3GX9A

Structure of morphinone reductase n189a mutant in complex with tetrahydronad
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
369
structure length
364
Chain Sequence
NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAAAACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Morphinone reductase
publication title Parallel Pathways and Free-Energy Landscapes for Enzymatic Hydride Transfer Probed by Hydrostatic Pressure
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 134
structure length 364
sequence length 369
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gx9A00
1TPEA 1LP6A 3HB9A 2ISWA 1AW2A 3O63A 4NVTA 3NXFA 1GG0A 4MKNA 5KZDA 3RK8A 3PSWA 2PURA 1WAUA 1W3NA 5FF3A 3FEMA 3O15A 4MZYA 4CLMA 1QWGA 2E6FA 1TJRA 3BG9A 3NPUA 1GWJA 1WBJA 5G1YA 1I8JA 1ML1A 1ALDA 2EAWA 3L66A 3ABQA 1TV8A 2RDUA 4ORMA 3BG5A 4O28A 2E5BA 1OF8A 3HPZA 1DJNA 1TPVA 3Q94A 3NQ6A 3W76A 4ZVJA 4K36A 4O4VA 3S9YA 3QMRA 3SJ3A 2VFIA 2C16A 4NNAA 3M0ZA 1H7XA 3LGEA 3W7NA 5DELA 4IUOA 2QCDA 3LCHA 5AHIA 1W56A 4RZ4A 2V2CA 4FO4A 2A4AA 4UFKA 4M7SA 5EKYA 4L4LA 1GOXA 4JYFA 4P2VA 3PAJA 2RHGA 4DBEA 3QH2A 1ICPA 2G5WA 2ABAA 4LW7A 3VE7A 3C52A 5DCBA 1TYGA 1QCWA 4AWUA 1OJXA 4RK8A 1BWLA 1K7FA 3G1VA 3FIGA 3Q58A 1Z42A 2Y7EA 3UPWA 4JTGA 3F4NA 2Q3RA 4DF1A 2OX1A 4O17A 4AF0A 3F03K 3W1MA 4FNQA 4JR5A 3E0IA 2B4GA 3O6CA 2A7NA 2GQAA 3P74A 3MMTA 4GUFA 1Q6RA 3W2NA 1TJPA 3HIJA 4U28A 1LRNA 2WPBA 1KV5A 3DAQA 1SUXA 3UZJA 4FEZA 4LVGA 1EEPA 3M1ZA 4EOUA 1VRDA 4ADTA 1ZNNA 1ADOA 4X2RA 3DFSA 2NZLA 4X3ZA 5AFDA 5K9CA 5D09A 2C3ZA 4UNLA 1NFBA 4YXGA 2J9XA 1VGAA 1A5AA 1X7FA 5BRBA 1OYAA 4JDBA 4MZ8A 1TB3A 3NQ8A 1OX4A 3HO8A 3HBLA 3EX2A 1O94A 2FPVA 1F2JA 5T26A 3A5VA 8TIMA 2GPTA 2NXHA 3P82A 2HTMA 4NQ1A 4IXHA 1TPFA 1K03A 2ABBA 1TREA 5HUPA 3LCWA 2WV8A 2A0NA 1WOAA 3NGJA 2C19A 4K37A 3LV5A 3FA5A 3TFXA 1LBLA 2Q8LA 1WOBA 5BW6A 5F1VA 3LXCA 4WJEA 4KFNA 3UWYA 1XUUA 4QSHA 3IRDA 2B7PA 4LTSA 4A22A 3A9IA 4H6KA 5EPDA 4Y8FA 2FQIA 1ZCOA 3M16A 3EKLA 5FESA 3VNDA 3JS3A 1UBSA 1W5PA 1ME8A 2X1TA 3PY2A 4ALDA 1LTDA 4MPQA 3OIXA 2CW6A 1I2OA 3LTSA 1G7VA 5CGQA 4Z1AA 3LI1A 3NZRA 4RJEA 2ZRYA 2QCDB 1FDZA 5AHNA 3RMJA 4TIMA 1H7WA 4AH7A 3ELFA 3CWNA 1BTMA 4MFDA 3GLCA 5AC6A 3BLEA 2QCNA 3MUXA 3W7MA 4CQAA 4IPJA 3GR7A 3W1TA 2XN0A 4XWUA 4JYDA 4UFHA 1KM6A 3IIPA 4AF0B 1V7YA 1WBHA 4TMBA 4W9TA 3UNDA 5AB3A 2GJNA 1FWSA 1G4TA 4UTWA 4MIMA 4TMCA 3LXBA 3IGXA 3Q37A 1DVJA 3W23A 3G1AA 3C2VA 4LY8A 2DP3A 3T55A 1KM5A 1OFBA 4DPPA 5KZEA 1KA9F 5LZLA 4MVAA 1A50A 3WK1A 3NNTA 4IMFA 1AL7A 3B4UA 1FUYA 3CIXA 1JQVA 3W74A 1VYSX 4LT9A 3TSMA 1QPQA 1JJKA 1OX4B 2AAMA 4O4WA 1I2RA 2EPHA 1P5BA 3WJXA 2G96A 3CEUA 4GUIA 1SO3A 4QAIA 1JQXA 4CQ9A 2ALDA 2JKEA 2Z6JA 3MW7A 2V5BA 1UASA 3S0CA 2FTPA 4JTFA 3W6YA 4ZQRA 3QW4B 2YW4A 1R47A 5F1UA 3L2IA 1LOSA 3ANYA 3P81A 3SFKA 4K7YA 2Z0IA 1HTIA 2NXGA 1L6SA 5IBXA 4LRSA 3TCEA 1KLZA 4N4QA 2A85A 3STFA 3WJSA 1L9WA 3SI9A 5C6MA 1FDYA 3O8AA 5LHFA 2E09A 4N9EA 3C2EA 3E12A 1O4UA 3HF3A 5DCEA 1VZWA 3EWZA 2QCGA 1FWRA 1GVFA 1HG3A 1QPRA 2FJKA 1KM3A 5DXYA 4HHPA 1X6UA 5AYZA 1YPFA 1L6WA 1ME7A 3U6WA 4HNTA 3KVMA 4JYEA 2CLHA 3UYCA 1MO0A 4Y9AA 3IGUA 4ZQCA 3ABOA 3EWBX 2CFFA 4WZHA 1DQXA 2QUVA 4RV8A 3S5YA 3CHVA 2W6RA 2WSRA 5AHFA 3TIMA 2A2IA 1G67A 4JS3A 1QOPA 4RR4A 3G8RA 4OQVA 1GQNA 1GYLA 1F74A 2CLOA 2E5DA 1EX5A 3NG3A 1YLVA 4UTTA 2R8WA 4LS2A 5ABTA 1ZAIA 1VJIA 3G0XA 1H51A 2FPYA 1SZEA 1Q45A 3DHDA 5MHBA 3QF0A 1TPUA 5I3FA 3ZFHA 3O06A 1XC4A 2VEMA 4PA8A 3KX6A 3VFLA 1KFJA 4UMCA 5LHEA 2R94A 5KSWA 1VLWA 5D37A 3BO9A 1VQTA 1D9EA 2C1HA 4NJHA 3THAA 4WY0A 1W54A 3WK0A 4IPIA 5LGZA 1MEIA 1SW3A 2ZDRA 2QCFA 4A2RA 4BF9A 4XQ6A 5LNWA 4NXKA 5C5YA 1EWEA 2TRSA 5KZMA 3CM4A 4OHQA 1SU5A 4O10A 4O0KA 1JUEA 3WK3A 3MJYA 2BLEA 3M41A 4JTTA 2ZRZA 3L5MA 1VYRA 3O1NA 2ZA3A 4K39A 2ZZ1A 1DKWA 1KV8A 1WQ5A 2Y85A 5AC7A 4CNNA 4JD4A 2GJLA 5TBOA 5L6UA 3C56A 3LLFA 1P0NA 3PSVA 1K3UA 2V30A 4UFLA 2IQTA 1UUMA 2ZRVA 4PFMA 3KRSA 4BWLC 1XBZA 3JR2A 1HO4A 4N9BA 4M19A 1W37A 4MJMA 3TMQA 3IIXA 4MUZA 2ZZ6A 1PCKA 2RFGA 3O16A 4R34A 4XZ9A 4JTHA 1TSIA 4QQ3A 4WOZA 4EWND 3W2LA 4XTIA 1EB3A 2A1YA 1RZMA 3CIWA 4FXRA 1F6KA 2FPTA 3IVTA 3FYPA 4BK9A 1S5WA 2I1OA 2Z1BA 4UR8A 5EL1A 3G1SA 3TQVA 5FEWA 1F05A 1VC4A 2J24A 5FEZA 5KMYA 4Q32A 3HQ1A 3NQFA 4UXDA 4P61A 5D05A 1GVQA 2C14A 1DHPA 1OYBA 4I9AA 4AHOA 3M5XA 2CU0A 2TPSA 5HINA 3DI1A 4Z0JA 2D73A 2QCCA 2OJPA 3NPVA 2DZTA 4O1AA 4S2CA 2A6NA 4PL2A 4GE8A 5KINA 2F7FA 3NM3A 4GUHA 3M5YA 5D38A 4N9DA 2PRLA 3UWUA 2HSAA 4GJ1A 4WY0B 1QMLA 3QC3A 5LKYA 1WDWA 1JCNA 3C2FA 4KFPA 3A22A 2VFDA 3NL6A 1GTHA 3QMSA 1W5QA 2CZ5A 4PCFA 4MJZA 1ZJIA 1DV7A 3LCGA 4NX5A 3GZ3A 1KFCA 4A29A 1YYAA 4E0CA 4K8EA 3L21A 4OGZA 4FNPA 2QDGA 4UR7A 3TU9A 3OG3A 1QO5A 2YCEA 5H2ZA 2PRMA 4IWWA 3W1RA 1DORA 3E02A 3PM6A 1QR7A 4HNNA 5AOUA 4NJGA 3RFAA 1TPH1 4RZ6A 4YCOA 2V2DA 1LORA 1T0OA 4FF7A 2JK2A 4O8RA 4C1KA 3W7IA 5G4EA 3T44A 1P1XA 4RX0A 3IV3A 4LUIA 3NQEA 1C8VA 4AAJA 2WJZA 4TU1A 3CEPA 4IJBA 4O19A 5KTLA 5FEXA 2QCLA 3W87A 2JBMA 1IGSA 3TDFA 4GFSA 4MLJA 1P0KA 3R5EA 3TXVA 4NJKA 1SPQA 1EA0A 4ZQOA 2VFFA 4HN4A 4JNMA 5I3HA 4KWVA 4GWEA 1W5OA 1H5YA 4BI6A 3DZ1A 4CNOA 1JUKA 1OHLA 1RQEA 3P80A 3W7EA 3W84A 4HKPA 3C61A 1U5JA 3HGJA 1EUAA 3R13A 3P84A 5K7JA 1LBFA 1X8FA 1XCFA 4IMCA 3W3OA 4BFAA 3EB2A 3KFTA 3PB2A 2P10A 3DFNA 5BMXA 4L4MA 2DU2A 4IGHA 2VEPA 3DI0A 3TC7A 1KTBA 4KWWA 1QPOA 3HGOA 1LOLA 4LWWA 3W86A 4CCDA 3ABRA 4FNRA 2ATMA 3L5LA 3PWAA 4S2BA 1ONRA 3NO5A 3W2UA 4RXFA 4RXGA 3HOJA 3LBMA 2R14A 3ATYA 4FNSA 5I3IA 2ZZ7A 3QSRA 5FEPA 5FF2A 1Y0EA 3FLUA 3STGA 1H62A 2X30A 5I3KA 3MI6A 2ISSA 3VI2A 1GPWA 5EMUA 1G4EA 3LX9A 3M5ZA 1EP2A 2V0TA 2XN1A 3SR7A 4UMAA 1JCLA 2BSLA 4CCCA 1W1ZA 5C54A 2TMDA 1THFD 1SZFA 1H63A 3O6DA 4Z1CA 5BOOA 1GTEA 3V75A 1H60A 4AB4A 5G2WA 1RQHA 1XI3A 4WUIA 5CZ0A 3GXTA 3TQKA 3CLMA 1NSJA 2Y6ZA 3DKJA 1F7BA 2Y70A 5EBUA 2QUTA 4UFIA 3NQMA 1KM4A 4DEFA 2WQPA 5BMWA 3IVSA 3N14A 1DOSA 3QW3A 1K7EA 3P8JA 4GRSA 4CNPA 5F4WA 1QAPA 3O05A 4NNBA 3C3NA 4N02A 1OVDA 4JICA 1M7OA 2X1RA 3NQDA 3TFCA 5D03A 1AL8A 2KZHA 3MWAA 4YMZA 3QPYA 3SGZA 4JTEA 1TTQA 5CSRA 3LLDA 3KRZA 3PUOA 4AWSA 2PE4A 3LI0A 5D30A 3TQ0A 4E38A 1L6YA 3LTPA 3NQAA 4JIPA 3C4UA 1LDCA 3W7RA 1ZAJA 2YSWA 3CWOX 1V5XA 3EXRA 1YDOA 4XBSA 4HNUA 1GT8A 3BK0A 4MY1A 2X1UA 1MEHA 2JGYA 4X22A 3EWYA 1EPXA 4O52A 4G1KA 2Y7GA 3QPZA 1OFQA 3W1UA 5AHMA 3WFAA 3VKJA 1GVOA 1TPDA 5SWUA 3QJAA 4JX6A 1A5SA 5DBUA 1OFRA 2ZYFA 1W3TA 3GK0A 2NV2A 1YPIA 3R8RA 4RKAA 3NPWA 1W5NA 4GUJA 3STEA 2E1DA 2ZZ3A 4MZ1A 3L68A 3SGUA 1VYPX 3BARA 4EIVA 3G3MA 3PG9A 3RU6A 1HO1A 3HMJG 1PHWA 3EX4A 5LNVA 4RCXA 5G4WA 4RLIA 1QDSA 5D2XA 5TQLA 4YLWA 3PULA 4IOTA 3WJZA 2Y7DA 3KRUA 4UTKA 3KVJA 1VCFA 3S1WA 4WY0F 4OV4A 2CZDA 2X16A 2C18A 5U7SA 1KFBA 2ZTJA 3PBUA 3S1UA 1GYNA 4O18A 3ZS4A 4GUGA 3W72A 2H8XA 5E93A 4PL1A 1XUZA 3G3DA 1XBVA 3W88A 5CZTA 3GX9A 3MP5A 4WX2A 4LS0A 1RPXA 1A5BA 3S6DA 3DFOA 3TSDA 3LRMA 2YFOA 2WSYA 1FQ0A 1CX9A 4NXSA 2CLFA 2JGQA 4XBKA 3CTLA 4A2SA 5LSMA 1H1ZA 5BNKA 3S1VA 1AK5A 4TX9A 4D2JA 3W1QA 4DQWA 4IMGA 2A5HA 3P60A 4PODA 3L0KA 1OFDA 4WOQA 1YXDA 3TJLA 1OFEA 3DXIA 2NUYA 1W0MA 1RR2A 1VCVA 3LRLA 5HQEA 4ZZ9A 1I2PA 3O6YX 1FWWA 3MP3A 1IIHA 3R2GA 4M5PA 4NX0A 3M6YA 1LBMA 5A8GA 4B5NA 3NEVA 2FFCA 3BGGA 3NOEA 4M6QA 4JN6A 4JXCA 1Q6LA 2B0MA 1T96A 5LGXA 3L0GA 4O53A 2WNNA 2GQ9A 1XFBA 2E6AA 3QQ1A 5E1QA 4KFOA 3HGRA 3GIYA 5HR6A 1UCWA 4LU0A 2CLEA 3IIOA 3LCLA 3NYZA 1R2TA 5D02A 5CG7A 1AMKA 4OE7A 4Y6GA 2J9YA 2J27A 2ZRXA 4XKYA 3TJXA 2E5CA 3UXDA 3H54A 2E6DA 3QZEA 4O50A 2A7PA 3P5YA 4ZQNA 5LNRA 4QNEA 4OBTA 2BWGA 2B7NA 1WYIA 1NF7A 4O54A 3QQ0A 1XXXA 1S3HA 3M44A 3EKZA 3UY7A 4Y96A 3W22A 4GXMA 2Z6IA 1H7NA 1KLYA 3MYPA 4AHQA 5AYXA 1OF6A 2PCQA 4FHAA 4HNVA 4Q33A 3W75A 5HNRA 1QFEA 5AHLA 1NAL1 4M7TA 4Q4KA 4LRTA 2BX7A 3GR8A 5C55A 4WXZA 3AJXA 4O14A 4FIQA 3FYOA 1SZNA 5DCDA 3A5FA 1OK6A 3QYQA 4NJJA 3UZ5A 4IX0A 1G6CA 4ICNA 4NU7A 5LNUA 1SW7A 4FIRA 3W9ZA 2UV8G 4O13A 2A7RA 3N2MA 5K9DA 2PRHA 3LCFA 1IXPA 4UTLA 1HFBA 4IX2A 3G0UA 4LC8A 1RV8A 1VPXA 2LLEA 1EP3A 3ZWTA 3PG8A 3PBVA 3JRKA 4WQ6A 3GDMA 5C2XA 2ZRUA 1K7XA 1YTDA 1XDMA 1Q6QA 7TIMA 5D04C 3U8GA 3A23A 1XBXA 3GNNA 3Q2DA 5HUOA 5K4ZA 3A21A 4O0ZA 4AVFA 1KBJA 2WSQA 4GBUA 2GVLA 5F4XA 4BR1A 4N4PA 2QEZA 1SQ7A 2J9ZA 4K6AA 2ZCGA 3NR0A 3VCRA 3B06A 3LHYA 1FCQA 3QMTA 3GAYA 2G95A 4MY9A 3FJ6A 4ML9A 1TQJA 2V9DA 3S5OA 1YDVA 2YDAA 3FJLA 2XN2A 3B0PA 4JTSA 5F4SA 4OT7A 2E77A 3G1YA 4DO4A 4JTKA 2QKFA 3G8EA 1RVGA 1PCWA 4UFJA 4XKYB 2YYUA 4ORIA 3USBA 1JR1A 1H7RA 2E6YA 2DORA 3HG3A 2DZSA 4ZL1A 2WNZA 4QJ1A 4BWLA 3I6RA 3LDVA 1SSGA 1ZY9A 4UTHA 1AG1O 1HUVA 2WO5A 1F6PA 1QOQA 2OZ0A 1G4SA 4JEQA 2Y62A 3OA3A 3T7VA 4FX8A 1JRCA 3S8HA 3TV8A 1R2RA 3LHZA 3MBFA 1LZOA 1L2UA 1M5WA 2GQ8A 1TCDA 4K7VA 1PV8A 2I9EA 3BW2A 1JCYA 3I7QA 1SZGA 4POCA 3G1HA 1QO2A 2CLIA 2GOUA 3QSTA 3W1NA 3L0NA 3P7YA 2VFEA 4N9CA 2GVJA 3GXNA 2J88A 2BTMA 2NUWA 2Q3OA 4U4MA 4JY9A 1ZHAA 4HPXA 5J5RA 1JUBA 4AMAA 3CU2A 1I2NA 2EHHA 4XTDA 3UPBA 4N6FA 4FB7A 3BV4A 1OFOA 1PVNA 2CLMA 1IF2A 3NQ2A 5CPOA 3NL5A 1WA3A 1NEYA 1YTKA 2YR1A 5H91A 1KFEA 3OVQA 4MFEA 1LROA 4HPJA 4HT3A 3DFTA 3TW7A 3KHJA 1OABA 1WXJA 2EGZA 4ZMGA 1OYCA 3PUDA 3T40A 5AYYA 3P67A 1J5TA 1UB3A 2NUXA 4YWIA 2C13A 3LM7A 3W71A 3C2RA 4DO6A 1XBYA 2H3DA 1TPB1 4KKXA 3NAVA 3MHUA 1U83A 2DZVA 4UTMA 5F2MA 4IMDA 2DJXA 1H50A 4ZQPA 3LV6A 4S1FA 3WJYA 2CWNA 1UUOA 3O07A 4C1LA 3W7JA 1PHQA 1NVMA 3PUEA 3GYEA 4AXKA 3DFPA 3WJWA 1X1ZA 1FCBA 2YGYA 2HMCA 1KM2A 2O7SA 4JY8A 5DY3A 4N6EA 1GVSA 5CZJA 1C9DA 5HJLA 4MYAA 5EYWA 2FDSA 1R46A 2Z2UA 4O57A 2NV1A 1JCMP 3W7LA 3MI2A 1KW1A 2QR6A 3B05A 1GZGA 1TO3A 4MOZA 4FX7A 3C2OA 3W2MA 3L9CA 3TX9A 1IXOA 3W1AA 1GEQA 1VS1A 4QM1A 3V1PA 5FI8A 2V2HA 4UMBA 3BW4A 1LRQA 3NZ1A 2QAPA 5AHEA 3PBWA 2Q8ZA 2R91A 2YW3A 3W1LA 1HL2A 1TRDA 4NZFA 5CPNA 3DGRA 1T99A 2ZA1A 1FWNA 5CZSA 3TE9A 4LC6A 2VC6A 3R12A 1SO5A 3LCIA 3CQ0A 2NWRA 4DF0A 3DU0A 4O1DA 1TQXA 3LRKA 2NX1A 2H3BA 1GG1A 1TPWA 3LHVA 3CPRA 3WK2A 1VHCA 3S1XA 3W70A 3CB8A 1MXSA 1OFAA 3M43A 1B4KA 1JRBA 3SIZA 3TR2A 2ZFAA 3UD6A 3HPSA 4BI5A 3GB6A 4I7UA 4LVFA 1OG0A 3W7OA 5AC8A 1FXQA 2FIQA 1PL9A 3DFQA 4GNJA 2WKJA 1SFJA 3NDOA 1Z44A 4XUGA 3E9AA 3F1QA 1YTEA 1VCGA 1I4NA 4QIUA 4AEOA 4AWTA 4FX6M 4R7JA 1K8XA 2QF7A 2VEKA 5IM51 2XFWA 3DHFA 2OT1A 3OVRA 4LS1A 4NT0A 3UWVA 1N7KA 1VHNA 3G22A 3TAOA 5K9XA 1FWTA 4TR9A 3RLVA 1UJPA 2AGKA 4DPQA 2C0AA 3LTYA 3W7QA 2BXVA 2O7QA 2W79A 4MLRA 1JCJA 1P4CA 2QDHA 1ZAHA 1QNVA 3KVKA 5CPLA 1ME9A 3DENA 2CZFA 2JKPA 4FXSA 1EUNA 1GVRA 3GXPA 3STCA 1M6JA 3FKKA 5TIMA 1BEUA 3N2XA 4LNYA 1BWKA 2FLIA 3GKAA 2BZNA 1J2WA 3MI3A 3ZWSA 3I68A 2C6QA 3SW6A 1XDLA 1O5XA 3TA6A 5U4NA 5DY2A 2TSYA 2OT0A 3PC0A 1AW1A 5I3GA 3YPIA 1DL3A 1DQWA 3GVGA 4HIBA 3B0UX 3PS7A 5K4XA 3TKFA 2QAFA 2NX9A 3B8DA 3EWUA 4I7WA 5D2WA 1YADA 2Y7FA 3NQGA 3TUUA 1GJPA 1FCUA 3NA8A 5L9FA 2CLLA 4R33A 2DZPA 4NUWA 1ICSA 2J6XA 3EX1A 5LNSA 4J9JA 3G1DA 6TIMA 3QM3A 1N55A 2VFGA 3P5ZA 3GKFA 4OWGA 5E0KA 4O16A 1FXPA 2QJHA 5DN1A 3TC6A 1I2QA 3LHUA 3HG5A 2OCZA 3S5NA 4I7VA 2F84A 1K8YA 3FKRA 2VEIA 3R89A 3SSJA 3W73A 3W7DA 1LOQA 2H8ZA 3N34A 3UWWA 3TMLA 3BGJA 2YFNA 3ABSA 1DBTA 3T78A 1XL9A 4YL2A 2X2GA 3BW3A 3EWXA 5HWJA 3NQ7A 1MEWA 4CQ8A 4JX5A 3P8IA 1KM1A 2QUUA 3HGSA 1W8SA 3UQNA 3GAKA 5G5IA 3FS2A 5K3VA 5DBTA 1KTCA 3PBYA 4FNUA 1SO6A 3M47A 3OBKA 4LVAA 1XKYA 4ZQMA 4R53A 3D0CA 5HR7A 2I14A 1TPC1 1RD5A 3UY8A 4ADUA 4GC4A 4QNWA 3PF3A 4E2DA 3QFEA 4Z1BA 5GVJA 1SW0A 2DZWA 5D2YA 1OK4A 2VENA 3C8FA 2FB3A 5CPMA 3ZR4A 2Y61A 1S5VA 4Z08A 3E49A 3LCXA 1H61A 2Y63A 1FDJA 1K8ZA 2YZRA 1FCVA 3W1XA 1TTPA 1F73A 3EX3A 3IEBA 1A53A 4Y90A 3MP4A 4UFMA 4UTUA 1VH7A 3UWQA 4IXXA 3W7GA 1TTJA 1I45A 3QRHA 4UNKA 4ADSA 2QCHA 3GDLA 3TK7A 3LERA 3IIZA 1LLWA 1D3GA 1G4PA 1JVNA 3ATZA 3N73A 1E51A 3NQCA 3BLFA 4O1BA 3S5ZA 5D33A 3GNDA 1B4EA 5D32A 1OX6A 1VLIA 3OVPA 1EP1A 1N8FA 4OV9A 3GDKA 3KAOA 2E68A 3LXAA 1TTIA 2QJIA 5F2GA 6ALDA 3BLIA 4JGDA 1JULA 4N2YA 3C6CA 4Z0SA 4MYXA 4UTWC 2DZUA 5G2HA 1B9BA 5F2LA 1W5MA 2A21A 4E2BA 5FF4A 3NQVA 1LLZA 2ISVA 1Z48A 3W85A 1H7PA 5FF0A 1IIGA 2FB2A 3LBCA 2NLIA 3G24A 3PVFA 2HS6A 3LHWA 4K8HA 1A5CA 3EWWA 2QJGA 3T4CA 4A3UA 5G1TA 3BG3A 3RLUA 1LCOA 4HSOA 4DXVA 3N9RA 4EVZA 3DBPA 4OU1A 2VOMA 4JTJA 1TV5A 2V81A 3W83A 4WD0A 1F76A 2V82A 4DF2A 1YXCA 2YYTA 3M5VA 2Y89A 2H90A 1MSSA 4LOCA 2DZXA 4O15A 1O95A 4PEKA 3RNDA 1YXYA 2YXGA 1RQBA 5HWNA 3TW6A 5IBXC 5HWMA 3MO7A 3THQA 2NXIA 4DELA 1B3OA 1Q3NA 3C0JA 3TAKA 4O11A 2ATSA 2QCMA 2RH9A 4UTIA 1IXQA 1SSDA 3BVJA 1FX6A 3N19B 2C15A 1FBAA 3W7HA 4IMEA 2GVGA 2TYSA 3EXTA 4JX4A 4MY8A 4UIOA 1G69A 1H7OA 3TXZA 1LM1A 2B7OA 5I3JA 1TMHA 2RDWA 3N3MA 5G2IA 1EWDA 3P62A 4JTLA 1ZALA 4UTTC 1W3IA 1H1YA 4BI7A 1W31A 3MHGA 1ICQA 3CC1A 5D2TA 3B0VC 1B57A 4LVDA 3KXQA 1O5KA 2ZQ0A 3EXSA 2PC4A 4LV4A 3IIVA 3AO0A 3TH6A 3W7PA 2JKAA 2P1FA 2X1SA 1QPNA 4UTJA 1PIIA 3LHTA 3NVTA 5KITA 2P0OA 3NL2A 1Q6OA 4PTNA 1OX5A 1T8XA 5FF7A 1F5ZA 4H4IA 3I7RA 1EIXA 3U2OA 3SECA 1XM3A 4JDYA 4H3DA 5J5DA 1MZHA 3OHIA 4JIQA 5HMSA 3G1FA 4DBDA 4EF8A 2WNQA 3S42A 4JTIA 2ZRWA 3PR2A 2GUUA 4UUIA 1PE1A 3CT7A 1KM0A 3W2JA 1ZENA 2ZBTA 2ZZ5A 3RF9A 3L67A 4IQLA 4PH6A 5K2ZA 3P61A 1NF0A 4PC8A 4TO8A 1R30A 3GDRA 1TV7A 1DJQA 3MYOA 1ZFJA 5F2IA 5D2VA 1SFLA 3W2KA 5AN7A 1BKSA 1PS9A 3QEZA 1O60A 1R2SA 2B7QA 4WXYA 3W7CA 2V8ZA 4Z1DA 3NM1A 3B04A 3H55A 5CSSA 4ONVA 1C29A 3VE9A 4O12A 3DH7A 4AHPA 3K30A 4LUJA 1IXNA 2AQWA 1FY6A 2NWSA 3N9SA 4EF9A 1WV2A 2G97A 3EEGA 4K38A 3MHFA 3HG2A 1K02A 2YPIA 3M7WA 1G7UA 2CZEA 3EX6A 3DKLA 1X1OA 4JTUA 3L65A 3W07A 5DXXA 1OFPA 1TIMA 4DO5A 1KBIA 3G18A 3OEXA 3TSBA 1JCXA 3B03A 3HG4A 4UC5A 3KVLA 2QCEA 3IGSA 3E96A 4UCGA 3IVUA 3INPA 1KFKA 3FFSA 4M6PA 4NNCA 3MBDA 1TRIA 3BPWA 4HSNA 2WOQA 2CLKA 2EF9A 1D3HA 2V5LA 3HJZA 1SR9A 3NPXA 4O1CA 1KFLA 3KOFA 2EKCA 4YCPA 4LV9A 4CCEA 5HULA 4FNTA 2HS8A 2RKXA 3G1XA 5DLCA 1YDNA 2VELA 2VFHA 5A5WA 2YX0A 3A24A 3PB0A 3TNOA 2ZA2A 4QISA 1KTNA 3UXAA 4LVBA 2ZTKA 1AW5A 4QITA 4X9SA 4M6VA 3I7SA 2RDTA 1SO4A 1CI1A 3NL3A 3I65A 3SZ8A 3FOKA 3HPXA 3LOTA 5CKSA 3F4WA 1WX0A 1M7PA 3G0SA 2DJLA 1VR6A 4RZ5A 3H53A 2VKZG 2W0UA 3SY5A 2NX3A 3M9YA 3TROA 1Z41A 2VXNA 3L5AA 3GDTA 1LRTA 2ZZ4A 3W1PA 1LYXA 3W7KA 1S5TA 2Y88A 4NJIA 3UWZA 2OMAA 2A6LA 2ZZ2A 3LB0A 1J4EA 4A21A 2H6RA 1CW2A 5EA9A 5EY5A 4NZJA
chains in the Genus database with same CATH superfamily
1LP6A 3HB9A 4AX6A 1T8QA 4NVTA 1KRAC 3POCA 5HJYA 1GG0A 4MKNA 3G5EA 4YYFA 3KUMA 4AZCB 1ISWA 1HX0A 2PURA 2Z1WA 3RX2A 2P76A 4ZB0A 3WQPA 5FF3A 1VFSA 4B5WA 3UJSA 2GDUA 3MZ2A 3NPUA 3ZIZA 4W89A 4PN2A 4HTBA 3L66A 2EAWA 4L4OA 1TV8A 1HJVA 1T5AA 1J10A 4HVXA 3BTNA 3E3HA 3KBSA 2E5BA 3HPZA 1DJNA 2Q8XA 3I4KA 3NQ6A 4RW3A 2X8RA 3E2SA 4O4VA 2CBIA 3S9YA 1PYMA 4H7CA 3LBOA 3LGEA 3W7NA 1V02A 4ZFMA 5M2FX 4IUOA 5AHIA 1H49A 2X2YA 4PCPA 4UFKA 4JBRA 4MWAA 5AC5A 4M7SA 4L4LA 1MUWA 4JYFA 2QT3A 2ABAA 3S2JA 3IARA 1P0BA 2CHOA 3PFMA 1OJXA 4JTDA 1K7FA 2Y7EA 4H6EA 3UPWA 2VVNA 1V79A 3ARZA 2OX1A 4O17A 4BQ3A 3K1DA 3NTYA 4JKLA 3E0IA 6CGTA 3MMTA 3LMZA 4GUFA 4Q4SA 3A64A 2WPBA 3HMCA 4FEZA 4LVGA 1BVZA 2QDEA 4MDPA 4PMOA 3T2QA 3SCTA 1ISVA 4ATWA 1ADOA 3UZWA 3S4TA 3TA9A 4X3ZA 5AFDA 4IGSA 2C3ZA 1SR0A 1OC7A 4WDWA 4MZ8A 4MB1A 3EX2A 4IJRA 3UWEA 1XLLA 3S47A 1FOBA 2J62A 1W9BM 3QZAA 7XIMA 1RJQA 3P82A 4NQ1A 1FFQA 1RH9A 1S2VA 3MUIA 1H0GA 6REQA 3WBAA 3O9NA 1EZ2A 3PTMA 2QXWA 3NGJA 3TFXA 2VM8A 1WOBA 2J7DA 3LXCA 3B8UA 4XVDA 2I5IA 5E6YA 3UWYA 2EPLX 3CMFA 3K4DA 2E0PA 3PZMA 4EACA 4A22A 4Y8FA 2FQIA 3B8IA 2I5GA 2PMQA 5FESA 2I56A 1ME8A 3THCA 3VKAA 3ARQA 2A3CA 3GTFA 5CGQA 2PWHA 4Z1AA 6ENLA 4WF7A 1IEXA 4CQCA 4MWAB 2DSVA 3CLWA 4GGBA 1UWUA 1H7WA 1ZP3A 3CWNA 1BTMA 1V3LA 2DT0A 1YNQA 2HK0A 3GLCA 1UPPA 3BLEA 5AC6A 1EKOA 4CQAA 1FP8A 3K1GA 1FWJC 2XN0A 4XWUA 4JYDA 4L64A 1KM6A 4I8YA 2FTWA 1V7YA 3UNDA 4AQLA 3IUIA 3U9IA 3UG3A 4TMCA 4H6RA 3IGXA 1H3GA 3Q37A 3GTXA 3C2VA 2ZE0A 3T55A 1XLDA 3CNYA 3MJMA 2PF8A 3TW9A 1KA9F 2W63A 2IQDA 2WC7A 2BHYA 3SN0A 4NRRA 2CCRA 4GFIA 3KDNA 3PTKA 3DFHA 3CIXA 3CTTA 3W74A 3PBGA 1LQ0A 1XLAA 2E67A 2OGJA 4LT9A 2INEA 1EOKA 3NIYA 4W8BA 2E40A 4O4WA 3E2VA 4GUIA 5CH9A 2VR2A 4QAIA 1JQXA 3MW7A 2V5BA 2J7GA 3S0CA 3W6YA 4GQQA 4ZQRA 6REQB 3ANYA 4S3FA 2QUMA 4XZLX 4LAZA 2CXEA 3NYDA 4KS0A 3C0SA 3TCEA 2C0HA 2A85A 5B7ZA 4JPGA 3H70A 4LAOA 3TN4A 3AMLA 4DO7A 5LHFA 3FVDA 2E09A 1LT8A 3C2EA 2VRKA 2WC4A 4AEFA 1HG3A 1QPRA 2VURA 3TJ4A 1KM3A 3EOEA 4L6HA 1DE6A 4UOQA 4YN5A 4HHPA 1X6UA 4IP5A 3WBYA 2PTYA 4MSSA 3U6WA 1EBHA 1MO0A 3BICA 1DYSA 5ABGA 3V0SA 4W85A 3S5YA 4EK7A 1MXGA 2WSRA 3U2ZA 1US3A 4JS3A 4ATLA 1QOPA 4C65A 1EX5A 3NG3A 4RNFA 4UTTA 3VFCA 1ZAIA 3PZGA 3WNPA 3G0XA 3CQIA 4KEMA 2ISFA 2FPYA 1SZEA 1R38A 3QF0A 3KBJA 3O06A 3KTSA 4IZGA 3HM7A 3NFUA 4M6UA 3TYEA 4UMCA 3VNYA 4F0RA 1VLWA 3VCCA 1D9EA 4NJHA 3GIQA 2OU4A 5LGZA 3D6NA 2OQHA 2PTXA 3AICA 3N11A 3MT1A 4U5IA 3GVVA 2BFGA 4OHQA 1UWIA 3P3BA 4RDZA 1ZPTA 3I10A 2ZRZA 3PPFA 3O1NA 5CLTA 1UKPA 5JXQA 1UP0A 3H2FA 2I9UA 1DKWA 1WQ5A 4TQTA 5TBOA 3GW3A 3C56A 4AZGA 3CV6A 3PSVA 3HTWA 2IQTA 4JQ3A 2VZTA 4GY1A 2PA6A 4GMEA 3KRSA 1V77A 1V6VA 3ZLFA 3RXZA 1XBZA 2YL6A 1HO4A 1BXNA 2YBVA 4H9UA 4MJMA 3DYOA 2E1WA 4MUZA 4HGXA 3K8KA 3BSMA 4H9MA 2O92A 5IDZA 4TVCA 4XZ9A 1TSIA 4EWND 1GEHA 3V0UA 1R87A 1K4HA 5I79A 2J7EA 1E6SM 4GXWA 2CPUA 3CIWA 4C6JA 5JVLA 1UD4A 2WMIA 2MNRA 1LUCA 4Q8QA 5FEZA 4HK7A 1PZ1A 5D05A 2X42A 3DYPA 4FA3A 2KAUC 3FDGA 3L2MA 2UY4A 4MWAD 1MW3A 1U30A 3ARXA 3KL0A 2TPSA 2W61A 3V4BA 4PTDA 4ZODA 1XIDA 4CQBA 4QAWA 3NPVA 2DZTA 1P6CA 4O1AA 5B7YA 4PRTA 2A6NA 2WWCA 5KINA 2F7FA 3M5YA 3ZSSA 3WN6A 3WF0A 3S6TA 2HSAA 3B0XA 1JCNA 3UYIA 4DYEA 3A22A 3RLGA 1W5QA 3CGTA 1PKNA 3LCGA 3CV2A 1YYAA 1CB7B 1UKSA 1CLXA 1KBKA 2VDHA 1F8IA 4HZ6A 3UVAA 4UR7A 3TU9A 3MUZ1 4DZ5A 2KX9A 3N4EA 1JDFA 3A47A 4ZO6A 3W00A 8CGTA 3NOYA 4C1KA 1GOQA 1B5TA 3NQEA 1C8VA 4C6IA 4AAJA 1IEWA 5I78A 4DM1A 3AALA 4GZEA 4O19A 5EFDA 4S3JA 4GFSA 3QZ6A 5I77A 1SPQA 4KF1A 1V02E 3PJUA 2V3DA 5C8BB 3DZ1A 1TZ9A 1JUKA 1OHLA 3APTA 2J74A 4MWAE 1W1TA 3W84A 2CNCA 4B9YA 4HKPA 1U5JA 2A3LA 1X8FA 3W3OA 3EB2A 2Y8VA 2WMIB 2AMGA 3DFNA 5BMXA 4L4MA 1UQZA 3U7BA 1LUCB 2VEPA 2XDFA 3HGOA 4LWWA 4CCDA 3PWAA 4S2BA 1ONRA 4RXFA 3HOJA 3LBMA 2R14A 1DTNA 3UBPC 1NTHA 3LGDA 5FEPA 1C9WA 4ZE5A 5JIPA 2QPXA 4Z2LA 2OEKA 1JF5A 1H62A 2G37A 4UZSA 1OY0A 2HK1A 3CASA 2ISSA 3WUGA 1DWHM 5I07A 4HNLA 1GPWA 4F9DA 1G4EA 3LN3A 3OQEA 1QBBA 3T6CA 4UMAA 5EMMA 3VD3A 2DT2A 1MWOA 3O6DA 1ISYA 1H63A 3TONA 3B8TA 3VIKA 4MAVA 1RQHA 1XI3A 1H41A 3N2OA 3TQKA 3CLMA 4UOZA 5GQBA 4V33A 3THUA 2DVXA 4I3GA 5BMWA 4U31A 4AVNA 1UKOA 1HKWA 3WLSA 1RK6A 3B9DA 3OPSA 1DTUA 4JICA 3T0TA 1M7OA 2WZIA 3AYVA 3TFCA 3BAXA 3VD7A 5E0FA 1HN1A 3LLDA 4AWSA 2Y2WA 2XH7A 2B31A 5RUBA 2GDVA 1DJZA 3C4UA 2XIQA 3MPGA 3EXRA 3VD4A 1GT8A 4MY1A 1DIDA 1UYQA 4X22A 5A3HA 4O52A 1W1VA 3WFAA 3W1UA 5AHMA 4V2XA 3DC8A 3QKZA 4XZNX 1XPYA 3U57A 3VKCA 3PWGA 3QV6A 2E7FA 3SUVA 1OFRA 4RE0A 3QN3A 5A6TC 2V3FA 3NPWA 3UG5A 2HWGA 3STEA 4FLSA 5J04A 3L68A 3SGUA 3I4EA 5EMYA 3P2VA 1QJWA 1UR8A 2WCSA 3G3MA 2X7WA 2GVYA 3OZMA 4KMQA 5G4WA 4RLIA 3N9KA 3PJWA 2G0WA 1X96A 2VC9A 3VMOA 3S1WA 3DESA 1LG1A 1S2TA 1OCNA 3A4JA 3OJGA 2Z29A 1GYNA 1E0TA 1Q13A 3W72A 5A6LA 5E93A 3TEVA 3VNLA 4LFYA 3G3DA 3NSXA 3W88A 3GX9A 3SURA 2GWNA 3S6DA 2WM0A 3LRMA 3KOYA 1WDRA 4NXSA 1V0LA 5CGMA 3RUBL 1CYGA 1JZ2A 5LSMA 4C6KA 4D2JA 2XSBA 4NHVA 3W1QA 4JCLA 2A5HA 3W82A 3BV7A 3P60A 4WDUA 3L0KA 1OFDA 4U3CA 1YXDA 1OFEA 2NUYA 3W4RA 3FNDA 5HQEA 4L5ZA 4ZZ9A 7REQA 1HGWA 3O6YX 1FWWA 3MP3A 1CT5A 1MW0A 1CECA 3B8SA 3IANA 1M65A 4RNJA 3BGGA 2FZBA 3NOEA 3EOLA 4M6QA 4JN6A 1QHPA 1T96A 2XFYA 3L0GA 4O53A 2GQ9A 1XFBA 2E6AA 3QQ1A 4JKKA 3HGRA 1HKIA 5TF0A 5MF5A 4G2DA 5HR6A 2CLEA 3LCLA 5D02A 3MQTA 2J9YA 2DSUA 3UXDA 4ZQNA 1PKMA 2BWGA 3C0LA 3UG4A 4O54A 1JI2A 1F4AA 4WSJA 2XH2A 3EKZA 3UY7A 2J79A 4L6DA 1H7NA 3FJ4A 1XSKA 5AYXA 1WXYA 2HNHA 4FHAA 2O4MA 2BXYA 3MU7A 1QFEA 3EAUA 4BF7A 3AJXA 4O14A 3A5FA 4C6EA 1WKDA 2XUCA 3URNA 4NU7A 2A7RA 3M0XA 5K9DA 2WZHA 3TP4A 1FH8A 3OA5A 4XZWA 1RV8A 1GW1A 3ZZ1A 3WQFA 1EP3A 4QFUA 5D8ZA 1E6QM 1UA7A 2D69A 4Q4QA 7TIMA 4I9MA 3U8GA 3A23A 3BQ5A 1ZJHA 3HA1A 3CZ8A 4P8XA 3V16A 3A21A 1XYMA 4Q8OA 1LLOA 4ZCWA 4O0ZA 7REQB 4GVGA 1KBJA 1AUSL 2WSQA 4N4PA 2QEZA 1DWIM 1Q63A 2J9ZA 2ZCGA 4NILA 3SY1A 1QTWA 3H26A 1VIWA 1FCQA 5GNYA 4HD5A 1YIXA 1ONXA 2G95A 2VWTA 1HVQA 4MKVA 2WJDA 1IE7C 1F4HA 2ACRA 3S5OA 1YDVA 1W1B1 3FJLA 4DJDA 4JTSA 4MHBA 4OT7A 2WANA 3GG7A 4QX4A 2YL9A 2QKFA 4AYGA 2FTYA 2WSKA 3II1A 2YLLA 1JZ4A 1Z9AA 5H8MA 4ORIA 1JR1A 3F7JA 4LGXA 4Q8TA 4BWLA 3I6RA 3IJIA 3ITOA 1ZY9A 2DW7A 3BCJA 1VENA 3H7VA 2G50A 3HQNA 2WHLA 1JRCA 2NQ9A 3S8HA 3T8LA 3WUBA 2HROA 4Q8NA 4K68A 4EPBC 2ZC1A 3NZGA 4CU7A 1I6NA 4AZBA 2G3MA 4B92A 2WHJA 1SZGA 4POCA 4ROPA 4UCFA 2GGJA 4XSLA 2D0GA 3W1NA 3T1GA 2VFEA 5JIWA 1ESWA 5AKQA 4B3LA 2J88A 2VX7A 5J5RA 4HPXA 1JUBA 2FHCA 1U2YA 4URIA 1KXQA 3UPBA 4FB7A 3BV4A 5IFTA 2WXDM 1PVNA 2CLMA 1MW2A 1A3WA 1LQ2A 2PP3A 3GVQA 3IWPA 2UWFA 4UOJA 1WA3A 2ZUMA 3H2EA 2YR1A 5H91A 3OVQA 3UP8A 2HE5A 4HPJA 1AH0A 3KHJA 1OABA 2GGHA 3VZYA 1WXJA 1OYCA 3PUDA 2R24A 4TXEA 4F0LA 2J6VA 5AYYA 2NUXA 3OOQA 2WBGA 4GQGA 2VGBA 1E0UA 1QI0A 2OWWA 1XBYA 4I5UA 4KH2A 1G9HA 1WP6A 3MHUA 1NP2A 1ZP4A 4UTMA 5F2MA 3UNTA 2WHKA 1E71M 1HJXA 3ANVA 1XX1A 3UGVA 1AFSA 2CWNA 1UUOA 3QR3A 3O07A 1NVMA 4ERGA 3GYEA 4AXKA 3BQ6A 4GYJA 4YJ5A 3DFPA 1DXFA 3WJWA 2YGYA 1KQZA 1XG3A 1M3UA 1XC6A 3C2YA 5BXTA 2FH6A 1DE5A 5CZJA 3WBEA 5HJLA 1KXTA 4MYAA 2HJPA 5EYWA 2PB1A 4UWMA 2Z2UA 3B05A 3CZGA 1WPCA 1UH4A 4FX7A 1AH4A 1ZBCA 5CEWA 3TX9A 3TWAA 3WQ6A 1VS1A 3VD9A 3PZTA 2V2HA 1H4PA 1MQRA 1KGUA 1KO0A 3GQYA 2IPFA 1FWBC 3CK5A 1LRQA 1NDZA 3PN8A 3EB3A 2D0HA 2Q8ZA 1QT1A 3DGRA 5C7VA 3NUKA 1BKHA 1BPLB 2ZVRA 1H1NA 1ONEA 2VC6A 3VDHA 1LJYA 1OZMA 2NWRA 2DDXA 3DU0A 3GFZA 4O1DA 2GUBA 1TPWA 1VHCA 1KGXA 3MMWA 2HEJA 2Z1KA 3UCQA 3FEQA 3SUTA 5HDRA 5KEZA 4TUFA 2XINA 1XLIA 2VHLA 3TR2A 3HPSA 3GB6A 1XIBA 3DFQA 5HAOA 3Q65A 3T0AA 1M41A 3HURA 3OO2A 1GOIA 3BOLA 3ES8A 4Q4MA 1RY0A 3SCSA 3NDOA 2VRJA 1XCWA 4MB4A 1VCGA 5E09A 4QE4A 3AXIA 3ZLGA 1X8CA 4FX6M 4R7JA 2QF7A 1KKRA 2OT1A 1BGGA 3A4WA 3ARSA 3OVRA 4GO9A 4NT0A 3G22A 3MUCA 2A3BA 5K9XA 5I3DA 1BWVA 1UJPA 2YA0A 1QNRA 3LTYA 2BV9A 2BXVA 2W79A 1P4CA 3KEHA 4AD3A 1ITCA 2BP1A 1QNVA 2I7GA 4KIEA 3SY8A 1M03A 3VX1A 3ZXWA 1DJYA 1JXKA 1PBGA 3N04A 3SGGA 4GYPC 2AL2A 1UD8A 4Q4PA 1BEUA 4LNYA 1V3IA 2FLIA 4UQ9A 3FK4A 1W2VA 2BZNA 2FVMA 1J2WA 3MI3A 3I68A 3ISIX 1A4LA 5E0CA 1O5XA 5A6SA 4DM2A 2W3ZA 2TSYA 1PX3A 1R9YA 3YPIA 1DQWA 1NOFA 1KFWA 2E8ZA 1CEOA 4IIFA 3EWUA 1D8CA 4OUIA 5L9FA 1SJBA 5CAHA 3T05A 4P7OA 2J6XA 1V6UA 3VIPA 3MUY1 6TIMA 1Q6FA 1VP5A 1W3LA 5E0KA 4YIWA 1US0A 5HNTA 3CQHA 4J3UA 2HPIA 1X7IA 3LHUA 3SCOA 3OQ8A 1YBQA 1K8YA 1EDGA 3V5CA 4ROQA 2VEIA 1Z6KA 3CUIA 3PPHA 1TVNA 3UESA 3KCLA 2VO5A 3EWXA 3WMBA 1XISA 4LBSA 1NU5A 4HTYA 2FZMA 3FVMA 4JX5A 3P8IA 1XIJA 3UJEA 1H09A 3UQNA 3LSBA 4IIHA 1MQPA 4PTWA 3KLKA 3M7SA 3M47A 3OBKA 1XKYA 4HK6A 4R53A 1GCYA 2F8QA 2Y8KA 4B4FA 2VCCA 1TPC1 2PBOA 2PLJA 3GE7A 4MGGA 4QNWA 4HU3A 1RAKA 4JHZA 4Z1BA 4KQNA 1BG4A 5D2YA 3C8FA 3UW6A 2FB3A 2Y61A 3E49A 2Y63A 1UR9A 2YZRA 4S39A 4DJDD 3W1XA 1F73A 4J2MA 3FA3A 3SCQA 1BLIA 1RVKA 5A6JA 3UWQA 1Q6CA 1XLGA 1I60A 4UNKA 4WVXA 4GIEA 2AL2B 3GDLA 2D23A 5CC6A 4W7UA 3IIZA 3BZJA 1GJUA 1D3GA 1G4PA 3VNIA 4CGTA 3N73A 1UR0A 5C70A 3POHA 3GNDA 1B4EA 5D32A 4ZXLA 4MDOA 1ELSA 1YRRA 3H7RA 1N8FA 3GC5A 1L8PA 1WXZA 2QGHA 3RLHA 3GDKA 5D8WA 4KGJA 4PBFA 1TTIA 2RGMA 4PUNA 4Q8WA 2PTDA 4JGDA 3ZMRA 4D6DA 3VVGA 1W5MA 4E2BA 4B3ZA 1Z48A 4XIAA 1DJXA 3I3EA 3SCWA 2FB2A 3NWRA 1YBQB 2CETA 2YBUA 3PVFA 1PIGA 3EWWA 2YL8A 2QJGA 1LQAA 2ZX9A 4EAMA 1XP3A 4U33A 3U2EA 4V15A 1UMYA 2V81A 2Q01A 3W24A 3TR9A 3IAPA 2VZUA 4NY2A 3F5JA 2ISDA 2NQZA 1VBRA 2OPJA 3VAVA 2GUYA 5I5RA 2GVEA 2ZKMX 4GZJA 1BQCA 4AVOA 3MO7A 2NXIA 4IGNA 1QATA 3CQKA 3TAKA 3AC0A 1C93A 1IXQA 1MVYA 2OYKA 3BVJA 1FX6A 1PEZA 2O9RA 4HHMA 1FBAA 4JHOA 4JX4A 4MY8A 5ECUA 1PSCA 1BXBA 5I3JA 1TMHA 4OUEA 5G2IA 3OLIA 3BSGA 3M0YA 3RITA 1UPMB 1EWDA 2ZADA 4UTTC 2IKIA 2BASA 1UH3A 3MHGA 3U5YA 4V1YA 1ICQA 4PTXA 4LVDA 3N25A 3CBWA 1UBPC 4YVXA 1IT8A 2ZQ0A 3WLTA 3AMKA 3C0QA 3URBA 3IIVA 3AO0A 1EBGA 2EPNA 3WH6A 3WEMA 3N6HA 4C6NA 1CWYA 1QPNA 4OFCA 4J3XA 2W62A 4HA3A 3WDIA 1UKQA 1XSJA 2XGIA 3RILA 2PODA 1M68A 1SZRA 2Q6ZA 5BZAA 3H7UA 5DRCA 1XH1A 1XKJA 3PTQA 4H4IA 3I7RA 1JZ3A 3SECA 3ITVA 1OIFA 5J5DA 1YHTA 3IV8A 3OHIA 4S3GA 4JIQA 2HPMA 3M6DA 3G1FA 5HMSA 2WNQA 4AZ6A 3CUGA 3S42A 2YKKA 3KLLA 4WDTA 3AWNA 4DRSA 1VFHA 2GUUA 2X09A 3WD1A 2AQVA 3R25A 4MNMA 1OINA 5C9WA 3RF9A 3AJ7A 4IQLA 4PH6A 4GCXA 1PX4A 1CXKA 2CBJA 3GH4A 4TX8A 1TV7A 4GQBA 2BVYA 2G3JA 2PCEA 2FVLA 3ZT6A 3AI0A 3D5HA 2J78A 2V8ZA 1GQKA 3R94A 3CJPA 3OB8A 3B04A 4JN7A 5CSSA 4TVDA 1E3XA 1P6WA 3GHRA 2ADAA 3UCDA 4L9YA 2XJ7A 3N9SA 2G97A 1O6IA 5I00A 4ICCX 4LAKA 1OFPA 4C6OA 4A6GA 1ONWA 3FHQA 1E1EA 1QHOA 4UC5A 4FALA 3KVLA 4ERIA 3IJ9A 4WLCA 3E96A 3ZM8A 1WZAA 1KFKA 3GU2A 3WMCA 1TRIA 5KZ6A 2EF9A 4QCEA 3TQPA 1JFHA 3P0WA 3KOFA 1GHRA 4M3PA 4CCEA 1Q2SA 2UY5A 1VBUA 2VUYA 1KXVA 5A5WA 3BLDA 3FJNA 1KTNA 2WHMA 4IMAA 3S1GA 2XIMA 4QITA 4GX8A 2JIWA 4WIWA 1SO4A 1S38A 2MUCA 3NL3A 2IXVA 3LOTA 1EJSC 4C7GA 2RAGA 2AKZA 4QDPA 4DWDA 3AHXA 3UU0A 1WX0A 3GC2A 3MV11 4PR4A 1TJ0A 1V3HA 5LA1A 1VR6A 3KS5A 3WDQA 2F6XA 4O1EA 3M9YA 3TROA 1Z41A 1NDYA 4D8LA 1XLEA 3QQWA 4OJYA 2CITA 1VFLA 2QIIA 1UW9A 4A21A 1HNYA 1J0KA 3B9NA 1Q8AA 4DNMA 3M0JA 5KZDA 3RK8A 4BZYA 4HJWA 1SFSA 4PMRA 1CIUA 1WAUA 4G5DA 1W3NA 3FEMA 3O15A 1EXBA 4CLMA 1QWGA 1E40A 2E6FA 3A9BA 1WBJA 5DMYA 1UWAA 2D22A 2L5HA 5G1YA 2OKOA 5H6HA 1EGVA 3URAA 3ERPA 1ALDA 3PK7A 2QMKA 2RDUA 3GG8A 1U1HA 5AYIA 1A5KC 3MDWA 3MCNA 3UG8A 4ZEPA 1TPVA 1E4MM 5G1MA 3Q94A 3KP0A 4ZVJA 5JBDA 4IP7A 2VFIA 2XGBA 3A4AA 1JPIA 4XAYA 1FVPA 3LCHA 1W56A 3FAXA 3JVAA 3PFRA 3WFZA 4WDXA 3MKKA 5EKYA 3IK2A 1GOXA 3N3TA 3AISA 3L4WA 4DBEA 2GYIA 1FWIC 3BLOA 2G5WA 4LW7A 5HATA 5DCBA 4AWUA 2BY3A 3VA8A 3FIGA 1Z42A 4YU1A 2FZ8A 4AF0A 3NURA 2PLKA 3W1MA 5C9UA 4FNQA 4IPLA 4JR5A 1MUMA 3O6CA 3I6TA 3P74A 1B0IA 3WG6A 3GO2A 3LQLA 3MVIA 1KV5A 3N13A 3WELA 3N6QA 1EEPA 4PMQA 4XK2A 4EOUA 5IDIA 4X2RA 4NZCA 2NZLA 1F8MA 4W8LA 5FJIA 4GO8A 1X7FA 3S3GA 2O9PA 5BRBA 1A5LC 1OYAA 4JDBA 3AIRA 3AIWA 3HO8A 4LJ3A 1TV3A 2FPVA 4CNSA 3BMXA 4ZSUA 2BOEX 3A5VA 8TIMA 1XGZA 4W84A 2WSPA 3EDDA 4EANA 4IXHA 3EA3A 3UXKA 3LCWA 2WV8A 5D4YA 3U7VA 3MKCA 4D8AA 3LV5A 3U4AA 1W9XA 1LBLA 1TMLA 5F1VA 5ENLA 3OYZA 4E8DA 4QSHA 1AQFA 1D8WA 4G7FA 3IRDA 1BQGA 4QJ4B 2D2OA 3BC9A 4Z2KA 1Q8JA 4OOZA 3VNDA 2FHBA 1W5PA 3PY2A 5CCZA 3OIXA 1XW8A 4L1XA 1I2OA 2XM1A 1G7VA 3LI1A 3W26A 4ACZA 2Y1HA 1E9LA 3VO0A 4B9ZA 1OT1A 4H04A 5AHNA 3TC3A 4XSMA 1SJCA 3T07A 3BLKA 4ML4A 4NL1A 3ELFA 4W7WA 4BS0A 1L6FA 4IPJA 2PWDA 1W2PA 1IYXA 1UMLA 3W1TA 1GJWA 2XH4A 4XZIA 1W9UA 4AF0B 4W9TA 4H9YA 3CYJA 1W3JA 2VP8A 5FJOA 4QCFA 3SB0A 4WEVX 1KM5A 3L4TA 3VOJA 4DPPA 5KZEA 2D20A 4FS9A 5LZLA 1A50A 4H2HA 3KRBA 4ZOBA 3UCCA 3WK1A 4AXNA 2X0SA 1EEXA 1JQVA 1VEMA 3A13A 2XVLA 5A2CA 2YDQA 1KCZA 3D3FA 3EKGA 3B9AA 2G96A 3VD5A 3B4YA 1SO3A 2QQ6A 4S3CA 3AZRA 4CQ9A 2Z6JA 2W66A 3AS0A 1QNSA 1UASA 4JTFA 2HISA 2ZVIA 3SRHA 2YW4A 3AIBA 3WFLA 4DNHA 1R47A 1LOSA 3SFKA 5HPCA 1ISXA 1KR1A 1J0ZA 2QF8A 2PF0A 1XIGA 2NXGA 1L6SA 4CKQA 5IBXA 4H8VA 1XYAA 3E5PA 1M9HA 2GJXA 4PUUA 2E28A 5C6MA 4UTFA 1FDYA 3LLXA 4PSRA 1VFUA 1O4UA 1NWSA 2G3IA 1VZWA 3EWZA 1GKQA 1K4GA 1S1RA 4ECLA 2BY2A 5GNXA 4US6A 3EB4A 5HMEA 3SJNA 1XWYA 1YPFA 4F40A 2PDBA 1XIHA 4Y9AA 1C92A 3F2DA 2VTFA 3EWBX 2CFFA 3GHUA 1AJZA 4C7DA 4ACZB 3TIMA 3WF3A 3WQDA 2A3EA 4RR4A 2RUSA 3HPAA 4OQVA 1PKYA 2CLOA 4IICA 2R8WA 1DXEA 1H51A 2B81A 1ZSXA 3DG3A 3DHDA 4B3KA 3N15A 1TPUA 3ZFHA 4PA8A 3KX6A 2OWCA 1R3TA 5LHEA 2Z7GA 3L4ZA 2R94A 3LMYA 3LPGA 5D37A 3BO9A 1VQTA 2C1HA 4TTUA 3W01A 1AJ0A 2HXUA 1TVLA 1MEIA 2OELA 3WBXA 4JN8A 2QCFA 2JQXA 4N0RA 5LNWA 5C5YA 3VILA 3FGCA 3CM4A 1HJSA 2XIIA 3WENA 1J6PA 1WB0A 2OLHA 1N82A 1EF3A 3GS6A 4O10A 3CIVA 1JUEA 3WK3A 3MJYA 5JH2A 2QMJA 3M41A 4K1WA 2QS8A 1JDEA 2FHFA 4B5VA 1KV8A 2HVOA 4B5TA 5AC7A 2ZX6A 2GJLA 1XGDA 3LLFA 2OODA 4FP1A 4F66A 2XH0A 3GU1A 4PFMA 1JI1A 2GJXB 5J8LA 4BWLC 1FFRA 1W37A 2J8TA 4E8CA 3OW1A 4U2YA 3TOYA 1PCKA 1ZB5A 2NV9A 3O16A 5CSYA 6TAAA 3LPFA 4QQ3A 2WJFA 3W2LA 1C91A 4BHYA 2QVNA 4DJFC 1V6XA 5FA5A 1HXJA 1V0NA 3L4XA 4FXRA 1F6KA 4E4UA 3FYPA 4DWSA 1S5WA 2Z1BA 3TQVA 5FEWA 4RL3A 3NZQA 3WLQA 1DWGM 4UXDA 4H7ZA 1DHPA 4JQ1A 1OYBA 4DXKA 1IWBA 3M5XA 2DUXA 3ARRA 5HINA 1EZWA 3EGJA 2D73A 2QCCA 1FWGC 1V93A 3SAZA 3WLHA 5LIUX 3T0BA 3CHEA 2H9AA 3R4IA 4GE8A 9CGTA 2ZXQA 1Q5MA 2XTKA 3WBWA 1NJJA 5H8PA 3UWUA 1R5YA 2YCJA 1QMLA 3QC3A 2YB1A 4LAMA 3ME3A 1UQYA 1CXLA 3AIQA 4A8IA 4KFPA 1HL9A 2VFDA 3NL6A 2NSOA 5LIWX 1GTHA 3BAIA 5FL0A 3FGCB 1DV7A 1KRCC 4NG3A 1JF6A 4K8EA 3LSCA 3BAWA 1X6NA 3R79A 1FWHC 2P3EA 2HNEA 3M64A 3K46A 3OG3A 1QO5A 2YCEA 5H2ZA 3QVQA 2NQHA 3QBUA 3W1RA 2X0YA 3PM6A 1VBGA 1ODUA 4O0QA 2YLAA 3QHOA 4NJGA 1TPH1 4RZ6A 4YCOA 2GGEA 2V2DA 3S9ZA 3W7IA 3KZSA 1U5HA 5C9RA 2ZC8A 3PPGA 2YL5A 5KTLA 3CEPA 2JBMA 1IGSA 3R5EA 3TXVA 3VTRA 5EMKA 1QVBA 4PMZA 2J13A 1IEQA 4LUYA 1EA0A 3S46A 1W32A 2WVTA 4TOQA 4HN4A 4KWVA 1PAMA 1H5YA 2J8GA 3S83A 1ZBVA 4BI6A 1AMYA 1RQEA 2IQ0A 4JL2A 3W7EA 3W6LA 3C61A 1KBLA 1EUAA 1YEYA 3R13A 5DMMA 1LBFA 3AU6A 3DDMA 3CUJA 2FJUB 1PZ0A 4DYJA 1GQIA 4DWSB 4MB3A 2PDYA 2P50A 1C8YA 4JFTA 2QUNA 3N4FA 4IFKA 3UZXA 1NH6A 4FNRA 1PJ9A 2ATMA 2BNJA 3L5LA 4H83A 2PDUA 3NO5A 4RXGA 2OOGA 3OP2A 4LPCA 1U22A 5I3IA 3OIHA 3QSRA 4JTQA 2QV4A 4F79A 2QULA 2X41A 4XAGA 1QNQA 2ZUTA 2CKRA 3MI6A 2H9AB 2QJNA 4ZOCA 5CPQA 2OYLA 2BS9A 4L4PA 1JCLA 4BQ5A 1NFPA 3M07A 2YB4A 5BOOA 4KPLA 4A4AA 1H60A 5G2WA 5A95A 1W6TA 4MPKA 4PZVA 4ZO7A 5DX7A 4F2BA 1NSJA 2Y6ZA 1F7BA 5GNZA 1XIFA 5EBUA 2V3EA 4LSBA 1J79A 5E6ZA 1K70A 4DEFA 2XM2A 3QW3A 3P8JA 3RCYA 4CNPA 1LF1A 2X1RA 2VQUA 4QJ5B 2KZHA 1W9PA 4YMZA 3VIJA 5BXSA 3GU9A 2PE4A 3DBNA 5D30A 3TQ0A 1GKPA 3LTPA 4JIPA 3RG6A 3LEPA 3ICJA 2E8YA 3PJTA 1LDCA 3H2NA 4AEEA 2UBPC 2I16A 3IK4A 1RK5A 3ALFA 4XBSA 3GNPA 3BK0A 5I02A 1P1MA 1BXCA 2R1LA 2Y7GA 1ZJBA 4XD6A 1JYNA 1TPDA 3QTGA 1EYWA 3KDOA 3AROA 3M0VA 8RUCA 1QK0A 1Q2RA 1EFZA 3ABXA 2HQAA 3B40A 4IFKB 3E1F1 4ZSTA 2DIEA 1ZBWA 1QK2A 4AZ5A 4J7RA 4MZ1A 4EIVA 3RU6A 1WAWA 2QW5A 4AIUA 4FMVA 4JIRA 5D2XA 2VWSA 3CS2A 3SUWA 3PULA 4IOTA 3WJZA 2Y7DA 1FWDC 5CAKA 3BLLA 1XR2A 1XIMA 3OGSA 3GTNA 1I0BA 3G1RA 1KFBA 3PBUA 1BGAA 4O18A 1SMAA 4V28A 2CKSA 3S2NA 1UR4A 2SFPA 3ZR6A 4ICMA 3HU7A 5CZTA 1MZRA 1RHCA 3SM0A 3DFOA 5CBJA 1B3YA 2WSYA 1FQ0A 1CX9A 2NSXA 1OC5A 1CZ1A 3CTLA 3ZT5A 2QVHA 5BNKA 3FSUA 2FDMA 2TAAA 3GH7A 3KL3A 3WQVA 4DQWA 3IGHX 1Y7VA 3RJXA 1M53A 4WOQA 3TJLA 2INFA 3H4WA 1VCVA 4FOKA 3E0FA 3VM5A 3N17A 3WH5A 2GZXA 2QIWA 4M5PA 3R2GA 1QASA 2OOFA 4M1RA 1LBMA 1WDPA 3AHZA 1MXDA 2OKTA 4JXCA 2DSWA 4GKLA 1A0EA 4JIEA 5LGXA 2WNNA 4HU0A 1SGJA 3GIYA 2YCKX 2VGIA 4Q8MA 1UCWA 3NYZA 5CG7A 4DWSD 2J27A 4IFRA 2E5CA 3RYSA 2E6DA 3SIMA 4O50A 1R7AA 2DEPA 5AY7A 1XFCA 2ZUNA 2PZ0A 1WZMA 4OBTA 3WQ5A 2I57A 1D2KA 4QDWA 1BVWA 2F38A 3NSMA 1YW1A 1NF7A 4J35A 3QQ0A 1WNOA 1XXXA 1E55A 3M44A 5D9NA 3QXBA 3W22A 1R3WA 1HKMA 3ZT7A 4FAMA 1DWFM 3BOFA 1KLYA 4BQ4A 3MYPA 1SYTA 2PCQA 5BYWA 1MRQA 3W75A 4YWSA 1DJHA 4Q4KA 4LRTA 1ENUA 4WXZA 3FYOA 4W86A 4DUVA 4F9JA 7CGTA 5DCDA 5REQA 2BG5A 1VFFA 3NDYA 5LNUA 1SW7A 1J8VA 3FHAA 4O13A 1QOXA 2PRHA 1IXPA 4IX2A 3G0UA 4IT1A 4LC8A 3BH4A 1BYAA 2LLEA 1QBAA 3H4XA 3PG8A 4OTKA 3JRKA 3GDMA 2ZRUA 1K7XA 1YTDA 1XDMA 1YNYA 5D04C 2VCAA 1VFMA 1VIZA 5K4ZA 5BRPA 2ESCA 4EXAA 1GGOA 4GBUA 5F4XA 3GNRA 2GQ3A 2FZ9A 4DN1A 1JL8A 4K6AA 3KWSA 4HOZA 1G0CA 4CD4A 1R9XA 3B06A 3LHYA 3QMTA 1LL4A 5IOBA 3R58A 1YKWA 1UROA 3L4VA 2RGLA 2E3ZA 3OLDA 2FZNA 3BAJA 3LS9A 4LEFA 2J4GA 4QEEA 1PCWA 3V5OA 3OGVA 4IF2A 5EMJA 2IUZA 4CVUA 4UFJA 2FZDA 3TYAA 3S5SA 1E9YB 1H7RA 3BAKA 2E6YA 2VEFA 3I3DA 4HPHA 4AD5A 3LDVA 1JDCA 3ZLHA 4UTHA 3N29A 4IISA 2WO5A 1F6PA 1G4SA 4GBDA 4JEQA 2Y62A 4NAEA 2IW0A 3DUGA 2QPUA 1R2RA 4DLFA 3VXGA 2GQ8A 1TCDA 4JTRA 2I9EA 4Y7EA 3I7QA 3A3HA 3TYCA 4BQ2A 5A8PA 1CB2A 2CLIA 1VAHA 2PGFA 3QSTA 1IEIA 2WVVA 3L0NA 3P7YA 3H12A 4N9CA 5REQB 3N4AA 1QW9A 2VOTA 2Q3OA 1VRXA 2G4JA 2D3LA 4JY9A 1ZHAA 3IACA 5HQMA 3CU2A 7ENLA 4HMDA 2GK1A 4N6FA 3LNPA 1OFOA 4IL2A 4QG8A 1OGBA 4DXXA 3C3UA 2XG9A 1NEYA 3USZA 2QDDA 3H8AA 2Y5EA 1DIKA 1FKWA 1XIEA 4W5ZA 2G41A 4ZMGA 3VZXA 4UQDA 4HNCA 1UB3A 3C2RA 1G94A 1V51A 4KBXA 3DECA 4S3BA 2PD9A 3KP1A 2E9MA 1TCMA 1U83A 4W93A 1XQLA 3AYTA 2DJXA 2ZICA 3GG0A 1PB0A 4S1FA 4J3WA 2VUNA 4C1LA 1XLBA 3OHMB 4K1GA 3EEZA 4CNUA 1JZ6A 1FTXA 2HMCA 2O7SA 2CERA 4RNHA 5GJMA 1GVSA 1EJVC 2R1NA 2YDRA 4GQRA 4O57A 1EO7A 5FSEC 4B15A 1E6RA 3MI2A 4JZ5A 2QR6A 3CL7A 2AGTA 3UA3A 1TO3A 4MOZA 5AVNA 3W2MA 4CD7A 1IXOA 1N2VA 3W1AA 1GEQA 5BU9A 3H23A 4NAEB 3FAWA 1Z89A 3XINA 4M1BA 5FI8A 4E4PA 4F0KA 1H0IA 4UMBA 4LB4A 2QAPA 5AHEA 3RPDA 3W1LA 1HL2A 4NZFA 2EXOA 4JHMA 2WVVB 3CPUA 4LC6A 3CQ0A 3QYSA 1TQXA 2NX1A 4RE2A 3NO3A 1SM9A 3CPRA 1RPKA 1L0PA 2GK1B 3S1XA 1XF0A 3CB8A 3BL3A 4JIIX 2HCVA 1EJRC 4I7UA 1A0DA 3T42A 1SFJA 1E73M 2RJHA 2JIEA 3EMZA 2CWXA 4PUMA 4IP4A 2CEQA 4QIUA 4AWTA 4HQVA 1TUXA 2DV0A 2POTA 1HIZA 5IM51 1JGMA 3DHFA 4LS1A 4Y8EA 3UWVA 1V6YA 1N7KA 2I5QA 3TAOA 1R0MA 4PTMA 4LXFA 1GOMA 2AGKA 3UR7A 1MQQA 3W7QA 4MLRA 2NW0A 2QDHA 3H24A 4LCRA 3KVKA 4ZE4A 3DENA 2CZFA 2JKPA 1OC6A 2GGGA 3GW0A 1JZ8A 4PMYA 3UXIA 3STCA 6PTDA 5TIMA 3GD6A 4MMWA 1F61A 3T0DA 2ACQA 4M82A 2C6QA 2GJRA 3SW6A 1FA2A 5BXPA 4DJEA 2VEGA 5DY2A 2JFEX 4KWSA 2OT0A 3PC0A 4IIEA 5I3GA 1DL3A 4HIBA 4S3DA 4X0VA 5K4XA 4WJXA 4RPPA 1YADA 2PLMA 3NQGA 1GJPA 1FCUA 4GABA 4OOUA 3RO6A 1O68A 3TNBA 2WW5A 1RJRA 2DZPA 2Q02A 1ICSA 4J9JA 3G1DA 2VFGA 3P5ZA 3GKFA 1RY8A 3TC6A 1WKEA 2BVWA 3S5NA 2OG9A 2F84A 3LZ5A 3QKEA 3JW7A 1UZHA 3N34A 2PTWA 1E4IA 3TMLA 2YFNA 3IJLA 3R1ZA 1DBTA 1XYLA 2D3NA 2IKJA 3T78A 5ABHA 2HVMA 5HWJA 4LCSA 2VQTA 3E74A 1OCQA 3CHFA 1MEWA 4LBUA 2QJJA 3QOKA 1KM1A 3PZ9A 4H8NA 1POJA 4F0SA 1UD5A 4GLEA 5DBTA 3NVDA 4CN1A 1KTCA 1AJ2A 4Q22A 1SO6A 4LVAA 1TFVA 3DERA 1KB3A 3ES7A 4I9TA 3WX7A 2ZUSA 4LQ1A 3WCZA 3PF3A 4E2DA 3TYZA 3ZYZA 3IJ6A 4DZIA 4RDVA 3VGGA 2DZWA 1A0CA 3ZR4A 3MC5A 3MSDA 2X1IA 4Z08A 1H61A 1FCVA 3EX3A 3IEBA 3MP4A 7A3HA 4UTUA 1FH9A 1TTJA 3GTIA 2QCHA 3Q67A 1BYBA 1J0HA 1LLWA 1V3KA 3GHSA 3ATZA 2OYMA 2Z4GA 5C7HA 1E51A 3NQCA 4PE8A 3BLFA 3S5ZA 3EPNA 3GSMA 1OX6A 1VLIA 3WUFA 3WKZA 3OVPA 3FN9A 1FWAC 5A1AA 1N8IA 1JAKA 3KAOA 2E68A 3BLIA 2F61A 4Z0SA 4C91A 2DZUA 5G2HA 4CN6A 5FF4A 3NQVA 2ISVA 4KCVA 3JU2A 1IIGA 2V5KA 4BKNA 3G24A 3ONCA 4K8HA 1A5CA 2WMKA 3T2OA 1AD1A 1E56A 1RBLA 1NQ6A 3ARPA 4FXFA 4DXVA 2QNEA 4EVZA 3V18A 3DBPA 1WO2A 1EQPA 5AC4A 4JTJA 3RJYA 1X98A 2AMXA 1A5OC 2ZX5A 4WD0A 2V82A 2DY3A 4H9ZA 2ASHA 4YHGA 1EHAA 1J6OA 1YXCA 4Q4RA 2ACUA 1CGWA 4LOCA 1KC7A 4F4RA 2DT3A 4PEKA 2CYGA 2YXGA 4E2OA 5IBXC 5HWMA 1Q3NA 4YVVA 4US5A 3M0IA 1XLMA 1IQ8A 2FMOA 3C5QA 3N2CA 1E1CA 2ATSA 2RH9A 4UTIA 3N19B 2QYGA 3E6EA 3AZTA 7ODCA 1TR9A 1YMYA 5CZKA 3W7HA 4IMEA 2GVGA 3EXTA 3R8HA 1BSIA 4YTTA 2EG6A 2FMNA 3TXZA 5XIMA 2VX4A 2B7OA 2IPGA 5JMUA 3FV9A 3P62A 5LXXA 2Q71A 2NVCA 3RPTA 4MAZA 3BOXA 4PMUA 1W31A 5HOSA 3OLGA 3CC1A 3P93A 3LZ3A 3QV7A 4YNGA 5AZ0A 1MW1A 1O5KA 3H22A 1PYFA 3FYYA 2OO6A 3MSRA 3TH6A 2JKAA 4HPGA 1RCXB 3OZYA 4UTJA 1PIIA 4Q7NA 3VOCA 3ZOAA 4IJCA 4MNLA 3BMVA 3LHTA 3H2AA 3IJ8A 3WH7A 4LX4A 3WNNA 2P0OA 3NL2A 3MA8A 3EWCA 1F5ZA 3LG3A 1EIXA 3S2LA 3KCJA 2VR4A 4JCMA 1MZHA 3WYZA 2DIJA 4JTIA 1B31A 2ZRWA 4ZFCA 3CT2A 3WLPA 2OEJA 3AXXA 5IXEA 2GOKA 4GHRA 4EXBA 1JEZA 5FAJA 4UUIA 1OEPA 1PE1A 2IXUA 2O0TA 1ZENA 5K2ZA 3P61A 3TJIA 1NF0A 3GH5A 2PLCA 1E1CB 4TO8A 5BXRA 1R30A 1DJQA 3MYOA 5F2IA 1LL7A 1BKSA 1PS9A 3QEZA 1IZKA 1O60A 2B7QA 4YHEA 4AX7A 4WXYA 2G8ZA 1TWSA 2R1MA 1I0DA 4CEUC 3NM1A 2WPGA 2GWGA 2AQWA 3NEHA 2YA2A 3EEGA 4FLQA 4K38A 5JBFA 4J3TA 1K02A 1G7UA 2CZEA 4DJED 3W07A 1JD7A 1TIMA 3EOUA 1KBIA 4MF4A 4PB3A 4K2SA 2OZ3A 1JCXA 3CHDA 3AS3A 3GC4A 4B4HA 2WZMA 2QCEA 4KERA 3MZNA 1PTGA 3INPA 3CL8A 5FJPA 4G8TA 1UD3A 4NNCA 3WH9A 4HSNA 1NDWA 3ITGA 1QUMA 3T4WA 2Z1SA 2V5LA 3HJZA 4MJ2A 4HNOA 1I1XA 4Y2WA 3TN3A 3NPXA 3LQGA 3GY1A 4QROA 2EKCA 2R6OA 4LV9A 3SN1A 2RKXA 1XLCA 3G1XA 3H2OA 2W91A 4C60A 4CN4A 2EJAA 2YX0A 3PB0A 5HK4A 2ZA2A 3TNOA 3UXAA 1EYEA 3U2CA 3WDPP 4NIRA 4X9SA 5LIKX 3SFWA 1DIEA 1IWPA 3UEQA 3HPXA 4M0XA 4MB5A 4ATDA 2XYLA 5I7GA 3R8GA 4Q4OA 1M7PA 1UWQA 3VU2A 4GKTA 4OBRA 3PZQA 3SY5A 3L5AA 5FJTA 1UD6A 3WNMA 1DEDA 1LYXA 1RP9A 3G2GA 4QDMA 2YBTA 2Z2AA 3UWZA 2OMAA 2ZZ2A 3LB0A 1J4EA 2H6RA 3WMSA 3PZIA 5EY5A 1TPEA 2ISWA 1E0WA 3O63A 3EDEA 4ZA0A 4RZBA 5FACA 1J2BA 3NXFA 1OD0A 1B2YA 4S38A 4NYUA 3PSWA 3TYUA 2VVSA 1ITXA 5D9OA 3PUGA 4MZYA 3IRSA 1B3WA 4JTCA 1TJRA 1YE6A 3DN5A 3APYA 3ARUA 1I8JA 1VB9A 1ML1A 3O2LA 1BSLA 5CBIA 3ABQA 1BD0A 2J77A 1US2A 4ORMA 2DW6A 3G6MA 3W81A 1E6NA 3MTWA 4CEXC 3HV8A 3SJ3A 4NNAA 1H7XA 4J4KA 5DELA 2AAAA 4XB3A 2QCDA 4KW2A 1A5UA 4RZ4A 4FO4A 1R3SA 3ALGA 4P2VA 3PAJA 2FGLA 3VE7A 3C52A 1TYGA 1BWLA 2XPKA 3VGHA 3G1VA 2GFTA 1B3VA 1GVEA 3L4YA 1P0EA 3KHDA 3M0KA 4JTGA 1S2AA 4M24A 4QE1A 2Q3RA 1VPYA 3F03K 2WM1A 5IHRA 1HP5A 4JQAA 1UKTA 3VGDA 2B4GA 1HJQA 2GQAA 3VMNA 3WD4A 2A3AA 4W8AA 4FOJA 1Q6RA 4IHCA 1Z8AA 4U28A 4EKJA 2PDFA 4UR9A 3M1ZA 4ADTA 3OU8A 1X6LA 4US5D 1DXIA 1EQCA 1FHVA 4UNLA 1FKXA 4YXGA 2J9XA 1A5AA 1T7LA 1TB3A 2C1IA 3NQ8A 3DCPA 3HBLA 4HPNA 1O94A 4S23A 1NDVA 1A49A 3CH9A 3RCNA 5E9XA 1OT2A 2HTMA 1E70M 5HUPA 3KOZA 4GI9A 2YCLA 3ZVIA 1BHGA 1WOAA 2C19A 4HB7A 4FR6A 4GC3A 4P5UA 2Q8LA 3EMQA 5BW6A 3P6LA 4CCZA 4WJEA 5A2AA 3VABA 1XUUA 3VYLA 3A9IA 4H6KA 1A3HA 2PGRA 1TX2A 4FLOA 1YQ2A 3BANA 5EB8A 3Q45A 4Y9PA 1Q7MA 3V0TA 1LTDA 4ALDA 1TA3A 2DPEA 4O1FA 1Q6DA 1SVDA 1JZ5A 2QCDB 2EKGA 5T91A 3RDKA 3VOFA 5A94A 4HK5A 4TIMA 2PI6A 4AH7A 4KWOA 4MFDA 1JCTA 3VC5A 2EPOA 1X38A 2QCNA 3MUXA 3AIEA 3W7MA 2AQOA 4GG9A 3DG6A 5HXMA 4UFHA 3QTPA 3IIPA 5DMLA 1WBHA 4TMBA 1PZ3A 1FWSA 2D2HA 4UTWA 2FGBA 3RX3A 4I9JA 3SQSA 3MSGA 1R3VA 2WJEA 3CZKA 3W23A 3RCMA 4LY8A 4MKSA 2DP3A 3VUSA 2YXOA 4E5TA 1OFBA 5FKYA 5ABEA 1GK8A 1RLDA 4MVAA 4GI6A 1BVNP 3NNTA 3KOWA 4IMFA 1FUYA 3LNMA 2YOCA 4GZIA 1XINA 5DANA 2P0IA 2Y5JA 1QPQA 4AY7A 1JJKA 4R7OA 3MCMA 1G5AA 2AAMA 1P5BA 3MO4A 1UC5A 2ALDA 2JKEA 1XCXA 2O9OA 3QW4B 4NZ1A 4A3HA 4X2PA 3L2IA 3P81A 2XVKA 4K7YA 3VKDA 2YCLB 4PTVA 4Z1YA 1KLZA 3WJSA 4AZIA 1NP0A 3O8AA 4JAWA 4H8HA 1W1A1 3PNZA 5HA7A 5DCEA 3DHPA 2PDLA 2QCGA 1WZLA 1FWRA 3R0DA 3UGRA 4PMVA 3WDHA 5DXYA 2XVGA 1AQMA 1HVXA 5AYZA 5I0DA 4LYPA 2DQWA 2ZOXA 1L6WA 3PZVA 4HNTA 3FX4A 4JYEA 1TA3B 3RRAA 4GYFA 3IGUA 1TJ2A 2PDHA 1E3ZA 1PZ2A 2UZ9A 4HHHA 4Q3MA 4WZHA 3F5KA 3AYSA 4FR1A 2W6RA 3BMWA 4G1NA 5EFFA 2A2IA 1G67A 3SCVA 2BY0A 3G8RA 1GQNA 2YJQA 3WQEA 1F74A 2E5DA 1FWCC 1YLVA 5ABTA 3CWHA 3ARTA 1VJIA 3QV8A 3OGRA 1OCJA 4OZOA 3HJEA 1J0IA 4AC7C 1XC4A 2VEMA 3LD5A 1QI3A 3QHNA 3VFLA 3QR0A 4Z2HA 4B5XA 2AKMA 3R0UA 3THAA 1EX1A 3HFTA 3S6OA 3WK0A 1RALA 1TWDA 2ZDRA 1E43A 3SQLA 1RP8A 3I6EA 1SMDA 3EDKA 4XQ6A 1EWEA 2TRSA 5KZMA 1SU5A 3RM8A 4O0KA 3K13A 1DHKA 4JTTA 1VYRA 3TLQA 4F2UA 2ZA3A 5GJPA 1JYVA 2PZNA 1GZJA 1P0NA 4UFLA 3WQGA 1G1YA 2ZRVA 5FL1A 4KRZA 3WQWA 4QR6A 3VKBA 1BYDA 3R0KA 4M19A 2WBKA 2C1GA 2OGYA 3IIXA 1NOUA 2ZZ6A 2RFGA 2BVTA 3SCPA 3WQOA 2YZ5A 4JTHA 3DOPA 2PP1A 3LK6A 3VUPA 3AS2A 4XTIA 2A1YA 2ON3A 2FPTA 3IVTA 4PSPA 4BK9A 2I1OA 3G1SA 3UZZA 4HZ7A 2VJXA 3D47A 1VC4A 4GCAA 3AIUA 4Q32A 3NQFA 2V3GA 1EC7A 4P61A 1GVQA 3QR1A 1YX1A 4I9AA 4TV6A 1EGZA 2PGWA 2ONEA 4L1WA 1E1FA 3ZQ9A 4S2CA 4A35A 4XAFA 3NM3A 2WWDA 4GUHA 4TX6A 3EPMA 4N9DA 2PRLA 3F2BA 1EJ7L 5M17A 5LKYA 1AH3A 1GQLA 1W3HA 3H21A 3GBEA 5CC5A 3EA1A 1DJGA 2MANA 2CZ5A 4PCFA 4MJZA 1ZJIA 4ZR8A 4NX5A 4A29A 4LYRA 4E0CA 3L21A 3KTCA 3V7PA 2YCIX 4FNPA 2QDGA 1Q4WA 1CBGA 2PRMA 4AD0A 5A8OA 1QR7A 3BXWA 2V63A 3WLLA 3RFAA 4FF7A 1TUFA 1M7JA 5G4EA 3T44A 1IT0A 1P1XA 2JEQA 3IV3A 1EJUC 1B3XA 3IUHA 3ITXA 2WJZA 4HJFA 2EJ1A 4I6VA 3B8WA 4TU1A 4JIHA 5FEXA 3E0WA 2QCLA 3RU8X 3W87A 1JYWA 3TDFA 1V08A 3F2CA 2X7VA 4W7VA 2VFFA 1HJWA 2X05A 1W5OA 1RD6A 4CNOA 4M80A 4NYYA 2O56A 3P80A 3UF9A 2V5DA 4IIGA 1P0DA 2PAJA 3PANA 3HGJA 1IV8A 3P84A 1XCFA 4AZ7A 2J7HA 3G6LA 1QI4A 3QY6A 1GORA 3KWXA 2OZTA 1ZU8A 2P10A 2POZA 2PDPA 4IGHA 3TC7A 4QS5A 5AVHA 1KTBA 4KWWA 2XGZA 3DEQA 1SJDA 3ABRA 1Q66A 4R5EA 5DQPA 4RW5A 2ZZ7A 3K4AA 4D6CA 5FF2A 1Y0EA 2ZXAA 4NASA 4XKMA 5EMUA 2WMFA 5C2GA 2J7FA 3LX9A 2XN1A 3M5ZA 5CQ1A 2HBVA 3SR7A 4PCSA 2BSLA 3EA2A 1EDQA 1W1ZA 1VJZA 1THFD 2P3ZA 4GYPA 4GYKA 1GTEA 1Q85A 3MV01 4D9PA 3GXTA 1EJXC 1UIOA 4PBEA 4ENLA 2WZTA 3DKJA 2Y70A 2QUTA 3CZLA 4UFIA 2JALA 3NQMA 1KM4A 1QW8A 3N14A 1DOSA 4GRSA 4XD4A 3T0CA 4PRWA 4XD3A 5F4WA 2WVUA 3OZOA 4N02A 1B1YA 4NZ3A 3ZJ8A 2BOFX 3NQDA 4XAZA 5D03A 2G3NA 1AL8A 3MWAA 1KRBC 3QPYA 4B5SA 5CSRA 4MWAC 3PUOA 1K9EA 3KRZA 3LI0A 3C8NA 4E38A 1EXPA 3NQAA 4M51A 3WQ4A 3T2PA 1KR0A 3W7RA 1ZAJA 2Z26A 2YSWA 3A3XA 4IL0A 4DJEC 1YDOA 3VDGA 4EPKA 1HT6A 2X1UA 1UOZA 2JGYA 4J40A 3ITTA 3N1AA 4G1KA 3L12A 3VKJA 5SWUA 3QJAA 4JX6A 5DRIA 5LIXX 1WDDA 3MSYA 2DQXA 1OIMA 2ZYFA 1W3TA 3GK0A 4GINA 1D7FA 3R8RA 3EMCA 4IPPA 2J75A 1Z3NA 4GUJA 4E3VA 3CO4A 6XIMA 1VYPX 3BARA 3CAWA 4NKCA 1RA5A 4H9TA 5H8UA 3CUFA 1HO1A 1I1WA 1PHWA 1TE6A 2AL1A 4RCXA 5LNVA 1KD0A 5JU6A 1QDSA 4W88A 1DJIA 4AISA 1C90A 4Y9MA 4UTKA 3KVJA 1VCFA 1BTCA 2ALRA 2OO0A 4WY0F 4OV4A 2CZDA 5LYRA 2ZTJA 1PTDA 1NWUA 3S1UA 3VIIA 3ZS4A 5C9ZA 3PWIA 1FHLA 2H8XA 4PL1A 3KOXA 1XBVA 4LY4A 4X60A 3MP5A 4LS0A 1LWIA 1RPXA 1A5BA 1TZZA 4ZOAA 3RIKA 6XIAA 2QZRA 2CLFA 4XBKA 3AMDA 4A2SA 2WNWA 4IQEA 4Z2JA