3GX8A

Structural and biochemical characterization of yeast monothiol glutaredoxin grx5
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
b'STEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEEAQALVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monothiol glutaredoxin-5, mitochondrial
publication title Structural and biochemical characterization of yeast monothiol glutaredoxin Grx5
rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 38
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gx8A01
3TJFA 3FZ4A 4Q5NA 4TXVA 3IA1A 4KDXA 1TK8B 1PX6A 3IAM2 4JU5A 3KTLA 1EP7A 1K0BA 4NXIA 2IL3A 1XZOA 3EMPA 1GSEA 3GH9A 2DJKA 2LS5A 4AJ7A 2FNOA 1GTAA 3QAVA 4F0CA 1O7UA 3LXZA 5KEJA 4NHZA 1MDJA 1ZCPA 1K3YA 3QD9A 5ELGA 3OR5A 3E9JB 1TRSA 3IHQA 5J3RA 3UIWA 1OE8A 4OO5A 3JCML 4GCIA 1XXUA 1LU4A 3ERGA 1Z9HA 2H71A 4WXTA 3IK9A 1O6JA 3C71A 4PQIA 5JWOB 3LWAA 3IR4A 2EC4A 3ZVJA 4LL1B 2HZEA 4HEA2 3GTUA 2PMTA 1BAYA 4NAXA 2R37A 2KP1A 5JWRB 4Z7XA 3EC3A 1U87A 1V40A 2M72A 2XC2A 1S3CA 3Q19A 6GSWA 1PN9A 5LD0A 4KCAA 3GNJA 2MBTA 2DJ1A 3EVIA 4GXZA 1WMJA 2C0GA 1GUKA 2AYTA 3KP8A 4AJ8A 1FHEA 1XW6A 3ZIVA 2VCWA 1A0FA 2V6OA 2V1MA 3CRTA 1EOHA 3QCPA 3CSHA 1M2BA 2CV4A 1TU8A 1GTBA 1ST9A 2L6DA 3D21A 4ZL8A 2OE0A 3LYKA 2DIYA 3CMIA 4OFMA 4WEYA 3G7YA 3D22A 4ZB8A 1TXXA 1A2LA 4IKHA 4NPBA 5B8BA 4MH2A 4HU7A 1T8EB 3BBYA 2AUVA 1WRYA 4IN0A 3LGCA 1Z6NA 4TVEA 1SU9A 2VL3A 2DC5A 1XWAA 2OBIA 3GUSA 2L5LA 4F82A 3GHAA 5HQPA 2NVLA 3TJKA 5A4VA 2L57A 1XWCA 4EC0A 4FH8A 3APQA 1T4YA 3UVTA 3W8SA 3WT2A 2VLTA 3GA4A 4ILFA 4YQVA 1M7TA 2E2GA 3H8QA 3FRCA 2LEGA 1QXHA 2YWMA 4IQAA 1AXDA 2VO4A 3KH9A 1PX7A 4POKA 3KM6A 2HLSA 5G30A 4K1FA 4JZQA 1BQ7A 1GH2A 2C8UA 2GQKA 5DALB 2HSYA 1TI1A 1V9WA 4E8EA 3CTFA 5D96A 2EIQA 2IMDA 4QL7A 5CRDA 4WF4A 3IRAA 5ELAA 1AUCA 2YWOA 2MMNA 3TKPA 3LJRA 5KN0A 1B9XC 3WGEA 3BCIA 1Z3EA 2K9FA 2H6YA 2P5QA 3TB2A 1A2MA 3HZ8A 4MLYA 3QAGA 1G6WA 4GLTA 2YPMA 2L5OA 1TK5B 4AJ6A 5HFIA 4XS4B 1A2JA 4FO5A 2F3MA 2YN1A 3C73A 2I9HA 4CW9A 2RIIA 4ZB6A 3WT1A 2NPBA 1TK0B 4ZL7A 4ZBAA 4J2FA 2QKEA 4K7OA 4TXOA 2GGTA 2H19A 1YDKA 2VD0A 3IDVA 1BYEA 4XRAA 3TGZA 3TKRA 2K8SA 5DALA 5GSSA 4KNDA 1ZMAA 4L0UA 2IMFA 4O92A 4EL1A 2C3QA 4HI7A 2P31A 1SJIA 3ERFA 1GSFA 3M9JA 1SJZA 1O8XA 1WIKA 1ZYEA 3CXGA 3H1NA 1ZOFA 4DEJA 2V41A 4J57E 4RUVA 3VI5A 1WE0A 2MZCA 1R4WA 1F3AA 3DVWA 3J7Yk 2H74A 1Z7PA 1N2AA 2PVQA 1VF4A 4YQUA 3KTBA 4XS4A 3QFBC 2DBCA 4MZWA 1NW2A 3F4SA 2R5GA 5IM9A 19GSA 1A8LA 5CYYA 3FHKA 1F2EA 1SK1A 4EVMA 2OA7A 4N30A 14GSA 4I2TA 3FK8A 1G0TA 2K6VA 3K8NA 5DCHA 2M80A 2H75A 2E0QA 2OBKA 1JHBA 3KZQA 4KSMA 5J5NA 3G9BA 3VWVA 1S3AA 5ECQB 3A2VA 1B4PA 5DVBA 3A3TA 3LYPA 3BOAA 3ME7A 2H1DA 3ISOA 4WF5A 5IPHA 2ALBA 2NTOA 1G7OA 3TCOA 3EURA 3US3A 1AIUA 3M3MA 1EZKA 3EMXA 1XOAA 1V2AA 3O76A 3VWXA 2GSQA 2ES7A 1MD4A 1YQ1A 5DAKB 2HXKA 2XPDA 1SK0A 2MMAA 1JZWA 2D2ZA 1A23A 1BEDA 1PGTA 2DJ3A 1JZOA 4V1Ap 1JZDA 3L78A 1O8WA 1B4QA 1EOGA 3F0IA 3MWHA 4FYBA 2GSSA 5CO3A 1W4VA 2JZRA 4HOJA 1M99A 3WGXA 2XPEA 4MF7A 1WP0A 2VCXA 2MMOA 5CAXA 3HDCA 2LJRA 4I6XA 3F3RA 1XVWA 4PGTA 4BWSA 20GSA 1FB0A 4N0VA 2C0EA 3TKSE 1RQMA 2HSHA 3D0ZA 4I97A 1TI3A 3ZFLA 1GSSA 2YV7A 3N9JA 3CYNA 3I6AA 1FG4A 4WETA 4LLRA 5ECNB 2FUG2 2YNXA 1N8JA 4H86A 4DSRA 2VAFA 5IMZA 2HI7A 3BCKA 1OC9A 4EF0A 5DJMA 4V2MA 1XWBA 5DAKA 4OD7A 1T1VA 4O7HA 3TJBA 1URMA 2H0GA 2E7PA 2DMMA 4Q5FA 4GSSA 3UARA 3ZYWA 5IO2A 1PL2A 3KIJA 5FT3A 5FWGA 2ZUPA 2IWTA 2GT5A 2H72A 3F6DA 2B6MA 3L4NA 4MK3A 4WR4A 2WULA 4V1Ag 3KEBA 6GSTA 4MMMA 4PUAA 3GKNA 3UL3A 2LQOA 1EGOA 2V6KA 3ZZXA 2H76A 4TR1B 2A2RA 5GAND 6GSYA 1ZL9A 3IXRA 1Y25A 2PU9C 4YAPA 4KX4A 4EUYA 22GSA 3QMXA 2O7KA 4G19A 4AGSA 5G5EA 3HCZA 2H1BA 4ISDA 1YEPA 1EV9A 4KA0A 1VRSD 2AJQB 3RBTA 4EO3A 4BA7A 2CQ9A 3KMNA 3M0FA 4FYCA 1LJRA 3VPQA 4MJEA 3HA9A 3QFAC 2PERA 4XCSA 3DGQA 1THXA 3CSJA 2HFDA 2B7KA 4DSQA 4JR4A 1AQXA 4MF5A 1U3IA 2FA4A 4LA1A 1OC3A 4X43A 4KUNA 2LJKA 1HNCA 1KBNA 4EE0A 4ML6A 4I5QA 5IMFA 4PX1A 4TR1A 1ML6A 4X0XA 1YKCA 4HU9A 4LMVA 1EEMA 1BJXA 3KGKA 5EPFA 2EIOA 3MNGA 1XCCA 4MJBA 5LNKe 3D4MA 1AAZA 5JCWA 4D73A 4EDYA 1VF3A 2WJUA 4KW6A 2BJXA 3GX8A 2VOCA 5AIVA 4ECJA 2YJ7A 3TOUA 2PVOC 4N0ZA 4MP4A 4OMVA 1MDKA 3RDWA 4GTUA 2F8AA 4IHUA 3HVSA 5HR3A 3E3EA 3HJMA 1TU7A 3S9FA 4IJIA 2VL9A 3C8EA 4EKZA 1QMVA 3DRNA 1HNBA 5F8BA 5IMCA 3TUEA 1JZRA 1B48A 1T7PB 3UMAA 3QOUA 1JLWA 5FHIA 2J9HA 3HJOA 1TKDB 3N5OA 1M2DA 3M1GA 3Q6OA 1XWKA 4KCEA 1O85A 4TR3A 1X9WB 1TOFA 2HNLA 1K0MA 5J9CA 16GSA 12GSA 2KUCA 2REMA 2CZ2A 2WCIA 4RQXA 1YZXA 4MPFA 3EINA 1K3LA 3DEXA 5IMVA 1U6TA 1DBYA 4NWYA 3GSSA 2IMKA 2JL4A 3HVXA 3HXSA 2VCTA 3W6GA 2RM6A 3TRXA 1F3BA 4AF2A 3ZVJD 5HR0A 2WFCA 5D9WA 1F37A 1XFLA 1XOBA 5LCZA 2X64A 1EGRA 1GNWA 3FYGA 2P5RA 5F0GA 1X9MB 2OE3A 2PUKC 1SKRB 1C72A 1E2YA 3QPMA 4V2NA 1A24A 2B3SA 2CZ3A 5HR2A 3P90A 4I2UA 1RW1A 1Z5YE 3ZTLA 2VL2A 4TXOB 4NV2A 1M9BA 1BX9A 2DLXA 2DIZA 1J9BA 1IYIA 1TRVA 1I9DA 1SYXA 5G5FA 3AY8A 4L8EA 5AISA 4IVFA 3F8UA 3M8NA 1KTEA 1ACVA 1X5DA 2GS3A 2I81A 1NM3A 4CHSA 2JSYA 1SKWB 5IPGA 3H79A 2O89A 4PQHA 1YKAA 4ZXGA 2GZZA 2X8GA 1USBA 2C4JA 1O73A 2FWEA 1K3OA 4HQZA 4GWRA 5ECLB 1TTZA 3FY7A 1J08A 2RUFA 5CRGA 4QL9A 4TRXA 2OACA 5H5SA 3GMFA 5AIXA 3D5JA 2GVPA 3IK7A 5AN1A 5A4UA 1EWXA 3TKSC 1M9AA 1YF0A 4BWQA 6GSSA 1AW9A 3VWWA 2AV4A 2JZSA 1OYJA 3SBCA 4KE3A 4KGIA 4ECIA 4JR6A 17GSA 2IJYA 2QGVA 1PD21 5IOWA 4MH3A 2YANA 1GUHA 2LV3A 5ECPB 1ERWA 1K0DA 2IFQA 1XPVA 3H4KA 1SD9A 5H5RA 1MTCA 2K18A 2CVBA 2TRXA 4P3YB 1FO5A 1IYHA 3UVHA 3FZAA 3ZMLA 5IIZA 2PPTA 2FWGA 4K9ZA 2N5BA 1GSQA 4ULXA 1ZGNA 5HR1A 2FLSA 3QDNA 1F9MA 1W89A 4MZBA 3O3TA 5JWQB 3F9UA 4WBRD 3GIXA 4KDYA 3L9SA 2VM2A 2FHEA 2GLRA 3RHBA 1G6YA 3GL3A 1PQNA 3WGDA 2V2GA 3KXOA 2YOIA 2L6CA 2GDRA 3VURA 2B5EA 1G7EA 3UBKA 2H73A 2YWIA 3F4RA 3F4TA 1B8XA 2L4QA 3I43A 2KHPA 1SK2A 3VLNA 3KD0A 2AB6A 3GN3A 4ID0A 3L9VA 2WS2A 1QGVA 1PKZA 4DVCA 5IOXA 1X0RA 4OCFA 2CX4A 5B7CA 4TOPA 4MPGA 1A0RP 2CAIA 2OJLA 2HRNA 4ACSA 1KEBA 1I5GA 2PGTA 1DUGA 1OC9B 4OFNA 1DE2A 3HVVA 1EEJA 3F3QA 4TKYA 4CDOA 1T3BA 3IV4A 2IMIA 1OE7A 4E8HA 4HUAA 5B6NA 1TJDA 3CSIA 4BPYA 3RPNA 1OVNA 2FCHA 3FR3A 3U5RE 1XW5A 1HNAA 2C3NA 5B6MA 3TRPA 4PNFA 4XHMA 2LSTA 6GSUA 2DMLA 2LRTA 1ON4A 1GWCA 2BMXA 2A4VA 4F9ZA 4OO4A 1TDIA 1GSYA 3DVXA 3GH6A 1PSQA 4HJMA 5CRWA 5KN2A 2QC7A 1GSDA 1OKDA 4HDEA 5F05A 3FR9A 1NHYA 5IO0A 2HRFA 2GSTA 2HZFA 1ZYQB 1BG5A 3E0UA 5ECKB 2C0DA 2H30A 4GRFA 5E4WA 4MJCA 11GSA 1X5CA 1ABAA 2M46A 2YZUA 3RPPA 1XBSA 1ZZYA 7GSSA 5KN3A 5CREA 2CVKA 4KH7A 4KDUA 1XW9A 5D8IA 1FAAA 1XIYA 2ON5A 4IJ3A 4L5OA 2H6ZA 4K0GA 3KCMA 4NMUA 3PINA 4HJ2A 2GZPA 3ZFBA 4IS0A 2IMEA 3FW2A 2B1LA 2VLUA 4I8BA 3TOTA 4NHWA 3L0HA 3GX0A 5INYA 2JADA 4RQRA 5J4UA 4ZBDA 1R7HA 3DWVA 2YZHA 2LUSA 5ECHB 1QUWA 3CTGA 3GL5A 4BL7A 8GSSA 2NDOA 1GUMA 5AGYA 4KB3A 2OE1A 3C1RA 1QQ2A 3WYWA 2YV9A 2GT6A 3G7IA 2B5YA 4J56E 3DXBA 2N5AA 3P2AA 4KSOA 5G1LA 2FWHA 1H75A 1AC1A 1R5AA 3DMLA 4GQCA 1AQVA 2HT9A 1K0CA 2H66A 4POBA 2IPAA 2WGRA 4K7IA 2VIMA 3P8WA 5H5QA 5C00A 2H6XA 5E59A 2A2SA 1HYUA 2GSRA 4IP6A 1SKSB 4WBJA 2FGXA 5J41A 4D73B 1GLPA 1WWJA 1MEKA 2XHFA 2VL2C 3EWLA 2PN8A 2WRTA 3GKMA 3LEFA 3LFLA 4IQ1A 3QR6A 4ECBA 2TRCP 3TJJA 4K2DA 2FY6A 5DDLA 3FZ9A 3FEUA 4LL4B 2DJ2A 2KOKA 2J23A 3HD5A 5C04A 3CBUA 4F0BA 1V98A 1PL1A 2AAWA 4ZB9A 2EIRA 4Q5QA 1E6BA 1FB6A 1MDIA 3UBLA 5ECSA 4L0WA 4LMWA 2R2JA 3M9KA 4RI6A 4TN8A 4PQ1A 1HD2A 3DIEA 3LQ7A 2O8VB 3F63A 1NSWA 2N5FA 1EV4A 2XBQA 5ABRA 1UA5A 3I69A 5IQYA 4JRRA 3KH7A 2VD1A 5EY6A 4L5LA 1X5EA 1QK8A 3VI7A 2QSIA 3VWUA 2GQLA 2H1GA 1TRWA 2NBSA 3HKRA 3VFIA 3GRXA 2C0FA 5B8AA 1PA3A 1GSUA 2X8HA 2H8LA 2LJAA 4HZ2A 4POMA 5GSTA 2GTUA 1R5PA 2RM5A 2K8VA 2JACA 3VK9A 2HE3A 3Q18A 4GQFA 1QFNA 2I1UA 2B7JA 2GZYA 1KNGA 3GV1A 3LG6A 1SENA 2DJJA 1A8YA 2RLIA 3P7XA 2B5XA 1GRXA 3HJPA 1X9SB 3ED3A 3UOMA 1VF1A 4BVYA 4EDZA 4YH2A 4HQSA 1B9YC 5L71A 5GAPD 1T00A 4IELA 4YQMA 2YWNA 3FR6A 3IBHA 2Z9SA 3SWLA 3BJ5A 3CRUA 4DSSB 1SL1B 1Y6EA 2MYGA 1M2AA 3V1WA 1GL8A 4F03A 3APOA 3IC4A 2B1KA 4V2LA 3L9UA 2G0FA 1CQHA 1K0AA 3UEMA 1TRUA 3KJYA 2PWJA 1ERUA 1F6MC 3GSTA 1Z6MA 3MDKA 5ECRB 3KP9A 3D4TA 3KMOA 3DD3A 4OFTA 2LKUA 4BVXA 2C1YA 4IBPA 2E2MA 5D9XA 2CVDA 3RAZA 3ZLPA 1V58A 4IGJA 4K7NA 4QQ7A 4JEDA 4GSNA 4TR0A 1HQOA 4PURA 3GYKA 1R26A 2IFQB 2R4VA 1ERTA 3FZ5A 1GLQA 1YEXA 5IMAA 10GSA 4OCEA 3Q74A 1LBKA 3APSA 4OWYA 2JZTA 5DQSA 2XBIA 1UC7A 1MD3A 1WPIA 3PH9A 4ML1A 2BTOT 2LQQA 2LTKA 3I9V2 2MMZA 5G2ZA 3A5WA 1TW9A 4EXJA 4DSSA 3BD2A 4MF6A 5ID2B 3ZREA 4N11A 2LNTA 2JSZA 2H0IA 2VUPA 1FVJA 3VPTA 3LORA 3WD6A 1OKTA 3U6VA 1WOUA 1S3DA 5A4WA 3TKQA 1J0FA 4HS1A 1VGLA 5ECMB 1UVZA 1XVQA 2LRCA 2JU5A 1K0NA 3PR8A 4G9HA 3LSZA 3H93A 4MABA 3MSZA 4XIHA 2X8CA 4JE1A 2ON7A 5D93A 3EE2A 5J9BA 3DKSA 2H01A 4Q5RA 4ZILA 2O87A 3PGTA 1ERVA 4FIWA 2X99A 3ZIJA 1SL0B 2WDUA 2VCVA 2F9SA 6GSVA 1Z7RA 1NHOA 3O6TA 4XS1A 4MA9A 4G10A 1YF1A 2OKAA 1GULA 3J7Yb 2C80A 5ID2A 3TDGA 5D9TA 5D9VA 4ECCA 4GF0A 2I4AA 5KN1A 4PXOA 1DE1A 4RI7A 4PUFC 1ILOA 4MJAA 1K0OA 3ZL5A 4IP1A 3D6IA 4ZBBA 2WB9A 2L59A 2LNSA 1PMTA 3IOSA 3GFKA 3UAPA 2FA8A 4K6XA 5JCUA 1GTUA 2AHEA 3A2WA 2CX3A 6GSXA 5ENUA 4WR5A 5HFKA 2VM1A 1O81A 1YY7A 2KP2A 4K0NA 2R3XA 4HZ4A 1U3AA 3RHCA 4K8MA 3EU3A 1GNEA 2KLXA 2GQMA 2CA8A 3R2QA 1SD8A 3F6FA 3EU4A 3NOFA 5DQYA 3NZNA 4JBBA 3GKXA 3W8JA 3C7MA 4POLA 1GTIA 2DSAA 1PRXA 4G2EA 2YP6A 3IPZA 5F06A 1JLVA 2R6KA 1JFUA 4XRDA 3G7JA 2HYXA 3NIVA 1Q4JA 4WKWA 5CNWA 2OADA 1Q98A 3GURA 3HY2A 2IN3A 3IAS2 2YJHA 1SYRA 3GKKA 1EP8A 4YAVA 2MBSA 5EVOA 4FYUA 2H0HA 4MCUA 5A5KA 1DSBA 13GSA 3ME8A 2ZNMA 3HZ4A 2H70A 1TP9A 1U88A 5COHA 3LXTA 3DYRA 3UJ1A 2VCZA 3ERWA 4TR4A 3MAKA 1WJKA 1XWGA 1H4OA 1CQGA 1THOA 3QAWA 3A2XA 3TJGA 2P0GA 5ECOB 5G1KA 5G31A 2YCDA 3TKSA 4O32A 4TW5A 4O5RA 3HYPA 1FVKA 5D73A 2FD3A 4MZCA 4ZL9A 4X1UA 2C3TA 2H1AA 2RUEA 1OAZA 3IE3A 5JCGA 4N10A 3EYTA 2CAQA 1V57A 2VLVA 2VCQA 1GP1A 4MDCA 9GSSA 1T4ZA 2F8FA 1UN2A 4XS6A 5HFGA 18GSA 5DBQA 3C1SA 4KAEA 5IMDA 1YJ6A 5CP1A 2FWFA 5DCGA 2LRNA 2G2QA 1FOVA 4PNGA 1RK4A 4F2IA 3ZITA 5EL8A 1SL2B 5DJLA 2ZCTA 3TRQA 1FW1A 1VF2A 2PBJA 4ZIJA 5CRHA 1PKWA 1AQWA 2I3YA 2IIYA 4IW9A 2HZEB 2WZ9A 3FKFA 5ECIB 3GTUB 4NV5A 4XTSA 2V32A 2CT6A 3HHVA 2F51A 1SJ6A 1M0UA 5GZZB 4GSTA 2L4CA 5F07A 1OC8A 3ZMKA 2TIRA 2O85A 2DJ0A 3ZRDA
chains in the Genus database with same CATH superfamily
3TJFA 3FZ4A 4Q5NA 4TXVA 3IA1A 4KDXA 1TK8B 1PX6A 3IAM2 4JU5A 3KTLA 1EP7A 1K0BA 4NXIA 2IL3A 1XZOA 3EMPA 1GSEA 3GH9A 2DJKA 2LS5A 4AJ7A 2FNOA 1GTAA 3QAVA 4F0CA 1O7UA 3LXZA 5KEJA 4NHZA 1MDJA 1ZCPA 1K3YA 3QD9A 5ELGA 3OR5A 1M3JA 3E9JB 1TRSA 3IHQA 4BVYB 5J3RA 3UIWA 1OE8A 4OO5A 2QA1A 3JCML 4GCIA 1XXUA 1LU4A 3ERGA 1Z9HA 2H71A 4WXTA 3IK9A 1O6JA 3C71A 4PQIA 5JWOB 3LWAA 3IR4A 2EC4A 3ZVJA 4LL1B 2HZEA 4HEA2 3GTUA 2PMTA 1BAYA 4NAXA 2R37A 2KP1A 5JWRB 4Z7XA 3EC3A 1U87A 1V40A 2M72A 2XC2A 1S3CA 3Q19A 6GSWA 1PN9A 5LD0A 4KCAA 3GNJA 2MBTA 2DJ1A 3EVIA 4GXZA 1WMJA 2C0GA 1GUKA 2AYTA 3KP8A 4AJ8A 1FHEA 1XW6A 3ZIVA 2VCWA 1A0FA 2V6OA 2V1MA 3CRTA 1EOHA 3QCPA 3CSHA 4K5SA 1M2BA 2CV4A 1TU8A 1GTBA 5BRTA 1ST9A 2L6DA 3D21A 4ZL8A 2OE0A 3LYKA 2DIYA 3CMIA 4OFMA 4WEYA 3G7YA 3D22A 3IHGA 4ZB8A 1TXXA 1A2LA 4IKHA 4NPBA 5B8BA 4MH2A 4HU7A 1T8EB 5KOXA 3BBYA 2AUVA 1WRYA 4IN0A 3LGCA 1Z6NA 4TVEA 1SU9A 2VL3A 2DC5A 2A2PA 1XWAA 2OBIA 3GUSA 2L5LA 4F82A 3GHAA 5HQPA 2NVLA 3TJKA 5A4VA 2L57A 1XWCA 4EC0A 4FH8A 3APQA 1T4YA 3UVTA 3W8SA 3WT2A 2VLTA 3GA4A 4ILFA 4YQVA 1M7TA 2E2GA 3H8QA 3FRCA 2LEGA 1QXHA 2YWMA 4IQAA 4YKFA 1AXDA 2VO4A 3KH9A 1PX7A 4POKA 3KM6A 2HLSA 5G30A 4K1FA 4JZQA 1BQ7A 1GH2A 4K2XA 2C8UA 2GQKA 5DALB 2HSYA 1TI1A 1V9WA 4E8EA 3CTFA 1PN0A 5D96A 2EIQA 2IMDA 4QL7A 5CRDA 4WF4A 3IRAA 5ELAA 1AUCA 2YWOA 2MMNA 3TKPA 3LJRA 5KN0A 1B9XC 3WGEA 3BCIA 1Z3EA 2K9FA 2H6YA 2P5QA 3TB2A 1A2MA 3HZ8A 4MLYA 3QAGA 1G6WA 4GLTA 2YPMA 2L5OA 1TK5B 4AJ6A 5HFIA 4XS4B 1A2JA 4FO5A 2F3MA 2YN1A 3C73A 2I9HA 4CW9A 2RIIA 4ZB6A 3WT1A 2NPBA 1TK0B 4ZL7A 4ZBAA 4J2FA 2QKEA 4Z2TA 4K7OA 4TXOA 2GGTA 2H19A 1YDKA 2VD0A 3IDVA 1BYEA 4XRAA 3TGZA 3TKRA 2K8SA 5DALA 5GSSA 4KNDA 1ZMAA 4L0UA 2IMFA 4EIQA 4O92A 4EL1A 2C3QA 4HI7A 2P31A 1SJIA 3ERFA 1GSFA 3M9JA 1SJZA 1O8XA 1WIKA 1ZYEA 3CXGA 3H1NA 1ZOFA 4DEJA 2V41A 4J57E 5KOWA 4RUVA 3VI5A 1WE0A 2MZCA 1R4WA 1F3AA 3DVWA 2HRKA 3J7Yk 2H74A 1Z7PA 1N2AA 2PVQA 1VF4A 4YQUA 3KTBA 4XS4A 3QFBC 2DBCA 4MZWA 1NW2A 3F4SA 2R5GA 5IM9A 19GSA 1A8LA 5CYYA 3FHKA 1F2EA 1SK1A 4EVMA 2OA7A 4N30A 14GSA 4I2TA 3FK8A 1G0TA 2K6VA 3K8NA 5DCHA 3LW9A 2M80A 2H75A 2E0QA 2OBKA 1JHBA 3KZQA 4KSMA 5J5NA 3G9BA 3VWVA 1S3AA 3A2VA 5ECQB 1B4PA 5DVBA 3A3TA 3LYPA 3BOAA 3ME7A 2H1DA 3ISOA 4WF5A 5IPHA 2ALBA 2NTOA 2X49A 1G7OA 3TCOA 3EURA 3US3A 3FMWA 1AIUA 3M3MA 1EZKA 3EMXA 1XOAA 1V2AA 3O76A 3VWXA 2GSQA 2ES7A 1MD4A 1YQ1A 5DAKB 2HXKA 2XPDA 1SK0A 2MMAA 1JZWA 2D2ZA 1A23A 1BEDA 1PGTA 2DJ3A 1JZOA 4V1Ap 1JZDA 3L78A 1O8WA 1B4QA 1EOGA 3F0IA 3MWHA 4FYBA 2GSSA 5CO3A 1W4VA 2JZRA 4HOJA 1M99A 3WGXA 2XPEA 4MF7A 1WP0A 2VCXA 2MMOA 5CAXA 3HDCA 2LJRA 4I6XA 1ZYNA 3F3RA 4G0LA 1XVWA 4PGTA 4BWSA 20GSA 1FB0A 4N0VA 2C0EA 3TKSE 1RQMA 2HSHA 3D0ZA 4I97A 1TI3A 3ZFLA 1GSSA 2YV7A 3N9JA 3CYNA 3I6AA 1FG4A 4WETA 4LLRA 2FUG2 5ECNB 2YNXA 1N8JA 4H86A 4DSRA 2VAFA 5IMZA 2HI7A 3BCKA 1OC9A 4EF0A 5DJMA 4V2MA 1XWBA 5DAKA 4OD7A 1T1VA 4O7HA 3TJBA 4CY8A 1URMA 2H0GA 2E7PA 2DMMA 4Q5FA 4GSSA 3UARA 3ZYWA 5IO2A 1PL2A 3KIJA 5FT3A 5FWGA 4BIKA 2ZUPA 2IWTA 2GT5A 2H72A 3F6DA 2B6MA 3L4NA 4MK3A 4WR4A 2WULA 4USSA 4V1Ag 3KEBA 6GSTA 4MMMA 4PUAA 3GKNA 3UL3A 2LQOA 1EGOA 2V6KA 3ZZXA 2H76A 4TR1B 2A2RA 5GAND 6GSYA 1ZL9A 3IXRA 1Y25A 2PU9C 4YAPA 4KX4A 4EUYA 22GSA 3QMXA 3HVNA 2O7KA 4G19A 4AGSA 5G5EA 3HCZA 2H1BA 4ISDA 1YEPA 1EV9A 4KA0A 1VRSD 2AJQB 2HRAA 3RBTA 4EO3A 4BA7A 2CQ9A 3KMNA 4O5UA 3M0FA 4FYCA 1LJRA 3IC8A 3VPQA 4MJEA 3HA9A 3QFAC 2PERA 4XCSA 3DGQA 1THXA 3CSJA 2HFDA 2B7KA 4DSQA 4JR4A 1AQXA 4MF5A 1U3IA 2FA4A 4LA1A 1OC3A 4X43A 4KUNA 2LJKA 1HNCA 1KBNA 4EE0A 4ML6A 4I5QA 5IMFA 4PX1A 4TR1A 1ML6A 4X0XA 1YKCA 4HU9A 4LMVA 1EEMA 1BJXA 3KGKA 5EPFA 2EIOA 3MNGA 1XCCA 4MJBA 5LNKe 3D4MA 1AAZA 5JCWA 4D73A 4EDYA 1VF3A 2WJUA 4KW6A 2BJXA 3GX8A 2VOCA 5AIVA 4ECJA 2YJ7A 3TOUA 2PVOC 4N0ZA 4MP4A 4OMVA 1MDKA 3RDWA 4GTUA 2F8AA 4IHUA 3HVSA 4HSCX 5HR3A 3E3EA 3HJMA 1TU7A 3S9FA 4IJIA 2VL9A 3C8EA 4EKZA 1QMVA 3DRNA 1HNBA 5F8BA 1FOHA 5IMCA 3TUEA 1JZRA 1B48A 1T7PB 3UMAA 3QOUA 1JLWA 5FHIA 2J9HA 3HJOA 1TKDB 3N5OA 1M2DA 3M1GA 3Q6OA 1XWKA 2UZ8A 4KCEA 1O85A 4TR3A 1X9WB 1TOFA 2HNLA 1K0MA 5J9CA 16GSA 12GSA 2KUCA 2REMA 2CZ2A 2WCIA 4RQXA 1YZXA 4MPFA 3EINA 1K3LA 3DEXA 5IMVA 1U6TA 1DBYA 4NWYA 3GSSA 2IMKA 2JL4A 3HVXA 3HXSA 2VCTA 2QA2A 3W6GA 2RM6A 3TRXA 1F3BA 4AF2A 3ZVJD 5HR0A 2WFCA 5D9WA 1F37A 1XFLA 1XOBA 5LCZA 2X64A 1EGRA 1GNWA 3FYGA 2P5RA 5F0GA 1X9MB 2OE3A 2PUKC 1SKRB 1C72A 1E2YA 3QPMA 4V2NA 1A24A 2B3SA 2CZ3A 5HR2A 3P90A 4I2UA 1RW1A 1Z5YE 3ZTLA 2VL2A 4TXOB 4NV2A 1M9BA 1BX9A 2DLXA 2DIZA 1J9BA 1IYIA 1TRVA 1I9DA 1SYXA 5G5FA 3AY8A 4L8EA 5AISA 4IVFA 3F8UA 3M8NA 1KTEA 1ACVA 1X5DA 2GS3A 2I81A 1NM3A 4CHSA 2JSYA 1SKWB 5IPGA 3H79A 2O89A 4PQHA 1YKAA 4ZXGA 2GZZA 2X8GA 1USBA 2C4JA 1O73A 4Z2RA 4CY6A 2FWEA 1K3OA 4HQZA 4GWRA 5ECLB 1TTZA 3FY7A 1J08A 2RUFA 5CRGA 4QL9A 4TRXA 2OACA 5H5SA 3GMFA 5AIXA 3D5JA 2GVPA 3IK7A 5AN1A 5A4UA 1EWXA 3TKSC 1M9AA 1YF0A 4BWQA 2DKIA 6GSSA 1AW9A 3VWWA 2AV4A 2JZSA 1OYJA 3SBCA 4KE3A 4KGIA 4ECIA 4JR6A 17GSA 2IJYA 2QGVA 1PD21 5IOWA 4MH3A 2YANA 1GUHA 2LV3A 5ECPB 1ERWA 1K0DA 2IFQA 1XPVA 3H4KA 1SD9A 5H5RA 2R0CA 1MTCA 2K18A 2CVBA 2TRXA 4P3YB 1FO5A 1IYHA 3UVHA 3FZAA 3ZMLA 5IIZA 2PPTA 2FWGA 4K9ZA 2N5BA 1GSQA 4ULXA 1ZGNA 5HR1A 2FLSA 3QDNA 1F9MA 1W89A 4MZBA 3O3TA 5JWQB 3F9UA 4WBRD 3GIXA 4KDYA 3L9SA 2VM2A 2FHEA 2GLRA 3RHBA 1G6YA 3GL3A 1PQNA 3WGDA 2V2GA 3KXOA 2YOIA 2L6CA 2GDRA 3VURA 2B5EA 1G7EA 3UBKA 1ZYPA 2H73A 2YWIA 3F4RA 3F4TA 1B8XA 2L4QA 3I43A 2KHPA 1SK2A 4FQUA 3VLNA 3KD0A 2AB6A 3GN3A 4ID0A 3L9VA 2WS2A 1QGVA 1PKZA 2DKHA 4DVCA 5IOXA 1X0RA 4OCFA 2CX4A 5B7CA 4TOPA 4MPGA 1A0RP 2CAIA 2OJLA 2HRNA 4ACSA 1KEBA 1I5GA 2PGTA 1DUGA 1OC9B 4OFNA 1DE2A 3HVVA 1EEJA 3F3QA 4TKYA 4CDOA 1T3BA 3IV4A 2IMIA 1OE7A 4E8HA 4HUAA 5B6NA 1TJDA 3CSIA 4BPYA 3RPNA 1OVNA 2FCHA 3FR3A 3U5RE 1XW5A 1HNAA 2C3NA 5B6MA 3TRPA 4PNFA 4XHMA 2LSTA 6GSUA 2DMLA 2LRTA 1ON4A 1GWCA 2BMXA 2A4VA 4F9ZA 4OO4A 1TDIA 1GSYA 3DVXA 3GH6A 1PSQA 4HJMA 5CRWA 5KN2A 2QC7A 1GSDA 1OKDA 4HDEA 5F05A 3FR9A 1NHYA 5IO0A 2HRFA 2GSTA 2HZFA 1ZYQB 1BG5A 3E0UA 5ECKB 2C0DA 2H30A 4GRFA 5E4WA 4MJCA 11GSA 1X5CA 1ABAA 2M46A 2YZUA 3RPPA 1XBSA 1ZZYA 7GSSA 5KN3A 5CREA 2CVKA 4KH7A 4KDUA 1XW9A 5D8IA 1FAAA 1XIYA 2ON5A 4IJ3A 4L5OA 2H6ZA 4K0GA 2A4HA 3KCMA 4NMUA 3PINA 4HJ2A 2GZPA 3ZFBA 4IS0A 4EIPA 2IMEA 3FW2A 2B1LA 2VLUA 4I8BA 3TOTA 4NHWA 3L0HA 3GX0A 5INYA 2JADA 4RQRA 5J4UA 4ZBDA 1R7HA 3DWVA 3A5IA 2YZHA 2LUSA 5ECHB 1QUWA 3CTGA 3GL5A 4BL7A 8GSSA 2NDOA 1GUMA 5AGYA 4KB3A 2OE1A 3C1RA 1QQ2A 3WYWA 2YV9A 2GT6A 3G7IA 2B5YA 4J56E 3DXBA 2N5AA 3P2AA 4KSOA 5G1LA 2FWHA 1H75A 1AC1A 1R5AA 3DMLA 4GQCA 1AQVA 2HT9A 1K0CA 2H66A 4POBA 2IPAA 2WGRA 2X4AA 4K7IA 2VIMA 3P8WA 5H5QA 5C00A 2H6XA 5BMUA 5E59A 2A2SA 1HYUA 3CQFA 2GSRA 4IP6A 1SKSB 4WBJA 2FGXA 5J41A 4D73B 1GLPA 1WWJA 1MEKA 2XHFA 2VL2C 3EWLA 2PN8A 2WRTA 3GKMA 3LEFA 3LFLA 4IQ1A 3QR6A 4ECBA 3EPTA 2TRCP 3TJJA 4K2DA 2FY6A 5DDLA 3FZ9A 3FEUA 4LL4B 2DJ2A 2KOKA 2J23A 3HD5A 5C04A 3CBUA 4F0BA 1V98A 1PL1A 2AAWA 4ZB9A 2EIRA 4Q5QA 1E6BA 4ICYA 1FB6A 1MDIA 3UBLA 5ECSA 4L0WA 4LMWA 2R2JA 3M9KA 4RI6A 4TN8A 4PQ1A 1HD2A 3DIEA 3LQ7A 2O8VB 3F63A 1NSWA 2N5FA 1EV4A 2XBQA 5ABRA 1UA5A 3I69A 5IQYA 4JRRA 3KH7A 2VD1A 5EY6A 4L5LA 1X5EA 1QK8A 3VI7A 2QSIA 3VWUA 2GQLA 2H1GA 1TRWA 2NBSA 3HKRA 3VFIA 3GRXA 2C0FA 5B8AA 1PA3A 3MYDA 1GSUA 2X8HA 2H8LA 2LJAA 4HZ2A 4Z2UA 4POMA 5GSTA 2GTUA 1R5PA 2RM5A 2K8VA 4BVXB 2JACA 3VK9A 2HE3A 3Q18A 4GQFA 1QFNA 2I1UA 2B7JA 2GZYA 1KNGA 3GV1A 3LG6A 1SENA 2DJJA 1A8YA 2RLIA 3P7XA 2B5XA 1GRXA 3HJPA 1X9SB 3ED3A 3UOMA 1VF1A 4BVYA 4EDZA 4YH2A 4HQSA 1B9YC 5L71A 5GAPD 1T00A 4IELA 4YQMA 2YWNA 3FR6A 3IBHA 2Z9SA 3SWLA 3BJ5A 3CRUA 4DSSB 1SL1B 1Y6EA 2MYGA 1M2AA 3V1WA 1GL8A 4F03A 3APOA 3IC4A 2B1KA 4V2LA 3L9UA 2G0FA 1CQHA 1K0AA 3UEMA 1TRUA 3KJYA 2PWJA 1ERUA 1F6MC 3GSTA 1Z6MA 3MDKA 5ECRB 3KP9A 3D4TA 3KMOA 3DD3A 4OFTA 2LKUA 4BVXA 2C1YA 4IBPA 2E2MA 5D9XA 2CVDA 3RAZA 3ZLPA 1V58A 4IGJA 4K7NA 4QQ7A 4JEDA 4GSNA 4TR0A 1HQOA 4PURA 3GYKA 1R26A 2IFQB 2R4VA 1ERTA 3FZ5A 1GLQA 1YEXA 5IMAA 2R0GA 10GSA 4OCEA 3Q74A 1LBKA 3APSA 4OWYA 2JZTA 5DQSA 2XBIA 1UC7A 1MD3A 1WPIA 3PH9A 4ML1A 2BTOT 2LQQA 2LTKA 3I9V2 2MMZA 5G2ZA 3A5WA 1TW9A 4EXJA 4DSSA 3BD2A 4MF6A 1PFOA 5ID2B 3ZREA 4N11A 2LNTA 2JSZA 2H0IA 2VUPA 1FVJA 3VPTA 3LORA 3WD6A 1OKTA 3U6VA 1WOUA 1S3DA 5A4WA 3TKQA 1J0FA 4HS1A 1VGLA 5ECMB 1UVZA 1XVQA 2LRCA 2JU5A 1K0NA 3PR8A 4G9HA 3LSZA 3H93A 4MABA 3MSZA 4XIHA 3PPUA 2X8CA 4JE1A 2ON7A 5D93A 3EE2A 5J9BA 3DKSA 2H01A 4Q5RA 4ZILA 2O87A 3PGTA 1ERVA 4FIWA 2X99A 3ZIJA 1SL0B 2WDUA 2VCVA 2HSMA 2F9SA 6GSVA 1Z7RA 1NHOA 3O6TA 4XS1A 4MA9A 4G10A 1YF1A 2OKAA 1GULA 3J7Yb 2C80A 5ID2A 3TDGA 5D9TA 5D9VA 4ECCA 4GF0A 2I4AA 5KN1A 4PXOA 1DE1A 4RI7A 4PUFC 1ILOA 1M3IA 4MJAA 1K0OA 3ZL5A 4IP1A 1XG8A 3D6IA 4ZBBA 2WB9A 2L59A 2LNSA 4KF9A 1PMTA 3IOSA 3GFKA 3UAPA 2FA8A 4K6XA 5JCUA 1GTUA 2AHEA 3A2WA 2CX3A 6GSXA 5ENUA 4WR5A 5HFKA 2VM1A 1O81A 1YY7A 2KP2A 4K0NA 2R3XA 4HZ4A 1U3AA 3RHCA 4K8MA 3EU3A 1GNEA 2KLXA 2GQMA 4YKGA 2CA8A 3R2QA 1SD8A 3F6FA 3EU4A 3NOFA 5DQYA 3NZNA 4JBBA 3GKXA 3W8JA 3C7MA 4POLA 1GTIA 2DSAA 1PRXA 4G2EA 2YP6A 3IPZA 5F06A 1JLVA 2R6KA 1JFUA 4XRDA 3G7JA 2R0PA 2HYXA 3NIVA 4BL7B 1Q4JA 4WKWA 5CNWA 2OADA 1Q98A 3GURA 3HY2A 2IN3A 3IAS2 2YJHA 1SYRA 3GKKA 1EP8A 4YAVA 2MBSA 5EVOA 4FYUA 2H0HA 4MCUA 3MIXA 5A5KA 1DSBA 13GSA 3ME8A 2ZNMA 3HZ4A 2H70A 1TP9A 1U88A 5COHA 3LXTA 1S3RA 3DYRA 3UJ1A 2VCZA 3ERWA 4TR4A 3MAKA 1WJKA 1XWGA 1H4OA 1CQGA 1THOA 3QAWA 3A2XA 3TJGA 2P0GA 5ECOB 5G1KA 5G31A 2YCDA 3TKSA 4MNNA 4O32A 4TW5A 4O5RA 3HYPA 1FVKA 5D73A 2FD3A 4MZCA 4ZL9A 4O5QA 4X1UA 2C3TA 2H1AA 2RUEA 1OAZA 3IE3A 5JCGA 4N10A 3EYTA 4PTSA 2CAQA 1V57A 2VLVA 2VCQA 1GP1A 4MDCA 9GSSA 1T4ZA 2F8FA 1UN2A 4XS6A 5HFGA 4X4JA 18GSA 4G0IA 4K5RA 5DBQA 3C1SA 4KAEA 5IMDA 1YJ6A 5CP1A 2FWFA 5DCGA 2LRNA 2G2QA 1FOVA 4PNGA 1RK4A 4F2IA 3ZITA 5EL8A 1SL2B 5DJLA 2ZCTA 3TRQA 1FW1A 1VF2A 4G0KA 2PBJA 4ZIJA 5CRHA 1PKWA 1AQWA 2I3YA 2IIYA 4IW9A 4A5PA 2HZEB 2WZ9A 3FKFA 5ECIB 3GTUB 4NV5A 4XTSA 2V32A 2CT6A 3HHVA 2F51A 1SJ6A 1M0UA 3R3EA 5GZZB 4GSTA 2L4CA 5F07A 1OC8A 3ZMKA 2TIRA 2O85A 2DJ0A 3ZRDA
chains in the Genus database with same CATH topology
3TJFA 3FZ4A 4Q5NA 4TXVA 3IA1A 4KDXA 1TK8B 1PX6A 3IAM2 4JU5A 3KTLA 1EP7A 1K0BA 4NXIA 2IL3A 1XZOA 3EMPA 1GSEA 3GH9A 2DJKA 2LS5A 4AJ7A 2FNOA 1GTAA 3QAVA 4F0CA 1O7UA 3LXZA 5KEJA 4NHZA 1MDJA 1ZCPA 1K3YA 3QD9A 5ELGA 3OR5A 3E9JB 1TRSA 3IHQA 4BVYB 5J3RA 3UIWA 1OE8A 4OO5A 2QA1A 3JCML 4GCIA 1XXUA 1LU4A 3ERGA 1Z9HA 2H71A 4WXTA 3IK9A 1O6JA 3C71A 4PQIA 5JWOB 3LWAA 3IR4A 2EC4A 3ZVJA 4LL1B 2HZEA 4HEA2 3GTUA 2PMTA 1BAYA 4NAXA 2R37A 2KP1A 5JWRB 4Z7XA 3EC3A 1U87A 1V40A 2M72A 2XC2A 1S3CA 3Q19A 6GSWA 1PN9A 5LD0A 4KCAA 3GNJA 2MBTA 2DJ1A 3EVIA 4GXZA 1WMJA 2C0GA 1GUKA 2AYTA 3KP8A 4AJ8A 1FHEA 1XW6A 3ZIVA 2VCWA 1A0FA 2V6OA 2V1MA 3CRTA 1EOHA 3QCPA 3CSHA 4K5SA 1M2BA 2CV4A 1TU8A 1GTBA 5BRTA 1ST9A 2L6DA 3D21A 4ZL8A 2OE0A 3LYKA 2DIYA 3CMIA 4OFMA 4WEYA 3G7YA 3D22A 3IHGA 4ZB8A 1TXXA 1A2LA 4IKHA 4NPBA 5B8BA 4MH2A 4HU7A 1T8EB 5KOXA 3BBYA 2AUVA 1WRYA 4IN0A 3LGCA 1Z6NA 4TVEA 1SU9A 2VL3A 2DC5A 2A2PA 1XWAA 2OBIA 3GUSA 2L5LA 4F82A 3GHAA 5HQPA 2NVLA 3TJKA 5A4VA 2L57A 1XWCA 4EC0A 4FH8A 3APQA 1T4YA 3UVTA 3W8SA 3WT2A 2VLTA 3GA4A 4ILFA 4YQVA 1M7TA 2E2GA 3H8QA 3FRCA 2LEGA 1QXHA 2YWMA 4IQAA 4YKFA 1AXDA 2VO4A 3KH9A 1PX7A 4POKA 3KM6A 2HLSA 5G30A 4K1FA 4JZQA 1BQ7A 1GH2A 4K2XA 2C8UA 2GQKA 5DALB 2HSYA 1TI1A 1V9WA 4E8EA 3CTFA 1PN0A 5D96A 2EIQA 2IMDA 4QL7A 5CRDA 4WF4A 3IRAA 5ELAA 1AUCA 2YWOA 2MMNA 3TKPA 3LJRA 5KN0A 1B9XC 3WGEA 3BCIA 1Z3EA 2K9FA 2H6YA 2P5QA 3TB2A 1A2MA 3HZ8A 4MLYA 3QAGA 1G6WA 4GLTA 2YPMA 2L5OA 1TK5B 4AJ6A 5HFIA 4XS4B 1A2JA 4FO5A 2F3MA 2YN1A 3C73A 2I9HA 4CW9A 2RIIA 4ZB6A 3WT1A 2NPBA 1TK0B 4ZL7A 4ZBAA 4J2FA 2QKEA 4Z2TA 4K7OA 4TXOA 2GGTA 2H19A 1YDKA 2VD0A 3IDVA 1BYEA 4XRAA 3TGZA 3TKRA 2K8SA 5DALA 5GSSA 4KNDA 1ZMAA 4L0UA 2IMFA 4EIQA 4O92A 4EL1A 2C3QA 4HI7A 2P31A 1SJIA 3ERFA 1GSFA 3M9JA 1SJZA 1O8XA 1WIKA 1ZYEA 3CXGA 3H1NA 1ZOFA 4DEJA 2V41A 4J57E 5KOWA 4RUVA 3VI5A 1WE0A 2MZCA 1R4WA 1F3AA 3DVWA 2HRKA 3J7Yk 2H74A 1Z7PA 1N2AA 2PVQA 1VF4A 4YQUA 3KTBA 4XS4A 3QFBC 2DBCA 4MZWA 1NW2A 3F4SA 2R5GA 5IM9A 19GSA 5CYYA 1A8LA 3FHKA 1F2EA 1SK1A 4EVMA 2OA7A 4N30A 14GSA 4I2TA 3FK8A 1G0TA 2K6VA 3K8NA 5DCHA 3LW9A 2M80A 2H75A 2E0QA 2OBKA 1JHBA 3KZQA 4KSMA 5J5NA 3G9BA 3VWVA 1S3AA 3A2VA 5ECQB 1B4PA 5DVBA 3A3TA 3LYPA 3BOAA 3ME7A 2H1DA 3ISOA 4WF5A 5IPHA 2ALBA 2NTOA 2X49A 1G7OA 3TCOA 3EURA 3US3A 3FMWA 1AIUA 3M3MA 1EZKA 3EMXA 1XOAA 1V2AA 3O76A 3VWXA 2GSQA 2ES7A 1MD4A 1YQ1A 5DAKB 2HXKA 2XPDA 1SK0A 2MMAA 1JZWA 2D2ZA 1A23A 1BEDA 1PGTA 2DJ3A 1JZOA 4V1Ap 1JZDA 3L78A 1O8WA 1B4QA 1EOGA 3F0IA 3MWHA 4FYBA 2GSSA 5CO3A 1W4VA 2JZRA 4HOJA 1M99A 3WGXA 2XPEA 4MF7A 1WP0A 2VCXA 2MMOA 5CAXA 3HDCA 2LJRA 4I6XA 1ZYNA 3F3RA 4G0LA 1XVWA 4PGTA 4BWSA 20GSA 1FB0A 4N0VA 2C0EA 3TKSE 1RQMA 2HSHA 3D0ZA 4I97A 1TI3A 3ZFLA 1GSSA 2YV7A 3N9JA 3CYNA 3I6AA 1FG4A 4WETA 4LLRA 2FUG2 5ECNB 2YNXA 1N8JA 4H86A 4DSRA 2VAFA 5IMZA 2HI7A 3BCKA 1OC9A 4EF0A 5DJMA 4V2MA 1XWBA 5DAKA 4OD7A 1T1VA 4O7HA 3TJBA 4CY8A 1URMA 2H0GA 2E7PA 2DMMA 4Q5FA 4GSSA 3UARA 3ZYWA 5IO2A 1PL2A 3KIJA 5FT3A 5FWGA 2ZUPA 2IWTA 2GT5A 2H72A 3F6DA 2B6MA 3L4NA 4MK3A 4WR4A 2WULA 4USSA 4V1Ag 3KEBA 6GSTA 4MMMA 4PUAA 3GKNA 3UL3A 2LQOA 1EGOA 2V6KA 3ZZXA 2H76A 4TR1B 2A2RA 5GAND 6GSYA 1ZL9A 3IXRA 1Y25A 2PU9C 4YAPA 4KX4A 4EUYA 22GSA 3QMXA 2O7KA 4G19A 4AGSA 5G5EA 3HCZA 2H1BA 4ISDA 1YEPA 1EV9A 4KA0A 1VRSD 2AJQB 2HRAA 3RBTA 4EO3A 4BA7A 2CQ9A 3KMNA 4O5UA 3M0FA 4FYCA 1LJRA 3IC8A 3VPQA 4MJEA 3HA9A 3QFAC 2PERA 4XCSA 3DGQA 1THXA 3CSJA 2HFDA 2B7KA 4DSQA 4JR4A 1AQXA 4MF5A 1U3IA 2FA4A 4LA1A 1OC3A 4X43A 4KUNA 2LJKA 1HNCA 1KBNA 4EE0A 4ML6A 4I5QA 5IMFA 4PX1A 4TR1A 1ML6A 4X0XA 1YKCA 4HU9A 4LMVA 1EEMA 1BJXA 3KGKA 5EPFA 2EIOA 3MNGA 1XCCA 4MJBA 5LNKe 3D4MA 1AAZA 5JCWA 4D73A 4EDYA 1VF3A 2WJUA 4KW6A 2BJXA 3GX8A 2VOCA 5AIVA 4ECJA 2YJ7A 3TOUA 2PVOC 4N0ZA 4MP4A 4OMVA 1MDKA 3RDWA 4GTUA 2F8AA 4IHUA 3HVSA 5HR3A 3E3EA 3HJMA 1TU7A 3S9FA 4IJIA 2VL9A 3C8EA 4EKZA 1QMVA 3DRNA 1HNBA 5F8BA 1FOHA 5IMCA 3TUEA 1JZRA 1B48A 1T7PB 3UMAA 3QOUA 1JLWA 5FHIA 2J9HA 3HJOA 1TKDB 3N5OA 1M2DA 3M1GA 3Q6OA 1XWKA 2UZ8A 4KCEA 1O85A 4TR3A 1X9WB 1TOFA 2HNLA 1K0MA 5J9CA 16GSA 12GSA 2KUCA 2REMA 2CZ2A 2WCIA 4RQXA 1YZXA 4MPFA 3EINA 1K3LA 3DEXA 5IMVA 1U6TA 1DBYA 4NWYA 3GSSA 2IMKA 2JL4A 3HVXA 3HXSA 2VCTA 2QA2A 3W6GA 2RM6A 3TRXA 1F3BA 4AF2A 3ZVJD 5HR0A 2WFCA 5D9WA 1F37A 1XFLA 1XOBA 5LCZA 2X64A 1EGRA 1GNWA 3FYGA 2P5RA 5F0GA 1X9MB 2OE3A 2PUKC 1SKRB 1C72A 1E2YA 3QPMA 4V2NA 1A24A 2B3SA 2CZ3A 5HR2A 3P90A 4I2UA 1RW1A 1Z5YE 3ZTLA 2VL2A 4TXOB 4NV2A 1M9BA 1BX9A 2DLXA 2DIZA 1J9BA 1IYIA 1TRVA 1I9DA 1SYXA 5G5FA 3AY8A 4L8EA 5AISA 4IVFA 3F8UA 3M8NA 1KTEA 1ACVA 1X5DA 2GS3A 2I81A 1NM3A 4CHSA 2JSYA 1SKWB 5IPGA 3H79A 2O89A 4PQHA 1YKAA 4ZXGA 2GZZA 2X8GA 1USBA 2C4JA 1O73A 4Z2RA 4CY6A 2FWEA 1K3OA 4HQZA 4GWRA 5ECLB 1TTZA 3FY7A 1J08A 2RUFA 5CRGA 4QL9A 4TRXA 2OACA 5H5SA 3GMFA 5AIXA 3D5JA 2GVPA 3IK7A 5AN1A 5A4UA 1EWXA 3TKSC 1M9AA 1YF0A 4BWQA 2DKIA 6GSSA 1AW9A 3VWWA 2AV4A 2JZSA 1OYJA 3SBCA 4KE3A 4KGIA 4ECIA 4JR6A 17GSA 2IJYA 2QGVA 1PD21 5IOWA 4MH3A 2YANA 1GUHA 2LV3A 5ECPB 1ERWA 1K0DA 2IFQA 1XPVA 3H4KA 1SD9A 5H5RA 2R0CA 1MTCA 2K18A 2CVBA 2TRXA 4P3YB 1FO5A 1IYHA 3UVHA 3FZAA 3ZMLA 5IIZA 2PPTA 2FWGA 4K9ZA 2N5BA 1GSQA 4ULXA 1ZGNA 5HR1A 2FLSA 3QDNA 1F9MA 1W89A 4MZBA 3O3TA 5JWQB 3F9UA 4WBRD 3GIXA 4KDYA 3L9SA 2VM2A 2FHEA 2GLRA 3RHBA 1G6YA 3GL3A 1PQNA 3WGDA 2V2GA 3KXOA 2YOIA 2L6CA 2GDRA 3VURA 2B5EA 1G7EA 3UBKA 1ZYPA 2H73A 2YWIA 3F4RA 3F4TA 1B8XA 2L4QA 3I43A 2KHPA 1SK2A 4FQUA 3VLNA 3KD0A 2AB6A 3GN3A 4ID0A 3L9VA 2WS2A 1QGVA 1PKZA 2DKHA 4DVCA 5IOXA 1X0RA 4OCFA 2CX4A 5B7CA 4TOPA 4MPGA 1A0RP 2CAIA 2OJLA 2HRNA 4ACSA 1KEBA 1I5GA 2PGTA 1DUGA 1OC9B 4OFNA 1DE2A 3HVVA 1EEJA 3F3QA 4TKYA 4CDOA 1T3BA 3IV4A 2IMIA 1OE7A 4E8HA 4HUAA 5B6NA 1TJDA 3CSIA 4BPYA 3RPNA 1OVNA 2FCHA 3FR3A 3U5RE 1XW5A 1HNAA 2C3NA 5B6MA 3TRPA 4PNFA 4XHMA 2LSTA 6GSUA 2DMLA 2LRTA 1ON4A 1GWCA 2BMXA 2A4VA 4F9ZA 4OO4A 1TDIA 1GSYA 3DVXA 3GH6A 1PSQA 4HJMA 5CRWA 5KN2A 2QC7A 1GSDA 1OKDA 4HDEA 5F05A 3FR9A 1NHYA 5IO0A 2HRFA 2GSTA 2HZFA 1ZYQB 1BG5A 3E0UA 5ECKB 2C0DA 2H30A 4GRFA 5E4WA 4MJCA 11GSA 1X5CA 1ABAA 2M46A 2YZUA 3RPPA 1XBSA 1ZZYA 7GSSA 5KN3A 5CREA 2CVKA 4KH7A 4KDUA 1XW9A 5D8IA 1FAAA 1XIYA 2ON5A 4IJ3A 4L5OA 2H6ZA 4K0GA 2A4HA 3KCMA 4NMUA 3PINA 4HJ2A 2GZPA 3ZFBA 4IS0A 4EIPA 2IMEA 3FW2A 2B1LA 2VLUA 4I8BA 3TOTA 4NHWA 3L0HA 3GX0A 5INYA 2JADA 4RQRA 5J4UA 4ZBDA 1R7HA 3DWVA 3A5IA 2YZHA 2LUSA 5ECHB 1QUWA 3CTGA 3GL5A 4BL7A 8GSSA 2NDOA 1GUMA 5AGYA 4KB3A 2OE1A 3C1RA 1QQ2A 3WYWA 2YV9A 2GT6A 3G7IA 2B5YA 4J56E 3DXBA 2N5AA 3P2AA 4KSOA 5G1LA 2FWHA 1H75A 1AC1A 1R5AA 3DMLA 4GQCA 1AQVA 2HT9A 1K0CA 2H66A 4POBA 2IPAA 2WGRA 2X4AA 4K7IA 2VIMA 3P8WA 5H5QA 5C00A 2H6XA 5BMUA 5E59A 2A2SA 1HYUA 2GSRA 4IP6A 1SKSB 4WBJA 2FGXA 5J41A 4D73B 1GLPA 1WWJA 1MEKA 2XHFA 2VL2C 3EWLA 2PN8A 2WRTA 3GKMA 3LEFA 3LFLA 4IQ1A 3QR6A 4ECBA 3EPTA 2TRCP 3TJJA 4K2DA 2FY6A 5DDLA 3FZ9A 3FEUA 4LL4B 2DJ2A 2KOKA 2J23A 3HD5A 5C04A 3CBUA 4F0BA 1V98A 1PL1A 2AAWA 4ZB9A 2EIRA 4Q5QA 1E6BA 4ICYA 1FB6A 1MDIA 3UBLA 5ECSA 4L0WA 4LMWA 2R2JA 3M9KA 4RI6A 4TN8A 4PQ1A 1HD2A 3DIEA 3LQ7A 2O8VB 3F63A 1NSWA 2N5FA 1EV4A 2XBQA 5ABRA 1UA5A 3I69A 5IQYA 4JRRA 3KH7A 2VD1A 5EY6A 4L5LA 1X5EA 1QK8A 3VI7A 2QSIA 3VWUA 2GQLA 2H1GA 1TRWA 2NBSA 3HKRA 3VFIA 3GRXA 2C0FA 5B8AA 1PA3A 3MYDA 1GSUA 2X8HA 2H8LA 2LJAA 4HZ2A 4Z2UA 4POMA 5GSTA 2GTUA 1R5PA 2RM5A 2K8VA 4BVXB 2JACA 3VK9A 2HE3A 3Q18A 4GQFA 1QFNA 2I1UA 2B7JA 2GZYA 1KNGA 3GV1A 3LG6A 1SENA 2DJJA 1A8YA 2RLIA 3P7XA 2B5XA 1GRXA 3HJPA 1X9SB 3ED3A 3UOMA 1VF1A 4BVYA 4EDZA 4YH2A 4HQSA 1B9YC 5L71A 5GAPD 1T00A 4IELA 4YQMA 2YWNA 3FR6A 3IBHA 2Z9SA 3SWLA 3BJ5A 3CRUA 4DSSB 1SL1B 1Y6EA 2MYGA 1M2AA 3V1WA 1GL8A 4F03A 3APOA 3IC4A 2B1KA 4V2LA 3L9UA 2G0FA 1CQHA 1K0AA 3UEMA 1TRUA 3KJYA 2PWJA 1ERUA 1F6MC 3GSTA 1Z6MA 3MDKA 5ECRB 3KP9A 3D4TA 3KMOA 3DD3A 4OFTA 2LKUA 4BVXA 2C1YA 4IBPA 2E2MA 5D9XA 2CVDA 3RAZA 3ZLPA 1V58A 4IGJA 4K7NA 4QQ7A 4JEDA 4GSNA 4TR0A 1HQOA 4PURA 3GYKA 1R26A 2IFQB 2R4VA 1ERTA 3FZ5A 1GLQA 1YEXA 5IMAA 2R0GA 10GSA 4OCEA 3Q74A 1LBKA 3APSA 4OWYA 2JZTA 5DQSA 2XBIA 1UC7A 1MD3A 1WPIA 3PH9A 4ML1A 2BTOT 2LQQA 2LTKA 3I9V2 2MMZA 5G2ZA 3A5WA 1TW9A 4EXJA 4DSSA 3BD2A 4MF6A 5ID2B 3ZREA 4N11A 2LNTA 2JSZA 2H0IA 2VUPA 1FVJA 3VPTA 3LORA 3WD6A 1OKTA 3U6VA 1WOUA 1S3DA 5A4WA 3TKQA 1J0FA 4HS1A 1VGLA 5ECMB 1UVZA 1XVQA 2LRCA 2JU5A 1K0NA 3PR8A 4G9HA 3LSZA 3H93A 4MABA 3MSZA 4XIHA 3PPUA 2X8CA 4JE1A 2ON7A 5D93A 3EE2A 5J9BA 3DKSA 2H01A 4Q5RA 4ZILA 2O87A 3PGTA 1ERVA 4FIWA 2X99A 3ZIJA 1SL0B 2WDUA 2VCVA 2HSMA 2F9SA 6GSVA 1Z7RA 1NHOA 3O6TA 4XS1A 4MA9A 4G10A 1YF1A 2OKAA 1GULA 3J7Yb 2C80A 5ID2A 3TDGA 5D9TA 5D9VA 4ECCA 4GF0A 2I4AA 5KN1A 4PXOA 1DE1A 4RI7A 4PUFC 1ILOA 4MJAA 1K0OA 3ZL5A 4IP1A 3D6IA 4ZBBA 2WB9A 2L59A 2LNSA 4KF9A 1PMTA 3IOSA 3GFKA 3UAPA 2FA8A 4K6XA 5JCUA 1GTUA 2AHEA 3A2WA 2CX3A 6GSXA 5ENUA 4WR5A 5HFKA 2VM1A 1O81A 1YY7A 2KP2A 4K0NA 2R3XA 4HZ4A 1U3AA 3RHCA 4K8MA 3EU3A 1GNEA 2KLXA 2GQMA 4YKGA 2CA8A 3R2QA 1SD8A 3F6FA 3EU4A 3NOFA 5DQYA 3NZNA 4JBBA 3GKXA 3W8JA 3C7MA 4POLA 1GTIA 2DSAA 1PRXA 4G2EA 2YP6A 3IPZA 5F06A 1JLVA 2R6KA 1JFUA 4XRDA 3G7JA 2R0PA 2HYXA 3NIVA 4BL7B 1Q4JA 4WKWA 5CNWA 2OADA 1Q98A 3GURA 3HY2A 2IN3A 3IAS2 2YJHA 1SYRA 3GKKA 1EP8A 4YAVA 2MBSA 5EVOA 4FYUA 2H0HA 4MCUA 3MIXA 5A5KA 1DSBA 13GSA 3ME8A 2ZNMA 3HZ4A 2H70A 1TP9A 1U88A 5COHA 3LXTA 3DYRA 3UJ1A 2VCZA 3ERWA 4TR4A 3MAKA 1WJKA 1XWGA 1H4OA 1CQGA 1THOA 3QAWA 3A2XA 3TJGA 2P0GA 5ECOB 5G1KA 5G31A 2YCDA 3TKSA 4MNNA 4O32A 4TW5A 4O5RA 3HYPA 1FVKA 5D73A 2FD3A 4MZCA 4ZL9A 4O5QA 4X1UA 2C3TA 2H1AA 2RUEA 1OAZA 3IE3A 5JCGA 4N10A 3EYTA 4PTSA 2CAQA 1V57A 2VLVA 2VCQA 1GP1A 4MDCA 9GSSA 1T4ZA 2F8FA 1UN2A 4XS6A 5HFGA 4X4JA 18GSA 4G0IA 4K5RA 5DBQA 3C1SA 4KAEA 5IMDA 1YJ6A 5CP1A 2FWFA 5DCGA 2LRNA 2G2QA 1FOVA 4PNGA 1RK4A 4F2IA 3ZITA 5EL8A 1SL2B 5DJLA 2ZCTA 3TRQA 1FW1A 1VF2A 4G0KA 2PBJA 4ZIJA 5CRHA 1PKWA 1AQWA 2I3YA 2IIYA 4IW9A 4A5PA 2HZEB 2WZ9A 3FKFA 5ECIB 3GTUB 4NV5A 4XTSA 2V32A 2CT6A 3HHVA 2F51A 1SJ6A 1M0UA 3R3EA 5GZZB 4GSTA 2L4CA 5F07A 1OC8A 3ZMKA 2TIRA 2O85A 2DJ0A 3ZRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJF A;  3FZ4 A;  4Q5N A;  4TXV A;  3IA1 A;  4KDX A;  1TK8 B;  1PX6 A;  3IAM 2;  4JU5 A;  3KTL A;  1EP7 A;  1K0B A;  4NXI A;  2IL3 A;  1XZO A;  3EMP A;  1GSE A;  3GH9 A;  2DJK A;  2LS5 A;  4AJ7 A;  2FNO A;  1GTA A;  3QAV A;  4F0C A;  1O7U A;  3LXZ A;  5KEJ A;  4NHZ A;  1MDJ A;  1ZCP A;  1K3Y A;  3QD9 A;  5ELG A;  3OR5 A;  3E9J B;  1TRS A;  3IHQ A;  5J3R A;  3UIW A;  1OE8 A;  4OO5 A;  3JCM L;  4GCI A;  1XXU A;  1LU4 A;  3ERG A;  1Z9H A;  2H71 A;  4WXT A;  3IK9 A;  1O6J A;  3C71 A;  4PQI A;  5JWO B;  3LWA A;  3IR4 A;  2EC4 A;  3ZVJ A;  4LL1 B;  2HZE A;  4HEA 2;  3GTU A;  2PMT A;  1BAY A;  4NAX A;  2R37 A;  2KP1 A;  5JWR B;  4Z7X A;  3EC3 A;  1U87 A;  1V40 A;  2M72 A;  2XC2 A;  1S3C A;  3Q19 A;  6GSW A;  1PN9 A;  5LD0 A;  4KCA A;  3GNJ A;  2MBT A;  2DJ1 A;  3EVI A;  4GXZ A;  1WMJ A;  2C0G A;  1GUK A;  2AYT A;  3KP8 A;  4AJ8 A;  1FHE A;  1XW6 A;  3ZIV A;  2VCW A;  1A0F A;  2V6O A;  2V1M A;  3CRT A;  1EOH A;  3QCP A;  3CSH A;  1M2B A;  2CV4 A;  1TU8 A;  1GTB A;  1ST9 A;  2L6D A;  3D21 A;  4ZL8 A;  2OE0 A;  3LYK A;  2DIY A;  3CMI A;  4OFM A;  4WEY A;  3G7Y A;  3D22 A;  4ZB8 A;  1TXX A;  1A2L A;  4IKH A;  4NPB A;  5B8B A;  4MH2 A;  4HU7 A;  1T8E B;  3BBY A;  2AUV A;  1WRY A;  4IN0 A;  3LGC A;  1Z6N A;  4TVE A;  1SU9 A;  2VL3 A;  2DC5 A;  1XWA A;  2OBI A;  3GUS A;  2L5L A;  4F82 A;  3GHA A;  5HQP A;  2NVL A;  3TJK A;  5A4V A;  2L57 A;  1XWC A;  4EC0 A;  4FH8 A;  3APQ A;  1T4Y A;  3UVT A;  3W8S A;  3WT2 A;  2VLT A;  3GA4 A;  4ILF A;  4YQV A;  1M7T A;  2E2G A;  3H8Q A;  3FRC A;  2LEG A;  1QXH A;  2YWM A;  4IQA A;  1AXD A;  2VO4 A;  3KH9 A;  1PX7 A;  4POK A;  3KM6 A;  2HLS A;  5G30 A;  4K1F A;  4JZQ A;  1BQ7 A;  1GH2 A;  2C8U A;  2GQK A;  5DAL B;  2HSY A;  1TI1 A;  1V9W A;  4E8E A;  3CTF A;  5D96 A;  2EIQ A;  2IMD A;  4QL7 A;  5CRD A;  4WF4 A;  3IRA A;  5ELA A;  1AUC A;  2YWO A;  2MMN A;  3TKP A;  3LJR A;  5KN0 A;  1B9X C;  3WGE A;  3BCI A;  1Z3E A;  2K9F A;  2H6Y A;  2P5Q A;  3TB2 A;  1A2M A;  3HZ8 A;  4MLY A;  3QAG A;  1G6W A;  4GLT A;  2YPM A;  2L5O A;  1TK5 B;  4AJ6 A;  5HFI A;  4XS4 B;  1A2J A;  4FO5 A;  2F3M A;  2YN1 A;  3C73 A;  2I9H A;  4CW9 A;  2RII A;  4ZB6 A;  3WT1 A;  2NPB A;  1TK0 B;  4ZL7 A;  4ZBA A;  4J2F A;  2QKE A;  4K7O A;  4TXO A;  2GGT A;  2H19 A;  1YDK A;  2VD0 A;  3IDV A;  1BYE A;  4XRA A;  3TGZ A;  3TKR A;  2K8S A;  5DAL A;  5GSS A;  4KND A;  1ZMA A;  4L0U A;  2IMF A;  4O92 A;  4EL1 A;  2C3Q A;  4HI7 A;  2P31 A;  1SJI A;  3ERF A;  1GSF A;  3M9J A;  1SJZ A;  1O8X A;  1WIK A;  1ZYE A;  3CXG A;  3H1N A;  1ZOF A;  4DEJ A;  2V41 A;  4J57 E;  4RUV A;  3VI5 A;  1WE0 A;  2MZC A;  1R4W A;  1F3A A;  3DVW A;  3J7Y k;  2H74 A;  1Z7P A;  1N2A A;  2PVQ A;  1VF4 A;  4YQU A;  3KTB A;  4XS4 A;  3QFB C;  2DBC A;  4MZW A;  1NW2 A;  3F4S A;  2R5G A;  5IM9 A;  19GS A;  1A8L A;  5CYY A;  3FHK A;  1F2E A;  1SK1 A;  4EVM A;  2OA7 A;  4N30 A;  14GS A;  4I2T A;  3FK8 A;  1G0T A;  2K6V A;  3K8N A;  5DCH A;  2M80 A;  2H75 A;  2E0Q A;  2OBK A;  1JHB A;  3KZQ A;  4KSM A;  5J5N A;  3G9B A;  3VWV A;  1S3A A;  5ECQ B;  3A2V A;  1B4P A;  5DVB A;  3A3T A;  3LYP A;  3BOA A;  3ME7 A;  2H1D A;  3ISO A;  4WF5 A;  5IPH A;  2ALB A;  2NTO A;  1G7O A;  3TCO A;  3EUR A;  3US3 A;  1AIU A;  3M3M A;  1EZK A;  3EMX A;  1XOA A;  1V2A A;  3O76 A;  3VWX A;  2GSQ A;  2ES7 A;  1MD4 A;  1YQ1 A;  5DAK B;  2HXK A;  2XPD A;  1SK0 A;  2MMA A;  1JZW A;  2D2Z A;  1A23 A;  1BED A;  1PGT A;  2DJ3 A;  1JZO A;  4V1A p;  1JZD A;  3L78 A;  1O8W A;  1B4Q A;  1EOG A;  3F0I A;  3MWH A;  4FYB A;  2GSS A;  5CO3 A;  1W4V A;  2JZR A;  4HOJ A;  1M99 A;  3WGX A;  2XPE A;  4MF7 A;  1WP0 A;  2VCX A;  2MMO A;  5CAX A;  3HDC A;  2LJR A;  4I6X A;  3F3R A;  1XVW A;  4PGT A;  4BWS A;  20GS A;  1FB0 A;  4N0V A;  2C0E A;  3TKS E;  1RQM A;  2HSH A;  3D0Z A;  4I97 A;  1TI3 A;  3ZFL A;  1GSS A;  2YV7 A;  3N9J A;  3CYN A;  3I6A A;  1FG4 A;  4WET A;  4LLR A;  5ECN B;  2FUG 2;  2YNX A;  1N8J A;  4H86 A;  4DSR A;  2VAF A;  5IMZ A;  2HI7 A;  3BCK A;  1OC9 A;  4EF0 A;  5DJM A;  4V2M A;  1XWB A;  5DAK A;  4OD7 A;  1T1V A;  4O7H A;  3TJB A;  1URM A;  2H0G A;  2E7P A;  2DMM A;  4Q5F A;  4GSS A;  3UAR A;  3ZYW A;  5IO2 A;  1PL2 A;  3KIJ A;  5FT3 A;  5FWG A;  2ZUP A;  2IWT A;  2GT5 A;  2H72 A;  3F6D A;  2B6M A;  3L4N A;  4MK3 A;  4WR4 A;  2WUL A;  4V1A g;  3KEB A;  6GST A;  4MMM A;  4PUA A;  3GKN A;  3UL3 A;  2LQO A;  1EGO A;  2V6K A;  3ZZX A;  2H76 A;  4TR1 B;  2A2R A;  5GAN D;  6GSY A;  1ZL9 A;  3IXR A;  1Y25 A;  2PU9 C;  4YAP A;  4KX4 A;  4EUY A;  22GS A;  3QMX A;  2O7K A;  4G19 A;  4AGS A;  5G5E A;  3HCZ A;  2H1B A;  4ISD A;  1YEP A;  1EV9 A;  4KA0 A;  1VRS D;  2AJQ B;  3RBT A;  4EO3 A;  4BA7 A;  2CQ9 A;  3KMN A;  3M0F A;  4FYC A;  1LJR A;  3VPQ A;  4MJE A;  3HA9 A;  3QFA C;  2PER A;  4XCS A;  3DGQ A;  1THX A;  3CSJ A;  2HFD A;  2B7K A;  4DSQ A;  4JR4 A;  1AQX A;  4MF5 A;  1U3I A;  2FA4 A;  4LA1 A;  1OC3 A;  4X43 A;  4KUN A;  2LJK A;  1HNC A;  1KBN A;  4EE0 A;  4ML6 A;  4I5Q A;  5IMF A;  4PX1 A;  4TR1 A;  1ML6 A;  4X0X A;  1YKC A;  4HU9 A;  4LMV A;  1EEM A;  1BJX A;  3KGK A;  5EPF A;  2EIO A;  3MNG A;  1XCC A;  4MJB A;  5LNK e;  3D4M A;  1AAZ A;  5JCW A;  4D73 A;  4EDY A;  1VF3 A;  2WJU A;  4KW6 A;  2BJX A;  3GX8 A;  2VOC A;  5AIV A;  4ECJ A;  2YJ7 A;  3TOU A;  2PVO C;  4N0Z A;  4MP4 A;  4OMV A;  1MDK A;  3RDW A;  4GTU A;  2F8A A;  4IHU A;  3HVS A;  5HR3 A;  3E3E A;  3HJM A;  1TU7 A;  3S9F A;  4IJI A;  2VL9 A;  3C8E A;  4EKZ A;  1QMV A;  3DRN A;  1HNB A;  5F8B A;  5IMC A;  3TUE A;  1JZR A;  1B48 A;  1T7P B;  3UMA A;  3QOU A;  1JLW A;  5FHI A;  2J9H A;  3HJO A;  1TKD B;  3N5O A;  1M2D A;  3M1G A;  3Q6O A;  1XWK A;  4KCE A;  1O85 A;  4TR3 A;  1X9W B;  1TOF A;  2HNL A;  1K0M A;  5J9C A;  16GS A;  12GS A;  2KUC A;  2REM A;  2CZ2 A;  2WCI A;  4RQX A;  1YZX A;  4MPF A;  3EIN A;  1K3L A;  3DEX A;  5IMV A;  1U6T A;  1DBY A;  4NWY A;  3GSS A;  2IMK A;  2JL4 A;  3HVX A;  3HXS A;  2VCT A;  3W6G A;  2RM6 A;  3TRX A;  1F3B A;  4AF2 A;  3ZVJ D;  5HR0 A;  2WFC A;  5D9W A;  1F37 A;  1XFL A;  1XOB A;  5LCZ A;  2X64 A;  1EGR A;  1GNW A;  3FYG A;  2P5R A;  5F0G A;  1X9M B;  2OE3 A;  2PUK C;  1SKR B;  1C72 A;  1E2Y A;  3QPM A;  4V2N A;  1A24 A;  2B3S A;  2CZ3 A;  5HR2 A;  3P90 A;  4I2U A;  1RW1 A;  1Z5Y E;  3ZTL A;  2VL2 A;  4TXO B;  4NV2 A;  1M9B A;  1BX9 A;  2DLX A;  2DIZ A;  1J9B A;  1IYI A;  1TRV A;  1I9D A;  1SYX A;  5G5F A;  3AY8 A;  4L8E A;  5AIS A;  4IVF A;  3F8U A;  3M8N A;  1KTE A;  1ACV A;  1X5D A;  2GS3 A;  2I81 A;  1NM3 A;  4CHS A;  2JSY A;  1SKW B;  5IPG A;  3H79 A;  2O89 A;  4PQH A;  1YKA A;  4ZXG A;  2GZZ A;  2X8G A;  1USB A;  2C4J A;  1O73 A;  2FWE A;  1K3O A;  4HQZ A;  4GWR A;  5ECL B;  1TTZ A;  3FY7 A;  1J08 A;  2RUF A;  5CRG A;  4QL9 A;  4TRX A;  2OAC A;  5H5S A;  3GMF A;  5AIX A;  3D5J A;  2GVP A;  3IK7 A;  5AN1 A;  5A4U A;  1EWX A;  3TKS C;  1M9A A;  1YF0 A;  4BWQ A;  6GSS A;  1AW9 A;  3VWW A;  2AV4 A;  2JZS A;  1OYJ A;  3SBC A;  4KE3 A;  4KGI A;  4ECI A;  4JR6 A;  17GS A;  2IJY A;  2QGV A;  1PD2 1;  5IOW A;  4MH3 A;  2YAN A;  1GUH A;  2LV3 A;  5ECP B;  1ERW A;  1K0D A;  2IFQ A;  1XPV A;  3H4K A;  1SD9 A;  5H5R A;  1MTC A;  2K18 A;  2CVB A;  2TRX A;  4P3Y B;  1FO5 A;  1IYH A;  3UVH A;  3FZA A;  3ZML A;  5IIZ A;  2PPT A;  2FWG A;  4K9Z A;  2N5B A;  1GSQ A;  4ULX A;  1ZGN A;  5HR1 A;  2FLS A;  3QDN A;  1F9M A;  1W89 A;  4MZB A;  3O3T A;  5JWQ B;  3F9U A;  4WBR D;  3GIX A;  4KDY A;  3L9S A;  2VM2 A;  2FHE A;  2GLR A;  3RHB A;  1G6Y A;  3GL3 A;  1PQN A;  3WGD A;  2V2G A;  3KXO A;  2YOI A;  2L6C A;  2GDR A;  3VUR A;  2B5E A;  1G7E A;  3UBK A;  2H73 A;  2YWI A;  3F4R A;  3F4T A;  1B8X A;  2L4Q A;  3I43 A;  2KHP A;  1SK2 A;  3VLN A;  3KD0 A;  2AB6 A;  3GN3 A;  4ID0 A;  3L9V A;  2WS2 A;  1QGV A;  1PKZ A;  4DVC A;  5IOX A;  1X0R A;  4OCF A;  2CX4 A;  5B7C A;  4TOP A;  4MPG A;  1A0R P;  2CAI A;  2OJL A;  2HRN A;  4ACS A;  1KEB A;  1I5G A;  2PGT A;  1DUG A;  1OC9 B;  4OFN A;  1DE2 A;  3HVV A;  1EEJ A;  3F3Q A;  4TKY A;  4CDO A;  1T3B A;  3IV4 A;  2IMI A;  1OE7 A;  4E8H A;  4HUA A;  5B6N A;  1TJD A;  3CSI A;  4BPY A;  3RPN A;  1OVN A;  2FCH A;  3FR3 A;  3U5R E;  1XW5 A;  1HNA A;  2C3N A;  5B6M A;  3TRP A;  4PNF A;  4XHM A;  2LST A;  6GSU A;  2DML A;  2LRT A;  1ON4 A;  1GWC A;  2BMX A;  2A4V A;  4F9Z A;  4OO4 A;  1TDI A;  1GSY A;  3DVX A;  3GH6 A;  1PSQ A;  4HJM A;  5CRW A;  5KN2 A;  2QC7 A;  1GSD A;  1OKD A;  4HDE A;  5F05 A;  3FR9 A;  1NHY A;  5IO0 A;  2HRF A;  2GST A;  2HZF A;  1ZYQ B;  1BG5 A;  3E0U A;  5ECK B;  2C0D A;  2H30 A;  4GRF A;  5E4W A;  4MJC A;  11GS A;  1X5C A;  1ABA A;  2M46 A;  2YZU A;  3RPP A;  1XBS A;  1ZZY A;  7GSS A;  5KN3 A;  5CRE A;  2CVK A;  4KH7 A;  4KDU A;  1XW9 A;  5D8I A;  1FAA A;  1XIY A;  2ON5 A;  4IJ3 A;  4L5O A;  2H6Z A;  4K0G A;  3KCM A;  4NMU A;  3PIN A;  4HJ2 A;  2GZP A;  3ZFB A;  4IS0 A;  2IME A;  3FW2 A;  2B1L A;  2VLU A;  4I8B A;  3TOT A;  4NHW A;  3L0H A;  3GX0 A;  5INY A;  2JAD A;  4RQR A;  5J4U A;  4ZBD A;  1R7H A;  3DWV A;  2YZH A;  2LUS A;  5ECH B;  1QUW A;  3CTG A;  3GL5 A;  4BL7 A;  8GSS A;  2NDO A;  1GUM A;  5AGY A;  4KB3 A;  2OE1 A;  3C1R A;  1QQ2 A;  3WYW A;  2YV9 A;  2GT6 A;  3G7I A;  2B5Y A;  4J56 E;  3DXB A;  2N5A A;  3P2A A;  4KSO A;  5G1L A;  2FWH A;  1H75 A;  1AC1 A;  1R5A A;  3DML A;  4GQC A;  1AQV A;  2HT9 A;  1K0C A;  2H66 A;  4POB A;  2IPA A;  2WGR A;  4K7I A;  2VIM A;  3P8W A;  5H5Q A;  5C00 A;  2H6X A;  5E59 A;  2A2S A;  1HYU A;  2GSR A;  4IP6 A;  1SKS B;  4WBJ A;  2FGX A;  5J41 A;  4D73 B;  1GLP A;  1WWJ A;  1MEK A;  2XHF A;  2VL2 C;  3EWL A;  2PN8 A;  2WRT A;  3GKM A;  3LEF A;  3LFL A;  4IQ1 A;  3QR6 A;  4ECB A;  2TRC P;  3TJJ A;  4K2D A;  2FY6 A;  5DDL A;  3FZ9 A;  3FEU A;  4LL4 B;  2DJ2 A;  2KOK A;  2J23 A;  3HD5 A;  5C04 A;  3CBU A;  4F0B A;  1V98 A;  1PL1 A;  2AAW A;  4ZB9 A;  2EIR A;  4Q5Q A;  1E6B A;  1FB6 A;  1MDI A;  3UBL A;  5ECS A;  4L0W A;  4LMW A;  2R2J A;  3M9K A;  4RI6 A;  4TN8 A;  4PQ1 A;  1HD2 A;  3DIE A;  3LQ7 A;  2O8V B;  3F63 A;  1NSW A;  2N5F A;  1EV4 A;  2XBQ A;  5ABR A;  1UA5 A;  3I69 A;  5IQY A;  4JRR A;  3KH7 A;  2VD1 A;  5EY6 A;  4L5L A;  1X5E A;  1QK8 A;  3VI7 A;  2QSI A;  3VWU A;  2GQL A;  2H1G A;  1TRW A;  2NBS A;  3HKR A;  3VFI A;  3GRX A;  2C0F A;  5B8A A;  1PA3 A;  1GSU A;  2X8H A;  2H8L A;  2LJA A;  4HZ2 A;  4POM A;  5GST A;  2GTU A;  1R5P A;  2RM5 A;  2K8V A;  2JAC A;  3VK9 A;  2HE3 A;  3Q18 A;  4GQF A;  1QFN A;  2I1U A;  2B7J A;  2GZY A;  1KNG A;  3GV1 A;  3LG6 A;  1SEN A;  2DJJ A;  1A8Y A;  2RLI A;  3P7X A;  2B5X A;  1GRX A;  3HJP A;  1X9S B;  3ED3 A;  3UOM A;  1VF1 A;  4BVY A;  4EDZ A;  4YH2 A;  4HQS A;  1B9Y C;  5L71 A;  5GAP D;  1T00 A;  4IEL A;  4YQM A;  2YWN A;  3FR6 A;  3IBH A;  2Z9S A;  3SWL A;  3BJ5 A;  3CRU A;  4DSS B;  1SL1 B;  1Y6E A;  2MYG A;  1M2A A;  3V1W A;  1GL8 A;  4F03 A;  3APO A;  3IC4 A;  2B1K A;  4V2L A;  3L9U A;  2G0F A;  1CQH A;  1K0A A;  3UEM A;  1TRU A;  3KJY A;  2PWJ A;  1ERU A;  1F6M C;  3GST A;  1Z6M A;  3MDK A;  5ECR B;  3KP9 A;  3D4T A;  3KMO A;  3DD3 A;  4OFT A;  2LKU A;  4BVX A;  2C1Y A;  4IBP A;  2E2M A;  5D9X A;  2CVD A;  3RAZ A;  3ZLP A;  1V58 A;  4IGJ A;  4K7N A;  4QQ7 A;  4JED A;  4GSN A;  4TR0 A;  1HQO A;  4PUR A;  3GYK A;  1R26 A;  2IFQ B;  2R4V A;  1ERT A;  3FZ5 A;  1GLQ A;  1YEX A;  5IMA A;  10GS A;  4OCE A;  3Q74 A;  1LBK A;  3APS A;  4OWY A;  2JZT A;  5DQS A;  2XBI A;  1UC7 A;  1MD3 A;  1WPI A;  3PH9 A;  4ML1 A;  2BTO T;  2LQQ A;  2LTK A;  3I9V 2;  2MMZ A;  5G2Z A;  3A5W A;  1TW9 A;  4EXJ A;  4DSS A;  3BD2 A;  4MF6 A;  5ID2 B;  3ZRE A;  4N11 A;  2LNT A;  2JSZ A;  2H0I A;  2VUP A;  1FVJ A;  3VPT A;  3LOR A;  3WD6 A;  1OKT A;  3U6V A;  1WOU A;  1S3D A;  5A4W A;  3TKQ A;  1J0F A;  4HS1 A;  1VGL A;  5ECM B;  1UVZ A;  1XVQ A;  2LRC A;  2JU5 A;  1K0N A;  3PR8 A;  4G9H A;  3LSZ A;  3H93 A;  4MAB A;  3MSZ A;  4XIH A;  2X8C A;  4JE1 A;  2ON7 A;  5D93 A;  3EE2 A;  5J9B A;  3DKS A;  2H01 A;  4Q5R A;  4ZIL A;  2O87 A;  3PGT A;  1ERV A;  4FIW A;  2X99 A;  3ZIJ A;  1SL0 B;  2WDU A;  2VCV A;  2F9S A;  6GSV A;  1Z7R A;  1NHO A;  3O6T A;  4XS1 A;  4MA9 A;  4G10 A;  1YF1 A;  2OKA A;  1GUL A;  3J7Y b;  2C80 A;  5ID2 A;  3TDG A;  5D9T A;  5D9V A;  4ECC A;  4GF0 A;  2I4A A;  5KN1 A;  4PXO A;  1DE1 A;  4RI7 A;  4PUF C;  1ILO A;  4MJA A;  1K0O A;  3ZL5 A;  4IP1 A;  3D6I A;  4ZBB A;  2WB9 A;  2L59 A;  2LNS A;  1PMT A;  3IOS A;  3GFK A;  3UAP A;  2FA8 A;  4K6X A;  5JCU A;  1GTU A;  2AHE A;  3A2W A;  2CX3 A;  6GSX A;  5ENU A;  4WR5 A;  5HFK A;  2VM1 A;  1O81 A;  1YY7 A;  2KP2 A;  4K0N A;  2R3X A;  4HZ4 A;  1U3A A;  3RHC A;  4K8M A;  3EU3 A;  1GNE A;  2KLX A;  2GQM A;  2CA8 A;  3R2Q A;  1SD8 A;  3F6F A;  3EU4 A;  3NOF A;  5DQY A;  3NZN A;  4JBB A;  3GKX A;  3W8J A;  3C7M A;  4POL A;  1GTI A;  2DSA A;  1PRX A;  4G2E A;  2YP6 A;  3IPZ A;  5F06 A;  1JLV A;  2R6K A;  1JFU A;  4XRD A;  3G7J A;  2HYX A;  3NIV A;  1Q4J A;  4WKW A;  5CNW A;  2OAD A;  1Q98 A;  3GUR A;  3HY2 A;  2IN3 A;  3IAS 2;  2YJH A;  1SYR A;  3GKK A;  1EP8 A;  4YAV A;  2MBS A;  5EVO A;  4FYU A;  2H0H A;  4MCU A;  5A5K A;  1DSB A;  13GS A;  3ME8 A;  2ZNM A;  3HZ4 A;  2H70 A;  1TP9 A;  1U88 A;  5COH A;  3LXT A;  3DYR A;  3UJ1 A;  2VCZ A;  3ERW A;  4TR4 A;  3MAK A;  1WJK A;  1XWG A;  1H4O A;  1CQG A;  1THO A;  3QAW A;  3A2X A;  3TJG A;  2P0G A;  5ECO B;  5G1K A;  5G31 A;  2YCD A;  3TKS A;  4O32 A;  4TW5 A;  4O5R A;  3HYP A;  1FVK A;  5D73 A;  2FD3 A;  4MZC A;  4ZL9 A;  4X1U A;  2C3T A;  2H1A A;  2RUE A;  1OAZ A;  3IE3 A;  5JCG A;  4N10 A;  3EYT A;  2CAQ A;  1V57 A;  2VLV A;  2VCQ A;  1GP1 A;  4MDC A;  9GSS A;  1T4Z A;  2F8F A;  1UN2 A;  4XS6 A;  5HFG A;  18GS A;  5DBQ A;  3C1S A;  4KAE A;  5IMD A;  1YJ6 A;  5CP1 A;  2FWF A;  5DCG A;  2LRN A;  2G2Q A;  1FOV A;  4PNG A;  1RK4 A;  4F2I A;  3ZIT A;  5EL8 A;  1SL2 B;  5DJL A;  2ZCT A;  3TRQ A;  1FW1 A;  1VF2 A;  2PBJ A;  4ZIJ A;  5CRH A;  1PKW A;  1AQW A;  2I3Y A;  2IIY A;  4IW9 A;  2HZE B;  2WZ9 A;  3FKF A;  5ECI B;  3GTU B;  4NV5 A;  4XTS A;  2V32 A;  2CT6 A;  3HHV A;  2F51 A;  1SJ6 A;  1M0U A;  5GZZ B;  4GST A;  2L4C A;  5F07 A;  1OC8 A;  3ZMK A;  2TIR A;  2O85 A;  2DJ0 A;  3ZRD A; 
#chains in the Genus database with same CATH topology
 3TJF A;  3FZ4 A;  4Q5N A;  4TXV A;  3IA1 A;  4KDX A;  1TK8 B;  1PX6 A;  3IAM 2;  4JU5 A;  3KTL A;  1EP7 A;  1K0B A;  4NXI A;  2IL3 A;  1XZO A;  3EMP A;  1GSE A;  3GH9 A;  2DJK A;  2LS5 A;  4AJ7 A;  2FNO A;  1GTA A;  3QAV A;  4F0C A;  1O7U A;  3LXZ A;  5KEJ A;  4NHZ A;  1MDJ A;  1ZCP A;  1K3Y A;  3QD9 A;  5ELG A;  3OR5 A;  1M3J A;  3E9J B;  1TRS A;  3IHQ A;  4BVY B;  5J3R A;  3UIW A;  1OE8 A;  4OO5 A;  2QA1 A;  3JCM L;  4GCI A;  1XXU A;  1LU4 A;  3ERG A;  1Z9H A;  2H71 A;  4WXT A;  3IK9 A;  1O6J A;  3C71 A;  4PQI A;  5JWO B;  3LWA A;  3IR4 A;  2EC4 A;  3ZVJ A;  4LL1 B;  2HZE A;  4HEA 2;  3GTU A;  2PMT A;  1BAY A;  4NAX A;  2R37 A;  2KP1 A;  5JWR B;  4Z7X A;  3EC3 A;  1U87 A;  1V40 A;  2M72 A;  2XC2 A;  1S3C A;  3Q19 A;  6GSW A;  1PN9 A;  5LD0 A;  4KCA A;  3GNJ A;  2MBT A;  2DJ1 A;  3EVI A;  4GXZ A;  1WMJ A;  2C0G A;  1GUK A;  2AYT A;  3KP8 A;  4AJ8 A;  1FHE A;  1XW6 A;  3ZIV A;  2VCW A;  1A0F A;  2V6O A;  2V1M A;  3CRT A;  1EOH A;  3QCP A;  3CSH A;  4K5S A;  1M2B A;  2CV4 A;  1TU8 A;  1GTB A;  5BRT A;  1ST9 A;  2L6D A;  3D21 A;  4ZL8 A;  2OE0 A;  3LYK A;  2DIY A;  3CMI A;  4OFM A;  4WEY A;  3G7Y A;  3D22 A;  3IHG A;  4ZB8 A;  1TXX A;  1A2L A;  4IKH A;  4NPB A;  5B8B A;  4MH2 A;  4HU7 A;  1T8E B;  5KOX A;  3BBY A;  2AUV A;  1WRY A;  4IN0 A;  3LGC A;  1Z6N A;  4TVE A;  1SU9 A;  2VL3 A;  2DC5 A;  2A2P A;  1XWA A;  2OBI A;  3GUS A;  2L5L A;  4F82 A;  3GHA A;  5HQP A;  2NVL A;  3TJK A;  5A4V A;  2L57 A;  1XWC A;  4EC0 A;  4FH8 A;  3APQ A;  1T4Y A;  3UVT A;  3W8S A;  3WT2 A;  2VLT A;  3GA4 A;  4ILF A;  4YQV A;  1M7T A;  2E2G A;  3H8Q A;  3FRC A;  2LEG A;  1QXH A;  2YWM A;  4IQA A;  4YKF A;  1AXD A;  2VO4 A;  3KH9 A;  1PX7 A;  4POK A;  3KM6 A;  2HLS A;  5G30 A;  4K1F A;  4JZQ A;  1BQ7 A;  1GH2 A;  4K2X A;  2C8U A;  2GQK A;  5DAL B;  2HSY A;  1TI1 A;  1V9W A;  4E8E A;  3CTF A;  1PN0 A;  5D96 A;  2EIQ A;  2IMD A;  4QL7 A;  5CRD A;  4WF4 A;  3IRA A;  5ELA A;  1AUC A;  2YWO A;  2MMN A;  3TKP A;  3LJR A;  5KN0 A;  1B9X C;  3WGE A;  3BCI A;  1Z3E A;  2K9F A;  2H6Y A;  2P5Q A;  3TB2 A;  1A2M A;  3HZ8 A;  4MLY A;  3QAG A;  1G6W A;  4GLT A;  2YPM A;  2L5O A;  1TK5 B;  4AJ6 A;  5HFI A;  4XS4 B;  1A2J A;  4FO5 A;  2F3M A;  2YN1 A;  3C73 A;  2I9H A;  4CW9 A;  2RII A;  4ZB6 A;  3WT1 A;  2NPB A;  1TK0 B;  4ZL7 A;  4ZBA A;  4J2F A;  2QKE A;  4Z2T A;  4K7O A;  4TXO A;  2GGT A;  2H19 A;  1YDK A;  2VD0 A;  3IDV A;  1BYE A;  4XRA A;  3TGZ A;  3TKR A;  2K8S A;  5DAL A;  5GSS A;  4KND A;  1ZMA A;  4L0U A;  2IMF A;  4EIQ A;  4O92 A;  4EL1 A;  2C3Q A;  4HI7 A;  2P31 A;  1SJI A;  3ERF A;  1GSF A;  3M9J A;  1SJZ A;  1O8X A;  1WIK A;  1ZYE A;  3CXG A;  3H1N A;  1ZOF A;  4DEJ A;  2V41 A;  4J57 E;  5KOW A;  4RUV A;  3VI5 A;  1WE0 A;  2MZC A;  1R4W A;  1F3A A;  3DVW A;  2HRK A;  3J7Y k;  2H74 A;  1Z7P A;  1N2A A;  2PVQ A;  1VF4 A;  4YQU A;  3KTB A;  4XS4 A;  3QFB C;  2DBC A;  4MZW A;  1NW2 A;  3F4S A;  2R5G A;  5IM9 A;  19GS A;  1A8L A;  5CYY A;  3FHK A;  1F2E A;  1SK1 A;  4EVM A;  2OA7 A;  4N30 A;  14GS A;  4I2T A;  3FK8 A;  1G0T A;  2K6V A;  3K8N A;  5DCH A;  3LW9 A;  2M80 A;  2H75 A;  2E0Q A;  2OBK A;  1JHB A;  3KZQ A;  4KSM A;  5J5N A;  3G9B A;  3VWV A;  1S3A A;  3A2V A;  5ECQ B;  1B4P A;  5DVB A;  3A3T A;  3LYP A;  3BOA A;  3ME7 A;  2H1D A;  3ISO A;  4WF5 A;  5IPH A;  2ALB A;  2NTO A;  2X49 A;  1G7O A;  3TCO A;  3EUR A;  3US3 A;  3FMW A;  1AIU A;  3M3M A;  1EZK A;  3EMX A;  1XOA A;  1V2A A;  3O76 A;  3VWX A;  2GSQ A;  2ES7 A;  1MD4 A;  1YQ1 A;  5DAK B;  2HXK A;  2XPD A;  1SK0 A;  2MMA A;  1JZW A;  2D2Z A;  1A23 A;  1BED A;  1PGT A;  2DJ3 A;  1JZO A;  4V1A p;  1JZD A;  3L78 A;  1O8W A;  1B4Q A;  1EOG A;  3F0I A;  3MWH A;  4FYB A;  2GSS A;  5CO3 A;  1W4V A;  2JZR A;  4HOJ A;  1M99 A;  3WGX A;  2XPE A;  4MF7 A;  1WP0 A;  2VCX A;  2MMO A;  5CAX A;  3HDC A;  2LJR A;  4I6X A;  1ZYN A;  3F3R A;  4G0L A;  1XVW A;  4PGT A;  4BWS A;  20GS A;  1FB0 A;  4N0V A;  2C0E A;  3TKS E;  1RQM A;  2HSH A;  3D0Z A;  4I97 A;  1TI3 A;  3ZFL A;  1GSS A;  2YV7 A;  3N9J A;  3CYN A;  3I6A A;  1FG4 A;  4WET A;  4LLR A;  2FUG 2;  5ECN B;  2YNX A;  1N8J A;  4H86 A;  4DSR A;  2VAF A;  5IMZ A;  2HI7 A;  3BCK A;  1OC9 A;  4EF0 A;  5DJM A;  4V2M A;  1XWB A;  5DAK A;  4OD7 A;  1T1V A;  4O7H A;  3TJB A;  4CY8 A;  1URM A;  2H0G A;  2E7P A;  2DMM A;  4Q5F A;  4GSS A;  3UAR A;  3ZYW A;  5IO2 A;  1PL2 A;  3KIJ A;  5FT3 A;  5FWG A;  4BIK A;  2ZUP A;  2IWT A;  2GT5 A;  2H72 A;  3F6D A;  2B6M A;  3L4N A;  4MK3 A;  4WR4 A;  2WUL A;  4USS A;  4V1A g;  3KEB A;  6GST A;  4MMM A;  4PUA A;  3GKN A;  3UL3 A;  2LQO A;  1EGO A;  2V6K A;  3ZZX A;  2H76 A;  4TR1 B;  2A2R A;  5GAN D;  6GSY A;  1ZL9 A;  3IXR A;  1Y25 A;  2PU9 C;  4YAP A;  4KX4 A;  4EUY A;  22GS A;  3QMX A;  3HVN A;  2O7K A;  4G19 A;  4AGS A;  5G5E A;  3HCZ A;  2H1B A;  4ISD A;  1YEP A;  1EV9 A;  4KA0 A;  1VRS D;  2AJQ B;  2HRA A;  3RBT A;  4EO3 A;  4BA7 A;  2CQ9 A;  3KMN A;  4O5U A;  3M0F A;  4FYC A;  1LJR A;  3IC8 A;  3VPQ A;  4MJE A;  3HA9 A;  3QFA C;  2PER A;  4XCS A;  3DGQ A;  1THX A;  3CSJ A;  2HFD A;  2B7K A;  4DSQ A;  4JR4 A;  1AQX A;  4MF5 A;  1U3I A;  2FA4 A;  4LA1 A;  1OC3 A;  4X43 A;  4KUN A;  2LJK A;  1HNC A;  1KBN A;  4EE0 A;  4ML6 A;  4I5Q A;  5IMF A;  4PX1 A;  4TR1 A;  1ML6 A;  4X0X A;  1YKC A;  4HU9 A;  4LMV A;  1EEM A;  1BJX A;  3KGK A;  5EPF A;  2EIO A;  3MNG A;  1XCC A;  4MJB A;  5LNK e;  3D4M A;  1AAZ A;  5JCW A;  4D73 A;  4EDY A;  1VF3 A;  2WJU A;  4KW6 A;  2BJX A;  3GX8 A;  2VOC A;  5AIV A;  4ECJ A;  2YJ7 A;  3TOU A;  2PVO C;  4N0Z A;  4MP4 A;  4OMV A;  1MDK A;  3RDW A;  4GTU A;  2F8A A;  4IHU A;  3HVS A;  4HSC X;  5HR3 A;  3E3E A;  3HJM A;  1TU7 A;  3S9F A;  4IJI A;  2VL9 A;  3C8E A;  4EKZ A;  1QMV A;  3DRN A;  1HNB A;  5F8B A;  1FOH A;  5IMC A;  3TUE A;  1JZR A;  1B48 A;  1T7P B;  3UMA A;  3QOU A;  1JLW A;  5FHI A;  2J9H A;  3HJO A;  1TKD B;  3N5O A;  1M2D A;  3M1G A;  3Q6O A;  1XWK A;  2UZ8 A;  4KCE A;  1O85 A;  4TR3 A;  1X9W B;  1TOF A;  2HNL A;  1K0M A;  5J9C A;  16GS A;  12GS A;  2KUC A;  2REM A;  2CZ2 A;  2WCI A;  4RQX A;  1YZX A;  4MPF A;  3EIN A;  1K3L A;  3DEX A;  5IMV A;  1U6T A;  1DBY A;  4NWY A;  3GSS A;  2IMK A;  2JL4 A;  3HVX A;  3HXS A;  2VCT A;  2QA2 A;  3W6G A;  2RM6 A;  3TRX A;  1F3B A;  4AF2 A;  3ZVJ D;  5HR0 A;  2WFC A;  5D9W A;  1F37 A;  1XFL A;  1XOB A;  5LCZ A;  2X64 A;  1EGR A;  1GNW A;  3FYG A;  2P5R A;  5F0G A;  1X9M B;  2OE3 A;  2PUK C;  1SKR B;  1C72 A;  1E2Y A;  3QPM A;  4V2N A;  1A24 A;  2B3S A;  2CZ3 A;  5HR2 A;  3P90 A;  4I2U A;  1RW1 A;  1Z5Y E;  3ZTL A;  2VL2 A;  4TXO B;  4NV2 A;  1M9B A;  1BX9 A;  2DLX A;  2DIZ A;  1J9B A;  1IYI A;  1TRV A;  1I9D A;  1SYX A;  5G5F A;  3AY8 A;  4L8E A;  5AIS A;  4IVF A;  3F8U A;  3M8N A;  1KTE A;  1ACV A;  1X5D A;  2GS3 A;  2I81 A;  1NM3 A;  4CHS A;  2JSY A;  1SKW B;  5IPG A;  3H79 A;  2O89 A;  4PQH A;  1YKA A;  4ZXG A;  2GZZ A;  2X8G A;  1USB A;  2C4J A;  1O73 A;  4Z2R A;  4CY6 A;  2FWE A;  1K3O A;  4HQZ A;  4GWR A;  5ECL B;  1TTZ A;  3FY7 A;  1J08 A;  2RUF A;  5CRG A;  4QL9 A;  4TRX A;  2OAC A;  5H5S A;  3GMF A;  5AIX A;  3D5J A;  2GVP A;  3IK7 A;  5AN1 A;  5A4U A;  1EWX A;  3TKS C;  1M9A A;  1YF0 A;  4BWQ A;  2DKI A;  6GSS A;  1AW9 A;  3VWW A;  2AV4 A;  2JZS A;  1OYJ A;  3SBC A;  4KE3 A;  4KGI A;  4ECI A;  4JR6 A;  17GS A;  2IJY A;  2QGV A;  1PD2 1;  5IOW A;  4MH3 A;  2YAN A;  1GUH A;  2LV3 A;  5ECP B;  1ERW A;  1K0D A;  2IFQ A;  1XPV A;  3H4K A;  1SD9 A;  5H5R A;  2R0C A;  1MTC A;  2K18 A;  2CVB A;  2TRX A;  4P3Y B;  1FO5 A;  1IYH A;  3UVH A;  3FZA A;  3ZML A;  5IIZ A;  2PPT A;  2FWG A;  4K9Z A;  2N5B A;  1GSQ A;  4ULX A;  1ZGN A;  5HR1 A;  2FLS A;  3QDN A;  1F9M A;  1W89 A;  4MZB A;  3O3T A;  5JWQ B;  3F9U A;  4WBR D;  3GIX A;  4KDY A;  3L9S A;  2VM2 A;  2FHE A;  2GLR A;  3RHB A;  1G6Y A;  3GL3 A;  1PQN A;  3WGD A;  2V2G A;  3KXO A;  2YOI A;  2L6C A;  2GDR A;  3VUR A;  2B5E A;  1G7E A;  3UBK A;  1ZYP A;  2H73 A;  2YWI A;  3F4R A;  3F4T A;  1B8X A;  2L4Q A;  3I43 A;  2KHP A;  1SK2 A;  4FQU A;  3VLN A;  3KD0 A;  2AB6 A;  3GN3 A;  4ID0 A;  3L9V A;  2WS2 A;  1QGV A;  1PKZ A;  2DKH A;  4DVC A;  5IOX A;  1X0R A;  4OCF A;  2CX4 A;  5B7C A;  4TOP A;  4MPG A;  1A0R P;  2CAI A;  2OJL A;  2HRN A;  4ACS A;  1KEB A;  1I5G A;  2PGT A;  1DUG A;  1OC9 B;  4OFN A;  1DE2 A;  3HVV A;  1EEJ A;  3F3Q A;  4TKY A;  4CDO A;  1T3B A;  3IV4 A;  2IMI A;  1OE7 A;  4E8H A;  4HUA A;  5B6N A;  1TJD A;  3CSI A;  4BPY A;  3RPN A;  1OVN A;  2FCH A;  3FR3 A;  3U5R E;  1XW5 A;  1HNA A;  2C3N A;  5B6M A;  3TRP A;  4PNF A;  4XHM A;  2LST A;  6GSU A;  2DML A;  2LRT A;  1ON4 A;  1GWC A;  2BMX A;  2A4V A;  4F9Z A;  4OO4 A;  1TDI A;  1GSY A;  3DVX A;  3GH6 A;  1PSQ A;  4HJM A;  5CRW A;  5KN2 A;  2QC7 A;  1GSD A;  1OKD A;  4HDE A;  5F05 A;  3FR9 A;  1NHY A;  5IO0 A;  2HRF A;  2GST A;  2HZF A;  1ZYQ B;  1BG5 A;  3E0U A;  5ECK B;  2C0D A;  2H30 A;  4GRF A;  5E4W A;  4MJC A;  11GS A;  1X5C A;  1ABA A;  2M46 A;  2YZU A;  3RPP A;  1XBS A;  1ZZY A;  7GSS A;  5KN3 A;  5CRE A;  2CVK A;  4KH7 A;  4KDU A;  1XW9 A;  5D8I A;  1FAA A;  1XIY A;  2ON5 A;  4IJ3 A;  4L5O A;  2H6Z A;  4K0G A;  2A4H A;  3KCM A;  4NMU A;  3PIN A;  4HJ2 A;  2GZP A;  3ZFB A;  4IS0 A;  4EIP A;  2IME A;  3FW2 A;  2B1L A;  2VLU A;  4I8B A;  3TOT A;  4NHW A;  3L0H A;  3GX0 A;  5INY A;  2JAD A;  4RQR A;  5J4U A;  4ZBD A;  1R7H A;  3DWV A;  3A5I A;  2YZH A;  2LUS A;  5ECH B;  1QUW A;  3CTG A;  3GL5 A;  4BL7 A;  8GSS A;  2NDO A;  1GUM A;  5AGY A;  4KB3 A;  2OE1 A;  3C1R A;  1QQ2 A;  3WYW A;  2YV9 A;  2GT6 A;  3G7I A;  2B5Y A;  4J56 E;  3DXB A;  2N5A A;  3P2A A;  4KSO A;  5G1L A;  2FWH A;  1H75 A;  1AC1 A;  1R5A A;  3DML A;  4GQC A;  1AQV A;  2HT9 A;  1K0C A;  2H66 A;  4POB A;  2IPA A;  2WGR A;  2X4A A;  4K7I A;  2VIM A;  3P8W A;  5H5Q A;  5C00 A;  2H6X A;  5BMU A;  5E59 A;  2A2S A;  1HYU A;  3CQF A;  2GSR A;  4IP6 A;  1SKS B;  4WBJ A;  2FGX A;  5J41 A;  4D73 B;  1GLP A;  1WWJ A;  1MEK A;  2XHF A;  2VL2 C;  3EWL A;  2PN8 A;  2WRT A;  3GKM A;  3LEF A;  3LFL A;  4IQ1 A;  3QR6 A;  4ECB A;  3EPT A;  2TRC P;  3TJJ A;  4K2D A;  2FY6 A;  5DDL A;  3FZ9 A;  3FEU A;  4LL4 B;  2DJ2 A;  2KOK A;  2J23 A;  3HD5 A;  5C04 A;  3CBU A;  4F0B A;  1V98 A;  1PL1 A;  2AAW A;  4ZB9 A;  2EIR A;  4Q5Q A;  1E6B A;  4ICY A;  1FB6 A;  1MDI A;  3UBL A;  5ECS A;  4L0W A;  4LMW A;  2R2J A;  3M9K A;  4RI6 A;  4TN8 A;  4PQ1 A;  1HD2 A;  3DIE A;  3LQ7 A;  2O8V B;  3F63 A;  1NSW A;  2N5F A;  1EV4 A;  2XBQ A;  5ABR A;  1UA5 A;  3I69 A;  5IQY A;  4JRR A;  3KH7 A;  2VD1 A;  5EY6 A;  4L5L A;  1X5E A;  1QK8 A;  3VI7 A;  2QSI A;  3VWU A;  2GQL A;  2H1G A;  1TRW A;  2NBS A;  3HKR A;  3VFI A;  3GRX A;  2C0F A;  5B8A A;  1PA3 A;  3MYD A;  1GSU A;  2X8H A;  2H8L A;  2LJA A;  4HZ2 A;  4Z2U A;  4POM A;  5GST A;  2GTU A;  1R5P A;  2RM5 A;  2K8V A;  4BVX B;  2JAC A;  3VK9 A;  2HE3 A;  3Q18 A;  4GQF A;  1QFN A;  2I1U A;  2B7J A;  2GZY A;  1KNG A;  3GV1 A;  3LG6 A;  1SEN A;  2DJJ A;  1A8Y A;  2RLI A;  3P7X A;  2B5X A;  1GRX A;  3HJP A;  1X9S B;  3ED3 A;  3UOM A;  1VF1 A;  4BVY A;  4EDZ A;  4YH2 A;  4HQS A;  1B9Y C;  5L71 A;  5GAP D;  1T00 A;  4IEL A;  4YQM A;  2YWN A;  3FR6 A;  3IBH A;  2Z9S A;  3SWL A;  3BJ5 A;  3CRU A;  4DSS B;  1SL1 B;  1Y6E A;  2MYG A;  1M2A A;  3V1W A;  1GL8 A;  4F03 A;  3APO A;  3IC4 A;  2B1K A;  4V2L A;  3L9U A;  2G0F A;  1CQH A;  1K0A A;  3UEM A;  1TRU A;  3KJY A;  2PWJ A;  1ERU A;  1F6M C;  3GST A;  1Z6M A;  3MDK A;  5ECR B;  3KP9 A;  3D4T A;  3KMO A;  3DD3 A;  4OFT A;  2LKU A;  4BVX A;  2C1Y A;  4IBP A;  2E2M A;  5D9X A;  2CVD A;  3RAZ A;  3ZLP A;  1V58 A;  4IGJ A;  4K7N A;  4QQ7 A;  4JED A;  4GSN A;  4TR0 A;  1HQO A;  4PUR A;  3GYK A;  1R26 A;  2IFQ B;  2R4V A;  1ERT A;  3FZ5 A;  1GLQ A;  1YEX A;  5IMA A;  2R0G A;  10GS A;  4OCE A;  3Q74 A;  1LBK A;  3APS A;  4OWY A;  2JZT A;  5DQS A;  2XBI A;  1UC7 A;  1MD3 A;  1WPI A;  3PH9 A;  4ML1 A;  2BTO T;  2LQQ A;  2LTK A;  3I9V 2;  2MMZ A;  5G2Z A;  3A5W A;  1TW9 A;  4EXJ A;  4DSS A;  3BD2 A;  4MF6 A;  1PFO A;  5ID2 B;  3ZRE A;  4N11 A;  2LNT A;  2JSZ A;  2H0I A;  2VUP A;  1FVJ A;  3VPT A;  3LOR A;  3WD6 A;  1OKT A;  3U6V A;  1WOU A;  1S3D A;  5A4W A;  3TKQ A;  1J0F A;  4HS1 A;  1VGL A;  5ECM B;  1UVZ A;  1XVQ A;  2LRC A;  2JU5 A;  1K0N A;  3PR8 A;  4G9H A;  3LSZ A;  3H93 A;  4MAB A;  3MSZ A;  4XIH A;  3PPU A;  2X8C A;  4JE1 A;  2ON7 A;  5D93 A;  3EE2 A;  5J9B A;  3DKS A;  2H01 A;  4Q5R A;  4ZIL A;  2O87 A;  3PGT A;  1ERV A;  4FIW A;  2X99 A;  3ZIJ A;  1SL0 B;  2WDU A;  2VCV A;  2HSM A;  2F9S A;  6GSV A;  1Z7R A;  1NHO A;  3O6T A;  4XS1 A;  4MA9 A;  4G10 A;  1YF1 A;  2OKA A;  1GUL A;  3J7Y b;  2C80 A;  5ID2 A;  3TDG A;  5D9T A;  5D9V A;  4ECC A;  4GF0 A;  2I4A A;  5KN1 A;  4PXO A;  1DE1 A;  4RI7 A;  4PUF C;  1ILO A;  1M3I A;  4MJA A;  1K0O A;  3ZL5 A;  4IP1 A;  1XG8 A;  3D6I A;  4ZBB A;  2WB9 A;  2L59 A;  2LNS A;  4KF9 A;  1PMT A;  3IOS A;  3GFK A;  3UAP A;  2FA8 A;  4K6X A;  5JCU A;  1GTU A;  2AHE A;  3A2W A;  2CX3 A;  6GSX A;  5ENU A;  4WR5 A;  5HFK A;  2VM1 A;  1O81 A;  1YY7 A;  2KP2 A;  4K0N A;  2R3X A;  4HZ4 A;  1U3A A;  3RHC A;  4K8M A;  3EU3 A;  1GNE A;  2KLX A;  2GQM A;  4YKG A;  2CA8 A;  3R2Q A;  1SD8 A;  3F6F A;  3EU4 A;  3NOF A;  5DQY A;  3NZN A;  4JBB A;  3GKX A;  3W8J A;  3C7M A;  4POL A;  1GTI A;  2DSA A;  1PRX A;  4G2E A;  2YP6 A;  3IPZ A;  5F06 A;  1JLV A;  2R6K A;  1JFU A;  4XRD A;  3G7J A;  2R0P A;  2HYX A;  3NIV A;  4BL7 B;  1Q4J A;  4WKW A;  5CNW A;  2OAD A;  1Q98 A;  3GUR A;  3HY2 A;  2IN3 A;  3IAS 2;  2YJH A;  1SYR A;  3GKK A;  1EP8 A;  4YAV A;  2MBS A;  5EVO A;  4FYU A;  2H0H A;  4MCU A;  3MIX A;  5A5K A;  1DSB A;  13GS A;  3ME8 A;  2ZNM A;  3HZ4 A;  2H70 A;  1TP9 A;  1U88 A;  5COH A;  3LXT A;  1S3R A;  3DYR A;  3UJ1 A;  2VCZ A;  3ERW A;  4TR4 A;  3MAK A;  1WJK A;  1XWG A;  1H4O A;  1CQG A;  1THO A;  3QAW A;  3A2X A;  3TJG A;  2P0G A;  5ECO B;  5G1K A;  5G31 A;  2YCD A;  3TKS A;  4MNN A;  4O32 A;  4TW5 A;  4O5R A;  3HYP A;  1FVK A;  5D73 A;  2FD3 A;  4MZC A;  4ZL9 A;  4O5Q A;  4X1U A;  2C3T A;  2H1A A;  2RUE A;  1OAZ A;  3IE3 A;  5JCG A;  4N10 A;  3EYT A;  4PTS A;  2CAQ A;  1V57 A;  2VLV A;  2VCQ A;  1GP1 A;  4MDC A;  9GSS A;  1T4Z A;  2F8F A;  1UN2 A;  4XS6 A;  5HFG A;  4X4J A;  18GS A;  4G0I A;  4K5R A;  5DBQ A;  3C1S A;  4KAE A;  5IMD A;  1YJ6 A;  5CP1 A;  2FWF A;  5DCG A;  2LRN A;  2G2Q A;  1FOV A;  4PNG A;  1RK4 A;  4F2I A;  3ZIT A;  5EL8 A;  1SL2 B;  5DJL A;  2ZCT A;  3TRQ A;  1FW1 A;  1VF2 A;  4G0K A;  2PBJ A;  4ZIJ A;  5CRH A;  1PKW A;  1AQW A;  2I3Y A;  2IIY A;  4IW9 A;  4A5P A;  2HZE B;  2WZ9 A;  3FKF A;  5ECI B;  3GTU B;  4NV5 A;  4XTS A;  2V32 A;  2CT6 A;  3HHV A;  2F51 A;  1SJ6 A;  1M0U A;  3R3E A;  5GZZ B;  4GST A;  2L4C A;  5F07 A;  1OC8 A;  3ZMK A;  2TIR A;  2O85 A;  2DJ0 A;  3ZRD A; 
#chains in the Genus database with same CATH homology
 3TJF A;  3FZ4 A;  4Q5N A;  4TXV A;  3IA1 A;  4KDX A;  1TK8 B;  1PX6 A;  3IAM 2;  4JU5 A;  3KTL A;  1EP7 A;  1K0B A;  4NXI A;  2IL3 A;  1XZO A;  3EMP A;  1GSE A;  3GH9 A;  2DJK A;  2LS5 A;  4AJ7 A;  2FNO A;  1GTA A;  3QAV A;  4F0C A;  1O7U A;  3LXZ A;  5KEJ A;  4NHZ A;  1MDJ A;  1ZCP A;  1K3Y A;  3QD9 A;  5ELG A;  3OR5 A;  3E9J B;  1TRS A;  3IHQ A;  4BVY B;  5J3R A;  3UIW A;  1OE8 A;  4OO5 A;  2QA1 A;  3JCM L;  4GCI A;  1XXU A;  1LU4 A;  3ERG A;  1Z9H A;  2H71 A;  4WXT A;  3IK9 A;  1O6J A;  3C71 A;  4PQI A;  5JWO B;  3LWA A;  3IR4 A;  2EC4 A;  3ZVJ A;  4LL1 B;  2HZE A;  4HEA 2;  3GTU A;  2PMT A;  1BAY A;  4NAX A;  2R37 A;  2KP1 A;  5JWR B;  4Z7X A;  3EC3 A;  1U87 A;  1V40 A;  2M72 A;  2XC2 A;  1S3C A;  3Q19 A;  6GSW A;  1PN9 A;  5LD0 A;  4KCA A;  3GNJ A;  2MBT A;  2DJ1 A;  3EVI A;  4GXZ A;  1WMJ A;  2C0G A;  1GUK A;  2AYT A;  3KP8 A;  4AJ8 A;  1FHE A;  1XW6 A;  3ZIV A;  2VCW A;  1A0F A;  2V6O A;  2V1M A;  3CRT A;  1EOH A;  3QCP A;  3CSH A;  4K5S A;  1M2B A;  2CV4 A;  1TU8 A;  1GTB A;  5BRT A;  1ST9 A;  2L6D A;  3D21 A;  4ZL8 A;  2OE0 A;  3LYK A;  2DIY A;  3CMI A;  4OFM A;  4WEY A;  3G7Y A;  3D22 A;  3IHG A;  4ZB8 A;  1TXX A;  1A2L A;  4IKH A;  4NPB A;  5B8B A;  4MH2 A;  4HU7 A;  1T8E B;  5KOX A;  3BBY A;  2AUV A;  1WRY A;  4IN0 A;  3LGC A;  1Z6N A;  4TVE A;  1SU9 A;  2VL3 A;  2DC5 A;  2A2P A;  1XWA A;  2OBI A;  3GUS A;  2L5L A;  4F82 A;  3GHA A;  5HQP A;  2NVL A;  3TJK A;  5A4V A;  2L57 A;  1XWC A;  4EC0 A;  4FH8 A;  3APQ A;  1T4Y A;  3UVT A;  3W8S A;  3WT2 A;  2VLT A;  3GA4 A;  4ILF A;  4YQV A;  1M7T A;  2E2G A;  3H8Q A;  3FRC A;  2LEG A;  1QXH A;  2YWM A;  4IQA A;  4YKF A;  1AXD A;  2VO4 A;  3KH9 A;  1PX7 A;  4POK A;  3KM6 A;  2HLS A;  5G30 A;  4K1F A;  4JZQ A;  1BQ7 A;  1GH2 A;  4K2X A;  2C8U A;  2GQK A;  5DAL B;  2HSY A;  1TI1 A;  1V9W A;  4E8E A;  3CTF A;  1PN0 A;  5D96 A;  2EIQ A;  2IMD A;  4QL7 A;  5CRD A;  4WF4 A;  3IRA A;  5ELA A;  1AUC A;  2YWO A;  2MMN A;  3TKP A;  3LJR A;  5KN0 A;  1B9X C;  3WGE A;  3BCI A;  1Z3E A;  2K9F A;  2H6Y A;  2P5Q A;  3TB2 A;  1A2M A;  3HZ8 A;  4MLY A;  3QAG A;  1G6W A;  4GLT A;  2YPM A;  2L5O A;  1TK5 B;  4AJ6 A;  5HFI A;  4XS4 B;  1A2J A;  4FO5 A;  2F3M A;  2YN1 A;  3C73 A;  2I9H A;  4CW9 A;  2RII A;  4ZB6 A;  3WT1 A;  2NPB A;  1TK0 B;  4ZL7 A;  4ZBA A;  4J2F A;  2QKE A;  4Z2T A;  4K7O A;  4TXO A;  2GGT A;  2H19 A;  1YDK A;  2VD0 A;  3IDV A;  1BYE A;  4XRA A;  3TGZ A;  3TKR A;  2K8S A;  5DAL A;  5GSS A;  4KND A;  1ZMA A;  4L0U A;  2IMF A;  4EIQ A;  4O92 A;  4EL1 A;  2C3Q A;  4HI7 A;  2P31 A;  1SJI A;  3ERF A;  1GSF A;  3M9J A;  1SJZ A;  1O8X A;  1WIK A;  1ZYE A;  3CXG A;  3H1N A;  1ZOF A;  4DEJ A;  2V41 A;  4J57 E;  5KOW A;  4RUV A;  3VI5 A;  1WE0 A;  2MZC A;  1R4W A;  1F3A A;  3DVW A;  2HRK A;  3J7Y k;  2H74 A;  1Z7P A;  1N2A A;  2PVQ A;  1VF4 A;  4YQU A;  3KTB A;  4XS4 A;  3QFB C;  2DBC A;  4MZW A;  1NW2 A;  3F4S A;  2R5G A;  5IM9 A;  19GS A;  5CYY A;  1A8L A;  3FHK A;  1F2E A;  1SK1 A;  4EVM A;  2OA7 A;  4N30 A;  14GS A;  4I2T A;  3FK8 A;  1G0T A;  2K6V A;  3K8N A;  5DCH A;  3LW9 A;  2M80 A;  2H75 A;  2E0Q A;  2OBK A;  1JHB A;  3KZQ A;  4KSM A;  5J5N A;  3G9B A;  3VWV A;  1S3A A;  3A2V A;  5ECQ B;  1B4P A;  5DVB A;  3A3T A;  3LYP A;  3BOA A;  3ME7 A;  2H1D A;  3ISO A;  4WF5 A;  5IPH A;  2ALB A;  2NTO A;  2X49 A;  1G7O A;  3TCO A;  3EUR A;  3US3 A;  3FMW A;  1AIU A;  3M3M A;  1EZK A;  3EMX A;  1XOA A;  1V2A A;  3O76 A;  3VWX A;  2GSQ A;  2ES7 A;  1MD4 A;  1YQ1 A;  5DAK B;  2HXK A;  2XPD A;  1SK0 A;  2MMA A;  1JZW A;  2D2Z A;  1A23 A;  1BED A;  1PGT A;  2DJ3 A;  1JZO A;  4V1A p;  1JZD A;  3L78 A;  1O8W A;  1B4Q A;  1EOG A;  3F0I A;  3MWH A;  4FYB A;  2GSS A;  5CO3 A;  1W4V A;  2JZR A;  4HOJ A;  1M99 A;  3WGX A;  2XPE A;  4MF7 A;  1WP0 A;  2VCX A;  2MMO A;  5CAX A;  3HDC A;  2LJR A;  4I6X A;  1ZYN A;  3F3R A;  4G0L A;  1XVW A;  4PGT A;  4BWS A;  20GS A;  1FB0 A;  4N0V A;  2C0E A;  3TKS E;  1RQM A;  2HSH A;  3D0Z A;  4I97 A;  1TI3 A;  3ZFL A;  1GSS A;  2YV7 A;  3N9J A;  3CYN A;  3I6A A;  1FG4 A;  4WET A;  4LLR A;  2FUG 2;  5ECN B;  2YNX A;  1N8J A;  4H86 A;  4DSR A;  2VAF A;  5IMZ A;  2HI7 A;  3BCK A;  1OC9 A;  4EF0 A;  5DJM A;  4V2M A;  1XWB A;  5DAK A;  4OD7 A;  1T1V A;  4O7H A;  3TJB A;  4CY8 A;  1URM A;  2H0G A;  2E7P A;  2DMM A;  4Q5F A;  4GSS A;  3UAR A;  3ZYW A;  5IO2 A;  1PL2 A;  3KIJ A;  5FT3 A;  5FWG A;  2ZUP A;  2IWT A;  2GT5 A;  2H72 A;  3F6D A;  2B6M A;  3L4N A;  4MK3 A;  4WR4 A;  2WUL A;  4USS A;  4V1A g;  3KEB A;  6GST A;  4MMM A;  4PUA A;  3GKN A;  3UL3 A;  2LQO A;  1EGO A;  2V6K A;  3ZZX A;  2H76 A;  4TR1 B;  2A2R A;  5GAN D;  6GSY A;  1ZL9 A;  3IXR A;  1Y25 A;  2PU9 C;  4YAP A;  4KX4 A;  4EUY A;  22GS A;  3QMX A;  2O7K A;  4G19 A;  4AGS A;  5G5E A;  3HCZ A;  2H1B A;  4ISD A;  1YEP A;  1EV9 A;  4KA0 A;  1VRS D;  2AJQ B;  2HRA A;  3RBT A;  4EO3 A;  4BA7 A;  2CQ9 A;  3KMN A;  4O5U A;  3M0F A;  4FYC A;  1LJR A;  3IC8 A;  3VPQ A;  4MJE A;  3HA9 A;  3QFA C;  2PER A;  4XCS A;  3DGQ A;  1THX A;  3CSJ A;  2HFD A;  2B7K A;  4DSQ A;  4JR4 A;  1AQX A;  4MF5 A;  1U3I A;  2FA4 A;  4LA1 A;  1OC3 A;  4X43 A;  4KUN A;  2LJK A;  1HNC A;  1KBN A;  4EE0 A;  4ML6 A;  4I5Q A;  5IMF A;  4PX1 A;  4TR1 A;  1ML6 A;  4X0X A;  1YKC A;  4HU9 A;  4LMV A;  1EEM A;  1BJX A;  3KGK A;  5EPF A;  2EIO A;  3MNG A;  1XCC A;  4MJB A;  5LNK e;  3D4M A;  1AAZ A;  5JCW A;  4D73 A;  4EDY A;  1VF3 A;  2WJU A;  4KW6 A;  2BJX A;  3GX8 A;  2VOC A;  5AIV A;  4ECJ A;  2YJ7 A;  3TOU A;  2PVO C;  4N0Z A;  4MP4 A;  4OMV A;  1MDK A;  3RDW A;  4GTU A;  2F8A A;  4IHU A;  3HVS A;  5HR3 A;  3E3E A;  3HJM A;  1TU7 A;  3S9F A;  4IJI A;  2VL9 A;  3C8E A;  4EKZ A;  1QMV A;  3DRN A;  1HNB A;  5F8B A;  1FOH A;  5IMC A;  3TUE A;  1JZR A;  1B48 A;  1T7P B;  3UMA A;  3QOU A;  1JLW A;  5FHI A;  2J9H A;  3HJO A;  1TKD B;  3N5O A;  1M2D A;  3M1G A;  3Q6O A;  1XWK A;  2UZ8 A;  4KCE A;  1O85 A;  4TR3 A;  1X9W B;  1TOF A;  2HNL A;  1K0M A;  5J9C A;  16GS A;  12GS A;  2KUC A;  2REM A;  2CZ2 A;  2WCI A;  4RQX A;  1YZX A;  4MPF A;  3EIN A;  1K3L A;  3DEX A;  5IMV A;  1U6T A;  1DBY A;  4NWY A;  3GSS A;  2IMK A;  2JL4 A;  3HVX A;  3HXS A;  2VCT A;  2QA2 A;  3W6G A;  2RM6 A;  3TRX A;  1F3B A;  4AF2 A;  3ZVJ D;  5HR0 A;  2WFC A;  5D9W A;  1F37 A;  1XFL A;  1XOB A;  5LCZ A;  2X64 A;  1EGR A;  1GNW A;  3FYG A;  2P5R A;  5F0G A;  1X9M B;  2OE3 A;  2PUK C;  1SKR B;  1C72 A;  1E2Y A;  3QPM A;  4V2N A;  1A24 A;  2B3S A;  2CZ3 A;  5HR2 A;  3P90 A;  4I2U A;  1RW1 A;  1Z5Y E;  3ZTL A;  2VL2 A;  4TXO B;  4NV2 A;  1M9B A;  1BX9 A;  2DLX A;  2DIZ A;  1J9B A;  1IYI A;  1TRV A;  1I9D A;  1SYX A;  5G5F A;  3AY8 A;  4L8E A;  5AIS A;  4IVF A;  3F8U A;  3M8N A;  1KTE A;  1ACV A;  1X5D A;  2GS3 A;  2I81 A;  1NM3 A;  4CHS A;  2JSY A;  1SKW B;  5IPG A;  3H79 A;  2O89 A;  4PQH A;  1YKA A;  4ZXG A;  2GZZ A;  2X8G A;  1USB A;  2C4J A;  1O73 A;  4Z2R A;  4CY6 A;  2FWE A;  1K3O A;  4HQZ A;  4GWR A;  5ECL B;  1TTZ A;  3FY7 A;  1J08 A;  2RUF A;  5CRG A;  4QL9 A;  4TRX A;  2OAC A;  5H5S A;  3GMF A;  5AIX A;  3D5J A;  2GVP A;  3IK7 A;  5AN1 A;  5A4U A;  1EWX A;  3TKS C;  1M9A A;  1YF0 A;  4BWQ A;  2DKI A;  6GSS A;  1AW9 A;  3VWW A;  2AV4 A;  2JZS A;  1OYJ A;  3SBC A;  4KE3 A;  4KGI A;  4ECI A;  4JR6 A;  17GS A;  2IJY A;  2QGV A;  1PD2 1;  5IOW A;  4MH3 A;  2YAN A;  1GUH A;  2LV3 A;  5ECP B;  1ERW A;  1K0D A;  2IFQ A;  1XPV A;  3H4K A;  1SD9 A;  5H5R A;  2R0C A;  1MTC A;  2K18 A;  2CVB A;  2TRX A;  4P3Y B;  1FO5 A;  1IYH A;  3UVH A;  3FZA A;  3ZML A;  5IIZ A;  2PPT A;  2FWG A;  4K9Z A;  2N5B A;  1GSQ A;  4ULX A;  1ZGN A;  5HR1 A;  2FLS A;  3QDN A;  1F9M A;  1W89 A;  4MZB A;  3O3T A;  5JWQ B;  3F9U A;  4WBR D;  3GIX A;  4KDY A;  3L9S A;  2VM2 A;  2FHE A;  2GLR A;  3RHB A;  1G6Y A;  3GL3 A;  1PQN A;  3WGD A;  2V2G A;  3KXO A;  2YOI A;  2L6C A;  2GDR A;  3VUR A;  2B5E A;  1G7E A;  3UBK A;  1ZYP A;  2H73 A;  2YWI A;  3F4R A;  3F4T A;  1B8X A;  2L4Q A;  3I43 A;  2KHP A;  1SK2 A;  4FQU A;  3VLN A;  3KD0 A;  2AB6 A;  3GN3 A;  4ID0 A;  3L9V A;  2WS2 A;  1QGV A;  1PKZ A;  2DKH A;  4DVC A;  5IOX A;  1X0R A;  4OCF A;  2CX4 A;  5B7C A;  4TOP A;  4MPG A;  1A0R P;  2CAI A;  2OJL A;  2HRN A;  4ACS A;  1KEB A;  1I5G A;  2PGT A;  1DUG A;  1OC9 B;  4OFN A;  1DE2 A;  3HVV A;  1EEJ A;  3F3Q A;  4TKY A;  4CDO A;  1T3B A;  3IV4 A;  2IMI A;  1OE7 A;  4E8H A;  4HUA A;  5B6N A;  1TJD A;  3CSI A;  4BPY A;  3RPN A;  1OVN A;  2FCH A;  3FR3 A;  3U5R E;  1XW5 A;  1HNA A;  2C3N A;  5B6M A;  3TRP A;  4PNF A;  4XHM A;  2LST A;  6GSU A;  2DML A;  2LRT A;  1ON4 A;  1GWC A;  2BMX A;  2A4V A;  4F9Z A;  4OO4 A;  1TDI A;  1GSY A;  3DVX A;  3GH6 A;  1PSQ A;  4HJM A;  5CRW A;  5KN2 A;  2QC7 A;  1GSD A;  1OKD A;  4HDE A;  5F05 A;  3FR9 A;  1NHY A;  5IO0 A;  2HRF A;  2GST A;  2HZF A;  1ZYQ B;  1BG5 A;  3E0U A;  5ECK B;  2C0D A;  2H30 A;  4GRF A;  5E4W A;  4MJC A;  11GS A;  1X5C A;  1ABA A;  2M46 A;  2YZU A;  3RPP A;  1XBS A;  1ZZY A;  7GSS A;  5KN3 A;  5CRE A;  2CVK A;  4KH7 A;  4KDU A;  1XW9 A;  5D8I A;  1FAA A;  1XIY A;  2ON5 A;  4IJ3 A;  4L5O A;  2H6Z A;  4K0G A;  2A4H A;  3KCM A;  4NMU A;  3PIN A;  4HJ2 A;  2GZP A;  3ZFB A;  4IS0 A;  4EIP A;  2IME A;  3FW2 A;  2B1L A;  2VLU A;  4I8B A;  3TOT A;  4NHW A;  3L0H A;  3GX0 A;  5INY A;  2JAD A;  4RQR A;  5J4U A;  4ZBD A;  1R7H A;  3DWV A;  3A5I A;  2YZH A;  2LUS A;  5ECH B;  1QUW A;  3CTG A;  3GL5 A;  4BL7 A;  8GSS A;  2NDO A;  1GUM A;  5AGY A;  4KB3 A;  2OE1 A;  3C1R A;  1QQ2 A;  3WYW A;  2YV9 A;  2GT6 A;  3G7I A;  2B5Y A;  4J56 E;  3DXB A;  2N5A A;  3P2A A;  4KSO A;  5G1L A;  2FWH A;  1H75 A;  1AC1 A;  1R5A A;  3DML A;  4GQC A;  1AQV A;  2HT9 A;  1K0C A;  2H66 A;  4POB A;  2IPA A;  2WGR A;  2X4A A;  4K7I A;  2VIM A;  3P8W A;  5H5Q A;  5C00 A;  2H6X A;  5BMU A;  5E59 A;  2A2S A;  1HYU A;  2GSR A;  4IP6 A;  1SKS B;  4WBJ A;  2FGX A;  5J41 A;  4D73 B;  1GLP A;  1WWJ A;  1MEK A;  2XHF A;  2VL2 C;  3EWL A;  2PN8 A;  2WRT A;  3GKM A;  3LEF A;  3LFL A;  4IQ1 A;  3QR6 A;  4ECB A;  3EPT A;  2TRC P;  3TJJ A;  4K2D A;  2FY6 A;  5DDL A;  3FZ9 A;  3FEU A;  4LL4 B;  2DJ2 A;  2KOK A;  2J23 A;  3HD5 A;  5C04 A;  3CBU A;  4F0B A;  1V98 A;  1PL1 A;  2AAW A;  4ZB9 A;  2EIR A;  4Q5Q A;  1E6B A;  4ICY A;  1FB6 A;  1MDI A;  3UBL A;  5ECS A;  4L0W A;  4LMW A;  2R2J A;  3M9K A;  4RI6 A;  4TN8 A;  4PQ1 A;  1HD2 A;  3DIE A;  3LQ7 A;  2O8V B;  3F63 A;  1NSW A;  2N5F A;  1EV4 A;  2XBQ A;  5ABR A;  1UA5 A;  3I69 A;  5IQY A;  4JRR A;  3KH7 A;  2VD1 A;  5EY6 A;  4L5L A;  1X5E A;  1QK8 A;  3VI7 A;  2QSI A;  3VWU A;  2GQL A;  2H1G A;  1TRW A;  2NBS A;  3HKR A;  3VFI A;  3GRX A;  2C0F A;  5B8A A;  1PA3 A;  3MYD A;  1GSU A;  2X8H A;  2H8L A;  2LJA A;  4HZ2 A;  4Z2U A;  4POM A;  5GST A;  2GTU A;  1R5P A;  2RM5 A;  2K8V A;  4BVX B;  2JAC A;  3VK9 A;  2HE3 A;  3Q18 A;  4GQF A;  1QFN A;  2I1U A;  2B7J A;  2GZY A;  1KNG A;  3GV1 A;  3LG6 A;  1SEN A;  2DJJ A;  1A8Y A;  2RLI A;  3P7X A;  2B5X A;  1GRX A;  3HJP A;  1X9S B;  3ED3 A;  3UOM A;  1VF1 A;  4BVY A;  4EDZ A;  4YH2 A;  4HQS A;  1B9Y C;  5L71 A;  5GAP D;  1T00 A;  4IEL A;  4YQM A;  2YWN A;  3FR6 A;  3IBH A;  2Z9S A;  3SWL A;  3BJ5 A;  3CRU A;  4DSS B;  1SL1 B;  1Y6E A;  2MYG A;  1M2A A;  3V1W A;  1GL8 A;  4F03 A;  3APO A;  3IC4 A;  2B1K A;  4V2L A;  3L9U A;  2G0F A;  1CQH A;  1K0A A;  3UEM A;  1TRU A;  3KJY A;  2PWJ A;  1ERU A;  1F6M C;  3GST A;  1Z6M A;  3MDK A;  5ECR B;  3KP9 A;  3D4T A;  3KMO A;  3DD3 A;  4OFT A;  2LKU A;  4BVX A;  2C1Y A;  4IBP A;  2E2M A;  5D9X A;  2CVD A;  3RAZ A;  3ZLP A;  1V58 A;  4IGJ A;  4K7N A;  4QQ7 A;  4JED A;  4GSN A;  4TR0 A;  1HQO A;  4PUR A;  3GYK A;  1R26 A;  2IFQ B;  2R4V A;  1ERT A;  3FZ5 A;  1GLQ A;  1YEX A;  5IMA A;  2R0G A;  10GS A;  4OCE A;  3Q74 A;  1LBK A;  3APS A;  4OWY A;  2JZT A;  5DQS A;  2XBI A;  1UC7 A;  1MD3 A;  1WPI A;  3PH9 A;  4ML1 A;  2BTO T;  2LQQ A;  2LTK A;  3I9V 2;  2MMZ A;  5G2Z A;  3A5W A;  1TW9 A;  4EXJ A;  4DSS A;  3BD2 A;  4MF6 A;  5ID2 B;  3ZRE A;  4N11 A;  2LNT A;  2JSZ A;  2H0I A;  2VUP A;  1FVJ A;  3VPT A;  3LOR A;  3WD6 A;  1OKT A;  3U6V A;  1WOU A;  1S3D A;  5A4W A;  3TKQ A;  1J0F A;  4HS1 A;  1VGL A;  5ECM B;  1UVZ A;  1XVQ A;  2LRC A;  2JU5 A;  1K0N A;  3PR8 A;  4G9H A;  3LSZ A;  3H93 A;  4MAB A;  3MSZ A;  4XIH A;  3PPU A;  2X8C A;  4JE1 A;  2ON7 A;  5D93 A;  3EE2 A;  5J9B A;  3DKS A;  2H01 A;  4Q5R A;  4ZIL A;  2O87 A;  3PGT A;  1ERV A;  4FIW A;  2X99 A;  3ZIJ A;  1SL0 B;  2WDU A;  2VCV A;  2HSM A;  2F9S A;  6GSV A;  1Z7R A;  1NHO A;  3O6T A;  4XS1 A;  4MA9 A;  4G10 A;  1YF1 A;  2OKA A;  1GUL A;  3J7Y b;  2C80 A;  5ID2 A;  3TDG A;  5D9T A;  5D9V A;  4ECC A;  4GF0 A;  2I4A A;  5KN1 A;  4PXO A;  1DE1 A;  4RI7 A;  4PUF C;  1ILO A;  4MJA A;  1K0O A;  3ZL5 A;  4IP1 A;  3D6I A;  4ZBB A;  2WB9 A;  2L59 A;  2LNS A;  4KF9 A;  1PMT A;  3IOS A;  3GFK A;  3UAP A;  2FA8 A;  4K6X A;  5JCU A;  1GTU A;  2AHE A;  3A2W A;  2CX3 A;  6GSX A;  5ENU A;  4WR5 A;  5HFK A;  2VM1 A;  1O81 A;  1YY7 A;  2KP2 A;  4K0N A;  2R3X A;  4HZ4 A;  1U3A A;  3RHC A;  4K8M A;  3EU3 A;  1GNE A;  2KLX A;  2GQM A;  4YKG A;  2CA8 A;  3R2Q A;  1SD8 A;  3F6F A;  3EU4 A;  3NOF A;  5DQY A;  3NZN A;  4JBB A;  3GKX A;  3W8J A;  3C7M A;  4POL A;  1GTI A;  2DSA A;  1PRX A;  4G2E A;  2YP6 A;  3IPZ A;  5F06 A;  1JLV A;  2R6K A;  1JFU A;  4XRD A;  3G7J A;  2R0P A;  2HYX A;  3NIV A;  4BL7 B;  1Q4J A;  4WKW A;  5CNW A;  2OAD A;  1Q98 A;  3GUR A;  3HY2 A;  2IN3 A;  3IAS 2;  2YJH A;  1SYR A;  3GKK A;  1EP8 A;  4YAV A;  2MBS A;  5EVO A;  4FYU A;  2H0H A;  4MCU A;  3MIX A;  5A5K A;  1DSB A;  13GS A;  3ME8 A;  2ZNM A;  3HZ4 A;  2H70 A;  1TP9 A;  1U88 A;  5COH A;  3LXT A;  3DYR A;  3UJ1 A;  2VCZ A;  3ERW A;  4TR4 A;  3MAK A;  1WJK A;  1XWG A;  1H4O A;  1CQG A;  1THO A;  3QAW A;  3A2X A;  3TJG A;  2P0G A;  5ECO B;  5G1K A;  5G31 A;  2YCD A;  3TKS A;  4MNN A;  4O32 A;  4TW5 A;  4O5R A;  3HYP A;  1FVK A;  5D73 A;  2FD3 A;  4MZC A;  4ZL9 A;  4O5Q A;  4X1U A;  2C3T A;  2H1A A;  2RUE A;  1OAZ A;  3IE3 A;  5JCG A;  4N10 A;  3EYT A;  4PTS A;  2CAQ A;  1V57 A;  2VLV A;  2VCQ A;  1GP1 A;  4MDC A;  9GSS A;  1T4Z A;  2F8F A;  1UN2 A;  4XS6 A;  5HFG A;  4X4J A;  18GS A;  4G0I A;  4K5R A;  5DBQ A;  3C1S A;  4KAE A;  5IMD A;  1YJ6 A;  5CP1 A;  2FWF A;  5DCG A;  2LRN A;  2G2Q A;  1FOV A;  4PNG A;  1RK4 A;  4F2I A;  3ZIT A;  5EL8 A;  1SL2 B;  5DJL A;  2ZCT A;  3TRQ A;  1FW1 A;  1VF2 A;  4G0K A;  2PBJ A;  4ZIJ A;  5CRH A;  1PKW A;  1AQW A;  2I3Y A;  2IIY A;  4IW9 A;  4A5P A;  2HZE B;  2WZ9 A;  3FKF A;  5ECI B;  3GTU B;  4NV5 A;  4XTS A;  2V32 A;  2CT6 A;  3HHV A;  2F51 A;  1SJ6 A;  1M0U A;  3R3E A;  5GZZ B;  4GST A;  2L4C A;  5F07 A;  1OC8 A;  3ZMK A;  2TIR A;  2O85 A;  2DJ0 A;  3ZRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...