA 3IHUA 3RKXA 3VB2A 1U5TA 2HFHA 4RB1A 2QZ8A 1J59A 3WU0A 3MFKA 1S7OA 2FBIA 2RC4A 1HSJA 1Z05A 2M8EA 4BQAA 2RVCA 4HQEA 1ONVA 3W6KB 4EJOA 4PGHA 1UHMA 2CO5A 3HHGA 4A0YA 2K86A 3E5XA 5FO5A 3CO7C 3HOTA 1TQPA 4R8HA 1JHFA 3K1PA 5CLSA 1KYZA 2HWVA 5D5WB 4Q48A 1V4RA 4BXUA 4UVAA 4HLXA 1LDDA 4HX7A 3ZQ7A 5K5RA 5E8IA 2YR2A 3TO9A 4BHCA 1JHHA 1Z7UA 2UXNA 5FB2A 3QPHA 4EJUA 2P7VB 2QQBA 1BI2A 3O6BB 2W57A 3WGIA 3KZZA 2DTRA 5ILSA 2QVOA 5H20A 1D5VA 2XAHA 3QU3A 1HXDA 1H9GA 1H9TA 2MA3A 5IT9K 1W5TA 3CUOA 2P4WA 6PAXA 3V8LA 5L3BA 1SD7A 4CICA 4HX4A 2W84A 5HDGA 1ZG5A 2HYFA 4L0YB 4P5OA 3VOEA 1FLIA 5DDGA 4IJAA 4ESJA 2FRHA 5AIPA 3DF8A 5DEQA 4QLCU 5FLXZ 3ERED 5DV5A 1X3UA 2OD5A 3S2WA 4L9TA 1RIOH 3ZMZA 3LA2A 1XGMA 5CVJA 3GVAA 2EWNA 1O3SA 5D4SA 5ICGA 1Q1HA 2EFQA 3F8MA 2EV5A 1TQMA 3HHHA 1FP2A 5DCMB 4KIFA 5D8LB 2OQGA 4KT5C 3TQNA 1OPCA 2WV0A 5K5QA 1NHAA 5HLHA 2J5PA 2RDPA 3L7WA 4EM2A 2LSOA 5ILUA 4RGSA 1LJ9A 4IVNA 5KVRA 4G94A 4UV8A 3Q9SA 5J8FA 4R79A 5FFXA 3HUGA 1BI1A 1D8JA 4ZZDA 3FMRA 3V7RA 1O7LA 2DK5A 4I98B 5DCFA 4RGXA 2COMA 4EQQA 1IAWA 1OYWA 4WK8F 3ELKA 1FX7A 4IRGA 4IF4A 1XCVA 4LFUA 5E1WA 1P4AA 5ED4A 5HS8A 1RUNA 5FD6A 1WWXA 3FHZA 4CDGA 3ULQB 2L3DA 4L5JA 1IW7F 2V1DA 1ZGAA 1XSXA 4ASNA 2HEOA 1HW2A 3TDUC 2MBFA 4U88A 4MHGA 3KFWX 2CFXA 3MCZA 1BI0A 1MDMB 1S6LA 1S3JA 2RKHA 3CO6C 2VT3A 4MEYF 5L3FA 4A0ZA 5KK1A 3CUQA 1XDSA 1J9IA 2RN7A 3QP6A 1BM9A 1RZ4A 5TJJA 3J81K 2OAZA 3GZ6A 1U3EM 3GUDA 1T0FA 4P9FA 2MH2A 3F6OA 2DAOA 3ZMUA 1I5ZA 3EDPA 2V6CA 4M72A 4L9NA 1FZPB 3RI4A 5HS9A 2E7XA 4HF1A 2FBKA 2A5YB 2FOKA 3F6VA 3B73A 1SMTA 1OMIA 1EH7A 3NRVA 2EV6A 1L3LA 1YYVA 2CQKA 3L00A 5ILVA 2PMUA 1OKRA 3LAPA 2HZTA 4RB0A 3ZN0A 1XGNA 1ZLKA 2R3SA 4LB5A 1ZRCA 1R58A 1HKQA 3W6JB 4ETSA 1H0MA 3FXQA 3E6CC 3F8BA 1XGSA 1W5SA 2PEXA 5D8KB 2KIUA 1UB9A 2UXXA 5H6RA 4KYWA 1OYYA 4Y17A 4HF2A 1AWCA 1FBQA 1OR7A 2BV6A 4ZYEA 3REOA 3PQJA 3L9FA 2RQPA 4U7BA 2W24A 2OZUA 4HOBA 3BPVA 2A69F 4KIBA 3HRTA 2FBHA 3R4KA 1TNSA 5BQTA 3LFKA 1G3YA 1P4XA 3RPQA 3BZ6A 2JTVA 1U5TC 3F22A 3J81Z 3C7JA 1U2WA 2CWEA 4QWQA 1WQ2A 1F4KA 4TV7A 2EK5A 2NNNA 5D5UB 1YO5C 3FM3A 2BE5F 1J2XA 4RAYA 5ICFA 5JR3A 3NEUA 4ENKA 4KNYA 3GXOA 2VC0A 4CHUA 1HW1A 2ZO4A 2EA4A 3COAC 1K79A 4ESBA 2ZFWA 3MWMA 2ZNZA 4H0EA 1R5HA 1KGSA 1R5GA 4LLGF 3LQQA 4I0BA 2B0LA 5A2QK 3HSRA 3DFGA 3H3UA 5ICEA 3ML6A 4DNCA 4OOIA 4RB3C 4OMYA 2YPRA 3WE2A 2LF7A 1BOAA 2XASA 3F23A 2VBWA 4KDPA 2HDCA 2FEZA 3ROUA 4M71A 3NQOA 4CXFA 2DBBA 2Z99A 3V8KA 2KIMA 5FGMA 1R23A 4EM1A 2M87A 1G3SA 3GWZA 2A6EF 3V7SA 5J6XA 3T1BA 4BH9A 3GFMA 2IVMA 2HYGD 4EV0A 3FXUA 3HYIA 1B1BA 1TNTA 2BBYA 4UVCA 5HLIA 1J0RA 4LMYA 2WC2A 1YG2A 2CYYA 3SZPA 2VXZA 1EV7A 1FT9A 2J5OA 1Z91A 2HQRA 2XGXA 3ISPA 2YU3A 4UHTA 3CDHA 1T6SA 2OU2A 5BPDA 3P9IA 4WF2A 3U9GA 1XD7A 5IT9Z 4PDKA 2DU9A 3BOQA 3R0JA 5BS6A 5AONA 1T39A 4N9IA 1EH6A 2GXGA 5HDKA 1YIOA 3I64A 3TOAA 3ABUA 2XKOA 1XDUA 1J7KA 3BJOA 3H3ZA 1L0OC 2STWA 3V8JA 4ENMA 2NYXA 4M6XA 3HRSA 3J80K 2MC3A 1LB2A 2DO7A 4LG0A 5L3EA 3L2CA 1KYWA 4P55A 5E8GA 3FM5A 2VONA 4XLPF 2FMLA 3H92A 2YSRA 4FX0A 1IUYA 1RNLA 1XCBA 3CTAA 3M9AA 1TW2A 4HLYA 3K1NA 3T5XA 2E1CA 1W7PA 1I1SA 2A3SA 1KU9A 3WTTC 4CO8A 4LB6B 4I09A 2FNAA 3GF2A 4EJVA 4RGUA 1SD4A 1G3WA 3QU6A 2HTJA 2HQNA 2OBPA 5HLGA 3O3KA 1R36A 3CUQB 2M45A 4JK1X 5BPIA 3GX4X 2K27A 3BP8A 3F8FA 2JPBA 5LHGA 4EGZA 2XIGA 5LBQA 1BC8C 2M1BA 3MEXA 2ZJ2A 4O5VA 2E7WA 2VT2A 2C6YA 4B8XA 2VE9A 3EUHA 1DPRA 2VC1A 1MKMA 4YFXF 5K1YA 2O6GE 5HDNA 3I4PA 3R0AA 4BAYA 3WTXC 4NQWA 2VN2A 2D45A 2QLZA 3I53A 2CW0F 1GHCA 1P6RA 5CVRA 1G3TA 3VFZA 3E3VA 4Q5SF 2K02A 5IT3A 3JSOA 2YX4A 5LEJA 1XSDA 1FYKA 4GYGA 4XLNF 3R6SA 5ICCA 4L0ZB 2FU4A 4HQMA 4R1HA 3J7AO 3R60A 1FPQA 2ETHA 1GVJA 1LDJA 3L09A 2UZKA 3M1EA 1YS6A 1Z1DA 5F64A 2EFNA 1U8RA 4HA8A 2X4HA 2Z33A 1FYLA 3D0SA 3GYHX 1RUOA 4Y15A 4EJTA 1OYIA 2NNYA 2DPDA 4FT8A 1LQ1A 1JE8A 5LGNA 4O3MA 2E1NA 3KETA 3M8EA 1BJAA 2XAGA 2DI3A 1WI9A 4YFNF 1ZARA 2EJRA 4I2OA 1HSTA 5L3CA 3I58A 4P96A 2IW5A 2P5KA 2LKPA 3I0TA 3JW4A 1C0WA 3HTUA 5JVTA 1P2FA 2V9VA 1VTNC 4IXAA 1XGOA 2UWMA 4D0PA 5DUKA 4G7ZF 2EV0A 3WTUC 2QENA 2F5FA 4HV5A 4F7ZA 2K4JA 4O6JA 5D6EA 2ZCWA 2Y48A 4EGYA 3I59A 3DP7A 2ZMEB 2AXLA 2R7FA 4HYEA 1U6GA 1O57A 3F21A 2O8XA 3Q9VA 4ESFA 2PJPA 3E5QA 2DQRA 2ZBKA 4HBLA 1R22A 1W7PB 3ABTA 4P9UA 4IHSA 5LHIA 4U7DA 3DEUA 4A5NA 3ZP5A 1XMKA 2Z9OA 2QQAA 4KMUX 2M30A 4DQ2A 4Q47A 1S29A 2XVCA 1B4AA 1P92A 3TDZC 1JGSA 2OZ6A 1PP8F 3LWFA 1ZAOA 1KU3A 1FBUA 1DP7P 5LEKA 5E20A 2M5WA 2GAUA 4ENNA 2EFPA 5K5OA 2PFBA 2OA4A 3IC7A 4OINF 3K9TA 3KZYA 2KJCA 3BJAA 1ZN2A 2XROA 1MD0A 5CVVA 2Q8KA 1QQIA 1PUEE 3KLNA 2GZWA 2ISZA 4WCGA 2NS0A 5TRDA 1R7JA 5E18F 3RYRA 1F9NA 4G6DA 1MJAA 3RPUA 1BC7C 1IN4A 3DKWA 1EH8A 4RAZA 1O3TA 4WX9A 2D2WA 2O0YA 1BI3A 2P7CB 1IRFA 5DUIA 3IRRA 4WXCA 1K7AA 3ECOA 3U2RA 1AOYA 2HTSA 1A04A 4ZH4F 1ZRFA 1FWZA 3EYYA 3BDDA 5ERIA 4OIRF 2ESHA 5HS7A 1IN5A 3D5LA 4BHPA 2NAZA 2WTEA 4U0VA 4I7HA 3O2PE 1V3FA 2ACJA 5FD5A 1FOKA 3DQVC 1LEBA 1BIBA 2H6CA 4ZZLA 4IRHA 4ON0A 1TW3A 4YIIA 3WG9A 2KIFA 2PI0A 1UCRA 5AIQA 2KJBA 4MTEA 2VE8A 2KKOA 3QOPA 4G8XA 3ZMVA 1CF7B 1B9MA 2MH9A 2VOPA 3K69A 5LGUA 1Z9CA 5H6QA 3MAJA 1SFXA 2MD5A 5JI6A 2VBYA 1D8KA 2X0LA 3I5UA 3P7NA 1PP7U 1IXRC 4M9XA 3PQKA 3TO7A 3BROA 1QBJA 1ON1A 1SD6A 3I71A 3LSTA 1R00A 4PCQA 1TLHB 5HOOA 1K6OA 4IRIA 2DPUA 1YTYA 2V1UA 4XSZF 2IP2A 4HZFA 2IA2A 2Z3YA 4RS8A 2FNPA 1HQCA 1IN7A 2RGVA 1QZZA 1XB4A 2FMYA 2QM3A 2HKOA 2A61A 3LA7A 2Q0OA 3V4GA 4G6QA 3CUQC 2PQ8A 1BIAA 4KN4X 1DPUA 2GWRA 3WTZA 4RGRA 3LAJA 1J75A 1IN8A 1GXPA 3GW2A 2QBYA 2K7LA 1DUXC 2H09A 1QPMA 2ESNA 1J5YA 2LNBA 3GFIA 2L54A 5D4RA 5DCMA 2F5DA 3F3XA 2G7UA 1F5TA 2H94A 4UVBA 2ZMEA 3WTWC 3QP5A 2Q2EA 5FFZA 1MDMA 4UNOA 5F1RA 2YX7A 3IRQA 4XBFA 2O3FA 4IHTA 4EMSA 1I6XA 1S8NA 4GXOA 2W25A 2XV4S 4HX8A 5L3DA 2Y0MA 3KP3A 2PBIA 1ZLJA 3ZPLA 3FX3A 2VOOA 3QPTA 1RI7A 1ZRDA 4ZYHA 4B09A 4HDVA 1HW5A 2QUFA 4M6YA 3HOSA 3KCCA 3RIRA 3FXRA 3WTYC 3WGHA 3R61A 1LEAA 3RKWA 2A07F 1TTYA 2BYVE 1QZYA 4YG2F 3DPTA 3EETA 4UXNA 4I02A 3KP6A 1BN5A 2ZKZA 3P9KA 2K4BA 2XAJA 4AWXB 4MQVA 2L4AA 4KN7X 1WSUA 3HTSB 1IF1A 2CGPA 2DT5A 1KU2A 5JHUA 1F1ZA 4HW0A 4PZJA 3E5UA 4G9YA 4I01A 4AD9A 1FP1D 2O61A 1O3QA 1USTA 1TBXA 4L9VA 3RKYA 1Z6RA 4M9SA 4LG0B 3BJ6A 5CJ9A 5EEHA 3N4MA 4CGZA 3F72A 1IXSB 4M73A 5CYVA 5LRRA 3G73A 5JFRA 3WODF 2P8TA 2VODA 5L3GA 3BWGA 3AAFA 1MJ9A 2GA2A 1ZG3A 5E1XA 1SFEA 3G3ZA 2GQQA 1KQ0A 2D1HA 2XUBA 1HKSA 2FXAA 2ISYA 1K78A 5LRSA 2FQ3A 4PGGA 2EA2A 4MEXF 4MNUA 4A12A 1Z6TA 2PMHA 1BBYA 4Z2YA 1TQIA 4AVPA 3K2ZA 2GXBA 2DLLA 1YW7A 1ZGJA 3N97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE3 A;  4XRF A;  4U0W A;  2QWW A;  4A6E A;  5DD8 A;  1YFH A;  4LK0 F;  3F8N A;  1FYM A;  1UHW A;  1SD5 A;  3KP4 A;  5F6F A;  2DFI A;  3M7G A;  5BMZ A;  5A2Q Z;  2FA5 A;  4M9Z A;  1ZG1 A;  4L5I A;  1FY7 A;  3FZV A;  1KQ8 A;  1ULY A;  3MZH A;  3KEO A;  3CJN A;  3GLX A;  2DQL A;  4YFK F;  4G7H F;  3GZ5 A;  4A6D A;  5E17 F;  3V7C A;  2QYO A;  4KFC A;  3VEP A;  4HF0 A;  1SMY F;  1YQA A;  3DXJ F;  1YLF A;  4WXH A;  3IL2 A;  2EB7 A;  2Z5U A;  3IKV A;  5CVI A;  2AS5 F;  1G4D A;  4GO1 A;  1MGT A;  4AIH A;  1K78 B;  1Y0U A;  3RDI A;  2XAQ A;  2V1X A;  3RJP A;  2L02 A;  4KUM A;  1IN6 A;  3BPX A;  4OU0 A;  4EJW A;  2F5E A;  3IWZ A;  3OV8 A;  4XSX F;  5E1Z B;  1KU7 A;  4N0B A;  1ZHF A;  2H6B A;  2JPC A;  4A2U A;  1YW9 A;  2D1V A;  3OOP A;  4L18 B;  2BEO A;  3TGN A;  2FSW A;  4L9J A;  3E6D A;  3JTG A;  5EEG A;  2XKP A;  3HRU A;  1B9N A;  4AIJ A;  3ZN1 A;  2H27 A;  1IXC A;  1B6A A;  3LA3 A;  1CF7 A;  3FF5 A;  4LD5 A;  3T0Y A;  1G6N A;  4HAM A;  3JTH A;  3MZY A;  1FC3 A;  4GGG A;  1YW8 A;  5LGT A;  3HRM A;  1PDN C;  1IZ1 A;  4WXD A;  1E17 A;  1QNT A;  2ZXJ A;  3J80 Z;  1REP C;  4CYD A;  5D5V B;  3M8F A;  3I59 B;  2HGC A;  1D3Y A;  3GFJ A;  3KP2 A;  2HKX A;  2P6T A;  1KA8 A;  3HSE A;  1LDK B;  3RTR A;  4MGR A;  1FBS A;  3FMQ A;  2GA1 A;  2P5V A;  3FMS A;  1ZRE A;  3K0L A;  1ODD A;  2V79 A;  2STT A;  3WGG A;  1P4W A;  4GCV A;  3I54 A;  1YS7 A;  2LDU A;  4K2E A;  1FNN A;  1O7F A;  1MJB A;  5DYM A;  4CZZ A;  5D6F A;  3TKY A;  3K1M A;  1GXQ A;  4JBA A;  4RB2 C;  1LNW A;  4BNC A;  3DV8 A;  3JAM Z;  2OQR A;  2XHK A;  4S04 A;  2IRF G;  4UV9 A;  2VBZ A;  3ZMS A;  1FSE A;  1MZB A;  3F8C A;  3WE3 A;  4A5M A;  1QO0 D;  1CGP A;  1IRG A;  4LLN A;  2ZNY A;  3E6M A;  4MQ9 F;  1QGP A;  5FLX K;  1R1T A;  2BGC A;  1UFM A;  1HBX G;  4UUV A;  3QRF F;  3QAH A;  4HDU A;  3LQR A;  4IPA A;  2A6H F;  4KMF A;  1ZH5 A;  3Q5F A;  3KLO A;  2IPQ X;  4JQF A;  2EFO A;  1O3R A;  3GEZ A;  1E2X A;  2L01 A;  5LHH A;  4ZYD A;  1WRJ A;  2A68 F;  4HV6 A;  2DK8 A;  3T8T A;  5BOX A;  4G7O F;  2PN6 A;  3JAM K;  4I0A A;  4BYY A;  2JZY A;  2W85 A;  2G9W A;  3U1D A;  3FWE A;  3WU1 B;  2ELH A;  1XSV A;  3RYP A;  2L4M A;  4S05 A;  4KIG A;  1DDN A;  2MLK A;  3CLO A;  3C18 A;  2CSO A;  2XAF A;  4E70 A;  1SAX A;  3B02 A;  3KEQ A;  1W7P D;  4EM0 B;  3JSP A;  2LF8 A;  1STZ A;  3SXY A;  4BHB A;  3HSF A;  2XRN A;  3IKT A;  2ADU A;  2R7D A;  3WTV C;  3WTS C;  4LK1 F;  1R1V A;  1USS A;  4FHT A;  3P9C A;  1T2K A;  1FSH A;  2MLG A;  1R1U A;  3GO5 A;  4N9H A;  2IA1 A;  1KQ9 A;  3TOB A;  3ZMT A;  3PFI A;  3MQ0 A;  3E97 A;  1XMA A;  1B59 A;  2IT0 A;  4KA4 A;  4LGW A;  2F2E A;  4ENJ A;  1U5T B;  1I1G A;  2CG4 A;  4ZYG A;  4AIK A;  1ON2 A;  1LVA A;  2P5L C;  5D5X B;  4NHJ A;  3C3W A;  3KP7 A;  3DPL C;  4KIC A;  4OIO F;  3ZMD A;  2PG4 A;  2EFW A;  2O03 A;  2Y75 A;  2HR3 A;  3SQN A;  2TDX A;  4M74 A;  2JSC A;  4U0Y A;  4Y13 A;  1XN7 A;  2GIV A;  1T38 A;  3SFZ A;  2QQ9 A;  5HVQ C;  1HKT A;  4LLL A;  2HOE A;  4NB5 A;  3KE2 A;  1ZYR F;  2JT1 A;  3SHF A;  4Q4Z F;  4WWC A;  3C1D A;  5CVU A;  4OIQ F;  4FX4 A;  4EVI A;  3HIF A;  1T98 A;  4OMZ A;  1U78 A;  2P6S A;  2NRA C;  2RV8 A;  2FF4 A;  3GFL A;  2JRT A;  3ECH A;  3SZT A;  2WWY A;  3EQL F;  3BY6 A;  2HS5 A;  2G7H A;  3T8R A;  1W4M A;  4YIF A;  3E6B A;  3VOD A;  2F5C A;  4OIP F;  3TO6 A;  2QBY B;  1WKM A;  1JXS A;  5DD4 A;  3EYI A;  2PLY A;  2RNJ A;  2IA0 A;  3KP5 A;  2VBX A;  3IWF A;  4MTD A;  4LJZ F;  1I27 A;  1S7A A;  5J8C A;  5LLQ A;  4GYI A;  4A0X A;  2KRF A;  1SFU A;  2DW4 A;  2IJL A;  3IHU A;  3RKX A;  3VB2 A;  1U5T A;  2HFH A;  4RB1 A;  2QZ8 A;  1J59 A;  3WU0 A;  3MFK A;  1S7O A;  2FBI A;  2RC4 A;  1HSJ A;  1Z05 A;  2M8E A;  4BQA A;  2RVC A;  4HQE A;  1ONV A;  3W6K B;  4EJO A;  4PGH A;  1UHM A;  2CO5 A;  3HHG A;  4A0Y A;  2K86 A;  3E5X A;  5FO5 A;  3CO7 C;  3HOT A;  1TQP A;  4R8H A;  1JHF A;  3K1P A;  5CLS A;  1KYZ A;  2HWV A;  5D5W B;  4Q48 A;  1V4R A;  4BXU A;  4UVA A;  4HLX A;  1LDD A;  4HX7 A;  3ZQ7 A;  5K5R A;  5E8I A;  2YR2 A;  3TO9 A;  4BHC A;  1JHH A;  1Z7U A;  2UXN A;  5FB2 A;  3QPH A;  4EJU A;  2P7V B;  2QQB A;  1BI2 A;  3O6B B;  2W57 A;  3WGI A;  3KZZ A;  2DTR A;  5ILS A;  2QVO A;  5H20 A;  1D5V A;  2XAH A;  3QU3 A;  1HXD A;  1H9G A;  1H9T A;  2MA3 A;  5IT9 K;  1W5T A;  3CUO A;  2P4W A;  6PAX A;  3V8L A;  5L3B A;  1SD7 A;  4CIC A;  4HX4 A;  2W84 A;  5HDG A;  1ZG5 A;  2HYF A;  4L0Y B;  4P5O A;  3VOE A;  1FLI A;  5DDG A;  4IJA A;  4ESJ A;  2FRH A;  5AIP A;  3DF8 A;  5DEQ A;  4QLC U;  5FLX Z;  3ERE D;  5DV5 A;  1X3U A;  2OD5 A;  3S2W A;  4L9T A;  1RIO H;  3ZMZ A;  3LA2 A;  1XGM A;  5CVJ A;  3GVA A;  2EWN A;  1O3S A;  5D4S A;  5ICG A;  1Q1H A;  2EFQ A;  3F8M A;  2EV5 A;  1TQM A;  3HHH A;  1FP2 A;  5DCM B;  4KIF A;  5D8L B;  2OQG A;  4KT5 C;  3TQN A;  1OPC A;  2WV0 A;  5K5Q A;  1NHA A;  5HLH A;  2J5P A;  2RDP A;  3L7W A;  4EM2 A;  2LSO A;  5ILU A;  4RGS A;  1LJ9 A;  4IVN A;  5KVR A;  4G94 A;  4UV8 A;  3Q9S A;  5J8F A;  4R79 A;  5FFX A;  3HUG A;  1BI1 A;  1D8J A;  4ZZD A;  3FMR A;  3V7R A;  1O7L A;  2DK5 A;  4I98 B;  5DCF A;  4RGX A;  2COM A;  4EQQ A;  1IAW A;  1OYW A;  4WK8 F;  3ELK A;  1FX7 A;  4IRG A;  4IF4 A;  1XCV A;  4LFU A;  5E1W A;  1P4A A;  5ED4 A;  5HS8 A;  1RUN A;  5FD6 A;  1WWX A;  3FHZ A;  4CDG A;  3ULQ B;  2L3D A;  4L5J A;  1IW7 F;  2V1D A;  1ZGA A;  1XSX A;  4ASN A;  2HEO A;  1HW2 A;  3TDU C;  2MBF A;  4U88 A;  4MHG A;  3KFW X;  2CFX A;  3MCZ A;  1BI0 A;  1MDM B;  1S6L A;  1S3J A;  2RKH A;  3CO6 C;  2VT3 A;  4MEY F;  5L3F A;  4A0Z A;  5KK1 A;  3CUQ A;  1XDS A;  1J9I A;  2RN7 A;  3QP6 A;  1BM9 A;  1RZ4 A;  5TJJ A;  3J81 K;  2OAZ A;  3GZ6 A;  1U3E M;  3GUD A;  1T0F A;  4P9F A;  2MH2 A;  3F6O A;  2DAO A;  3ZMU A;  1I5Z A;  3EDP A;  2V6C A;  4M72 A;  4L9N A;  1FZP B;  3RI4 A;  5HS9 A;  2E7X A;  4HF1 A;  2FBK A;  2A5Y B;  2FOK A;  3F6V A;  3B73 A;  1SMT A;  1OMI A;  1EH7 A;  3NRV A;  2EV6 A;  1L3L A;  1YYV A;  2CQK A;  3L00 A;  5ILV A;  2PMU A;  1OKR A;  3LAP A;  2HZT A;  4RB0 A;  3ZN0 A;  1XGN A;  1ZLK A;  2R3S A;  4LB5 A;  1ZRC A;  1R58 A;  1HKQ A;  3W6J B;  4ETS A;  1H0M A;  3FXQ A;  3E6C C;  3F8B A;  1XGS A;  1W5S A;  2PEX A;  5D8K B;  2KIU A;  1UB9 A;  2UXX A;  5H6R A;  4KYW A;  1OYY A;  4Y17 A;  4HF2 A;  1AWC A;  1FBQ A;  1OR7 A;  2BV6 A;  4ZYE A;  3REO A;  3PQJ A;  3L9F A;  2RQP A;  4U7B A;  2W24 A;  2OZU A;  4HOB A;  3BPV A;  2A69 F;  4KIB A;  3HRT A;  2FBH A;  3R4K A;  1TNS A;  5BQT A;  3LFK A;  1G3Y A;  1P4X A;  3RPQ A;  3BZ6 A;  2JTV A;  1U5T C;  3F22 A;  3J81 Z;  3C7J A;  1U2W A;  2CWE A;  4QWQ A;  1WQ2 A;  1F4K A;  4TV7 A;  2EK5 A;  2NNN A;  5D5U B;  1YO5 C;  3FM3 A;  2BE5 F;  1J2X A;  4RAY A;  5ICF A;  5JR3 A;  3NEU A;  4ENK A;  4KNY A;  3GXO A;  2VC0 A;  4CHU A;  1HW1 A;  2ZO4 A;  2EA4 A;  3COA C;  1K79 A;  4ESB A;  2ZFW A;  3MWM A;  2ZNZ A;  4H0E A;  1R5H A;  1KGS A;  1R5G A;  4LLG F;  3LQQ A;  4I0B A;  2B0L A;  5A2Q K;  3HSR A;  3DFG A;  3H3U A;  5ICE A;  3ML6 A;  4DNC A;  4OOI A;  4RB3 C;  4OMY A;  2YPR A;  3WE2 A;  2LF7 A;  1BOA A;  2XAS A;  3F23 A;  2VBW A;  4KDP A;  2HDC A;  2FEZ A;  3ROU A;  4M71 A;  3NQO A;  4CXF A;  2DBB A;  2Z99 A;  3V8K A;  2KIM A;  5FGM A;  1R23 A;  4EM1 A;  2M87 A;  1G3S A;  3GWZ A;  2A6E F;  3V7S A;  5J6X A;  3T1B A;  4BH9 A;  3GFM A;  2IVM A;  2HYG D;  4EV0 A;  3FXU A;  3HYI A;  1B1B A;  1TNT A;  2BBY A;  4UVC A;  5HLI A;  1J0R A;  4LMY A;  2WC2 A;  1YG2 A;  2CYY A;  3SZP A;  2VXZ A;  1EV7 A;  1FT9 A;  2J5O A;  1Z91 A;  2HQR A;  2XGX A;  3ISP A;  2YU3 A;  4UHT A;  3CDH A;  1T6S A;  2OU2 A;  5BPD A;  3P9I A;  4WF2 A;  3U9G A;  1XD7 A;  5IT9 Z;  4PDK A;  2DU9 A;  3BOQ A;  3R0J A;  5BS6 A;  5AON A;  1T39 A;  4N9I A;  1EH6 A;  2GXG A;  5HDK A;  1YIO A;  3I64 A;  3TOA A;  3ABU A;  2XKO A;  1XDU A;  1J7K A;  3BJO A;  3H3Z A;  1L0O C;  2STW A;  3V8J A;  4ENM A;  2NYX A;  4M6X A;  3HRS A;  3J80 K;  2MC3 A;  1LB2 A;  2DO7 A;  4LG0 A;  5L3E A;  3L2C A;  1KYW A;  4P55 A;  5E8G A;  3FM5 A;  2VON A;  4XLP F;  2FML A;  3H92 A;  2YSR A;  4FX0 A;  1IUY A;  1RNL A;  1XCB A;  3CTA A;  3M9A A;  1TW2 A;  4HLY A;  3K1N A;  3T5X A;  2E1C A;  1W7P A;  1I1S A;  2A3S A;  1KU9 A;  3WTT C;  4CO8 A;  4LB6 B;  4I09 A;  2FNA A;  3GF2 A;  4EJV A;  4RGU A;  1SD4 A;  1G3W A;  3QU6 A;  2HTJ A;  2HQN A;  2OBP A;  5HLG A;  3O3K A;  1R36 A;  3CUQ B;  2M45 A;  4JK1 X;  5BPI A;  3GX4 X;  2K27 A;  3BP8 A;  3F8F A;  2JPB A;  5LHG A;  4EGZ A;  2XIG A;  5LBQ A;  1BC8 C;  2M1B A;  3MEX A;  2ZJ2 A;  4O5V A;  2E7W A;  2VT2 A;  2C6Y A;  4B8X A;  2VE9 A;  3EUH A;  1DPR A;  2VC1 A;  1MKM A;  4YFX F;  5K1Y A;  2O6G E;  5HDN A;  3I4P A;  3R0A A;  4BAY A;  3WTX C;  4NQW A;  2VN2 A;  2D45 A;  2QLZ A;  3I53 A;  2CW0 F;  1GHC A;  1P6R A;  5CVR A;  1G3T A;  3VFZ A;  3E3V A;  4Q5S F;  2K02 A;  5IT3 A;  3JSO A;  2YX4 A;  5LEJ A;  1XSD A;  1FYK A;  4GYG A;  4XLN F;  3R6S A;  5ICC A;  4L0Z B;  2FU4 A;  4HQM A;  4R1H A;  3J7A O;  3R60 A;  1FPQ A;  2ETH A;  1GVJ A;  1LDJ A;  3L09 A;  2UZK A;  3M1E A;  1YS6 A;  1Z1D A;  5F64 A;  2EFN A;  1U8R A;  4HA8 A;  2X4H A;  2Z33 A;  1FYL A;  3D0S A;  3GYH X;  1RUO A;  4Y15 A;  4EJT A;  1OYI A;  2NNY A;  2DPD A;  4FT8 A;  1LQ1 A;  1JE8 A;  5LGN A;  4O3M A;  2E1N A;  3KET A;  3M8E A;  1BJA A;  2XAG A;  2DI3 A;  1WI9 A;  4YFN F;  1ZAR A;  2EJR A;  4I2O A;  1HST A;  5L3C A;  3I58 A;  4P96 A;  2IW5 A;  2P5K A;  2LKP A;  3I0T A;  3JW4 A;  1C0W A;  3HTU A;  5JVT A;  1P2F A;  2V9V A;  1VTN C;  4IXA A;  1XGO A;  2UWM A;  4D0P A;  5DUK A;  4G7Z F;  2EV0 A;  3WTU C;  2QEN A;  2F5F A;  4HV5 A;  4F7Z A;  2K4J A;  4O6J A;  5D6E A;  2ZCW A;  2Y48 A;  4EGY A;  3I59 A;  3DP7 A;  2ZME B;  2AXL A;  2R7F A;  4HYE A;  1U6G A;  1O57 A;  3F21 A;  2O8X A;  3Q9V A;  4ESF A;  2PJP A;  3E5Q A;  2DQR A;  2ZBK A;  4HBL A;  1R22 A;  1W7P B;  3ABT A;  4P9U A;  4IHS A;  5LHI A;  4U7D A;  3DEU A;  4A5N A;  3ZP5 A;  1XMK A;  2Z9O A;  2QQA A;  4KMU X;  2M30 A;  4DQ2 A;  4Q47 A;  1S29 A;  2XVC A;  1B4A A;  1P92 A;  3TDZ C;  1JGS A;  2OZ6 A;  1PP8 F;  3LWF A;  1ZAO A;  1KU3 A;  1FBU A;  1DP7 P;  5LEK A;  5E20 A;  2M5W A;  2GAU A;  4ENN A;  2EFP A;  5K5O A;  2PFB A;  2OA4 A;  3IC7 A;  4OIN F;  3K9T A;  3KZY A;  2KJC A;  3BJA A;  1ZN2 A;  2XRO A;  1MD0 A;  5CVV A;  2Q8K A;  1QQI A;  1PUE E;  3KLN A;  2GZW A;  2ISZ A;  4WCG A;  2NS0 A;  5TRD A;  1R7J A;  5E18 F;  3RYR A;  1F9N A;  4G6D A;  1MJA A;  3RPU A;  1BC7 C;  1IN4 A;  3DKW A;  1EH8 A;  4RAZ A;  1O3T A;  4WX9 A;  2D2W A;  2O0Y A;  1BI3 A;  2P7C B;  1IRF A;  5DUI A;  3IRR A;  4WXC A;  1K7A A;  3ECO A;  3U2R A;  1AOY A;  2HTS A;  1A04 A;  4ZH4 F;  1ZRF A;  1FWZ A;  3EYY A;  3BDD A;  5ERI A;  4OIR F;  2ESH A;  5HS7 A;  1IN5 A;  3D5L A;  4BHP A;  2NAZ A;  2WTE A;  4U0V A;  4I7H A;  3O2P E;  1V3F A;  2ACJ A;  5FD5 A;  1FOK A;  3DQV C;  1LEB A;  1BIB A;  2H6C A;  4ZZL A;  4IRH A;  4ON0 A;  1TW3 A;  4YII A;  3WG9 A;  2KIF A;  2PI0 A;  1UCR A;  5AIQ A;  2KJB A;  4MTE A;  2VE8 A;  2KKO A;  3QOP A;  4G8X A;  3ZMV A;  1CF7 B;  1B9M A;  2MH9 A;  2VOP A;  3K69 A;  5LGU A;  1Z9C A;  5H6Q A;  3MAJ A;  1SFX A;  2MD5 A;  5JI6 A;  2VBY A;  1D8K A;  2X0L A;  3I5U A;  3P7N A;  1PP7 U;  1IXR C;  4M9X A;  3PQK A;  3TO7 A;  3BRO A;  1QBJ A;  1ON1 A;  1SD6 A;  3I71 A;  3LST A;  1R00 A;  4PCQ A;  1TLH B;  5HOO A;  1K6O A;  4IRI A;  2DPU A;  1YTY A;  2V1U A;  4XSZ F;  2IP2 A;  4HZF A;  2IA2 A;  2Z3Y A;  4RS8 A;  2FNP A;  1HQC A;  1IN7 A;  2RGV A;  1QZZ A;  1XB4 A;  2FMY A;  2QM3 A;  2HKO A;  2A61 A;  3LA7 A;  2Q0O A;  3V4G A;  4G6Q A;  3CUQ C;  2PQ8 A;  1BIA A;  4KN4 X;  1DPU A;  2GWR A;  3WTZ A;  4RGR A;  3LAJ A;  1J75 A;  1IN8 A;  1GXP A;  3GW2 A;  2QBY A;  2K7L A;  1DUX C;  2H09 A;  1QPM A;  2ESN A;  1J5Y A;  2LNB A;  3GFI A;  2L54 A;  5D4R A;  5DCM A;  2F5D A;  3F3X A;  2G7U A;  1F5T A;  2H94 A;  4UVB A;  2ZME A;  3WTW C;  3QP5 A;  2Q2E A;  5FFZ A;  1MDM A;  4UNO A;  5F1R A;  2YX7 A;  3IRQ A;  4XBF A;  2O3F A;  4IHT A;  4EMS A;  1I6X A;  1S8N A;  4GXO A;  2W25 A;  2XV4 S;  4HX8 A;  5L3D A;  2Y0M A;  3KP3 A;  2PBI A;  1ZLJ A;  3ZPL A;  3FX3 A;  2VOO A;  3QPT A;  1RI7 A;  1ZRD A;  4ZYH A;  4B09 A;  4HDV A;  1HW5 A;  2QUF A;  4M6Y A;  3HOS A;  3KCC A;  3RIR A;  3FXR A;  3WTY C;  3WGH A;  3R61 A;  1LEA A;  3RKW A;  2A07 F;  1TTY A;  2BYV E;  1QZY A;  4YG2 F;  3DPT A;  3EET A;  4UXN A;  4I02 A;  3KP6 A;  1BN5 A;  2ZKZ A;  3P9K A;  2K4B A;  2XAJ A;  4AWX B;  4MQV A;  2L4A A;  4KN7 X;  1WSU A;  3HTS B;  1IF1 A;  2CGP A;  2DT5 A;  1KU2 A;  5JHU A;  1F1Z A;  4HW0 A;  4PZJ A;  3E5U A;  4G9Y A;  4I01 A;  4AD9 A;  1FP1 D;  2O61 A;  1O3Q A;  1UST A;  1TBX A;  4L9V A;  3RKY A;  1Z6R A;  4M9S A;  4LG0 B;  3BJ6 A;  5CJ9 A;  5EEH A;  3N4M A;  4CGZ A;  3F72 A;  1IXS B;  4M73 A;  5CYV A;  5LRR A;  3G73 A;  5JFR A;  3WOD F;  2P8T A;  2VOD A;  5L3G A;  3BWG A;  3AAF A;  1MJ9 A;  2GA2 A;  1ZG3 A;  5E1X A;  1SFE A;  3G3Z A;  2GQQ A;  1KQ0 A;  2D1H A;  2XUB A;  1HKS A;  2FXA A;  2ISY A;  1K78 A;  5LRS A;  2FQ3 A;  4PGG A;  2EA2 A;  4MEX F;  4MNU A;  4A12 A;  1Z6T A;  2PMH A;  1BBY A;  4Z2Y A;  1TQI A;  4AVP A;  3K2Z A;  2GXB A;  2DLL A;  1YW7 A;  1ZGJ A;  3N97 A; 
#chains in the Genus database with same CATH topology
 2FE3 A;  1OFC X;  4XRF A;  4U0W A;  1FMW A;  5DM7 F;  2QWW A;  4A6E A;  5DD8 A;  2N8G A;  1YFH A;  2X6X A;  1LE8 B;  2R7S A;  1V5E A;  4LK0 F;  3CJR B;  3F8N A;  3I56 I;  3K2A A;  1FYM A;  1UHW A;  5CQE A;  1SD5 A;  3KP4 A;  5FKL A;  3OWT A;  5F6F A;  1HLV A;  4IOA F;  1Y1V J;  3BR3 A;  2DFI A;  3M7G A;  5BMZ A;  5A2Q Z;  4W97 A;  4II3 A;  2FA5 A;  4M9Z A;  5F0H A;  1ZG1 A;  4L5I A;  4D7M A;  1FY7 A;  2R7R A;  3FZV A;  1KQ8 A;  1ULY A;  2JVG A;  4I76 A;  3JRC A;  1X1D A;  4P1W A;  3MZH A;  3KEO A;  4DBQ A;  4PJ0 C;  3CJN A;  3TP0 A;  1SC7 A;  4BS9 A;  2BY0 A;  2DMN A;  5DS9 A;  3GLX A;  2DQL A;  3KEY A;  4YFK F;  4G7H F;  4FE7 A;  3GZ5 A;  3NAR A;  2QSH X;  4A6D A;  3DBL B;  5E17 F;  2X51 A;  1VQ4 I;  3V7C A;  2W00 A;  2QYO A;  3JR9 A;  3S8P A;  3CME I;  3ASO H;  2NVX J;  3K4M A;  4KFC A;  3VEP A;  4HF0 A;  1OQY A;  1SMY F;  1JJ6 C;  2D5V A;  1FOX A;  2DFH A;  1YQA A;  3KPH A;  3LL7 A;  3DXJ F;  4CCN A;  1YLF A;  4WXH A;  3IL2 A;  2EB7 A;  2Z5U A;  3IKV A;  4B3X A;  2EIJ H;  3LSP A;  5CVI A;  3ERM A;  2XPW A;  2AS5 F;  1G4D A;  1EA3 A;  2O5R A;  4GO1 A;  5J40 A;  3GZN B;  1AA7 A;  1MGT A;  4AIH A;  3BLY A;  2OTL I;  2LP0 A;  2HZD A;  3BCB A;  1K78 B;  2K85 A;  1Y0U A;  2JUC A;  3RDI A;  3ASN H;  3FKI J;  2DDB A;  2XAQ A;  2V1X A;  2FOW A;  3RJP A;  3UNG C;  2L02 A;  4KUM A;  1IN6 A;  3BPX A;  4OU0 A;  1D0X A;  1OCZ H;  3D5R C;  4EJW A;  3HL2 A;  4HEA 2;  2LR8 A;  3PSI A;  1TWA J;  3CC4 I;  3CF2 A;  2F5E A;  2XDV A;  2NOG A;  3IWZ A;  3OV8 A;  2FD5 A;  3DTK A;  4XSX F;  5E1Z B;  2XSJ C;  1KU7 A;  4N0B A;  1ZHF A;  2H6B A;  2JPC A;  4A2U A;  4IZZ A;  1YW9 A;  2D1V A;  1P7J A;  3OOP A;  2E36 A;  4DBR A;  5J4Y A;  2LFB A;  1JTY A;  3HGG A;  4L18 B;  2BEO A;  1Y56 A;  3MKL A;  4QPO A;  3TGN A;  2FSW A;  1JGG A;  4L9J A;  4RMN A;  3SYT A;  3E6D A;  3JTG A;  5EEG A;  2LRE A;  1S5L C;  2XKP A;  3CQZ J;  1Z77 A;  4HRI A;  3HRU A;  1B72 B;  1AHD P;  2R4G A;  1R6R A;  1B9N A;  4AIJ A;  2K5C A;  3ZN1 A;  5F0F A;  1DU6 A;  2H27 A;  1IXC A;  2PJR B;  1RET A;  1B6A A;  3BZC A;  3LA3 A;  1CF7 A;  3FF5 A;  4LD5 A;  5J1U A;  3PJR A;  2GM4 A;  3T0Y A;  2M0C A;  1LFB A;  2M8G X;  1G6N A;  3MMY B;  1A5J A;  3PIO F;  1OIS A;  4HAM A;  3JTH A;  2CUE A;  3MZY A;  1FC3 A;  2OCC H;  4GGG A;  3RKQ A;  1YW8 A;  2E60 A;  5LGT A;  2QF7 A;  3HRM A;  2OC6 A;  1PDN C;  1IZ1 A;  4WXD A;  1E17 A;  4U87 A;  1QNT A;  2ZXJ A;  2EIL H;  4F91 B;  1MNE A;  3SZG A;  4FCY A;  3J80 Z;  1KZH A;  4BQO A;  4J00 A;  3Q0U A;  1REP C;  4CYD A;  5D5V B;  3G4S I;  4ABZ A;  3TW7 A;  3S17 J;  4CYC A;  3BR6 A;  2DCE A;  1GV5 A;  3M8F A;  3ZXS A;  2DMU A;  3I59 B;  3AL0 B;  2HGC A;  1D3Y A;  3GFJ A;  2Y0S A;  3KP2 A;  2HKX A;  2P6T A;  3A0H C;  1KA8 A;  3HSE A;  1LDK B;  3RTR A;  4B44 A;  3S2D J;  4MGR A;  1FBS A;  3FMQ A;  2GA1 A;  2P5V A;  3FMS A;  3SJM A;  1ZRE A;  1ACI A;  3K0L A;  3VYU B;  1ODD A;  2F4O B;  1YJN I;  3CLQ A;  2V79 A;  2STT A;  3RCO A;  2F6C A;  3WGG A;  1JT0 A;  4B47 A;  2CW7 A;  3DU5 A;  4V2G A;  4B4C A;  1P4W A;  3DEE A;  1JKQ C;  2FQ4 A;  2LD5 A;  4GCV A;  4ZJZ A;  3A2K A;  3I54 A;  1YS7 A;  2LDU A;  1VQM I;  4FAS D;  4ZDO A;  4K2E A;  1FNN A;  2XF7 A;  1O7F A;  1MJB A;  1IRX A;  3CDL A;  5DYM A;  4CZZ A;  5D6F A;  3ABM H;  5BNG A;  3ZQL A;  2CU7 A;  2OCE A;  3TKY A;  3K1M A;  2QSF X;  2HPI A;  1GXQ A;  4JBA A;  5IP7 J;  4RB2 C;  4F93 B;  1LNW A;  4BNC A;  3DV8 A;  3CMA I;  3IUO A;  3CJQ B;  3JAM Z;  3DLA A;  3VSK A;  3QQA A;  2OQR A;  2XHK A;  4S04 A;  2IRF G;  4UV9 A;  1MBJ A;  2VBZ A;  3ZMS A;  3L2V A;  1FSE A;  4XOR A;  1IG7 A;  3CZ6 A;  5IYD J;  1MZB A;  3F8C A;  3WE3 A;  4A5M A;  1QO0 D;  1CGP A;  1IRG A;  4LLN A;  5H2F C;  2Q1Z B;  2ZNY A;  3E6M A;  2UUZ A;  4MQ9 F;  1QGP A;  5FLX K;  1R1T A;  2BGC A;  3PSF A;  3DTE A;  1UFM A;  4S0H B;  1HBX G;  4UUV A;  3QRF F;  3QAH A;  2E2J J;  4HDU A;  1K61 A;  1X4O A;  1FOY A;  3LQR A;  4IPA A;  1BW5 A;  1IV6 A;  3L2Q A;  2A6H F;  4KMF A;  1ZH5 A;  2JA5 J;  3Q5F A;  3W2A A;  1WJ5 A;  2V7F A;  3KLO A;  2HVR A;  1SVO A;  2H1L A;  4KT6 A;  3G6E I;  4GFB A;  1TL8 A;  2IPQ X;  4JQF A;  2EFO A;  1O3R A;  2JA8 J;  1MSF C;  3GEZ A;  3VPR A;  1OCR H;  3RPU D;  4XKC A;  4B48 A;  4AYB A;  1E2X A;  1UAA A;  2L01 A;  5LHH A;  2IGM A;  4DOZ A;  4NDL A;  1WRJ A;  4ZYD A;  4IOC F;  3S32 A;  2VKD A;  2A68 F;  3K4B A;  3HOZ J;  2FX0 A;  2DK8 A;  2I8D A;  2L7F P;  4HV6 A;  3T8T A;  2R5Y A;  1ENH A;  1OCT C;  5E3M A;  5BOX A;  4G7O F;  2PN6 A;  3JAM K;  4I0A A;  3KYC B;  2BHZ A;  1W1W E;  4BYY A;  1MMN A;  2LMD A;  2JZY A;  2W85 A;  2ZC2 A;  2G9W A;  1JKR C;  3S14 J;  3U1D A;  3FWE A;  3WU1 B;  2ELH A;  1XSV A;  2L7Z A;  3RYP A;  5GAD J;  1RRJ A;  2L4M A;  1JUS A;  4IHW A;  4S05 A;  4KIG A;  1DDN A;  3VYS B;  4DZP A;  2MLK A;  3M1C A;  1J09 A;  2R93 J;  5C3E J;  3CLO A;  5E3L A;  2VKE A;  3C18 A;  2CSO A;  2XAF A;  4E70 A;  1SAX A;  4DZJ A;  3B02 A;  4F55 A;  1XMX A;  3IH3 A;  3KEQ A;  1W7P D;  3S1Q J;  1ETV A;  2X48 A;  4EM0 B;  3DU6 A;  3JSP A;  2LF8 A;  1STZ A;  2HQ5 A;  3F9K A;  3SXY A;  4BHB A;  1JUP A;  3HSF A;  3ABK H;  2BY3 A;  3ZQH A;  2XRN A;  3CF5 F;  3IKT A;  3BR1 A;  1TP4 A;  4LG3 A;  1UG2 A;  2ADU A;  2R7D A;  3WTV C;  1EJ9 A;  2BZT A;  1N78 A;  3OYI A;  3WTS C;  3JCU C;  4A3M J;  3DTI A;  1W0T A;  4LK1 F;  1R1V A;  1USS A;  3FDY A;  4FHT A;  1VQO I;  3P9C A;  1T2K A;  1FSH A;  1IUF A;  2K9S A;  2LC2 A;  4LIV A;  2MLG A;  1R1U A;  3GO5 A;  3WHB A;  2LG4 A;  3KYL A;  4RA2 A;  1YJW I;  5GP9 A;  3CD6 I;  4N9H A;  4XIC A;  2WB1 N;  4Y7N J;  4PJJ A;  2IA1 A;  1WVR A;  2JJ7 A;  1KQ9 A;  2GXA A;  3CMY A;  3TOB A;  1TWG J;  3ZMT A;  3PUB A;  3PFI A;  2DXI A;  2X1D A;  3JRF A;  2HOT A;  3MQ0 A;  3E97 A;  2M9H A;  1XMA A;  5LD2 C;  1B59 A;  3DWL E;  4UY8 I;  2IT0 A;  4KA4 A;  2XGE A;  4LGW A;  2F2E A;  4ENJ A;  2JSP A;  1W36 D;  1ZR4 A;  1U5T B;  1I1G A;  2CG4 A;  2LY1 A;  4D5C A;  4M3E A;  2WAF A;  4ZYG A;  2W1O A;  1MMG A;  4AIK A;  1ON2 A;  1LVA A;  4JX6 A;  3NWS A;  2WBM A;  2P5L C;  1V55 H;  3U1K A;  3TP3 A;  5D5X B;  4NHJ A;  2JK3 A;  4OWR B;  3C3W A;  2KP6 A;  3KP7 A;  5FRM A;  3DPL C;  2M7B A;  4KIC A;  4OIO F;  1AU7 A;  2XB5 A;  3ZMD A;  5C4J J;  2PG4 A;  2A5W A;  2EFW A;  2R7Q A;  3S3M A;  2PJR A;  2O03 A;  2Y75 A;  2HR3 A;  3SQN A;  2TDX A;  3PIP F;  4M74 A;  2DT7 B;  3BG5 A;  1OCC H;  2JSC A;  4U0Y A;  1K6Y A;  4Y13 A;  4XQF A;  1XN7 A;  3BT9 A;  2L2O A;  2GIV A;  3DPU A;  1T38 A;  3HGY A;  3M4O J;  2COB A;  3KX2 A;  3SFZ A;  1WCM J;  2QQ9 A;  5HVQ C;  1HKT A;  4W1U A;  2CJJ A;  3AG2 H;  4LLL A;  3I55 I;  5M3M J;  2HOE A;  3MN2 A;  4NB5 A;  3TMO A;  3KE2 A;  2PX9 A;  2KIQ A;  1ZYR F;  2JT1 A;  4A69 C;  3SHF A;  4Q4Z F;  1JKP C;  4WWC A;  3C1D A;  5CVU A;  3GTO J;  1ETK A;  4FX4 A;  2K9M A;  4CCO A;  4OIQ F;  3JRE A;  4EVI A;  2E34 A;  3HIF A;  1T98 A;  3LSJ A;  3V42 A;  4OMZ A;  2AO9 A;  5K7H A;  5EGO A;  1U78 A;  2IS1 A;  4XKB A;  4IQJ A;  2P6S A;  4ZDP A;  2NRA C;  2RV8 A;  2FF4 A;  3GFL A;  3CCV I;  2JRT A;  3ECH A;  4AUX A;  3SZT A;  2WWY A;  3A01 A;  4DJA A;  2R7V A;  3EQL F;  3BY6 A;  3H36 A;  2HS5 A;  1R71 A;  2ECC A;  2G7H A;  3T8R A;  1W4M A;  2DA4 A;  3OYN A;  3RQ4 A;  4PK4 A;  4YIF A;  3E6B A;  2VL8 A;  5KCM A;  3VOD A;  3FXL A;  3H9Q A;  3I4N J;  2F5C A;  3HG9 A;  4OIP F;  3TO6 A;  2QBY B;  1WKM A;  2RNG A;  1JXS A;  5DD4 A;  3BG3 A;  3EYI A;  2PLY A;  1D1B A;  2WB1 A;  2RNJ A;  2HYJ A;  2IA0 A;  2JWT A;  3KP5 A;  5IOY A;  4FIS A;  2VBX A;  2GIZ A;  4CH7 A;  5EJC A;  3IWF A;  4MTD A;  4LJZ F;  1I27 A;  1S7A A;  5J8C A;  2EIM H;  5LLQ A;  4GYI A;  3ESW B;  2P81 A;  1VQK I;  4A0X A;  2KRF A;  1SFU A;  1E3P A;  4D9J A;  2DW4 A;  2JVH A;  1D1A A;  2IJL A;  4JX5 A;  4A3F J;  2F5V A;  3IHU A;  4DYR A;  5EG0 B;  5F1J A;  2ZSH B;  3RKX A;  3VB2 A;  1U5T A;  2HFH A;  2EZK A;  4RB1 A;  2CMP A;  1MSE C;  2QZ8 A;  1J59 A;  2EIK H;  3WU0 A;  3FIW A;  3CCJ I;  3MFK A;  1PUF B;  1BR1 A;  4EEF G;  1S7O A;  5B1B H;  2JA2 A;  2FBI A;  2RC4 A;  2WAD A;  1P9Q C;  1HSJ A;  2X6Y A;  3CC2 I;  3K70 C;  1Z05 A;  1UG0 A;  3ZQF A;  2M8E A;  1TT0 A;  3CJT B;  1YX5 A;  2AQE A;  4BQA A;  2RVC A;  4HQE A;  3OYD A;  1XG1 A;  1MND A;  1ONV A;  2AQF A;  5EZG A;  4BY1 J;  4A93 J;  3K4L A;  1ZEL A;  5FKM A;  3W6K B;  1A31 A;  4EJO A;  4PGH A;  1UHM A;  3RZD J;  2E19 A;  3LSH A;  1R5I D;  2CO5 A;  3HHG A;  4A0Y A;  2K86 A;  3E5X A;  3PO3 J;  5FO5 A;  3CO7 C;  3HOT A;  2XB0 X;  1TQP A;  4R8H A;  1ZQ3 P;  3UKG A;  1A6Q A;  1JHF A;  3ZRG A;  3K1P A;  1WPK A;  1KYZ A;  5CLS A;  2DA2 A;  2HWV A;  5D5W B;  4B1R A;  1P7I A;  3GTQ J;  3FKJ A;  4Q48 A;  3LOC A;  1V4R A;  4BXU A;  4IHX A;  4UVA A;  1M1E B;  4HLX A;  2E1M C;  1LDD A;  4HX7 A;  3BCA A;  1BOB A;  2ID3 A;  3ZQ7 A;  5K5R A;  2VIX A;  3KYD B;  2YR2 A;  3TO9 A;  4BHC A;  5E8I A;  4XR6 A;  1JHH A;  2VXD A;  3K4J A;  3RSN A;  5HOD A;  1K83 J;  4PSW A;  1Z7U A;  3TL4 X;  2UXN A;  4F3Q A;  5FB2 A;  3QPH A;  2P0W A;  2P7V B;  4NNJ A;  3WHC A;  2QQB A;  4EJU A;  1BI2 A;  3O6B B;  1WJF A;  2W57 A;  3WGI A;  2PMZ N;  3KZZ A;  2DTR A;  3JRD A;  5ILS A;  2QVO A;  5H20 A;  3OYE A;  3CCU I;  1D5V A;  2ZJQ F;  2XAH A;  2VB6 A;  3QU3 A;  1HXD A;  1WJB A;  2BY2 A;  4AID A;  4AC0 A;  1H9G A;  3CC7 I;  2KZV A;  2KFD A;  1H9T A;  1BJZ A;  2MA3 A;  1WI3 A;  1ZKG A;  1GUU A;  5IT9 K;  3FK7 A;  1ETO A;  1W5T A;  1D1C A;  2P4W A;  3CUO A;  3W2V A;  6PAX A;  3V8L A;  3OYC A;  2DOD A;  5L3B A;  5F0C A;  4BL0 B;  1SD7 A;  3LSK A;  4CIC A;  4HX4 A;  2W84 A;  1S9H A;  5HDG A;  1VI0 A;  1IC8 A;  1VQN I;  1ZG5 A;  2HYF A;  2LKX A;  4L0Y B;  4P5O A;  1QZE A;  3VOE A;  2HDD A;  1FLI A;  2LOO A;  1Z67 A;  2JN6 A;  1APL C;  5DDG A;  4IJA A;  4ESJ A;  4BBS J;  2FRH A;  4V19 K;  1IO2 A;  5AIP A;  2H8W A;  3S1R J;  3DF8 A;  4UB8 C;  5DEQ A;  4QLC U;  5FLX Z;  3ERE D;  5DV5 A;  1X3U A;  2R7W A;  3AKZ A;  1FTT A;  2OD5 A;  3S2W A;  4L9T A;  4UUS A;  4ANJ A;  3BTJ A;  1W36 C;  3ABL H;  5C4X J;  3FXM A;  1RIO H;  3ZMZ A;  3LA2 A;  1XGM A;  1GV2 A;  4BEH A;  3OOU A;  3HPG A;  5CVJ A;  3GVA A;  3ONQ A;  2EWN A;  3O8H A;  4H4K C;  2ZJR F;  1O3S A;  5FRN A;  1Q1H A;  3F8M A;  2EFQ A;  3HB9 A;  1T56 A;  5D4S A;  2EV5 A;  5ICG A;  1TQM A;  3HHH A;  1FP2 A;  3W3C A;  5DCM B;  2W4S A;  4KIF A;  3PNV A;  2QCO A;  3EUH C;  5D8L B;  3JRH A;  2OQG A;  3FBI B;  4KT5 C;  3TQN A;  1OPC A;  2WV0 A;  3OMY A;  5K5Q A;  1NHA A;  1HC8 A;  5HLH A;  2XF5 A;  2J5P A;  3Q0W A;  4II2 A;  1X1A A;  1V5G A;  2RDP A;  2I10 A;  3L7W A;  2A6T A;  4EM2 A;  2Z16 A;  2LSO A;  2DOF A;  4N4O B;  5ILU A;  5LFA A;  1UJ8 A;  4BKX A;  4BXX J;  2IGK A;  4RGS A;  1LJ9 A;  4IVN A;  4RAG A;  5KVR A;  4G94 A;  4UV8 A;  3Q9S A;  2DN0 A;  5J8F A;  3L2U A;  2DMQ A;  4R79 A;  5FFX A;  3RQI A;  4MIM A;  5GPC A;  3HUG A;  5F27 A;  1BI1 A;  1D8J A;  2DA7 A;  2VPR A;  3FMR A;  3IAM 2;  4ZZD A;  4E7H A;  1G2H A;  3V7R A;  1ORK A;  1O7L A;  2DK5 A;  4RM2 A;  2M7A A;  2IBD A;  4I98 B;  5DCF A;  4RGX A;  2COM A;  4EQQ A;  2DA3 A;  2GLO A;  2DTZ A;  1IAW A;  1OYW A;  1EKE A;  4PUS A;  4WK8 F;  5KAI C;  3FIS A;  2Y9Y A;  3ELK A;  2ME6 A;  1FX7 A;  4QIW N;  4IRG A;  4IF4 A;  1XCV A;  3MZ8 A;  4LFU A;  1P4A A;  5E1W A;  5KNL A;  2GBY A;  2TRT A;  5ED4 A;  5HS8 A;  3A4C A;  4RAF A;  2YUS A;  5FD6 A;  3TED A;  1RUN A;  2XF6 A;  1WWX A;  4XOP A;  3FHZ A;  4CDG A;  4D5F A;  5GAH J;  2ZJP F;  1KON A;  3ULQ B;  2L3D A;  4L5J A;  5EZH A;  1IW7 F;  4RBO A;  1WHU A;  2V1D A;  4D7N A;  1ZGA A;  1XSX A;  4ASN A;  2HEO A;  3S93 A;  1HW2 A;  4AYB N;  3TDU C;  2MBF A;  4C3H J;  1AKH A;  2DMT A;  4U88 A;  4MHG A;  3A03 A;  5M3F J;  2CUF A;  2RRE A;  1YRN A;  4X6A J;  4XNF A;  2ICW G;  3KFW X;  2CFX A;  2MAB A;  3MCZ A;  2Q2E B;  1OJL A;  4C2T A;  5JVG F;  1BI0 A;  1MDM B;  3WG7 H;  1VQ5 I;  4IEJ A;  1S6L A;  4LOC A;  3MKZ A;  1S3J A;  2RKH A;  3CO6 C;  2CQN A;  2VT3 A;  5J1R A;  4MEY F;  1NTC A;  5L3F A;  1YIJ I;  3CCQ I;  1WH5 A;  4A0Z A;  5KK1 A;  1MH4 A;  3CUQ A;  3CES A;  2W82 A;  4QPQ A;  1XDS A;  1GVD A;  1YOV B;  1J9I A;  3GTG J;  2RN7 A;  3QP6 A;  1BM9 A;  1SEU A;  1RZ4 A;  1T8I A;  2HI3 A;  5TJJ A;  3J81 K;  3N97 A;  2OAZ A;  3GZ6 A;  2GOX B;  1UHS A;  1U3E M;  3GUD A;  2ZFU A;  1T0F A;  4P9F A;  2MH2 A;  3F6O A;  2DAO A;  4HSR A;  1ZR2 A;  3ZMU A;  1I5Z A;  3U21 A;  3EDP A;  2V6C A;  4GRI A;  4M72 A;  2KT0 A;  1B8I B;  4L9N A;  1I3Q J;  1FZP B;  4A3E J;  1PYV A;  2MC4 A;  4XL9 A;  2IS6 A;  3RI4 A;  5HS9 A;  2E7X A;  3L1P A;  4HF1 A;  2FBK A;  2A5Y B;  2OF7 A;  2Y9Z A;  1UMQ A;  2FOK A;  2WV1 A;  3I3L A;  3F6V A;  3B73 A;  1SMT A;  2ZXW H;  1OMI A;  1EH7 A;  3NRV A;  1YX3 A;  2EV6 A;  1L3L A;  1X2M A;  1YYV A;  2CQK A;  3L00 A;  3CP2 A;  5EYR A;  5ILV A;  2PMU A;  1ZK8 A;  2O8K A;  3VDX A;  4YEJ A;  1HA8 A;  4BUP A;  1OKR A;  2R7O A;  3LAP A;  2HZT A;  4RB0 A;  3S15 J;  4JP0 A;  3ZR8 X;  4ZTJ A;  3PO2 J;  3ZN0 A;  1XGN A;  1TWH J;  1ZLK A;  3IH2 A;  2R3S A;  4NC8 A;  4LB5 A;  1ZRC A;  1R58 A;  3HJE A;  1HKQ A;  1POG A;  3W6J B;  4ETS A;  1RC9 A;  1VZ0 A;  3FXQ A;  2KRC A;  3CDI A;  3F8B A;  3BZK A;  3E6C C;  1H0M A;  1XGS A;  1W5S A;  2PEX A;  5D8K B;  2E5N A;  2KIU A;  1UB9 A;  2Z1D A;  4RLF A;  2UXX A;  4PJN A;  5H6R A;  4YIR X;  4E7S A;  3HOU J;  3B6C A;  2L9N A;  4KYW A;  1R4M B;  1OYY A;  4Y17 A;  1RR7 A;  2CUZ A;  3FXO A;  3HM5 A;  4HF2 A;  1AWC A;  1FBQ A;  1OR7 A;  4HST A;  2BV6 A;  4ZYE A;  3REO A;  3A01 B;  1SFK A;  3PQJ A;  5E3O A;  3D5S C;  1UEL B;  4BGD A;  2KRH A;  2WAE A;  3L9F A;  1QVT A;  3HC7 A;  4CSW A;  1MBE A;  2RQP A;  3FHN A;  4U7B A;  2W24 A;  1EF4 A;  4LIT A;  2OZU A;  3CP8 A;  4HOB A;  3BPV A;  2A69 F;  4KIB A;  3HRT A;  2FBH A;  3R4K A;  1TNS A;  5BQT A;  3LFK A;  1G3Y A;  1P4X A;  3RPQ A;  2YU9 J;  3X2Q H;  2X6W A;  4FTH A;  4BAC A;  1JTX A;  3BZ6 A;  2JTV A;  1U5T C;  3F22 A;  3J81 Z;  3G1L A;  2L9S A;  3C7J A;  1U2W A;  4RLQ A;  1ETY A;  4D1Q A;  2CWE A;  1HDP A;  5FKN A;  5J3L A;  2R7Z J;  2JMW A;  2LTP A;  4QWQ A;  2NXN B;  1WQ2 A;  1F4K A;  1X19 A;  1D0Y A;  4C2M J;  2R5Z A;  4TV7 A;  1S7E A;  2EK5 A;  2NNN A;  3HKZ N;  5D5U B;  2RQQ A;  4AU7 A;  3FM3 A;  1YO5 C;  3H0G J;  2NVU B;  1A6I A;  2BE5 F;  1Q1V A;  3S1M J;  1J2X A;  2IXS A;  1NG6 A;  4RAY A;  4RDU A;  1H88 C;  3PFY A;  4A3J J;  5ICF A;  5JR3 A;  3OL4 A;  1PUF A;  3L2W A;  3NEU A;  2HVS A;  2X1E A;  5HLT A;  4ENK A;  4KNY A;  2VJJ A;  1W5C C;  2MW8 A;  2E2H J;  1U0J A;  3AG1 H;  3G1M A;  3GXO A;  4IL6 C;  1MIJ A;  3GBG A;  2VC0 A;  3Q0V A;  4IX7 A;  1JI8 A;  5IOZ A;  4CHU A;  1HW1 A;  3BQY A;  2ZO4 A;  4XRS G;  1I50 J;  2EA4 A;  3W6V A;  2K3P A;  1D0Z A;  3DKY A;  3COA C;  5EF6 A;  3W2W A;  2WY8 Q;  1GDT A;  1K79 A;  4ESB A;  2ZFW A;  3MWM A;  3SDB A;  3GTM J;  2NS8 A;  2DOE A;  1R5H A;  2ZNZ A;  3AG3 H;  4MFE A;  4H0E A;  4G12 A;  1KGS A;  3ZQC A;  1R5G A;  1T08 B;  4JX4 A;  1JJ8 C;  5IP9 J;  1Y39 A;  2F48 A;  1F36 A;  3LQQ A;  4I0B A;  4LLG F;  2B0L A;  5A2Q K;  3J7A Y;  3A0B C;  2LLK A;  3HSR A;  3DFG A;  5HNH A;  3H3U A;  2TCT A;  3H5N A;  2LRD A;  4Y52 J;  5ICE A;  3OS1 A;  3ML6 A;  4DNC A;  1X4P A;  4ZTF A;  4OOI A;  4RB3 C;  5IYC J;  4OMY A;  2YPR A;  3WE2 A;  2AHQ A;  2LF7 A;  1BOA A;  2XAS A;  3F23 A;  1BL0 A;  2VBW A;  1RR8 C;  3H5R A;  4KIT B;  2A05 A;  3PNT A;  4KDP A;  2HDC A;  2VKH A;  5K7F A;  4A3C J;  2FEZ A;  5CPR B;  3ROU A;  4M71 A;  1RKW A;  3NQO A;  2DA5 A;  5DTD A;  2W7N A;  5EG0 A;  4CXF A;  3DKX A;  4BXF A;  2DBB A;  5GPA A;  2LBF B;  5FKK A;  2Z99 A;  3V8K A;  4CZC A;  1ERD A;  2KIM A;  5FGM A;  4Z6Y A;  1N77 A;  1XPX A;  4PFP A;  4E7Z A;  1R23 A;  3CCE I;  4EM1 A;  5JHF A;  4CA0 A;  4I6Z A;  2M87 A;  1G3S A;  3GWZ A;  4CCL A;  2A6E F;  3V7S A;  4B3A A;  5J6X A;  2HPM A;  3T1B A;  2VPL A;  3LNQ A;  3TW6 A;  2JUG A;  4BH9 A;  3GFM A;  2I5U A;  2IVM A;  2HYG D;  4EV0 A;  4ZYA A;  3FXU A;  3HYI A;  1WJC A;  2VJ5 A;  3HOW J;  1B1B A;  3BTL A;  4XKV A;  1TNT A;  2L9R A;  2BBY A;  2ZME C;  1O4X A;  2L7K A;  4UVC A;  5HLI A;  1J0R A;  4LMY A;  1R9T J;  2WC2 A;  3OR1 C;  1YG2 A;  2ID6 A;  3L2R A;  2CYY A;  3SZP A;  2Y2Z A;  2VXZ A;  1EV7 A;  1FT9 A;  3QPS A;  2J5O A;  3AG4 H;  1Z91 A;  2HQR A;  3GCM A;  4A3D J;  2XGX A;  2BXZ A;  3G71 I;  4BEH B;  1WZ2 A;  3ISP A;  2YU3 A;  4UHT A;  2CQX A;  2VI6 A;  3CDH A;  2V9P A;  1T6S A;  2X6O A;  2CFO A;  4PJM A;  2R92 J;  2OU2 A;  4IKF A;  1WJE A;  3HKZ A;  3FBN B;  2NOJ B;  5BPD A;  3P9I A;  1NG7 A;  4WF2 A;  3ZQI A;  4AM3 A;  2MSY A;  2EZL A;  1QVU A;  3U9G A;  2DFF A;  1XD7 A;  4CYC B;  1IDZ A;  3K6G A;  3FK6 A;  1SAU A;  1ZGW A;  5IT9 Z;  4XLE A;  3S16 J;  2HU9 A;  2L0K A;  4PDK A;  2DU9 A;  1A35 A;  3BOQ A;  3R0J A;  5FJ8 J;  2Z2S B;  1DU0 A;  2KHM A;  5BS6 A;  5AON A;  1T39 A;  4N9I A;  3H0D A;  1EH6 A;  2CV2 A;  2GXG A;  4F52 A;  1GLN A;  4M3F A;  5HDK A;  2ECB A;  1YIO A;  3CCY A;  2CUJ A;  1RPW A;  3I64 A;  3TOA A;  5IY5 H;  4L5E A;  3ABU A;  2V9K A;  2XKO A;  1XDU A;  2OUM A;  1J7K A;  1TWC J;  3BJO A;  3H3Z A;  2FUG 2;  1L0O C;  2STW A;  3V8J A;  4ENM A;  3DLL F;  2NYX A;  4M6X A;  3HRS A;  3OYG A;  3J80 K;  2MC3 A;  1LB2 A;  2DO7 A;  4LG0 A;  5L3E A;  3L2C A;  3D1N I;  1KYW A;  4P55 A;  4DYQ A;  5E8G A;  3FM5 A;  2JA6 J;  2VON A;  4XLP F;  2IGO A;  1FJL A;  2FJ1 A;  1QHG A;  1YE9 A;  2ELK A;  2E1O A;  2FML A;  3H92 A;  5FLM J;  3HXL A;  2YSR A;  1S72 I;  1WH7 A;  4FX0 A;  2CQQ A;  1RNL A;  4DYC A;  5M5X J;  1IUY A;  1XCB A;  3CTA A;  3M9A A;  1E0E A;  4XLA A;  4KIS A;  2ME0 A;  1X58 A;  3GTL J;  3H9J A;  1TW2 A;  4HLY A;  2X85 A;  1WJD A;  3K1N A;  2KIS A;  3T5X A;  2E1C A;  4MLO A;  4MFD A;  1W7P A;  1I1S A;  4N4N B;  2A3S A;  1KU9 A;  3WTT C;  1T0F C;  4XRS A;  1LFP A;  4CO8 A;  3FXK A;  4LB6 B;  1SFO J;  4B43 A;  1YRN B;  2OTJ I;  4I09 A;  2FNA A;  4XM3 A;  4MO7 A;  4HNV A;  3GF2 A;  4NUB A;  4EJV A;  4RGU A;  1SD4 A;  1G3W A;  3QU6 A;  3VWB A;  2HTJ A;  1XC5 A;  1H89 C;  4F92 B;  2HQN A;  2OBP A;  4IQ4 A;  1T95 A;  5HLG A;  3O3K A;  3G1O A;  2CRG A;  2VQC A;  3OYJ A;  1FEX A;  3G2B A;  1R36 A;  2DYS H;  3H35 A;  4RM3 A;  3CUQ B;  1GT0 C;  1V5F A;  2M45 A;  4PJL A;  1BR4 A;  4JK1 X;  5BPI A;  4XON A;  4YRV A;  4XN3 A;  1LUJ B;  4KJZ A;  2M0M A;  2LY2 A;  2BOL A;  4J01 A;  2KMU A;  2IGN A;  3C2G A;  3HEF A;  3GX4 X;  5KHD A;  2K27 A;  3BP8 A;  3F8F A;  2JPB A;  5LHG A;  4EGZ A;  2JRM A;  2K9Q A;  2XIG A;  5LBQ A;  1BC8 C;  2M1B A;  3OYH A;  3MEX A;  2ZJ2 A;  4O5V A;  2E7W A;  3AFH A;  2VT2 A;  2C6Y A;  2DT6 A;  1X3Z B;  4B8X A;  3OYL A;  1HOM A;  2JQ7 A;  2EQR A;  3EUH A;  2VE9 A;  1DPR A;  4M3D A;  5GTI C;  2V26 A;  2XGD A;  2VC1 A;  1MKM A;  4QSH A;  4YFX F;  5K1Y A;  3KZI C;  5FKO A;  2E2I J;  2H1K A;  2O6G E;  5HDN A;  3K4N A;  3N05 A;  4BQN A;  2QKM B;  3I4P A;  3R0A A;  1MMA A;  1WGX A;  4BAY A;  3WTX C;  4NQW A;  1MMS A;  2VN2 A;  2D45 A;  4AVZ A;  2HVQ A;  2QLZ A;  3I53 A;  5IPA A;  2CW0 F;  2DFE A;  1GHC A;  3DBH B;  1DP3 A;  1G8X A;  1P6R A;  5CVR A;  1ETQ A;  3QPL A;  3IH4 A;  2QEX I;  1G3T A;  2LY9 A;  3VFZ A;  3E3V A;  2LYC A;  2BVL A;  3HZJ A;  3I4M J;  4Q5S F;  2M4K A;  3H3V K;  1R4N B;  2K02 A;  5IT3 A;  3JSO A;  2YX4 A;  5LEJ A;  1XSD A;  1FYK A;  4GYG A;  4XLN F;  3R6S A;  3LMM A;  1FOW A;  5ICC A;  1X3W B;  2QQ8 A;  4L0Z B;  2FU4 A;  2O9L A;  3KIO A;  1VQ8 I;  4HQM A;  2KQR A;  4R1H A;  3GTK J;  2KZG A;  3EUA A;  2NVT J;  3J7A O;  3OIQ A;  3DBR B;  3R60 A;  1FPQ A;  2ETH A;  2NVQ J;  1GVJ A;  1DQU A;  1X2N A;  1LDJ A;  3L09 A;  4A3L J;  2UZK A;  1QRY A;  4XLH A;  2XGC A;  1Z21 A;  3M1E A;  4A3G J;  2R5Y B;  1YS6 A;  2DJN A;  1Z1D A;  2HDW A;  5F64 A;  1RKT A;  2EFN A;  3OSF A;  4BY7 J;  4UB6 C;  2ZXH A;  1Z3Y A;  3S3N A;  2BHY A;  4NBQ A;  4CUG A;  3J7Z I;  1U8R A;  2V6E A;  4HA8 A;  2X4H A;  2Z33 A;  1FYL A;  2B9S A;  3D0S A;  2LKS A;  2VAS A;  2MG4 A;  3LSI A;  3GYH X;  1WJA A;  2OJE D;  1B72 A;  3M8J A;  1RUO A;  1QU3 A;  4Y15 A;  3K4C A;  4EJT A;  4JOM A;  1OYI A;  2NNY A;  2IS2 A;  1K4T A;  5FLV A;  2DPD A;  4FT8 A;  3GME A;  3E1S A;  1LQ1 A;  3QYE A;  5LGN A;  1JE8 A;  2F4M B;  4O3M A;  2E1N A;  5IP6 A;  3OL3 A;  3WU2 C;  3M07 A;  3M8E A;  3KET A;  2ELJ A;  5TIS C;  3BQZ A;  1BJA A;  5J1Y A;  4OAZ A;  1Z7L A;  3BG6 A;  1Y6I A;  2XAG A;  2DI3 A;  2DA1 A;  1WI9 A;  3TBI A;  1ZAR A;  4YFN F;  4Y33 A;  4E7J A;  2EJR A;  2Y30 A;  3VYT B;  4I2O A;  1HST A;  3UR3 C;  3BG9 A;  5L3C A;  1DGW Y;  1MH3 A;  3I58 A;  4P96 A;  4BBR J;  4BJ6 C;  2IW5 A;  2P5K A;  2LKP A;  3I0T A;  2KDO A;  3JW4 A;  1C0W A;  3HTU A;  5JVT A;  1P2F A;  5K7Z A;  3E0J B;  3OYB A;  2V9V A;  1VTN C;  4IXA A;  1U9O A;  1XGO A;  2UWM A;  5B3S H;  4D0P A;  1MW7 A;  5DUK A;  4G7Z F;  2EV0 A;  3WTU C;  3BR0 A;  1YHQ I;  5EDN A;  2QEN A;  2L7M P;  2XPV A;  2F5F A;  4CCJ A;  4HV5 A;  4F7Z A;  4IO9 F;  2K4J A;  4O6J A;  5D6E A;  3HDD A;  2ZCW A;  3K4K A;  1VQ6 I;  2Y48 A;  4EGY A;  3I59 A;  3DP7 A;  2ZME B;  3EUK L;  2AXL A;  1VQL I;  2LK2 A;  2R7F A;  3HUG B;  2MYS A;  1HCR A;  4J19 A;  1E3O C;  3IP4 B;  4M3B A;  4HYE A;  1U6G A;  1O57 A;  3F21 A;  3BG7 A;  3H9G A;  3A02 A;  2O8X A;  3B6A A;  3Q9V A;  3QYB A;  4Y4R A;  1LVK A;  4BJT A;  4ESF A;  2H8R A;  1MBH A;  2PJP A;  2V1N A;  2VQL A;  2DQR A;  3E5Q A;  2ZBK A;  2WY7 Q;  4HBL A;  1OR7 C;  4E7L A;  3BTC A;  1R22 A;  1U8B A;  1W7P B;  3ABT A;  4P9U A;  4IHS A;  5LHI A;  4FET A;  2IEK A;  4U7D A;  3H5A A;  3DEU A;  4A5N A;  3ZP5 A;  1XMK A;  4C9Y A;  2XAU A;  4HG2 A;  2Z9O A;  2B7E A;  2QQA A;  4KMU X;  2M30 A;  4DQ2 A;  4UUS B;  1TT5 B;  4XLF A;  4Q47 A;  1S29 A;  2XVC A;  1JUM A;  1B4A A;  1P92 A;  3TDZ C;  1JGS A;  2DYR H;  2HOS A;  2QA4 I;  2OZ6 A;  1PP8 F;  3LWF A;  1MBF A;  3S1N J;  4ZDL A;  1ZAO A;  3QOD A;  1AKH B;  1KU3 A;  1FBU A;  1DP7 P;  3M3Y J;  5LEK A;  5E20 A;  2M5W A;  3HOV J;  2GAU A;  1VF9 A;  1Z3X A;  4ENN A;  1LE8 A;  3LSG A;  1XS9 A;  2Y69 H;  2EFP A;  1Z0X A;  1BA5 A;  1V54 H;  5K5O A;  2PFB A;  5F08 A;  2ZB9 A;  3LFU A;  2BXY A;  2OA4 A;  3IC7 A;  4XMY A;  3HOX J;  3S2H J;  4OIN F;  3K9T A;  5J47 A;  3OYK A;  2WA0 A;  2G0E A;  2MGQ A;  1HF0 A;  3GLL A;  3KZY A;  2KJC A;  1Y8R B;  4BE1 A;  3BJA A;  3MD2 A;  1ZN2 A;  2XRO A;  1MD0 A;  1I39 A;  2QGU A;  3K7A J;  5CVV A;  2Q8K A;  1QQI A;  1VQ7 I;  1PUE E;  3KLN A;  2GZW A;  1VFC A;  5GAE J;  2ISZ A;  5M5W J;  3SEZ A;  4OAY A;  1PJR A;  4WCG A;  2NS0 A;  1IGN A;  5TRD A;  1NK3 P;  1CQT A;  1R7J A;  3OSG A;  4A3I J;  5E18 F;  1SVM A;  5B5E C;  2E5Z A;  3OIP A;  1XX5 A;  3RYR A;  4BU2 A;  4X1E A;  3SDG A;  3JRG A;  1F9N A;  4G6D A;  1MJA A;  4XK4 A;  4XRM A;  1IJW C;  3E7L A;  3RPU A;  1BC7 C;  4A3B J;  1FMV A;  1JKO C;  1IN4 A;  3DKW A;  1EH8 A;  4RAZ A;  3AL0 C;  2EZI A;  1O3T A;  9ANT A;  4WX9 A;  2BW3 A;  2IS4 A;  2NVY J;  3J7Y J;  1FIA A;  2CH0 A;  3QOE A;  2D2W A;  2O0Y A;  2VQH A;  1T33 A;  4PFO A;  1BI3 A;  2P7C B;  1IRF A;  5DUI A;  3IRR A;  3OYM A;  4HNT A;  4WXC A;  2R7X A;  1K7A A;  3ECO A;  3U2R A;  1H8A C;  1AOY A;  1X1P A;  2HTS A;  1A04 A;  1ETW A;  2M4G A;  4ZH4 F;  1ZRF A;  1FWZ A;  3EYY A;  3BDD A;  5ERI A;  3QYF A;  4OIR F;  2ESH A;  5HS7 A;  2K40 A;  1IN5 A;  1QHH D;  5JLX A;  3A1Y A;  3D5L A;  2LBF A;  4BHP A;  4XID A;  2NAZ A;  2WTE A;  2EIN H;  5HNF A;  2M2E A;  2XC7 A;  2R7U A;  2L9V A;  4FQG A;  4I7H A;  4U0V A;  4CCM A;  3CCL I;  3RZO J;  3O2P E;  2LH9 A;  3C2H A;  1V3F A;  2R7T A;  2ACJ A;  5FD5 A;  1FOK A;  1K4S A;  3VSL A;  3DQV C;  1HDD C;  5KAF C;  4E7K A;  4X0G A;  1LEB A;  1BIB A;  2H6C A;  4ZZL A;  4IRH A;  4ON0 A;  1X1B A;  1TW3 A;  4PSX A;  3Q3S A;  5E79 C;  3OR2 C;  4XN0 A;  4YII A;  2LVS A;  2WAQ N;  3JRI A;  5EGO B;  3LSM A;  2F4I A;  2M3A A;  2AXT C;  4GDF A;  3WG9 A;  4BDZ A;  2DDA A;  3OS0 A;  2KIF A;  3ZGK A;  5FRO A;  2DA6 A;  2HOA A;  4A3K J;  2PI0 A;  1UCR A;  5C44 J;  2YS9 A;  3PUF A;  5AIQ A;  2KJB A;  1SAN A;  4MTE A;  2VE8 A;  4XOT A;  1ITY A;  2KKO A;  3QOP A;  4G8X A;  3ZMV A;  1CF7 B;  1B9M A;  2MH9 A;  4M3G A;  1FTZ A;  2VOP A;  2UV1 A;  3K69 A;  4C30 A;  5LGU A;  3K10 A;  2OPT A;  1Z9C A;  5H6Q A;  3NAU A;  4I99 C;  1Y1W J;  1W0U A;  2PMZ A;  3HOY J;  1U9N A;  3MAJ A;  1SFX A;  2MD5 A;  5JI6 A;  4XKW A;  5E3N A;  2VBY A;  1D8K A;  4C3J J;  2X0L A;  2ZSI B;  3I5U A;  4E7I A;  5B1A H;  3P7N A;  1PP7 U;  4ITV A;  4BE2 A;  4NC6 A;  1IXR C;  2R5Z B;  4M9X A;  3H1C A;  3PQK A;  2CW8 A;  3TO7 A;  4LIU A;  2Y31 A;  2CS3 A;  5TGT A;  4FE4 A;  1TZL A;  3BRO A;  2CQ7 A;  2K3F A;  1QBJ A;  1ON1 A;  2K9N A;  2NS7 A;  1SD6 A;  3I71 A;  3LST A;  1R00 A;  4PCQ A;  1TLH B;  4HPQ A;  5HOO A;  1K6O A;  2EZH A;  5B66 C;  4IRI A;  3OS2 A;  3PM1 A;  2DPU A;  3ZQG A;  1YTY A;  2DOA A;  2V1U A;  2V4J C;  4XSZ F;  1FIP A;  2IP2 A;  4HZF A;  2IA2 A;  2Z3Y A;  2VQG A;  3LSR A;  4RS8 A;  2FNP A;  1HQC A;  2EPF A;  1IN7 A;  2CV0 A;  2RGV A;  1QZZ A;  1XB4 A;  2O7O A;  2QSG X;  4CCK A;  2FMY A;  2DMP A;  1UZC A;  2QM3 A;  2HKO A;  2A61 A;  3ZOB A;  3I9V 2;  4DW6 A;  1G59 A;  3LA7 A;  2Q0O A;  2RAE A;  3V4G A;  4G6Q A;  3CUQ C;  2WAQ A;  3C2B A;  2PQ8 A;  4BE0 A;  2M34 A;  3OYF A;  1BIA A;  4KN4 X;  1QPI A;  3QWL A;  3EPZ A;  1DPU A;  2GWR A;  3WTZ A;  4RGR A;  5J4V A;  3LAJ A;  1J75 A;  1IN8 A;  3CMM A;  2HXO A;  1GXP A;  2HNH A;  2OV7 A;  2VKV A;  3GTP J;  3PNY A;  3GW2 A;  2QBY A;  2XRL A;  2K7L A;  2XPU A;  5CQG A;  3ZCO A;  1DUX C;  2H09 A;  1QPM A;  1E3H A;  2ESN A;  1J5Y A;  3CCR I;  1ETX A;  3DEW A;  4QTR A;  1LPQ A;  2LNB A;  3GFI A;  2L54 A;  5D4R A;  1I6H J;  4HNU A;  5DCM A;  3MKW B;  5M5Y J;  5JLW A;  2F5D A;  4IHY A;  3F3X A;  2G7U A;  1F5T A;  2H94 A;  1A36 A;  4UVB A;  4C3I J;  2ZME A;  3WTW C;  5CKT A;  1TWF J;  2JA7 J;  3QP5 A;  2Q2E A;  5FFZ A;  1MDM A;  2QKL B;  2L5Q A;  4UNO A;  5F1R A;  2YX7 A;  1VQ9 I;  3IRQ A;  4XBF A;  3K70 D;  1NK2 P;  1XTA A;  2O3F A;  4IHT A;  5EEA A;  3ZQQ A;  4EMS A;  3P5J A;  1I6X A;  1S8N A;  4GXO A;  4DIQ A;  2W25 A;  5IYB J;  4E6K G;  1LKX A;  2XV4 S;  4NC7 A;  4EAT A;  2B63 J;  4HX8 A;  5L3D A;  2Y0M A;  3HBL A;  3DCF A;  3KP3 A;  2PBI A;  1ZLJ A;  4NQW B;  3ZPL A;  3FX3 A;  3JRA A;  2VOO A;  3QPT A;  2X9D A;  4IHV A;  1RI7 A;  2VLA A;  1ZRD A;  2KPM A;  3MKY B;  4YEL A;  2CV1 A;  1IDY A;  2ZXI A;  1RES A;  4ZYH A;  4B09 A;  4HDV A;  1HW5 A;  2QUF A;  4M6Y A;  3CCM I;  3HOS A;  2GOM A;  2R0Q C;  3OYA A;  2E71 A;  2KL4 A;  4ZC3 A;  3PL8 A;  3KCC A;  3VYR B;  3RIR A;  3FXR A;  2HXI A;  1Y8Q B;  3MVP A;  3WGH A;  1BR2 A;  3WTY C;  1BW6 A;  2DJI A;  3R61 A;  2XSD C;  1B8I A;  1LEA A;  3IAS 2;  3RKW A;  2A07 F;  1MBG A;  1TTY A;  2E1M B;  2BYV E;  1QZY A;  4YG2 F;  3DPT A;  3EET A;  4UXN A;  4I02 A;  3KP6 A;  1BN5 A;  2ZKZ A;  3P9K A;  4V2F A;  4BDY A;  3OIO A;  2K4B A;  2XAJ A;  1PVE A;  1YIT I;  1Y0N A;  3BC8 A;  2VJI A;  1VQP I;  3IV5 A;  2HQA A;  4AWX B;  3BR2 A;  3HPH A;  4MQV A;  1F43 A;  2MD0 A;  1MBK A;  2L4A A;  3OY9 A;  5DM6 F;  4KN7 X;  4Y3O A;  5GAG J;  4BQQ A;  1WSU A;  2VJ4 A;  3HTS B;  1IF1 A;  2CGP A;  4E4H A;  2DT5 A;  1YJ9 I;  1KU2 A;  5JHU A;  1F1Z A;  4HW0 A;  4PZJ A;  3E5U A;  4G9Y A;  5GTH C;  4I01 A;  4AD9 A;  3GTJ J;  1NH3 A;  1QA6 A;  1FP1 D;  2VUM J;  4DGW B;  1WFX A;  1O3Q A;  2O61 A;  1UST A;  4XLC A;  1TBX A;  4L9V A;  3RKY A;  1X1C A;  1Z6R A;  1LFU P;  4M9S A;  1ZTR A;  4LG0 B;  2BVM A;  2X1C A;  4BJ5 C;  2K9L A;  3BJ6 A;  3CCS I;  2KLO A;  5CJ9 A;  5EEH A;  1MMD A;  3BR5 A;  3N4M A;  4CGZ A;  1IRZ A;  3F72 A;  1IXS B;  4M73 A;  2W48 A;  5CYV A;  5LRR A;  1D5Y A;  3G73 A;  3S3O A;  3BTI A;  5JFR A;  3WOD F;  1I3A A;  2P8T A;  3JRB A;  2KDZ A;  5L3G A;  2VOD A;  3BWG A;  1JT6 A;  3AAF A;  1OCP A;  2EBI A;  1YI2 I;  1MJ9 A;  2GA2 A;  1ZG3 A;  5E1X A;  1SFE A;  3FXJ A;  3G3Z A;  3F0C A;  2BW3 B;  2GQQ A;  1KQ0 A;  1N75 A;  2D1H A;  2IAI A;  2XUB A;  4UUT A;  4JYK A;  3O8G A;  2MFZ A;  1HKS A;  3SEQ A;  2FXA A;  2ISY A;  1OLT A;  3NWT A;  1K78 A;  5LRS A;  2FQ3 A;  4PGG A;  2EA2 A;  4MEX F;  4MNU A;  5F04 A;  4A12 A;  1IV8 A;  1Z6T A;  1TC3 C;  1MNM C;  1N25 A;  1VND A;  2EH3 A;  3SFI A;  1R49 A;  2PMH A;  2E35 A;  4C2U A;  1BBY A;  4Z2Y A;  1DGR M;  2Y0S N;  1TQI A;  4AVP A;  3K2Z A;  2GXB A;  2DLL A;  2BY1 A;  1OCO H;  1YW7 A;  1ZGJ A;  4G6T B;  1SVL A;  4M6V A; 
#chains in the Genus database with same CATH homology
 2FE3 A;  4XRF A;  4U0W A;  2QWW A;  4A6E A;  5DD8 A;  1YFH A;  4LK0 F;  3F8N A;  1FYM A;  1UHW A;  1SD5 A;  3KP4 A;  5F6F A;  2DFI A;  3M7G A;  5BMZ A;  5A2Q Z;  2FA5 A;  4M9Z A;  1ZG1 A;  4L5I A;  1FY7 A;  3FZV A;  1KQ8 A;  1ULY A;  3MZH A;  3KEO A;  3CJN A;  3GLX A;  2DQL A;  4YFK F;  4G7H F;  3GZ5 A;  4A6D A;  5E17 F;  3V7C A;  2QYO A;  4KFC A;  3VEP A;  4HF0 A;  1SMY F;  1YQA A;  3DXJ F;  1YLF A;  4WXH A;  3IL2 A;  2EB7 A;  2Z5U A;  3IKV A;  5CVI A;  2AS5 F;  1G4D A;  4GO1 A;  1MGT A;  4AIH A;  1K78 B;  1Y0U A;  3RDI A;  2XAQ A;  2V1X A;  3RJP A;  2L02 A;  4KUM A;  1IN6 A;  3BPX A;  4OU0 A;  4EJW A;  2F5E A;  3IWZ A;  3OV8 A;  4XSX F;  5E1Z B;  1KU7 A;  4N0B A;  1ZHF A;  2H6B A;  2JPC A;  4A2U A;  1YW9 A;  2D1V A;  3OOP A;  4L18 B;  2BEO A;  3TGN A;  2FSW A;  4L9J A;  3E6D A;  3JTG A;  5EEG A;  2XKP A;  3HRU A;  1B9N A;  4AIJ A;  3ZN1 A;  2H27 A;  1IXC A;  1B6A A;  3LA3 A;  1CF7 A;  3FF5 A;  4LD5 A;  3T0Y A;  1G6N A;  4HAM A;  3JTH A;  3MZY A;  1FC3 A;  4GGG A;  1YW8 A;  5LGT A;  3HRM A;  1PDN C;  1IZ1 A;  4WXD A;  1E17 A;  1QNT A;  2ZXJ A;  3J80 Z;  1REP C;  4CYD A;  5D5V B;  3M8F A;  3I59 B;  2HGC A;  1D3Y A;  3GFJ A;  3KP2 A;  2HKX A;  2P6T A;  1KA8 A;  3HSE A;  1LDK B;  3RTR A;  4MGR A;  1FBS A;  3FMQ A;  2GA1 A;  2P5V A;  3FMS A;  1ZRE A;  3K0L A;  1ODD A;  2V79 A;  2STT A;  3WGG A;  1P4W A;  4GCV A;  3I54 A;  1YS7 A;  2LDU A;  4K2E A;  1FNN A;  1O7F A;  1MJB A;  5DYM A;  4CZZ A;  5D6F A;  3TKY A;  3K1M A;  1GXQ A;  4JBA A;  4RB2 C;  1LNW A;  4BNC A;  3DV8 A;  3JAM Z;  2OQR A;  2XHK A;  4S04 A;  2IRF G;  4UV9 A;  2VBZ A;  3ZMS A;  1FSE A;  1MZB A;  3F8C A;  3WE3 A;  4A5M A;  1QO0 D;  1CGP A;  1IRG A;  4LLN A;  2ZNY A;  3E6M A;  4MQ9 F;  1QGP A;  5FLX K;  1R1T A;  2BGC A;  1UFM A;  1HBX G;  4UUV A;  3QRF F;  3QAH A;  4HDU A;  3LQR A;  4IPA A;  2A6H F;  4KMF A;  1ZH5 A;  3Q5F A;  3KLO A;  2IPQ X;  4JQF A;  2EFO A;  1O3R A;  3GEZ A;  1E2X A;  2L01 A;  5LHH A;  4ZYD A;  1WRJ A;  2A68 F;  4HV6 A;  2DK8 A;  3T8T A;  5BOX A;  4G7O F;  2PN6 A;  3JAM K;  4I0A A;  4BYY A;  2JZY A;  2W85 A;  2G9W A;  3U1D A;  3FWE A;  3WU1 B;  2ELH A;  1XSV A;  3RYP A;  2L4M A;  4S05 A;  4KIG A;  1DDN A;  2MLK A;  3CLO A;  3C18 A;  2CSO A;  2XAF A;  4E70 A;  1SAX A;  3B02 A;  3KEQ A;  1W7P D;  4EM0 B;  3JSP A;  2LF8 A;  1STZ A;  3SXY A;  4BHB A;  3HSF A;  2XRN A;  3IKT A;  2ADU A;  2R7D A;  3WTV C;  3WTS C;  4LK1 F;  1R1V A;  1USS A;  4FHT A;  3P9C A;  1T2K A;  1FSH A;  2MLG A;  1R1U A;  3GO5 A;  4N9H A;  2IA1 A;  1KQ9 A;  3TOB A;  3ZMT A;  3PFI A;  3MQ0 A;  3E97 A;  1XMA A;  1B59 A;  2IT0 A;  4KA4 A;  4LGW A;  2F2E A;  4ENJ A;  1U5T B;  1I1G A;  2CG4 A;  4ZYG A;  4AIK A;  1ON2 A;  1LVA A;  2P5L C;  5D5X B;  4NHJ A;  3C3W A;  3KP7 A;  3DPL C;  4KIC A;  4OIO F;  3ZMD A;  2PG4 A;  2EFW A;  2O03 A;  2Y75 A;  2HR3 A;  3SQN A;  2TDX A;  4M74 A;  2JSC A;  4U0Y A;  4Y13 A;  1XN7 A;  2GIV A;  1T38 A;  3SFZ A;  2QQ9 A;  5HVQ C;  1HKT A;  4LLL A;  2HOE A;  4NB5 A;  3KE2 A;  1ZYR F;  2JT1 A;  3SHF A;  4Q4Z F;  4WWC A;  3C1D A;  5CVU A;  4OIQ F;  4FX4 A;  4EVI A;  3HIF A;  1T98 A;  4OMZ A;  1U78 A;  2P6S A;  2NRA C;  2RV8 A;  2FF4 A;  3GFL A;  2JRT A;  3ECH A;  3SZT A;  2WWY A;  3EQL F;  3BY6 A;  2HS5 A;  2G7H A;  3T8R A;  1W4M A;  4YIF A;  3E6B A;  3VOD A;  2F5C A;  4OIP F;  3TO6 A;  2QBY B;  1WKM A;  1JXS A;  5DD4 A;  3EYI A;  2PLY A;  2RNJ A;  2IA0 A;  3KP5 A;  2VBX A;  3IWF A;  4MTD A;  4LJZ F;  1I27 A;  1S7A A;  5J8C A;  5LLQ A;  4GYI A;  4A0X A;  2KRF A;  1SFU A;  2DW4 A;  2IJL A;  3IHU A;  3RKX A;  3VB2 A;  1U5T A;  2HFH A;  4RB1 A;  2QZ8 A;  1J59 A;  3WU0 A;  3MFK A;  1S7O A;  2FBI A;  2RC4 A;  1HSJ A;  1Z05 A;  2M8E A;  4BQA A;  2RVC A;  4HQE A;  1ONV A;  3W6K B;  4EJO A;  4PGH A;  1UHM A;  2CO5 A;  3HHG A;  4A0Y A;  2K86 A;  3E5X A;  5FO5 A;  3CO7 C;  3HOT A;  1TQP A;  4R8H A;  1JHF A;  3K1P A;  5CLS A;  1KYZ A;  2HWV A;  5D5W B;  4Q48 A;  1V4R A;  4BXU A;  4UVA A;  4HLX A;  1LDD A;  4HX7 A;  3ZQ7 A;  5K5R A;  5E8I A;  2YR2 A;  3TO9 A;  4BHC A;  1JHH A;  1Z7U A;  2UXN A;  5FB2 A;  3QPH A;  4EJU A;  2P7V B;  2QQB A;  1BI2 A;  3O6B B;  2W57 A;  3WGI A;  3KZZ A;  2DTR A;  5ILS A;  2QVO A;  5H20 A;  1D5V A;  2XAH A;  3QU3 A;  1HXD A;  1H9G A;  1H9T A;  2MA3 A;  5IT9 K;  1W5T A;  3CUO A;  2P4W A;  6PAX A;  3V8L A;  5L3B A;  1SD7 A;  4CIC A;  4HX4 A;  2W84 A;  5HDG A;  1ZG5 A;  2HYF A;  4L0Y B;  4P5O A;  3VOE A;  1FLI A;  5DDG A;  4IJA A;  4ESJ A;  2FRH A;  5AIP A;  3DF8 A;  5DEQ A;  4QLC U;  5FLX Z;  3ERE D;  5DV5 A;  1X3U A;  2OD5 A;  3S2W A;  4L9T A;  1RIO H;  3ZMZ A;  3LA2 A;  1XGM A;  5CVJ A;  3GVA A;  2EWN A;  1O3S A;  5D4S A;  5ICG A;  1Q1H A;  2EFQ A;  3F8M A;  2EV5 A;  1TQM A;  3HHH A;  1FP2 A;  5DCM B;  4KIF A;  5D8L B;  2OQG A;  4KT5 C;  3TQN A;  1OPC A;  2WV0 A;  5K5Q A;  1NHA A;  5HLH A;  2J5P A;  2RDP A;  3L7W A;  4EM2 A;  2LSO A;  5ILU A;  4RGS A;  1LJ9 A;  4IVN A;  5KVR A;  4G94 A;  4UV8 A;  3Q9S A;  5J8F A;  4R79 A;  5FFX A;  3HUG A;  1BI1 A;  1D8J A;  4ZZD A;  3FMR A;  3V7R A;  1O7L A;  2DK5 A;  4I98 B;  5DCF A;  4RGX A;  2COM A;  4EQQ A;  1IAW A;  1OYW A;  4WK8 F;  3ELK A;  1FX7 A;  4IRG A;  4IF4 A;  1XCV A;  4LFU A;  5E1W A;  1P4A A;  5ED4 A;  5HS8 A;  1RUN A;  5FD6 A;  1WWX A;  3FHZ A;  4CDG A;  3ULQ B;  2L3D A;  4L5J A;  1IW7 F;  2V1D A;  1ZGA A;  1XSX A;  4ASN A;  2HEO A;  1HW2 A;  3TDU C;  2MBF A;  4U88 A;  4MHG A;  3KFW X;  2CFX A;  3MCZ A;  1BI0 A;  1MDM B;  1S6L A;  1S3J A;  2RKH A;  3CO6 C;  2VT3 A;  4MEY F;  5L3F A;  4A0Z A;  5KK1 A;  3CUQ A;  1XDS A;  1J9I A;  2RN7 A;  3QP6 A;  1BM9 A;  1RZ4 A;  5TJJ A;  3J81 K;  2OAZ A;  3GZ6 A;  1U3E M;  3GUD A;  1T0F A;  4P9F A;  2MH2 A;  3F6O A;  2DAO A;  3ZMU A;  1I5Z A;  3EDP A;  2V6C A;  4M72 A;  4L9N A;  1FZP B;  3RI4 A;  5HS9 A;  2E7X A;  4HF1 A;  2FBK A;  2A5Y B;  2FOK A;  3F6V A;  3B73 A;  1SMT A;  1OMI A;  1EH7 A;  3NRV A;  2EV6 A;  1L3L A;  1YYV A;  2CQK A;  3L00 A;  5ILV A;  2PMU A;  1OKR A;  3LAP A;  2HZT A;  4RB0 A;  3ZN0 A;  1XGN A;  1ZLK A;  2R3S A;  4LB5 A;  1ZRC A;  1R58 A;  1HKQ A;  3W6J B;  4ETS A;  1H0M A;  3FXQ A;  3E6C C;  3F8B A;  1XGS A;  1W5S A;  2PEX A;  5D8K B;  2KIU A;  1UB9 A;  2UXX A;  5H6R A;  4KYW A;  1OYY A;  4Y17 A;  4HF2 A;  1AWC A;  1FBQ A;  1OR7 A;  2BV6 A;  4ZYE A;  3REO A;  3PQJ A;  3L9F A;  2RQP A;  4U7B A;  2W24 A;  2OZU A;  4HOB A;  3BPV A;  2A69 F;  4KIB A;  3HRT A;  2FBH A;  3R4K A;  1TNS A;  5BQT A;  3LFK A;  1G3Y A;  1P4X A;  3RPQ A;  3BZ6 A;  2JTV A;  1U5T C;  3F22 A;  3J81 Z;  3C7J A;  1U2W A;  2CWE A;  4QWQ A;  1WQ2 A;  1F4K A;  4TV7 A;  2EK5 A;  2NNN A;  5D5U B;  1YO5 C;  3FM3 A;  2BE5 F;  1J2X A;  4RAY A;  5ICF A;  5JR3 A;  3NEU A;  4ENK A;  4KNY A;  3GXO A;  2VC0 A;  4CHU A;  1HW1 A;  2ZO4 A;  2EA4 A;  3COA C;  1K79 A;  4ESB A;  2ZFW A;  3MWM A;  2ZNZ A;  4H0E A;  1R5H A;  1KGS A;  1R5G A;  4LLG F;  3LQQ A;  4I0B A;  2B0L A;  5A2Q K;  3HSR A;  3DFG A;  3H3U A;  5ICE A;  3ML6 A;  4DNC A;  4OOI A;  4RB3 C;  4OMY A;  2YPR A;  3WE2 A;  2LF7 A;  1BOA A;  2XAS A;  3F23 A;  2VBW A;  4KDP A;  2HDC A;  2FEZ A;  3ROU A;  4M71 A;  3NQO A;  4CXF A;  2DBB A;  2Z99 A;  3V8K A;  2KIM A;  5FGM A;  1R23 A;  4EM1 A;  2M87 A;  1G3S A;  3GWZ A;  2A6E F;  3V7S A;  5J6X A;  3T1B A;  4BH9 A;  3GFM A;  2IVM A;  2HYG D;  4EV0 A;  3FXU A;  3HYI A;  1B1B A;  1TNT A;  2BBY A;  4UVC A;  5HLI A;  1J0R A;  4LMY A;  2WC2 A;  1YG2 A;  2CYY A;  3SZP A;  2VXZ A;  1EV7 A;  1FT9 A;  2J5O A;  1Z91 A;  2HQR A;  2XGX A;  3ISP A;  2YU3 A;  4UHT A;  3CDH A;  1T6S A;  2OU2 A;  5BPD A;  3P9I A;  4WF2 A;  3U9G A;  1XD7 A;  5IT9 Z;  4PDK A;  2DU9 A;  3BOQ A;  3R0J A;  5BS6 A;  5AON A;  1T39 A;  4N9I A;  1EH6 A;  2GXG A;  5HDK A;  1YIO A;  3I64 A;  3TOA A;  3ABU A;  2XKO A;  1XDU A;  1J7K A;  3BJO A;  3H3Z A;  1L0O C;  2STW A;  3V8J A;  4ENM A;  2NYX A;  4M6X A;  3HRS A;  3J80 K;  2MC3 A;  1LB2 A;  2DO7 A;  4LG0 A;  5L3E A;  3L2C A;  1KYW A;  4P55 A;  5E8G A;  3FM5 A;  2VON A;  4XLP F;  2FML A;  3H92 A;  2YSR A;  4FX0 A;  1IUY A;  1RNL A;  1XCB A;  3CTA A;  3M9A A;  1TW2 A;  4HLY A;  3K1N A;  3T5X A;  2E1C A;  1W7P A;  1I1S A;  2A3S A;  1KU9 A;  3WTT C;  4CO8 A;  4LB6 B;  4I09 A;  2FNA A;  3GF2 A;  4EJV A;  4RGU A;  1SD4 A;  1G3W A;  3QU6 A;  2HTJ A;  2HQN A;  2OBP A;  5HLG A;  3O3K A;  1R36 A;  3CUQ B;  2M45 A;  4JK1 X;  5BPI A;  3GX4 X;  2K27 A;  3BP8 A;  3F8F A;  2JPB A;  5LHG A;  4EGZ A;  2XIG A;  5LBQ A;  1BC8 C;  2M1B A;  3MEX A;  2ZJ2 A;  4O5V A;  2E7W A;  2VT2 A;  2C6Y A;  4B8X A;  2VE9 A;  3EUH A;  1DPR A;  2VC1 A;  1MKM A;  4YFX F;  5K1Y A;  2O6G E;  5HDN A;  3I4P A;  3R0A A;  4BAY A;  3WTX C;  4NQW A;  2VN2 A;  2D45 A;  2QLZ A;  3I53 A;  2CW0 F;  1GHC A;  1P6R A;  5CVR A;  1G3T A;  3VFZ A;  3E3V A;  4Q5S F;  2K02 A;  5IT3 A;  3JSO A;  2YX4 A;  5LEJ A;  1XSD A;  1FYK A;  4GYG A;  4XLN F;  3R6S A;  5ICC A;  4L0Z B;  2FU4 A;  4HQM A;  4R1H A;  3J7A O;  3R60 A;  1FPQ A;  2ETH A;  1GVJ A;  1LDJ A;  3L09 A;  2UZK A;  3M1E A;  1YS6 A;  1Z1D A;  5F64 A;  2EFN A;  1U8R A;  4HA8 A;  2X4H A;  2Z33 A;  1FYL A;  3D0S A;  3GYH X;  1RUO A;  4Y15 A;  4EJT A;  1OYI A;  2NNY A;  2DPD A;  4FT8 A;  1LQ1 A;  1JE8 A;  5LGN A;  4O3M A;  2E1N A;  3KET A;  3M8E A;  1BJA A;  2XAG A;  2DI3 A;  1WI9 A;  4YFN F;  1ZAR A;  2EJR A;  4I2O A;  1HST A;  5L3C A;  3I58 A;  4P96 A;  2IW5 A;  2P5K A;  2LKP A;  3I0T A;  3JW4 A;  1C0W A;  3HTU A;  5JVT A;  1P2F A;  2V9V A;  1VTN C;  4IXA A;  1XGO A;  2UWM A;  4D0P A;  5DUK A;  4G7Z F;  2EV0 A;  3WTU C;  2QEN A;  2F5F A;  4HV5 A;  4F7Z A;  2K4J A;  4O6J A;  5D6E A;  2ZCW A;  2Y48 A;  4EGY A;  3I59 A;  3DP7 A;  2ZME B;  2AXL A;  2R7F A;  4HYE A;  1U6G A;  1O57 A;  3F21 A;  2O8X A;  3Q9V A;  4ESF A;  2PJP A;  3E5Q A;  2DQR A;  2ZBK A;  4HBL A;  1R22 A;  1W7P B;  3ABT A;  4P9U A;  4IHS A;  5LHI A;  4U7D A;  3DEU A;  4A5N A;  3ZP5 A;  1XMK A;  2Z9O A;  2QQA A;  4KMU X;  2M30 A;  4DQ2 A;  4Q47 A;  1S29 A;  2XVC A;  1B4A A;  1P92 A;  3TDZ C;  1JGS A;  2OZ6 A;  1PP8 F;  3LWF A;  1ZAO A;  1KU3 A;  1FBU A;  1DP7 P;  5LEK A;  5E20 A;  2M5W A;  2GAU A;  4ENN A;  2EFP A;  5K5O A;  2PFB A;  2OA4 A;  3IC7 A;  4OIN F;  3K9T A;  3KZY A;  2KJC A;  3BJA A;  1ZN2 A;  2XRO A;  1MD0 A;  5CVV A;  2Q8K A;  1QQI A;  1PUE E;  3KLN A;  2GZW A;  2ISZ A;  4WCG A;  2NS0 A;  5TRD A;  1R7J A;  5E18 F;  3RYR A;  1F9N A;  4G6D A;  1MJA A;  3RPU A;  1BC7 C;  1IN4 A;  3DKW A;  1EH8 A;  4RAZ A;  1O3T A;  4WX9 A;  2D2W A;  2O0Y A;  1BI3 A;  2P7C B;  1IRF A;  5DUI A;  3IRR A;  4WXC A;  1K7A A;  3ECO A;  3U2R A;  1AOY A;  2HTS A;  1A04 A;  4ZH4 F;  1ZRF A;  1FWZ A;  3EYY A;  3BDD A;  5ERI A;  4OIR F;  2ESH A;  5HS7 A;  1IN5 A;  3D5L A;  4BHP A;  2NAZ A;  2WTE A;  4U0V A;  4I7H A;  3O2P E;  1V3F A;  2ACJ A;  5FD5 A;  1FOK A;  3DQV C;  1LEB A;  1BIB A;  2H6C A;  4ZZL A;  4IRH A;  4ON0 A;  1TW3 A;  4YII A;  3WG9 A;  2KIF A;  2PI0 A;  1UCR A;  5AIQ A;  2KJB A;  4MTE A;  2VE8 A;  2KKO A;  3QOP A;  4G8X A;  3ZMV A;  1CF7 B;  1B9M A;  2MH9 A;  2VOP A;  3K69 A;  5LGU A;  1Z9C A;  5H6Q A;  3MAJ A;  1SFX A;  2MD5 A;  5JI6 A;  2VBY A;  1D8K A;  2X0L A;  3I5U A;  3P7N A;  1PP7 U;  1IXR C;  4M9X A;  3PQK A;  3TO7 A;  3BRO A;  1QBJ A;  1ON1 A;  1SD6 A;  3I71 A;  3LST A;  1R00 A;  4PCQ A;  1TLH B;  5HOO A;  1K6O A;  4IRI A;  2DPU A;  1YTY A;  2V1U A;  4XSZ F;  2IP2 A;  4HZF A;  2IA2 A;  2Z3Y A;  4RS8 A;  2FNP A;  1HQC A;  1IN7 A;  2RGV A;  1QZZ A;  1XB4 A;  2FMY A;  2QM3 A;  2HKO A;  2A61 A;  3LA7 A;  2Q0O A;  3V4G A;  4G6Q A;  3CUQ C;  2PQ8 A;  1BIA A;  4KN4 X;  1DPU A;  2GWR A;  3WTZ A;  4RGR A;  3LAJ A;  1J75 A;  1IN8 A;  1GXP A;  3GW2 A;  2QBY A;  2K7L A;  1DUX C;  2H09 A;  1QPM A;  2ESN A;  1J5Y A;  2LNB A;  3GFI A;  2L54 A;  5D4R A;  5DCM A;  2F5D A;  3F3X A;  2G7U A;  1F5T A;  2H94 A;  4UVB A;  2ZME A;  3WTW C;  3QP5 A;  2Q2E A;  5FFZ A;  1MDM A;  4UNO A;  5F1R A;  2YX7 A;  3IRQ A;  4XBF A;  2O3F A;  4IHT A;  4EMS A;  1I6X A;  1S8N A;  4GXO A;  2W25 A;  2XV4 S;  4HX8 A;  5L3D A;  2Y0M A;  3KP3 A;  2PBI A;  1ZLJ A;  3ZPL A;  3FX3 A;  2VOO A;  3QPT A;  1RI7 A;  1ZRD A;  4ZYH A;  4B09 A;  4HDV A;  1HW5 A;  2QUF A;  4M6Y A;  3HOS A;  3KCC A;  3RIR A;  3FXR A;  3WTY C;  3WGH A;  3R61 A;  1LEA A;  3RKW A;  2A07 F;  1TTY A;  2BYV E;  1QZY A;  4YG2 F;  3DPT A;  3EET A;  4UXN A;  4I02 A;  3KP6 A;  1BN5 A;  2ZKZ A;  3P9K A;  2K4B A;  2XAJ A;  4AWX B;  4MQV A;  2L4A A;  4KN7 X;  1WSU A;  3HTS B;  1IF1 A;  2CGP A;  2DT5 A;  1KU2 A;  5JHU A;  1F1Z A;  4HW0 A;  4PZJ A;  3E5U A;  4G9Y A;  4I01 A;  4AD9 A;  1FP1 D;  2O61 A;  1O3Q A;  1UST A;  1TBX A;  4L9V A;  3RKY A;  1Z6R A;  4M9S A;  4LG0 B;  3BJ6 A;  5CJ9 A;  5EEH A;  3N4M A;  4CGZ A;  3F72 A;  1IXS B;  4M73 A;  5CYV A;  5LRR A;  3G73 A;  5JFR A;  3WOD F;  2P8T A;  2VOD A;  5L3G A;  3BWG A;  3AAF A;  1MJ9 A;  2GA2 A;  1ZG3 A;  5E1X A;  1SFE A;  3G3Z A;  2GQQ A;  1KQ0 A;  2D1H A;  2XUB A;  1HKS A;  2FXA A;  2ISY A;  1K78 A;  5LRS A;  2FQ3 A;  4PGG A;  2EA2 A;  4MEX F;  4MNU A;  4A12 A;  1Z6T A;  2PMH A;  1BBY A;  4Z2Y A;  1TQI A;  4AVP A;  3K2Z A;  2GXB A;  2DLL A;  1YW7 A;  1ZGJ A;  3N97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...