3GX9A

Structure of morphinone reductase n189a mutant in complex with tetrahydronad
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
369
structure length
364
Chain Sequence
NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAAAACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Morphinone reductase
publication title Parallel Pathways and Free-Energy Landscapes for Enzymatic Hydride Transfer Probed by Hydrostatic Pressure
pubmed doi rcsb
source organism Pseudomonas putida
total genus 134
structure length 364
sequence length 369
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gx9A00
3NQ7A 1LZOA 3JR2A 2FLIA 1JCYA 4JGDA 4FNQA 1ZNNA 3HPZA 2J27A 3IGXA 1Z44A 3P80A 1W3NA 1NVMA 3SGZA 3IIXA 3O06A 4EOUA 5BNKA 3L5LA 3UY7A 3EWYA 1LCOA 3QZEA 2Q3OA 5D09A 3HJZA 2ZZ1A 3F4NA 1E51A 1F6PA 1DOSA 2V9DA 1N55A 4A22A 1TPUA 2QR6A 1GVOA 3PM6A 3EEGA 3F4WA 3NGJA 1DHPA 1CI1A 3ABRA 3TC6A 5D33A 3KFTA 4XKYA 1EP3A 2CWNA 1H1YA 1TPH1 2YZRA 3G22A 1G7UA 4JTEA 5CKSA 2VEKA 2CLIA 1Q6OA 3TV8A 4IMDA 1QFEA 3M9YA 4N2YA 1YYAA 3NQGA 2E09A 2Y85A 1YXCA 3QYQA 3W1QA 5A5WA 4JIQA 4A21A 1ME7A 1Q3NA 1WYIA 2VOMA 1TIMA 2QAFA 2FIQA 5T26A 2H6RA 1GT8A 3LRLA 1AK5A 1UB3A 3F03K 4UC5A 1TTIA 1TTQA 2TYSA 1JUKA 1H7XA 1O5XA 3ABOA 2IQTA 1ZALA 5LNVA 4JTTA 1JJKA 3A21A 1OFRA 2NWSA 3TSBA 2P1FA 4GE8A 5EL1A 1X7FA 3E9AA 2F84A 4MFEA 2VELA 2KZHA 1MSSA 1XL9A 3EX4A 2DZPA 3WJZA 2TRSA 4Z1AA 3EXRA 4LV9A 1FCUA 3VI2A 1OX6A 1TPFA 2DZSA 1FDYA 4YXGA 5G5IA 1OFEA 2A2IA 4R33A 3ZFHA 1BKSA 3W1PA 4OU1A 1PIIA 1EWEA 3NQMA 3UWWA 1LDCA 3S5ZA 3RF9A 4DPPA 4LU0A 4MYXA 2JK2A 3N9RA 3LHYA 2ZDRA 1JCNA 2X1UA 2Y7GA 1I4NA 2ZRUA 2YX0A 3TUUA 3SR7A 3P61A 3M5YA 1GZGA 2CLOA 2VC6A 2ZA1A 1KFKA 3IIOA 2B7QA 4O53A 3SIZA 3LERA 2ATSA 1H60A 1TPWA 3W88A 3B0UX 4BI6A 3W72A 3UXDA 5DLCA 2ZRZA 2EPHA 3E96A 1G69A 1K02A 4ZQRA 4UNLA 3NQFA 4Y90A 3K30A 1K7FA 1DJQA 3W2LA 4DEFA 1XBXA 5AYYA 4Z1BA 4OE7A 4CNPA 4XKYB 1W54A 3M47A 3QPYA 4NJHA 2HSAA 1P0KA 3N19B 1H50A 4S2CA 3N2MA 1O60A 3KVLA 2HS8A 2I9EA 4AB4A 1F7BA 3TXZA 3PBYA 2CW6A 4FXRA 5H2ZA 2ZCGA 3MP5A 3S5OA 1W5NA 3DI0A 3DFPA 1FDJA 2I14A 5FEPA 5KITA 3R2GA 4K39A 5IBXC 3P62A 2QCCA 4WUIA 1KM4A 2E5BA 1HO1A 2QCHA 2A0NA 3C2VA 2Q8ZA 2GVGA 4AHPA 3THQA 5KTLA 1AW5A 4IMCA 1ZCOA 3GNNA 3WJWA 1J4EA 1JCMP 3B04A 1G4TA 2PE4A 2OT0A 2Y7EA 2FB3A 3MUXA 1H7RA 4NNCA 2NXIA 1X1OA 3O1NA 5LGZA 4JTHA 1QR7A 1A5CA 4HPXA 4LNYA 4IX2A 5FEWA 4C1KA 4LRTA 1I2QA 3O07A 4M7SA 3G3MA 4AWUA 1GVQA 3DI1A 4MUZA 1S3HA 4CQAA 4FNPA 1G4SA 5FEXA 2XN2A 4O28A 1TPB1 1AW1A 3W7KA 4LUIA 4NX5A 3MHFA 1GEQA 4O11A 2FQIA 2Y6ZA 5F1VA 1P0NA 1P1XA 1F76A 1NF7A 1V5XA 4YCPA 3C2FA 4JTIA 2YDAA 2VENA 3OVPA 3SJ3A 3W1MA 3N2XA 2VXNA 3DU0A 5F2MA 4LVDA 1CW2A 5D05A 4ZMGA 4R34A 1XUZA 2R8WA 1SO3A 4NNAA 2C14A 3MHGA 4AMAA 1SU5A 2FDSA 3LRKA 4KFOA 4AVFA 4CCDA 4I7WA 4WXZA 2ZRWA 3EWXA 3DXIA 1I8JA 2WV8A 2VFEA 3THAA 5HWNA 2E6FA 3NO5A 1KV5A 2RHGA 1RV8A 1JCLA 3LRMA 3W85A 3TMQA 2WNNA 3N3MA 3NQ2A 1SSDA 4HNUA 2FB2A 4M6QA 3UYCA 2YYUA 1YDNA 1KLYA 5KZDA 2DZWA 3LBCA 4ZL1A 2EKCA 4O4VA 2CZDA 2YSWA 4GNJA 1K8XA 2WNQA 3A24A 1L6YA 2D73A 2DZXA 1EUNA 2Y88A 2ZBTA 2ZQ0A 3L21A 5FESA 4HNVA 4DBEA 1TTPA 4LRSA 3LHUA 4JR5A 3TJLA 4WOZA 5HMSA 3L5AA 4CCEA 1DKWA 3B05A 4L4LA 3LCXA 4KKXA 4ZZ9A 2Y89A 3NDOA 4BFAA 5AHNA 3T44A 1EX5A 1FWNA 4C1LA 4Z08A 1JCXA 3GAYA 2PCQA 3W7PA 3TC7A 3W7GA 3STCA 5IBXA 1PV8A 1OFOA 2EGZA 1W0MA 5G4WA 4LUJA 3VE9A 1H7OA 1JCJA 4QSHA 1S5TA 4UTWC 3INPA 3DFQA 3WK3A 1DV7A 1FQ0A 3KHJA 2VFIA 5D04C 5DY2A 1J2WA 4TR9A 1W1ZA 2X16A 3C2RA 1TPVA 4MVAA 3EX3A 4A2SA 4O1BA 3C6CA 3LTSA 4DO4A 1FXPA 1QAPA 3E02A 4A3UA 3BG5A 2TMDA 4UTLA 3U2OA 1GWJA 4IQLA 3PBUA 4JTKA 4WD0A 1PHQA 4X9SA 2VKZG 3F1QA 3T40A 1KFLA 3O8AA 4WX2A 2A7RA 2ZZ7A 1AMKA 4UFJA 4AF0A 1R46A 5CGQA 1DJNA 5G1YA 2ZFAA 1KM5A 1H62A 4LS1A 1YTKA 1ICSA 3MWAA 1YTEA 4O0ZA 1MEWA 3NQEA 1TYGA 3B0PA 4N02A 4O8RA 3UWVA 5MHBA 4EF8A 4DXVA 4I7VA 2X30A 3W2MA 4JTJA 1TB3A 4DO5A 1VPXA 3H54A 1EB3A 4DPQA 1MXSA 3KRSA 3SW6A 1TO3A 2QCNA 4FNRA 1JRCA 2H3DA 4AHQA 2ISSA 3PBVA 4MIMA 1VC4A 2Z1BA 5LHFA 2ZTKA 4FIQA 3UPBA 4N9CA 2CZ5A 4PCFA 3TE9A 4LVBA 3M5VA 1HFBA 2DU2A 4YL2A 1EPXA 3M16A 4ORIA 2Y62A 4GUGA 3SY5A 1C9DA 3PS7A 2Z6IA 1VLWA 2YYTA 1ME8A 5AYZA 4K38A 2G95A 1IGSA 1YDVA 3C61A 4RXFA 1JR1A 4YCOA 5J5RA 3W75A 2OZ0A 1VCGA 4JX5A 4M6VA 3TMLA 2BXVA 2V5LA 2C0AA 3OHIA 4K6AA 4E2DA 3DHFA 5L9FA 3G8RA 3LCGA 3UD6A 1L9WA 1ZJIA 5C2XA 2QAPA 3GAKA 3G8EA 1VYRA 1QOPA 3NXFA 1XDLA 3OIXA 4MZYA 3MP3A 5ABTA 1TTJA 4GC4A 4FNUA 2V8ZA 3TDFA 3I65A 3DENA 5CZ0A 3OA3A 5K9DA 3YPIA 3A5FA 2H3BA 1H63A 3JS3A 3G1YA 3NYZA 4BWLC 1KM2A 3HQ1A 5LNUA 1ZENA 3L68A 4UTWA 5F2IA 5LNSA 3GXNA 5D2XA 2YGYA 2GJNA 3W7NA 3S1WA 2E5CA 1WV2A 2DZVA 3QMTA 1P4CA 3U8GA 3I7RA 1QWGA 4IWWA 5LNWA 2A7NA 3CWOX 1A53A 3STFA 1IF2A 1OFQA 4JNMA 1B57A 1IXQA 3HMJG 2Z2UA 3W2NA 1W31A 3PUEA 4ML9A 3W2KA 1XDMA 3LI0A 4LC8A 1L6WA 1H5YA 3W71A 3PULA 1W8SA 1GQNA 3E12A 3TW6A 3EWWA 1PCWA 2W6RA 2JBMA 3KVMA 2FPYA 3BV4A 5J5DA 5FF4A 4OV4A 1XBVA 5D2WA 4O13A 1WQ5A 2A21A 3HGRA 5D37A 5U7SA 4U28A 1H7WA 4ZVJA 2NV2A 2CZEA 1W37A 2E6AA 1QDSA 3TROA 1C29A 3C56A 1VGAA 1TPC1 6TIMA 1OHLA 1HO4A 1UBSA 5DCBA 3G0XA 4WY0F 1KW1A 4X3ZA 5BMWA 1GYNA 1RQBA 5LGXA 3CU2A 5K9XA 3QM3A 5AC7A 5D2TA 1QNVA 4GFSA 4X22A 5CZSA 3W2JA 3LLDA 1OFDA 3BW4A 5BRBA 2QCDA 3TH6A 3LOTA 3PVFA 1WOBA 3W73A 2AGKA 2FTPA 4HKPA 4IUOA 2A85A 1DVJA 2Z0IA 4IMGA 4WY0B 3VE7A 4PEKA 3IEBA 2A6LA 5DXXA 4IMFA 1FUYA 3DGRA 2C6QA 3B0VC 3TAOA 4H6KA 4CLMA 1L2UA 4LOCA 4NQ1A 3R89A 3AJXA 1JVNA 3O05A 5CPNA 2RDTA 2ZA2A 4JTFA 1RQHA 3HF3A 3QSTA 3LXBA 2WSQA 4B5NA 4PL1A 5E93A 4GUHA 5AYXA 2DP3A 3TAKA 3IRDA 4ADSA 1LOSA 3CB8A 2ZA3A 5EYWA 5C54A 1FWRA 2NLIA 2QJIA 3C3NA 3MMTA 3PBWA 3MBDA 3NL5A 3RK8A 2VEMA 3R8RA 3B8DA 5K7JA 1VH7A 2ISVA 5FI8A 2HMCA 5D2VA 2OMAA 4FF7A 4O57A 4UFMA 4ZQOA 2J9YA 1OX5A 3PSWA 5K4ZA 4M6PA 3QMSA 3LHTA 1Q6QA 1UUOA 1JUBA 3MI2A 3W83A 1TRIA 1NEYA 1UUMA 3R5EA 3W7JA 2ZRVA 1LBLA 3B06A 3MW7A 1XKYA 5D02A 5DELA 4W9TA 3PC0A 4NVTA 5EA9A 3W86A 3N14A 1D3GA 4XBSA 3C8FA 2CLFA 1JUEA 5AHLA 4IXXA 1Y0EA 4GJ1A 3TFCA 3R13A 3LV5A 3G24A 4LS2A 2E6YA 2NUXA 1FCQA 1KLZA 1SW3A 4CQ9A 3QRHA 1NSJA 2CU0A 3FKKA 1MEIA 2B7OA 3H53A 3W7EA 3RMJA 5IM51 4YMZA 4JS3A 4JD4A 2G97A 4OT7A 1P5BA 2QKFA 4TU1A 1VRDA 3N73A 4JTLA 5DCEA 3TW7A 3QC3A 4MKNA 4JTUA 4Q32A 1XUUA 4ORMA 4NT0A 3NQVA 2QCDB 3VKJA 3S8HA 2NWRA 4IPJA 1IXOA 4ZQCA 3BGGA 4N4PA 3KOFA 2QCLA 2V2DA 3HGOA 4H4IA 2X1RA 3GXPA 3HO8A 4JY9A 4RCXA 5C6MA 4XZ9A 5AHIA 2DZTA 1OF8A 2NX1A 2RKXA 3B4UA 4NXKA 3GB6A 3W2UA 3EX1A 3HG5A 1ZHAA 3P74A 4K8EA 4UTMA 5EKYA 4FEZA 4UR7A 1V7YA 1H51A 2EHHA 3GX9A 3SSJA 3SZ8A 1OK4A 1TMHA 3GNDA 1Q45A 5D2YA 3UWZA 3UQNA 1D3HA 3HOJA 1PHWA 5HUPA 1G67A 3S5YA 3W76A 1OABA 3W1TA 2X1SA 4KFPA 1F5ZA 3SGUA 5KSWA 1I45A 1VHNA 3FKRA 4RZ5A 4Z1CA 3M43A 1N7KA 3FYOA 2VEIA 2Y7DA 2FJKA 3TA6A 2NUYA 3QW3A 3W1UA 8TIMA 1EA0A 4Y9AA 4AWSA 1YADA 3W3OA 1YPIA 4K36A 3IVSA 5BW6A 4RKAA 1KA9F 1TQJA 3W23A 4FIRA 4A2RA 1F73A 1KFBA 3W1AA 2GJLA 3PB2A 1EUAA 4O17A 4G1KA 3NOEA 3QF0A 4JDBA 1ONRA 2VFDA 3HB9A 5F4WA 5K4XA 3G1AA 4NJIA 4O16A 3CPRA 3P60A 3STEA 2H8XA 1LBFA 4FNTA 4E2BA 3QPZA 3MBFA 4EWND 1W56A 3DBPA 4NU7A 4WJEA 4N9BA 5H91A 4UFHA 5K9CA 3GR7A 1XBYA 5HWJA 3UZ5A 1XCFA 2ABBA 4AWTA 3FOKA 3DHDA 2HTMA 4UTUA 4ZQPA 4QNEA 5TIMA 4JICA 4Y6GA 1BWKA 3CM4A 4GUFA 4MOZA 3IVTA 3GKFA 1FBAA 2JKAA 4ICNA 2J9ZA 1G7VA 2J9XA 3HBLA 3TX9A 2X1TA 3G0SA 1A5SA 3M1ZA 1QMLA 3BO9A 2YW3A 3WJYA 2B0MA 3MYOA 1R2TA 3VFLA 3A5VA 3W7DA 1DBTA 2R94A 2YR1A 3Q37A 2YFOA 4LTSA 3DKJA 5I3GA 1YXYA 5L6UA 3NA8A 2JGYA 1KTBA 4FX7A 1DL3A 1Q6RA 1JULA 3G1FA 2BZNA 3MI6A 1ZAHA 4EVZA 4Z0SA 3W7MA 3BLEA 3G1XA 5EPDA 3G1HA 1C8VA 3A9IA 3FJ6A 2O7QA 3EXSA 3LCFA 3P5ZA 4O4WA 3UXAA 4BR1A 1LTDA 2R14A 3HPSA 4JY8A 1TSIA 3JRKA 5HJLA 5FF3A 2X2GA 1LOQA 1KM1A 5DCDA 4MYAA 1TPDA 1K7XA 4O18A 1WBJA 4O10A 3S1UA 2ZZ5A 1YDOA 2C19A 3PF3A 4RLIA 3IGUA 2Y70A 1RD5A 3M0ZA 4ADUA 1M7OA 3W1XA 4I7UA 3AO0A 4AEOA 1EIXA 3U6WA 4NJKA 4UNKA 3C52A 3W9ZA 1IIHA 2FFCA 3S5NA 1UJPA 3EXTA 4DBDA 2EF9A 4QM1A 3EWUA 2BX7A 3W1RA 4JYEA 2C13A 1DORA 4M7TA 4OBTA 1B4KA 5CPMA 2Q3RA 1LYXA 3I7SA 1GVSA 1SZEA 3LGEA 4DF2A 3TJXA 3S9YA 2BTMA 1QO2A 3EB2A 1RQEA 2B4GA 4QITA 2ZZ6A 1OFBA 4QIUA 2AAMA 1SFJA 3Q58A 4S1FA 3W7HA 2ZTJA 1VS1A 1GYLA 3OVQA 4L4MA 1VCFA 3BARA 5E1QA 3C0JA 1ADOA 1X8FA 3ELFA 2GQAA 3I7QA 1TREA 4UTTC 5EY5A 3QQ0A 4N6FA 2ISWA 1F05A 1DQXA 3O6CA 2OX1A 3VNDA 4WXYA 3DAQA 2TSYA 1VCVA 1TJRA 1HTIA 1N8FA 3FA5A 1I2PA 2C3ZA 3SFKA 1THFD 4XQ6A 3P8IA 3FS2A 5KZMA 1PE1A 2DJXA 2V2HA 4NJJA 2QCFA 1PL9A 1TCDA 1OYCA 4TO8A 4EIVA 4OGZA 3N9SA 3W70A 1JQVA 2CFFA 3CIWA 3LTPA 4JYDA 4O52A 4DF1A 4GBUA 1XM3A 4BK9A 2ATMA 4AHOA 2J88A 3W7IA 4BI7A 3D0CA 3PB0A 2GQ9A 1QCWA 3BW3A 2J24A 3KRUA 3BLFA 1H61A 3DFNA 3FFSA 2C1HA 3TQ0A 3NQCA 4HN4A 3HPXA 1LP6A 1QPRA 3HG4A 1J5TA 1OG0A 4LS0A 5AHMA 4FHAA 3TXVA 4WOQA 3LI1A 2V5BA 1AG1O 1NFBA 4UR8A 4NUWA 4PODA 3NM1A 2I1OA 3EWBX 3CC1A 5CPLA 3GK0A 4MZ1A 4GRSA 5C55A 3KAOA 1FWSA 1EEPA 4YLWA 3GR8A 3L0NA 3LLFA 1EP1A 4RX0A 4JXCA 5F4XA 1M6JA 3NZ1A 4U4MA 2GUUA 4I9AA 4FB7A 5CZTA 1OJXA 1NAL1 4NJGA 5DY3A 1LRNA 3CEUA 1XFBA 2Z6JA 4OV9A 5HINA 5F4SA 3S1VA 2P10A 3ANYA 3LTYA 1GVRA 2ZYFA 4RV8A 4PTNA 5F1UA 3L9CA 1Z42A 1KM6A 3CQ0A 2QJGA 1PCKA 2BLEA 4QNWA 1SW7A 2JGQA 5TQLA 1ML1A 3PAJA 3RFAA 5D32A 4KWWA 5AOUA 2RH9A 2A4AA 1RR2A 1BTMA 3EKLA 4ADTA 3NQDA 4RR4A 4NX0A 5CSSA 5SWUA 2Y7FA 3HG3A 3NQAA 3Q94A 3M5XA 1ALDA 4GUIA 3BG3A 1KBIA 4AF0B 3TFXA 4EF9A 3MO7A 3I6RA 4MFDA 2QUVA 1IIGA 3ATZA 2QDGA 4O1AA 1I2NA 2CLEA 3NPWA 4RZ6A 4UTTA 3LBMA 4MJMA 1ZAJA 3FEMA 1TRDA 3L66A 3GDRA 2OT1A 3NQ6A 3IIVA 1G6CA 4DQWA 2WNZA 3UWYA 3W84A 4IXHA 3LDVA 2C16A 1GOXA 2C15A 4FX6M 2CLLA 5HUOA 1QPOA 3V1PA 3S0CA 4X2RA 2YFNA 1OFPA 4MZ8A 1T99A 1FX6A 1SO6A 3W7CA 1KFJA 3GDTA 2WPBA 4O12A 3V75A 1LROA 3STGA 1SUXA 2V2CA 4HT3A 3TR2A 4MY9A 3LHZA 2WJZA 1SW0A 5K2ZA 3T55A 5HNRA 1R2RA 3HGJA 1W3IA 1ZY9A 2B7NA 4IGHA 5TBOA 3G18A 3UWQA 3IIZA 4WZHA 4JX6A 5K3VA 2HS6A 3GIYA 2VFGA 3KVKA 4UFIA 3LCHA 1TV7A 4XTIA 3C4UA 5G2WA 3MP4A 3G0UA 3B03A 4HIBA 4UFKA 1HG3A 4CCCA 3R12A 1YTDA 4HNNA 3RNDA 4IOTA 2DZUA 3A23A 1R30A 1SQ7A 4HHPA 5F2LA 1LOLA 3NL3A 1LORA 1D9EA 1OX4A 4UUIA 2OJPA 1W5MA 2UV8G 1K3UA 3LXAA 3M41A 1O4UA 1WDWA 1X1ZA 4DF0A 1VLIA 3H55A 3TQVA 3W87A 1FCVA 1MO0A 3MI3A 1VZWA 4UIOA 3NQ8A 4Z1DA 4NZJA 4IJBA 3NG3A 4PH6A 2B7PA 3CWNA 4JIPA 4O0KA 4HSOA 2WOQA 3E0IA 5AB3A 3BK0A 3P5YA 1K03A 3NNTA 3S42A 2JKPA 5LKYA 1W5QA 5KINA 2GVLA 1LLZA 4JEQA 3T7VA 2NZLA 2JKEA 3L0KA 4PFMA 3QQ1A 4FXSA 4OQVA 5AN7A 1PVNA 4MLJA 5DBUA 2RFGA 4O19A 3Q2DA 4BWLA 1MEHA 4N9DA 3TK7A 2ZRYA 4ZQMA 1I2OA 4PL2A 4K7YA 3CTLA 2A7PA 1A5BA 2PURA 3WK1A 2VEPA 3TQKA 1LRQA 1XI3A 3HG2A 4NZFA 4N9EA 1FXQA 3TSMA 3UNDA 2WQPA 4JX4A 3UPWA 4POCA 5DN1A 3W7OA 4JTSA 3VCRA 1LBMA 2XFWA 3ZWTA 2V30A 4ALDA 1W5PA 5AFDA 2CLMA 1B9BA 5E0KA 3PWAA 3CT7A 4MJZA 4UXDA 3NPVA 3BGJA 4MLRA 2E6DA 4TMBA 3RLVA 4UTIA 4PC8A 4Y8FA 2AQWA 3PUOA 3W7RA 3OVRA 1U83A 1HUVA 5D30A 2QUTA 2GPTA 1YXDA 4ZQNA 1VR6A 1RVGA 2QF7A 5CSRA 4QAIA 3L2IA 1H7NA 1TV8A 1ZAIA 1LLWA 5I3JA 1H7PA 1OYBA 2Y61A 3BLIA 3NVTA 1OX4B 4MY1A 2OCZA 1F6KA 4LWWA 4RK8A 4D2JA 5CPOA 3GXTA 3QJAA 3CLMA 3LCWA 3PG9A 3HIJA 4OWGA 4HPJA 2YW4A 3DH7A 5I3IA 3UZJA 2P0OA 3W1NA 3M44A 2A1YA 2QCGA 1WOAA 1T96A 3EX2A 3GLCA 2QCMA 5FEZA 2WO5A 3KRZA 2A6NA 4FO4A 4E38A 5G2IA 2PRLA 2QDHA 3TIMA 1KFCA 1SO5A 1T0OA 1AL8A 4IMEA 3OBKA 5EBUA 1WX0A 3LHWA 3MYPA 1OFAA 1XC4A 1OVDA 4K7VA 4JN6A 2WKJA 2BWGA 2ALDA 1ICQA 4JTGA 3W22A 3SI9A 2DJLA 3L5MA 5HR6A 4AAJA 4HNTA 3GDMA 4O15A 2Y63A 1B4EA 3G1SA 5EMUA 1G4PA 3M7WA 4Q4KA 5HWMA 2BSLA 2TPSA 5KMYA 3P8JA 1QPNA 4E0CA 2J6XA 1Z48A 4MY8A 4P2VA 1RZMA 4LY8A 3ZWSA 4IX0A 1OK6A 4UCGA 4LV4A 1GVFA 2XN1A 1O5KA 2ZZ2A 4OHQA 4FNSA 1GPWA 2H90A 1KBJA 3GDKA 1S5WA 1ZFJA 3G1VA 5FF7A 3T4CA 2YXGA 7TIMA 3N34A 3CIXA 4O50A 4UFLA 4LC6A 3P81A 3W1LA 3NM3A 3KX6A 3C2EA 4UMAA 3TCEA 1U5JA 2XN0A 3BW2A 3QFEA 1L6SA 3W7QA 3DFSA 3CEPA 2FPVA 1GG0A 2E1DA 4N4QA 3O6YX 1LRTA 3DFOA 2R91A 2QJHA 3FIGA 4M5PA 5DXYA 3LB0A 1TV5A 3QSRA 2NUWA 1VJIA 3L65A 2A5HA 1KFEA 3P82A 5GVJA 1AW2A 1KM3A 3IV3A 5AHEA 1JQXA 2WSYA 3I68A 3KVJA 4LVGA 3T78A 4CNOA 1OF6A 3FYPA 5KZEA 3TSDA 2H8ZA 3ZS4A 4N6EA 3NL6A 4FX8A 5DBTA 1M5WA 3W7LA 4UTKA 5BMXA 4BI5A 4LVFA 2QUUA 3UY8A 1LM1A 3OG3A 5LSMA 1X6UA 1A5AA 2ZRXA 5G4EA 3WK2A 3TU9A 3ABQA 1TJPA 1KTCA 3IIPA 4O1DA 2PRMA 4Z0JA 4XUGA 1QPQA 3ATYA 4O1CA 5LZLA 4KWVA 3NL2A 3LXCA 5BOOA 3WK0A 3NPUA 4H3DA 2PRHA 5HULA 3M5ZA 4UTJA 1UCWA 3OEXA 3ABSA 1M7PA 1BWLA 1ME9A 3L67A 3C2OA 3NPXA 4LW7A 5C5YA 3GDLA 3A22A 3P67A 1S5VA 1MZHA 3LM7A 4LVAA 1VHCA 5G1TA 5I3KA 1WBHA 1FDZA 3P84A 1KV8A 4M19A 2C18A 2QCEA 4S2BA 3ZR4A 1G4EA 4AXKA 4QJ1A 1SSGA 3EWZA 3LX9A 3IGSA 3PG8A 1Z41A 1T8XA 1W3TA 3L0GA 4K37A 5AC8A 4CQ8A 2CZFA 1SZNA 4XWUA 1O94A 1GG1A 1B3OA 1FWTA 2NXGA 3PR2A 3QMRA 1OYAA 3SECA 3WJSA 5D38A 1FCBA 3O63A 4NXSA 1SO4A 5LNRA 4O54A 1A50A 3FJLA 5CZJA 2V0TA 3W07A 4QQ3A 2QEZA 3NR0A 2LLEA 4IPIA 4UMBA 3KXQA 5D03A 4AH7A 2F7FA 4RXGA 3QW4B 3G3DA 2VFHA 2YCEA 4R7JA 1NF0A 2ABAA 3P7YA 4A29A 5FF2A 1RPXA 3G1DA 3O6DA 3DZ1A 4WQ6A 4RJEA 5G2HA 1EWDA 1O95A 1IXNA 2G96A 3FLUA 3NZRA 4GWEA 5CG7A 2CLHA 2V82A 1W5OA 2ZZ4A 4P61A 1QO5A 1VQTA 1KM0A 3TNOA 4DO6A 2E68A 3HGSA 1TQXA 6ALDA 1HL2A 2FPTA 1GTEA 1WA3A 1WAUA 5AHFA 4TMCA 1K7EA 2DORA 1SR9A 1FWWA 3MJYA 4R53A 3LV6A 3LCLA 4ONVA 3BG9A 2GVJA 1Q6LA 4KFNA 4QISA 3PSVA 3S1XA 1I2RA 2W79A 3RU6A 3BPWA 3O15A 3PY2A 2ZZ3A 1BEUA 4PA8A 1EP2A 3W74A 4TIMA 1VYPX 4Q33A 2PC4A 4K8HA 1XBZA 3IVUA 3GZ3A 2NX9A 3RLUA 1GTHA 1R47A 1KTNA 2W0UA 1XXXA 3S6DA 4CNNA 1K8ZA 1TPEA 1PS9A 3MHUA 1YPFA 2RDWA 4UMCA 1R2SA 4WY0A 2E77A 1JRBA 3E49A 3BVJA 1GJPA 2NXHA 1CX9A 5HR7A 1SPQA 4JDYA 3DKLA 3QH2A 4LT9A 4DELA 2CLKA 4Y96A 1F2JA 3DFTA 3CHVA 5HQEA 3USBA 4J9JA 4TX9A 5FF0A 4HSNA 1SZFA 5I3HA 4MPQA 3UWUA 1YLVA 2YPIA 3GYEA 4YWIA 1F74A 1H1ZA 2NX3A 2Q8LA 5LHEA 5A8GA 1ICPA 1IXPA 1FY6A 3NAVA 5F2GA 4GXMA 3NEVA 4UTHA 2G5WA 5AC6A 4O14A 3EX6A 4XBKA 5I3FA 3PUDA 2NV1A 4BF9A 1UASA 3GKAA 1AL7A 1WXJA 2GQ8A 4RZ4A 4GUJA 2RDUA 4NNBA 3W6YA 3QEZA 3GVGA 3LCIA 1QOQA 4JYFA 2V81A 2EAWA 5U4NA 2VFFA 3O16A 4XTDA 3WFAA 2O7SA 2WSRA 1SZGA 3LHVA 3TKFA 2E5DA 3M6YA 3EKZA 2GOUA 1K8YA 1SFLA 1DQWA 1VYSX 3WJXA
chains in the Genus database with same CATH superfamily
1LZOA 2FLIA 1ZNNA 2GWNA 8RUCA 3VOHA 1R0MA 3W37A 2FZMA 4M56A 2OEKA 5JBFA 2W67A 1Z44A 1JZ8A 5G1MA 1NVMA 3O06A 1FWCC 2QV4A 1E0WA 1XYZA 4QJ5B 1LCOA 3TN5A 4PGLA 4DJFC 1K1DA 4PN2A 1F6PA 3R4IA 4GI6A 3ZYZA 5C0QA 4A22A 1EL3A 3PM6A 3EEGA 4MWAC 4U2ZA 4B91A 3L4YA 3A3XA 4MDPA 5D33A 1XQKA 4XKYA 4HA3A 1V3MA 5CKSA 2VEKA 1Q6OA 3MS8A 3TV8A 3WUBA 1CDGA 1W9PA 1KRBC 4UOQA 4DI8A 4QLLA 2CC0A 3NO3A 1EYWA 1TIMA 2C7FA 1C8XA 2F6UA 2FIQA 5T26A 1VFHA 3R8GA 3DFHA 3LRLA 3ES8A 4Y9MA 1NP2A 1EZWA 2PWDA 1ZJHA 3GH5A 1TTQA 1ODUA 1GOWA 4OIFA 4QQUA 1S38A 4ECLA 1UD2A 1EJUC 2VELA 2KZHA 3EGJA 3IJDA 1V7AA 3BSMA 2Y0FA 3TYBA 2TRSA 1J9YA 3MZNA 3NURA 2V5JA 2DZSA 3CBWA 1PKYA 1VFUA 5CJ5A 1LWIA 1EYEA 4F66A 3TW9A 2VRJA 1BKSA 3VKBA 4IIEA 1BQCA 4EAMA 4DPPA 1VPQA 2JK2A 1O1ZA 1MXDA 2P8BA 2X1UA 3JZUA 1I4NA 1NDZA 1K70A 3TUUA 3TN3A 2VRKA 1GZGA 1K9FA 2ZA1A 2Z24A 1J01A 3CHCA 4AC7C 3CH9A 4AZ7A 1UJQA 5HQLA 2QPXA 3R0UA 3WF3A 3D46A 3WD1A 1Q6EA 3W72A 1XGZA 1W8GA 1RCXB 3RX3A 2X7VA 4ZQRA 1V79A 1PWMA 3GRIA 2PTXA 3UYIA 2GWGA 3M47A 3QPYA 4NJHA 4L6HA 3FHQA 3KVLA 2I9EA 4MTVA 4EPKA 1LQAA 3RJYA 2CW6A 4NI8A 2WB5A 3MP5A 3S5OA 5H2ZA 1W5NA 1LQ2A 3ZVHA 5I00A 1KM4A 2E5BA 3T0AA 4PB5A 1AJZA 4EK7A 3C2VA 4W4QA 1VAHA 3VD7A 1KD0A 3KE0A 1AW5A 1OADA 2WANA 1C92A 2WMIB 3WJWA 3ITOA 4LJ3A 2VCAA 2OTDA 2Y7EA 1S2UA 3EPMA 4AIUA 3QXBA 5JVLA 1H7RA 1JEZA 1AZ2A 3AXKA 1ELSA 1R3WA 1QR7A 4LNYA 5FEWA 3N29A 4C1KA 1D2KA 3EPOA 1UOZA 3O2LA 4M7SA 1C7TA 4P8UA 3OIHA 4MUZA 5IDIA 1S3HA 3R58A 1PZ2A 4CQAA 4XIMA 5LA0A 4GH1A 1AW1A 4PFHA 4NX5A 3ARYA 1E0XA 5F1VA 2EPKX 2GQ3A 1NF7A 2J74A 1QNRA 2J79A 3C2FA 3AYRA 3K8MA 1OSEA 1Q2SA 3OVPA 3N2XA 1VPYA 2VXNA 3DFYA 3RPDA 4LVDA 5D05A 3OLGA 4ZMGA 2OFJA 2X42A 4UZSA 1CENA 3MHGA 5XIAA 4AMAA 3MANA 4KFOA 4CCDA 7PTDA 3PZTA 1C93A 3AXXA 3WQ4A 2IMRA 1I8JA 2WV8A 3CHDA 1SFSA 1HNYA 4NAEB 4F9JA 4KCTA 2RHGA 4NF7A 2JF6A 1OWQA 3SAZA 2PGRA 3I3BA 5EMKA 3WQVA 5CJMA 1YDNA 1TX2A 4E6MA 1KLYA 5HOSA 4ZEPA 1QW9A 3LBCA 1A5LC 3SM0A 4PYSA 1XIGA 1FH8A 3PHAA 3M07A 1XCWA 1XLEA 5AECA 1K8XA 3KL3A 4OZOA 3AS3A 4MF4A 1HW6A 1N8IA 1Q7ZA 2DZXA 1EUNA 2Y88A 2ZQ0A 3TP4A 1XSKA 3SGGA 4WOZA 2J7EA 1JNEA 4ZE5A 2CKSA 4BFAA 2INEA 4S3AA 3D5HA 3SN1A 1CGXA 1FWNA 3GAYA 3W81A 2E7FA 3TC7A 5IBXA 4MGGA 2GGIA 2EGZA 3UJSA 1W0MA 4UQCA 3G6MA 4HN8A 3V18A 4DYEA 1ZCCA 3N4EA 2ZUUA 3GTXA 4GA8A 3INPA 3WK3A 4XSMA 4DJFD 4PMJA 4TR9A 4BF7A 2X16A 3UJ2A 4MVAA 4O1BA 3VA8A 4MWAD 3LTSA 1FXPA 1J5SA 3OZYA 2TMDA 3U2OA 1GWJA 4IQLA 2OYMA 1PHQA 2VKZG 3O8AA 1EBHA 2A7RA 4UFJA 5EMMA 1R46A 3RN6A 2POZA 4B5XA 5G1YA 4GIRA 2PLKA 2ZFAA 2IKIA 5CGTA 4H6RA 2Y4SA 5AZ1A 3MCMA 1UW9A 5J8LA 1MEWA 2WZTA 2PDJA 3NQEA 1TYGA 1WKEA 1ZU8A 3QHOA 4N02A 2FVKA 4O8RA 5MHBA 4LAMA 4DXVA 1XYLA 3TNBA 4JTRA 4AIBA 5C8BB 1TB3A 1HL8A 1VPXA 1ZJBA 1G01A 4IZGA 1DWGM 1W1VA 3THCA 4DBSA 4G6CA 1J10A 3BCJA 3PBVA 1L2QA 1CNVA 4FIQA 3V0TA 3S1GA 1JZ6A 3AS0A 3TE9A 4LVBA 2DU2A 3ZJ7A 1EPXA 3MUCA 4ORIA 3RGTA 1C9DA 3PS7A 1UKTA 4C7FA 2Z6IA 1ME8A 2J25A 2G95A 3KBVA 1IGSA 3CZ8A 1G0CA 4IIGA 1YE4A 3QHNA 3UPMA 4YCOA 5J5RA 1M53A 3F5LA 2D0FA 4JX5A 4K6AA 1SGJA 3DHFA 1R3YA 4BF5A 1EJSC 1ZJIA 4Y2WA 1A5UA 1MUCA 4YJ5A 1PX3A 1QOPA 3NXFA 4CKQA 1AUSL 4A8RA 3BOXA 4PTMA 3OIXA 4MZYA 3MP3A 5CQ1A 1MFUA 4TTGA 1TTJA 4GC4A 1QHPA 3I65A 4B5VA 3MA8A 5K9DA 4AZCA 2XINA 4JBRA 3JS3A 4IQJA 1EHNA 3W7NA 1E56A 3UCDA 1W9BM 1KCLA 3U2EA 1S2TA 1P4CA 1QWGA 1OCQA 4RDVA 3CWOX 4HVXA 2VRQA 1IEXA 3BCDA 2PDQA 4LGXA 3CUZA 1IXQA 3HMJG 2Z2UA 4CVWA 3PUEA 4S3DA 1IQ8A 3B9NA 1FWHC 2FZDA 4ZO9A 3E12A 1XG4A 1DJHA 4AFYA 2W6RA 1EBGA 3BV4A 1S1PA 4WEVX 4OV4A 5D2WA 1WQ5A 2A21A 2VYOA 3UG3A 1E4NA 4ZVJA 2NV2A 2XM1A 1RJRA 4PCPA 3LY0A 3H7RA 1C29A 1EC9A 4DRSA 3WF0A 4HMDA 1GOOA 5DCBA 4X3ZA 5BMWA 1GYNA 4Q7BA 2PUZA 2ZDSA 5AC7A 4KMQA 4GFSA 3W2JA 1OFDA 3BW4A 2QCDA 2Z28A 2O9PA 2FTPA 1OIFA 2IKHA 4M82A 3VE7A 3IEBA 2A6LA 3BDKA 5DXXA 3W4RA 1ENUA 4H1ZA 3R1ZA 4HP5A 1Q8JA 2ZC1A 4KW2A 3RX2A 5FACA 3LXBA 1VBRA 1JAEA 4B5NA 4G1NA 2VNCA 4FOJA 3ZM8A 4K1WA 4M3PA 1RALA 2XH2A 1LOSA 2WM0A 5EYWA 3MV01 1FWRA 1ADSA 4J2PA 3MWCA 1E3ZA 3PBWA 1XF0A 2IPGA 2V63A 3M0YA 3SCOA 2QT3A 3ERPA 4HSHA 3A64A 1S5NA 3B8DA 2GSHA 2ISVA 5FI8A 2HMCA 3VXGA 4O57A 3KS5A 4NZCA 3VILA 2XTKA 3PJUA 3GG8A 2PDNA 3R0KA 2V5KA 4HCDA 1WAWA 2Y8UA 4HTYA 1TE6A 1TRIA 4BHYA 1SZRA 1CLVA 3B06A 1XKYA 5ABHA 1EO5A 4W9TA 3AJ7A 3PC0A 3GXDA 4QG6A 2ZX7A 4ZO8A 1D3GA 4HOZA 3QOMA 2CLFA 4QE4A 4X0NA 5AZ0A 2QW5A 1Q6GA 2PTZA 1G94A 3CPGA 1Y65A 3LV5A 1QK2A 1MRAA 3VU2A 1TZZA 2CU0A 4WKFA 2B7OA 2OQHA 3W7EA 5FJTA 1RHCA 2HNEA 3EB4A 4H9ZA 3BLLA 3UR8A 3WLPA 1XUUA 4ORMA 5M2FX 3S8HA 3FK4A 1QWKA 4ZQCA 2QCLA 3R0DA 3HGOA 4GKLA 2GDUA 1PWLA 4DJDC 2X1RA 4JY9A 1DHKA 4RCXA 1AD1A 1E4MM 1BHGA 1MDLA 3HG5A 4DUWA 4GXPA 5H8UA 3D47A 3SQSA 1V7YA 1H51A 2ZUWA 3AIWA 3SSJA 1OK4A 2HXTA 5D2YA 1EJWC 3FA3A 4P8VA 2QUNA 2X1SA 3C0LA 3SCVA 4KS0A 3FKRA 4IT1A 3VC6A 2VEIA 2Y7DA 3U3HA 3TA6A 5H6HA 4QJ4B 1M68A 2NUYA 2GSJA 1S1RA 4K36A 3IVSA 3ARWA 5BW6A 4RKAA 1TQJA 1XCXA 4ROPA 5A8OA 2WAGA 1W17A 3LPPA 2XSXA 4G1KA 3LA4A 1RUSA 2VFDA 2YZ5A 4PUKA 2D2OA 4O16A 3P60A 3DECA 4G5DA 1XLHA 3MBFA 1W56A 4NU7A 4JN8A 5H91A 1JDCA 3N11A 1A5NC 4AWTA 2HPMA 3FOKA 2XIIA 3DHDA 2HTMA 3UG5A 5HNUA 3TVAA 2X40A 4QNEA 5TIMA 3L4WA 4V15A 4MOZA 3GKFA 4RDWA 5HK4A 2JKAA 1GCYA 2CETA 4AISA 1VFLA 1G7VA 2J9XA 1JXKA 3M1ZA 1QMLA 3PJWA 2B0MA 1P6WA 7ODCA 3AI0A 3MYOA 2G3FA 5A1AA 2R94A 1W1TA 2YFOA 4PMXA 2YJQA 3C2YA 1RP8A 1OG6A 2BXYA 2GLKA 2QNEA 3T9PA 4FX7A 1Q6RA 4U5KA 1YRRA 3REQB 3MI6A 1OB0A 4Z0SA 3EA3A 4B9ZA 1QW8A 4GHRA 1NY1A 3P5ZA 4O4WA 2R14A 3EA2A 3HPSA 4JY8A 4C6OA 4QR6A 2EQDA 1A5KC 3FW6A 4MYAA 1TPDA 2YLAA 4KWSA 2NSXA 1X6LA 4Y9PA 2ZZ5A 4H01A 3ITGA 3Q67A 1YDOA 2C19A 1J96A 1V3KA 3AO0A 3VNZA 4UNKA 2E9MA 4KQNA 3S5NA 2VZOA 1Y5VA 4DBDA 2EF9A 3S46A 3WDHA 4RPQA 3W1RA 4M7TA 2C13A 2GGJA 3EDKA 4ZTYA 4GH3A 4J27A 1XD1A 1GVSA 3KOWA 1NOWA 5H1WA 1QVBA 3EB2A 3SRDA 3GC2A 4TOQA 4S1FA 2MNRA 1VS1A 5HNNA 1VCFA 2J75A 3ELFA 1PZ3A 4P8WA 1Q6CA 5EY5A 4ES4A 1UROA 3ZR5A 3QQ0A 2EG7A 1Z7AA 1F05A 2OX1A 3ZR6A 1VKFA 1TJRA 1HTIA 2PDYA 2OU4A 1GOIA 4HMCA 1I2PA 4EPEC 2QVNA 4EXQA 1THFD 3USZA 3P8IA 3FS2A 5KZMA 1PE1A 2V2HA 4NJJA 4A3YA 3GSMA 5CG0A 5CPTA 4RNIA 4EIVA 3H24A 3EB3A 1NWUA 1XSIA 4DF1A 1RK6A 4NYUA 1A3WA 2ATMA 5HPCA 4AHOA 4LCSA 1XLGA 5TNVA 3D0CA 2Y5EA 2EJAA 4L56A 4L7ZA 2PCEA 4DX3A 3KW3A 3SCUA 3STPA 1ZB5A 1G1YA 1OG0A 3VIFA 2E67A 4KRTA 5AHMA 4FHAA 4NYYA 3TXVA 5DT7A 2BGNE 3ZQ9A 1AG1O 4UR8A 4NUWA 4KESA 4W8LA 3S83A 1XLKA 3NM1A 5CPLA 4MZ1A 1QRQA 3XIMA 1JI2A 5I7GA 3KAOA 1EA9C 3WQ6A 3S4TA 3GR8A 3A3WA 1TJ2A 3LLFA 1QNSA 3WD2A 4EWJA 2ACSA 4EE9A 1BD0A 4KCVA 3M0IA 4P7QA 2GUUA 4I9AA 2WYSA 5JIWA 4G9PA 3UP8A 4FB7A 4JIEA 3TYZA 4NJGA 5DY3A 1LRNA 3CEUA 3MSGA 3GUGA 4DJEC 2Z6JA 2HROA 5F4SA 2P10A 2ZYFA 4RV8A 3QLLA 2QJGA 2JGQA 1ML1A 1CGUA 1FRBA 2R1PA 4ZO7A 5EMYA 4TVDA 1JPDX 5AOUA 1ZGDA 3ES7A 3THUA 2A4AA 3UZZA 2DVXA 1V93A 3EEZA 4ADTA 3NQDA 2ZUSA 4RR4A 4DJDD 3WLMA 4DNHA 3ARRA 2PDKA 3NQAA 3Q94A 5M3WA 2FH6A 3UZWA 4EF9A 3MO7A 5IFPA 4HMNA 4Q3MA 3RLHA 2UY2A 4F8XA 4LEQA 3S2JA 4KT2A 3NPWA 3AAMA 3UGVA 4C6CA 4UTTA 3NIYA 1ZAJA 5FD0A 3TYEA 3L66A 1VFFA 4DQWA 2WNZA 1JPIA 4DIAA 3LDVA 3QGKC 2C16A 1GOXA 3N04A 3CQIA 4FX6M 1CZ1A 3QV8A 2CLLA 3IGHX 3MSRA 2QYGA 1C8QA 3KP0A 1OFPA 1E1EA 1T99A 1SO6A 1KFJA 2WPBA 1W3LA 3KTXA 1L8NA 1VFSA 1YE6A 3STGA 4MY9A 1WE5A 3BAWA 5K2ZA 2PGEA 5HNRA 1ZY9A 1KXQA 1XRSA 3UFYA 2P76A 4LF1A 3NZQA 4QROA 3UWQA 3GIYA 3VD4A 3KVKA 1TV7A 4XTIA 3MP4A 3AHTA 4HIBA 4UFKA 4CCCA 1NFGA 4G7EB 2R9RA 4HNNA 3RNDA 2D0HA 4IOTA 3M0XA 4KWOA 5DRCA 1H3GA 1SQ7A 3CH0A 4KRUA 3EYPA 4PMYA 1LOLA 1LORA 5D9PA 3DC0A 1D9EA 1UMYA 4UUIA 2H9AB 3GXIA 1PDZA 4G2DA 1XLBA 1XIEA 1MQPA 3QY6A 1O4UA 2Z26A 1QXLA 2ACQA 3SY1A 5CSYA 4DF0A 4J3ZA 3H55A 3WQPA 4GZJA 4PUEA 3WLIA 2GFTA 2QJJA 2CYGA 4FK9A 4GIAA 4UIOA 3NQ8A 5E9AA 4IJBA 3R25A 2XJ7A 3CWNA 2D24A 3NXLA 4JIPA 4LALA 4O0KA 2HV5A 3E0IA 1TIWA 3P5YA 3S42A 2Z1SA 5KINA 2W91A 3LK6A 4B15A 4JNYA 1F07A 1JPMA 2CIPA 5D8ZA 4JEQA 4DVOA 2JKEA 4H04A 3QQ1A 4X0VA 3AHVA 1YMYA 5AN7A 1NH6A 1PVNA 4MLJA 2RFGA 3WBXA 4GNKB 4LAOA 3AXIA 4MWAE 1AH0A 1A4MA 4PL2A 3CTLA 2GVEA 4E4UA 4JEJA 3WK1A 8CGTA 4X63A 1B3XA 4NZFA 4JHOA 3W24A 3TSMA 4ASTA 4GYPA 2WQPA 4JX4A 2IQ0A 2PPGA 2EKGA 4POCA 2ACRA 3TN4A 3XISA 5I02A 1B9BA 4PUJA 3BGJA 2ODOA 4C1NB 4LUSB 3P14A 2AQWA 3PUOA 3LUTA 1HUVA 5D4YA 1JNDA 1GW9A 2O0TA 3WIJA 4ZQNA 3CUHA 1ZBWA 1O66A 1GNXA 4PULA 2PF8A 2QJNA 2VD8A 3R8HA 1KB3A 3HPFA 4F0SA 5JU6A 2C71A 2Y61A 4IPNB 4IG2A 4MSSA 4RK8A 2EG8A 3ECQA 4B5TA 3GXTA 3UZYA 1V6TA 4DZHA 4L1XA 3L2LA 4J5NA 3HN3A 2QPUA 3WLKX 2YW4A 5HXMA 3DH7A 1YNQA 5I3IA 3UZJA 2HQAA 4HPGA 1ISXA 1V4YA 3A13A 4JTQA 2Z4GA 2VD9A 2WO5A 1O5QA 3VABA 8A3HA 4FO4A 4E5TA 2PRLA 3TIMA 3FSUA 4ATLA 1KKRA 2ACUA 4IMEA 1X97A 1M1BA 3OBKA 2QGYA 2YDQA 3EWDA 1RCQA 5B7YA 2XU2A 2BY1A 4AD5A 5E6YA 9CGTA 5IRPA 4AAJA 4IMAA 2X0YA 3KOXA 3CXOA 4Q4KA 3TTYA 2TPSA 1DIDA 2J6XA 3FN9A 4I9JA 4LY8A 1E9IA 4IX0A 3PN8A 1OK6A 2VZTA 4PUMA 2JF7A 1ZPTA 2XN1A 1JZ5A 4OHQA 1UH2A 3H2AA 1KBJA 2HBXA 4DJED 3T81A 1KRCC 5BXRA 7A3HA 3KCLA 2E4TA 4GVIA 3WX7A 4NKCA 3TYCA 2YCIX 2YXGA 3VIIA 3N34A 2YKKA 4LC6A 3IJLA 3W1LA 5FJRA 3KX6A 4UMAA 3AMKA 1I1WA 1DJXA 3W7QA 3TEVA 3WFLA 2FPVA 1GG0A 4N4QA 1LRTA 3DFOA 3FIGA 5DXYA 5CH9A 1JD7A 2WSKA 2C1IA 3V0UA 3IAQA 4HHLA 1VJIA 1YX1A 2CHOA 4DWSC 3WF1A 1QHOA 2DVTA 2IPFA 2DIJA 3IV3A 3I68A 3KVJA 1QUMA 3GFXA 1EOKA 5A6BD 3OBAA 4AG0A 1U2YA 3ZS4A 3MMDA 4N6EA 3CT2A 1UC4A 1E72M 4XX6A 3POCA 4AZ6A 2WHLA 1RY0A 4AU0A 5DBTA 1XLCA 3T09A 4AQLA 4UTKA 5EFFA 4LVFA 1DJIA 4M1RA 1C91A 3OG3A 4B5SA 2ZRXA 3EOEA 4WIWA 1A3XA 5G4EA 5KEZA 3AWNA 3TU9A 3ABQA 1KTCA 4XUGA 1BG9A 3MVIA 3PBMA 3H2OA 5BOOA 3WK0A 3O6AA 4H3DA 4R27A 1XICA 2OO0A 3T0BA 1BWLA 1JPHA 5C5YA 4Q7NA 3A4JA 4HHMA 1MZHA 4RW3A 5AYBA 1VHCA 5G1TA 2WLZA 1WBHA 4QX4A 4I3GA 2NLYA 4GZEA 3MMUA 4E8DA 2C18A 1NWRA 1QASA 5BOFA 1HF6A 3EDJA 5HAOA 4XG1A 2BHYA 3LX9A 3AHYA 3PG8A 1Z41A 2ZUVA 3FXYA 3L0GA 3TYUA 2CZFA 2I9UA 4Z2IA 1DJYA 1GG1A 4GIYA 2VP8A 1FWTA 4F4RA 2BHUA 1FCBA 2OGJA 3R11A 1E15A 1HZYA 3SIMA 5CZJA 2POTA 2L5HA 3GVQA 4NY2A 2AL2A 5AYIA 2OYKA 3W07A 3HV9A 2QEZA 4MMWA 1UC5A 1VBHA 1U1HA 4F0LA 2ISFA 3KXQA 2GUYA 5D03A 1OC5A 4LAUA 4RXGA 4KEVA 3SCPA 2VFHA 1F3XA 1NF0A 2ABAA 2BGQA 3PJXA 4S38A 2R1KA 1RPXA 3G1DA 1Z3NA 3EWCA 4WQ6A 1B30A 4PCTA 4REQA 5G2HA 4U31A 3PZIA 3RX4A 2D3LA 4C6EA 1W5OA 2ZZ4A 4Y9NA 3WNLA 4P61A 3QY8A 4QBXA 1QO5A 2MUCA 1YBQA 4KEUA 1TQXA 6ALDA 1RXOB 1QNPA 3GY1A 3C0SA 1ISVA 3QZ6A 4XIAA 1FKWA 1GTEA 3AU2A 4XZWA 4TMCA 1K7EA 4HNOA 4UBPC 3VINA 3WZ0E 4R53A 4A3HA 3WL0A 3LV6A 3DERA 4ONVA 4Q22A 4KFNA 4QISA 3U7BA 2ZE3A 3WMSA 3KCOA 1JDDA 2Z1WA 1EEXA 2W79A 1DWJM 5HBFA 3BPWA 3HPAA 5FJJA 3HZ3A 1S2WA 5REQA 3PY2A 4QCFA 1TELA 1N8WA 4TIMA 1VYPX 4RUBA 2ADAA 5FJUA 1GZJA 1E6PA 5CC7A 3GR4A 4GC3A 3RXZA 2GDQA 3S9IA 2QMJA 1YPFA 1UKSA 1R2SA 3V3WA 2WZEA 1JRBA 1GJPA 4Z2HA 4GCAA 5HR7A 1FHDA 1JYXA 4OJYA 3DKLA 2VC7A 1MNZA 4LT9A 2CLKA 3TZFA 1F2JA 4EACA 2BB0A 3B8TA 5HQEA 4J9JA 4UQEA 5FF0A 4GJJA 2PLJA 4Q8QA 2QDDA 3MUIA 1JDEA 3RO8A 3WQGA 5ENLA 3ANVA 1QHZA 3NAVA 4D8AA 5C9XA 5JQ9A 2G5WA 5I3FA 1XH1A 4HNLA 3GKAA 1EHAA 4RZ4A 4D6EA 2RDUA 1QJWA 3GVGA 4L1WA 5TD4A 3DYOA 1QOQA 4JYFA 1V3JA 2ANUA 2DDXA 3WFAA 2O7SA 5D9MA 3M6YA 3VD3A 4ZXOA 4MDOA 3EKZA 3WBWA 1DQWA 3QVQA 4JGDA 1J2BA 4JFWA 3B0YA 4IGMA 3HPZA 1M9HA 2J27A 3AIEA 1HGWA 2ZUNA 1W3NA 3SGZA 1HJWA 3VKKA 1XYAA 3F2DA 4KERA 1LLOA 4EOUA 3L5LA 1LF1A 3EWYA 4H9MA 1B3YA 3QZEA 3CUFA 2WC3A 5D09A 1OGGA 3F4NA 1XFCA 5A6LA 2WM1A 4H9YA 3F4WA 4P7NA 3H8AA 3NGJA 5I0DA 1ZTVA 4DWSD 1DTUA 1IWBA 3VAVA 2ALRA 1EP3A 2CWNA 1H1YA 1IEIA 1TPH1 2YZRA 1CXHA 3G22A 5TAOA 3W01A 3HA1A 3OLDA 2CLIA 3WH6A 3CYVA 1QFEA 1JFXA 5E70A 1AA1B 1YYAA 2JALA 3O3RA 4XZHA 2Y85A 1YXCA 4HD5A 4C60A 1ME7A 3AZRA 3H7VA 2VOMA 1UZHA 1EFZA 2PU0A 5BZAA 2H6RA 4FF5A 4XAFA 4Y8EA 1XJBA 4UC5A 1SMAA 3VCNA 1K9TA 1JUKA 1H7XA 1O5XA 1QI2A 2IQTA 1ZALA 3NZPA 3RM4A 1ITXA 5IHRA 4PSRA 2WK2A 3ARSA 3E9AA 1PYFA 2YB1A 2WWCA 3WLOA 1ECQA 2DZPA 3WJZA 1WDDA 1SYTA 4XK2A 2WCGA 4Z1AA 2HNHA 3EXRA 2VUNA 3ISIX 1E55A 1OX6A 3QR1A 1FWDC 5G5IA 2XH0A 2A2IA 4R33A 3ZFHA 1QI0A 2Y5SA 3BAYA 1FWBC 1PIIA 3DG7A 3IJ6A 3NQMA 3UWWA 3RF9A 3UF9A 2VGFA 3AALA 4MYXA 2ZDRA 2Y7GA 3U2CA 1XIIA 1XQLA 1VIZA 2HVOA 3PUGA 3M5YA 4Z2KA 3ZVIA 3H2NA 3LZ5A 4DM2A 3MUAA 4XZNX 1E6NA 3V1HA 5CBIA 5DLCA 2ZRZA 2EPHA 4CD6A 3E96A 4XD4A 1KCXA 4UNLA 2W92A 4Y90A 1Z32X 3K30A 3W2LA 1XBXA 4Z1BA 4OE7A 4CNPA 5C9RA 4LEFA 1W54A 1C7SA 4DJFA 3N2MA 2HS8A 2BASA 4ZBCA 4D6GA 1TWIA 3M0KA 4XZBA 4ERIA 4MWAA 1UR1A 1Z69A 4K39A 3E5PA 4AY7A 5I06A 3LYEA 2QCHA 2PTYA 3P6LA 3THQA 3RDKA 4R7WA 3V16A 1KCKA 3N17A 3B04A 1XH2A 1G4TA 1BKHA 2OT0A 4TUFA 4HOWA 1X1OA 4CD8A 3SUSA 4LBUA 5LGZA 4JTHA 1A5CA 4HPXA 5DX7A 1YEYA 1BAGA 3VOGA 3G3MA 4C6IA 2DT2A 3DI1A 1GOKA 1OD0A 2VC5A 4FNPA 4H2HA 4O28A 5T91A 4LUIA 1GEQA 2FQIA 2Y6ZA 1P0NA 1P1XA 4QS5A 5HMEA 3V0SA 1MDRA 2I17A 3W1MA 2PDPA 7XIMA 4DXKA 3EZ4A 3JU2A 4IG2B 4UOZA 2FKPA 4R34A 1XUZA 3A4WA 2DSUA 4XUYA 1SU5A 2FDSA 4AVFA 4I7WA 3EWXA 1CTNA 2VFEA 2E6FA 2VGIA 1S2VA 1KV5A 3CTTA 3NO5A 1RV8A 4GINA 4PMUA 3URNA 1UR0A 4QHRA 4QE5A 3PFMA 1SSDA 4EANA 5JUVA 1XYBA 4HNUA 2FB2A 4M6QA 2X1IA 2NQHA 5KZDA 3AIBA 4ZL1A 2EKCA 2HJPA 1GVYA 2YSWA 4GNJA 3N6HA 5E0CA 2WNQA 3RO6A 4RV3A 2D73A 4GQRA 3L21A 5FESA 3UA3A 4IISA 1BRLB 2DW7A 4DBEA 1OC6A 1TTPA 5JMUA 3LHUA 3E0FA 3TJLA 4JPGA 2NV9A 5ABGA 4L4LA 4ZZ9A 2Y89A 3SCWA 3BURA 4H9TA 3T44A 3WQEA 5A8QA 4Z08A 1JCXA 1VIWA 3STCA 3WDJA 1PV8A 1NWTA 1R3TA 2WJEA 4V1XA 3VE9A 1H7OA 1JCJA 3NDZA 2E3ZA 3T1GA 1S5TA 4UTWC 3DFQA 3W53A 5DY2A 4JFUA 4RE3A 3SCNA 3AIVA 3GU9A 3CV6A 4A2SA 1TPVA 2P0IA 1EDTA 3A47A 1NFPA 3LENA 4DO4A 2WZIA 1J0IA 2XISA 3PBUA 4WD0A 2HDJA 3IV8A 3ICJA 1FOBA 1JZ2A 3K5XA 1KFLA 2X2YA 4WX2A 1T40A 2BNJA 3NJ3A 4AZBA 1KXVA 3B9DA 5CGQA 1BVZA 3LSCA 3GG1A 5A6AA 1DJNA 1XR2A 3VKCA 5CBBA 1H62A 1YTKA 2GJPA 4D6HA 3UR7A 3BJTA 3CUIA 4AWEA 3KLKA 2OYLA 3GVVA 3N18A 4L65A 3B0PA 4EF8A 5AC4A 4I7VA 1O5RA 3W2MA 4DO5A 4FZIA 2ZKMX 2XVPA 3LPFA 5MKGB 2Y24A 4DPQA 1XDJA 2DEPA 1MXSA 1EDQA 1GJUA 2PDHA 2F6KA 2ISSA 3WH5A 3T2OA 5BYWA 1XIDA 1VC4A 1KGUA 1U33A 3VIKA 3IACA 3T08A 3IUDA 4H9VA 4N9CA 3MJMA 3WN6A 4IL2A 4PCFA 2PDIA 3DYMA 4HK6A 1AQFA 3WMLA 3AS1A 5CLWA 4HU3A 3F5JA 2YYTA 2MANA 5AYZA 2PAJA 4K38A 4S3JA 2I56A 3Q65A 1YDVA 1JR1A 3W75A 2ZX5A 2GVYA 2FFIA 1WO2A 5EBAA 1VCGA 3WFZA 1V02E 1B3ZA 2V5LA 2C0AA 3WQDA 3G8RA 3LCGA 3SQLA 3UD6A 2QAPA 6REQB 1XLIA 2ZXAA 4EX4A 1BSIA 3M7SA 2DSZA 4ZENA 1EJTC 2ZOXA 2V8ZA 3DENA 5CZ0A 3OA3A 2PD9A 4MB5A 3YPIA 3A5FA 4XAGA 3SN4A 3BGAA 4L6OA 1KM2A 5LNUA 1JYVA 4OUIA 5LNSA 3GXNA 4NHVA 4ZSTA 1O1HA 3LD5A 4HBKA 4XBJA 3S1WA 2E5CA 4HPHA 2ZXBA 3QMTA 2NQ5A 3ABXA 5GQBA 2A7NA 1A53A 5A3HA 4GYJA 4NZ5A 3WEMA 3RCNA 3RHGA 4QEEA 1H1NA 3MB9A 2F8QA 1J18A 5HMFA 1KGXA 2R82A 1W2PA 1XDMA 2YA2A 1L6WA 5C7VA 1E6SM 1GQNA 3LEPA 3TW6A 1TJ1A 4IL0A 4Z2JA 1PCWA 5GJMA 4AVOA 2EPNA 4TXEA 4IIFA 3G6LA 4C65A 3DCPA 5D37A 5U7SA 1B9ZA 2WW5A 4U28A 3BICA 2YCLB 3SEPA 4EPBC 3QV6A 3PPFA 4U10A 4HU4A 3GC4A 1WDRA 4Z1YA 3AHZA 4HGXA 3TROA 3VUPA 2Z1KA 3C56A 4V2XA 1TPC1 1OHLA 1HO4A 1UBSA 3WNPA 3S6OA 4IM4A 1KW1A 2WWDA 2O55A 2NVDA 3QM3A 4X22A 4DYKA 4QGCA 1TWDA 4OBSA 4E3VA 3W73A 3PZGA 1R3SA 1NJJA 4IUOA 2A85A 1DVJA 1X39A 4YN5A 1KBBA 3DGRA 1H5VA 2C6QA 3TAOA 3V5FA 1L2UA 4LOCA 3FYYA 4C6DA 3R89A 4MNMA 3O05A 1SVDA 3WUGA 2ZA2A 1RQHA 1WKDA 3QSTA 4ZFCA 2WSQA 4R9XA 3SCRA 2Z7GA 3VC5A 2E1WA 1P6CA 2P8CA 5T9CE 3U4AA 1RK5A 3OO2A 2QJIA 4YVXA 2E8YA 2F2KA 4URIA 3NL5A 2VEMA 3R8RA 3RM9A 5K7JA 3KL5A 2JE8A 1VH7A 2E9BA 5BWAA 4UFMA 4ZQOA 2NQJA 3K1GA 4Q7IA 4C7DA 3LHTA 2DVUA 1X1NA 1QATA 1O68A 1JUBA 1F6YA 4GGBA 4MNKA 5FAJA 1NEYA 5CPSA 3R5EA 2GSEA 2PWGA 2Z27A 4AD0A 2HE5A 3IARA 5DELA 2QZRA 1MW3A 4NVTA 3N14A 2QULA 3MC5A 4BCEA 4A4AA 1PB0A 1WNOA 3IAPA 4GJ1A 3R13A 7REQB 4PSPA 3DYPA 5EFDA 4L61A 1FCQA 2D23A 1XYMA 2OWCA 4CQ9A 2HVNA 3QRHA 5CLTA 1MVYA 4YMZA 2OZ3A 4JS3A 4JD4A 1PAMA 2QKFA 4TU1A 5DCEA 3QC3A 4W8AA 4Q32A 3OGVA 4NT0A 4AD1A 2XIJA 1AH4A 3VKJA 1IHIA 3BGGA 3PZUA 4W93A 3GXPA 5FL0A 5AHIA 1ZUAX 2DZTA 2NX1A 3B4UA 2G3JA 4JOMA 5FSEC 3O7UA 1ECEA 3W2UA 4NZ1A 4AEFA 2DSVA 2YBUA 5EKYA 3OZOA 1VBJA 4UR7A 2TODA 3GX9A 2OODA 2DT3A 1RA0A 2OWWA 1TMHA 3GNDA 1JYNA 3UQNA 3UWZA 1D3HA 3CS2A 2PWFA 3VDCA 1PHWA 1G67A 4PRRA 2VVSA 3U57A 3KUMA 3M43A 3FYOA 4TX8A 4F2UA 3U48A 2FZ9A 2XFYA 3W1UA 4HPNA 1EA0A 4DUVA 1E1CB 3VNYA 1XX1A 1NP0A 2Y1HA 4A2RA 3W1AA 3H4GA 2DUXA 4O17A 4NASA 3NOEA 3QF0A 3ARQA 3TC3A 5K4XA 2PBOA 3CPRA 3VCCA 1WUEA 4FNTA 3ZZ1A 5ECUA 2FTYA 4W86A 5K9CA 3GR7A 4X61A 4HU0A 5HWJA 3UZ5A 3ZSSA 3NSNA 4C91A 4MADA 3QTGA 2YB4A 4ZQPA 3CZKA 1F9CA 4Y6GA 1UR4A 4AXNA 2X41A 1BWKA 1MQQA 3NWRA 4GUFA 5D9NA 2XSBA 3FDKA 2J9ZA 3GXMA 1TX0A 2X1TA 4QLKA 1HJXA 1A5SA 1BSLA 3H2EA 4RDYA 1Q4WA 3A5VA 4NAFB 3T0CA 1R9YA 3DKJA 4XAPA 4BJHA 1YXYA 5L6UA 3QGVA 1DL3A 1JULA 3G1FA 2J7BA 3AFBA 1XIFA 3QLDA 3G1XA 3CAVA 3G1HA 3FJ6A 3F2CA 4MWAB 1BF2A 3GNXA 1TSIA 3NZGA 5HJLA 3SCTA 4ACZA 5FF3A 2X2GA 4DJDA 2XSAA 1WBJA 4O10A 3V4BA 3T05A 2JIWA 5GNZA 1DJZA 3AU6A 2VR5A 1RD5A 1I60A 4AEOA 1OGBA 3C52A 1Y8BA 1UJPA 3AUOA 4ZR8A 3VGGA 4L1GA 4QDWA 2WVVA 4JYEA 1DORA 4OBTA 1B4KA 1XYFA 1GKRA 1ZJAA 1MMFA 3AISA 1SZEA 2HRWA 3LGEA 1XIBA 1CGTA 3TJXA 2X0SA 2B4GA 1OFBA 3SCSA 3Q58A 5C2GA 3LU2A 1IZKA 1G5AA 2ZTJA 3BARA 4B4FA 3C0JA 3CQHA 1J11A 3I7QA 2O9TA 3LMZA 4IP7A 3N2TA 4MKSA 1DQXA 3NQBA 4KBXA 3CMJA 4WXYA 2DIKA 1LWHA 1I0BA 3OGSA 1VCVA 4DZAA 2XUCA 1QI3A 4Q4MA 3WENA 3FA5A 4CQBA 3B97A 4XQ6A 2OSYA 1PL9A 3AOFA 2XWEA 1TCDA 2G3IA 1A3HA 4U3AA 1RJQA 1JQVA 2Q02A 3P0WA 3LTPA 3MPGA 5T8GA 4BK9A 2J88A 1HJSA 4BI7A 3H2MA 4LANA 1KWGA 3KDOA 5HNTA 3W25A 3WLHA 2A3LA 2J24A 2NT0A 3BLFA 3OHMB 4QEHA 5A8PA 3DFNA 3H21A 3VFCA 1IEQA 2C1HA 2GJXA 2J7FA 3VZYA 2D2GA 3KCJA 5JIPA 4C5YA 4NSBA 1QT1A 3CUJA 1XLMA 1WKYA 4PUUA 1UD8A 4GRSA 9XIAA 1RBOB 3UCQA 2DPEA 4D6IA 4V27A 2I5IA 4AVNA 1W9DM 1H4PA 1NAL1 1CPUA 3TWAA 3VUSA 5F1UA 4PTNA 1CXLA 3L9CA 1KM6A 2BLEA 1SW7A 1LL6A 1FH9A 3OZPA 3PAJA 1EDGA 3RFAA 2R1MA 5D32A 4KWWA 3ARXA 2OSWA 1R3QA 1RR2A 4AY1A 1PEZA 2ZVIA 4PZVA 2ON3A 1A0DA 1UA3A 1KXHA 2IKJA 4P5UA 4PUWA 4GY7A 3BG3A 1KBIA 3TFXA 4MFDA 2ZWYA 4H8HA 3ATZA 2QDGA 2J7GA 2BBFA 2WMJA 2CBUA 1TRDA 2ZX8A 5BXPA 3UJRA 3GDRA 1WPCA 3IIVA 1VFOA 1G6CA 3UWYA 3W84A 1XWYA 2D22A 1J79A 2FTWA 1IWPA 3AYTA 3P93A 1ADDA 3UXIA 3CK5A 1QPOA 4RE0A 4M0XA 3L4TA 1VD6A 1LG2A 2E25A 2YFNA 4X2RA 2FGLA 3N2BA 3VGFA 3W7CA 4O12A 2CESA 1OCJA 3F4VA 1JGIA 1F3WA 3NCOA 3V75A 3VO0A 1LROA 2V2CA 1S39A 4HT3A 1BLIA 3PZMA 1R85A 3LMYA 2FZ8A 1XW8A 4NILA 1S46A 1W3IA 1ZBKA 3FVDA 4ZOCA 3IIZA 4WZHA 4JX6A 5K3VA 3BXWA 1DIKA 2HS6A 5I24A 3GBDA 3KWXA 3C4UA 4RNJA 3ZT7A 1V02A 3G0UA 2ZVRA 1V51A 1JCTA 2DZUA 1CB2A 1R30A 5C70A 2HWGA 1EXPA 5E0FA 1OX4A 1R7AA 1K3UA 4W84A 3M41A 2WPGA 1FWFC 3WLJA 1X1ZA 2W4XA 2BY0A 4JKKA 3TQVA 4GVHA 4FOUA 1GONA 1FCVA 3T4WA 2XG9A 3MI3A 3NG3A 4JAWA 4PH6A 4DJEA 2QV5A 1X6NA 4XO7A 4WLCA 4HOXA 4M29A 2AOSA 3NNTA 1NU5A 5LKYA 4GG9A 2GVLA 4XZIA 3VOFA 3GYCA 1EJ7L 1J93A 4FXSA 4OQVA 4FR6A 5DBUA 2Q01A 2YIHA 2BVWA 4O19A 3Q2DA 3CAQA 4N9DA 3OTRA 4L6DA 4A35A 3OPSA 1DE6A 1FH7A 2A7PA 1A5BA 1ZS2A 2PURA 3QGAC 4M6UA 3HG2A 5AY7A 5A6BA 3UPWA 1V6XA 1TVLA 3N4AA 3W7OA 1FKXA 4JTSA 3VCRA 3A9BA 4R7OA 1E71M 1LL7A 2QDEA 2VX6A 2V30A 4ALDA 5AFDA 3M0VA 3EMCA 2WBKA 4MLRA 4TMBA 3PWIA 3VTRA 4GMEA 3W7RA 4BKNA 4MB4A 5D30A 1O12A 2QUTA 2GPTA 2AQVA 6CGTA 1UKPA 2QF7A 4L9YA 5CSRA 5H8PA 2EG6A 2OOFA 1KBLA 3IPWA 1H7NA 1TV8A 1B3VA 1BWVA 3GG7A 1WZMA 3DHUA 5DF0A 1WDSA 2Q8XA 3E2QA 1W9UA 4JHZA 1BYAA 4CNUA 2OZTA 1K6WA 2V3EA 1F6KA 1XLLA 4XV0A 1YDYA 1IT7A 2YCJA 3QJAA 2FH8A 1VFTA 3CLMA 4ROQA 1U30A 3LCWA 1M3UA 4I5RA 1H11A 1B0IA 3HIJA 4OWGA 3WQ5A 2P0OA 3LGDA 1WOAA 3EX2A 4YIWA 2QCMA 6A3HA 2WCSA 2CBJA 1GPFA 5G2IA 4IHCA 3WDIA 4DBUA 4GABA 3TONA 1AL8A 3KDNA 3WF4A 4C6PA 1OT1A 1WX0A 2WMHA 3LHWA 1OFAA 2WKJA 1ICQA 4AMCA 4N7QA 3SI9A 2EPOA 2XH4A 3L5MA 2I57A 5JH1A 3S2MA 4HNTA 1GGOA 4MB3A 3CZEA 3TTEA 4PMQA 1G4PA 5HWMA 3H4XA 1PZ1A 4F0KA 2XWDA 3P8JA 3H70A 1GORA 1EC7A 1RZMA 3ZWSA 2X0HA 1UZ4A 1EOMA 1GVFA 1O5KA 2ZZ2A 4GIEA 4FNSA 1GPWA 3GDKA 3NSMA 1TE1A 1ZFJA 4YHEA 4LB3A 1A5OC 3EKGA 3MCOA 3VOIA 4CD7A 2BFGA 2DT0A 3C2EA 3TCEA 3VMNA 2PWVA 2XN0A 3WDPP 3QFEA 4KF1A 3MT1A 5HMDA 3CEPA 1JG9A 2WHMA 4UZUA 4CN4A 1AQMA 1F3EA 1FP8A 3LB0A 2REQB 5FKYA 2A5HA 1KFEA 4MNJA 4IPLA 3CL7A 4LPCA 5GVJA 2JIEA 5AHEA 1JQXA 2WSYA 4CNOA 3MUZ1 4B5WA 1HVQA 3TSDA 1H2JA 2H8ZA 3SQMA 3UNTA 4E3TA 4PMNA 3BMVA 4EXAA 3VNLA 1J8VA 1FA2A 3VOJA 3GNOA 4NZ3A 4BI5A 3ME3A 4I8DA 1JD9A 3MV11 3V5CA 2FHCA 2VURA 4Q8WA 1XS2A 3ZT6A 1J6PA 1UH4A 1TJPA 3B3DA 2QPSA 5HJXA 4O1DA 4XD3A 2PRMA 3O0FA 1YNYA 3ATYA 3XINA 6ENLA 4FS9A 4DB7A 1QOXA 3O0KA 3HFYA 1A49A 4UTJA 1UCWA 2J6VA 3MDWA 3VNIA 3ABSA 1AZ1A 1M7PA 1R86A 4FLRA 2HE8A 3L67A 3C2OA 4YTQA 4YYCA 4US5A 1Y7VA 3GDLA 1S5VA 3BV7A 3LM7A 3G2GA 5I3KA 3UXLA 1FDZA 3ARPA 3MCNA 4M19A 4IQDA 2QCEA 4S2BA 3ZR4A 1UD5A 3EWZA 4QSFA 1R9ZA 1LUCB 3IGSA 1SR0A 4P7RA 1JIBA 4K37A 1M41A 4WGXA 1KQYA 2BXZA 1EJVC 4OVXA 4W7UA 1NM9A 2NXGA 3SECA 4DN1A 4MM1A 1P7TB 4NXSA 5E5CA 4GX9A 5LNRA 1VEOA 4WDWA 3OQ8A 1CLXA 2AGTA 4MAZA 1DWIM 4US6A 4B92A 4AH7A 1BQGA 1RH9A 5PTDA 4S3KA 4J40A 4Z2GA 1W1A1 1REQA 2YCEA 4R7JA 5FF2A 5A94A 4WGHA 3O6DA 3KEHA 4GO8A 1V3IA 3UWEA 4C90A 1O95A 2G96A 3BLDA 3RITA 2FMOA 3BCFA 2CLHA 2V82A 3K46A 4HZ8A 5HJYA 1BPLB 4W85A 4FR1A 1NQ6A 1UKOA 4DWSA 3NFUA 5BU6A 1LWJA 2GGHA 1MYRA 1HP4A 1T5AA 1HL2A 3NO1A 1EJXC 4WJ8A 3ALFA 4X2PA 3CHFA 1SR9A 3ORWA 1PX8A 4YS1A 1FWWA 4YHGA 2O9RA 3MJYA 2GVJA 1Q6LA 3BAXA 1HL9A 1I2RA 2I5GA 3N9KA 3RU6A 3BJFA 3M4HA 1BEUA 3ZMRA 1EP2A 4J7RA 4GOAA 1XBZA 1C8YA 3HV8A 4J3VA 2DUZA 2NX9A 2ZWZA 1YPXA 2W0UA 5EU9A 4HA0A 1PZ0A 4V1YA 3S6DA 1L6FA 1TPEA 2VGBA 3MHUA 2RDWA 4GPNA 2BS9A 4UMCA 2D20A 2OKTA 1L6GA 4HA4A 2DQWA 2E77A 4S3FA 1JF6A 1CX9A 3FSTA 2EPLX 3URAA 3GIPA 4XAYA 3SADA 1AQHA 1K9DA 2ZX9A 5CPQA 4JQ2A 4W88A 3ONBA 1UIOA 4J2MA 1Y5WA 3C8NA 1YLVA 4MUPA 3BQ5A 4LYPA 1Q8AA 5HA7A 4A8IA 4PMVA 5KETA 1F74A 2Q8LA 4RNFA 2NVAA 4Q6JA 5F2GA 3NEVA 2F61A 2CLPA 4YTTA 4O14A 3PUDA 4PTXA 4OKDA 2V3DA 3LNPA 1WXJA 3OW1A 2OEJA 4GUJA 4UQ9A 4J28A 4F79A 3RCYA 3SBFA 2EAWA 2VFFA 3UR2A 4XTDA 1PSCA 3H2FA 1UWUA 3RCMA 4O1EA 2W61A 4U33A 1SFLA 3WDRA 1VYSX 3S9ZA 3E2SA 3NQ7A 3JR2A 3TOYA 2RJGA 3EDEA 2WC7A 5A6JA 1TR9A 1QNQA 1T41A 4D1JA 3IGXA 1FTXA 4D9PA 4ZFMA 4A05A 1SJBA 3UY7A 4S3BA 3GO2A 3WH8A 5DMLA 1FWJC 3PFRA 1E51A 6PTDA 3DESA 2V9DA 1N55A 1TPUA 3E5BA 5GPRA 5HDRA 2AKMA 4GI4A 1KKOA 4H6QA 3KFTA 4CQDA 3DEQA 4H9XA 1G7UA 4JTEA 1RLDA 4QE1A 3LLXA 3SUUA 5A6SA 4CQCA 1BYBA 3M9YA 1CIUA 2E09A 1OCBA 3J7HA 4JIQA 1OZMA 3PJTA 4JQ3A 3E0LA 4FXFA 1IEWA 1CXIA 1GT8A 2EJ1A 1AK5A 2QIWA 4CD4A 4WSKA 1RAKA 1TTIA 1KRAC 4PB3A 4JTTA 3K8LA 1JJKA 3A21A 4ZCWA 3EDDA 2P1FA 1XISA 4PUNA 3VGDA 1QNOA 2F84A 2Q6ZA 4MFEA 1MSSA 2C8NA 1OQFA 4Q8VA 2OSXA 2HK0A 1XG3A 2UY5A 1ZLPA 3WQOA 1FCUA 2QLYA 3WYZA 4YXGA 4OTKA 3OYXA 1OFEA 2FYMA 1HKIA 3W1PA 2WVSA 4N42A 3CL8A 4LU0A 1IR1A 4IGSA 3N9RA 3ALGA 1JCNA 3V5OA 3WY1A 3B8WA 4UR9A 3P61A 3WNOA 2CLOA 1KFKA 2B7QA 1W1IE 3DX5A 1FHUA 1E43A 3L23A 4O53A 3SIZA 3LERA 1H60A 3W88A 4QCEA 3B0UX 4GQ0A 2WC4A 3UXDA 1P0EA 1K02A 2G3MA 2D3NA 5I79A 3CJPA 3S2LA 1DJQA 4DEFA 3W27A 5AYYA 3BC9A 3B9OA 3OVGA 4XKYB 1W1YA 2HSAA 3N19B 4S2CA 3L7RA 3Q4DA 1T6MA 4U3CA 1UD6A 1F7BA 5CC6A 1NIUA 2ZCGA 3IANA 3DI0A 3DFPA 3GHSA 1FDJA 5KITA 3R2GA 5IDZA 3P62A 1PKNA 4ILSA 1ITCA 4B16A 2J7HA 5C71A 2CERA 1HO1A 1Z6KA 4C6FA 2Q8ZA 4F2BA 4FOKA 5KTLA 4HJWA 2BOEX 3GNNA 3N2OA 3V36A 2WCAA 1J4EA 5ABFA 1JCMP 2SFPA 1UQZA 2OOGA 2VGGA 3GVWA 4HCHA 3SUVA 3MUXA 3S3GA 3KHDA 1CCWB 4IX2A 1H0GA 1ITUA 3H22A 2QVHA 1NDWA 4LRTA 3HJEA 1I2QA 3O07A 3B4YA 1GVIA 3WD4A 2UY3A 4AWUA 1GVQA 4WHBA 4ATDA 1G4SA 3NSXA 3E74A 5FEXA 2XN2A 1TPB1 2YXXA 4ZOEA 4X9YA 4O11A 2DUAA 1AJ0A 4B4HA 4C6QA 2NQLA 1PDYA 4JTIA 4RE4A 2VENA 3WLNA 3BLKA 1PIGA 5EGRA 4XVDA 3MY9A 3URBA 3COTA 2DT1A 3WCZA 2C1GA 2R8WA 1SO3A 3ZJKA 3GDBA 4F48A 3LRKA 2ZRWA 4LH8A 3O9NA 4W7VA 3DXIA 3DIPA 2YL8A 4LBRA 3THAA 3BJSA 5HWNA 4QS6A 4JIRA 5JXQA 3LRMA 3W85A 3TMQA 3NQ2A 1CBGA 1ONXA 4XZMX 1H09A 2V5DA 4O4VA 3VDBA 2CZDA 3CWHA 1XYCA 3A24A 1L6YA 3ZVHB 2W3ZA 2ZBTA 1XPGA 2ZIDA 4B2DA 4LRSA 4JR5A 3EA1A 5HMSA 3GUWA 1TJ0A 3B05A 3LCXA 4KKXA 3WLSA 2VQUA 1EX5A 5FOOA 1NOUA 3EAUA 3BTNA 1UHVA 3OZMA 4CEXC 2O4MA 4PRWA 3ITTA 3CIVA 4R5EA 4LUJA 3H4WA 4HK5A 3W29A 1X38A 4M8UA 4EAYA 2C79A 3NOYA 3AC0A 3KHJA 3P3BA 5D04C 1J2WA 1EIBA 1JZ4A 3C2RA 4BQ3A 4Q8TA 1PBGA 2OVLA 5I6SA 2V5CA 1QAPA 4UTLA 1O7AA 3VMPA 3CL6A 1W1B1 1E9YB 5LYRA 2ZZ7A 3QYSA 4PBFA 4AF0A 2GUBA 4I8YA 1KM5A 2VTFA 4QLJA 3THDA 3MWAA 1YTEA 4DZ5A 1BXNA 2DY3A 3GTIA 3BZJA 3UWVA 3E2VA 5CAKA 3KOYA 1XV8A 2VDGA 1YQ2A 4JTJA 3H2CA 3H54A 1UWAA 2W9MA 1MI3A 1HT6A 4H19A 3LM3A 1M03A 2QCNA 2H3DA 4AHQA 1KBKA 2FJUB 4MIMA 4NIRA 2Z1BA 2ZTKA 2EEXA 3HMCA 3CPUA 3AZSA 2CZ5A 2CITA 1DJGA 1MUMA 1V8EA 5FJIA 3M5VA 4YL2A 2Y62A 3ZIZA 1RCOB 2ZX6A 5BRQA 3QQWA 3DC8A 1EQPA 2XPKA 4MG4A 4D6FA 2OZ0A 1UWQA 3KBNA 2ESCA 3OHIA 5F7UA 1L9WA 1VYRA 1XDLA 2D2HA 1PTGA 3APTA 5ABTA 3UBPC 4IP5A 2VVNA 3S2NA 2WZMA 4HYVA 2PDXA 1H63A 3G1YA 3QY7A 3RIKA 3L68A 4UTWA 5F2IA 5D2XA 5A69A 2YGYA 2GJNA 4HJFA 1C3FA 1UPPA 1WV2A 2DZVA 2I16A 4Q8OA 3OODA 4I9MA 5J04A 2J62A 1Q6FA 3U8GA 4UQBA 5LNWA 2DSKA 3E6EA 4JNMA 4JKMA 1B57A 4P7OA 1AODA 3WQFA 3CAWA 3W2NA 3OGRA 3UXKA 3W2KA 3LI0A 4LC8A 4ICMA 1H5YA 4DM1A 3W71A 1PKLA 3PULA 1UOKA 2OKOA 1FWIC 4J4KA 3EWWA 4H2CA 2YLLA 1XBVA 5E9XA 4JTCA 5BU9A 1E70M 2QIIA 3N12A 1W37A 2E6AA 1PKMA 3MMWA 4C6JA 1MNSA 6TIMA 4CNTA 1P48A 4QJ3B 3BAJA 1E9ZB 3G0XA 4WY0F 3H26A 5D9OA 1RQBA 5LGXA 2ONEA 5K9XA 5D2TA 3IUHA 2YA1A 4M51A 5CZSA 1DIOA 1IR2A 1VBUA 5BRBA 4GVGA 3KBWA 3PVFA 3CV1A 1WZAA 1WOBA 2AGKA 3LQGA 4ZB5A 3RUBL 4HKPA 1ZL1A 1Z8AA 2Z0IA 3M0LA 2VL4A 3IJQA 2FVLA 3OB8A 1XH0A 2C91A 4GKTA 2KX9A 4H6KA 4CLMA 1DIEA 3K8KA 4XO6A 1E0UA 2BOFX 5CC5A 2RDTA 4JTFA 2VOTA 4AZCB 1EJRC 4JIIX 3GW0A 2UWFA 1UP0A 4PL1A 3HQPA 4GUHA 5AYXA 3TAKA 1V3LA 3MKVA 4GX8A 2JEQA 3A12A 4QRNA 4AIEA 1D7FA 4IJCA 3MBDA 5I07A 1W9XA 4PMDA 2OMAA 3ONCA 4FF7A 4K68A 2J9YA 6TAAA 4L4OA 4M6PA 1P1MA 3QMSA 3G5EA 1UUOA 3W83A 1HKMA 1M01A 3I3DA 1WZLA 1UUMA 2G41A 1XLJA 2ZRVA 1OCNA 3EDFA 1K4HA 3MW7A 3QOKA 5E6ZA 3URQA 1UR3M 4XBSA 3VIJA 3C8FA 1SFTA 1WKFA 1JUEA 5AHLA 4IXXA 1BTCA 1ZZMA 3TFCA 2XVKA 3G24A 4LS2A 2E6YA 3OG2A 1SW3A 4PTVA 3WQWA 3E2RA 3FKKA 1MEIA 3MU7A 3RMJA 1P0BA 1KNWA 1FP9A 5IHSA 4OT7A 2RUSA 1HGYA 1P5BA 1VRDA 3N73A 3TW7A 1NOFA 3APYA 4JTUA 2QCDB 1OD8A 4IFOA 2NWRA 4IPJA 1IXOA 4Q4QA 3RG6A 3WQ8A 4N4PA 3KOFA 4LY4A 4H4IA 5A6KA 3VKAA 4XZ9A 1OF8A 2RKXA 4NXKA 4DO7A 2W63A 3EX1A 4G56A 3REQA 1ZHAA 3P74A 4K8EA 4C6MA 2E40A 4FEZA 2EHHA 1XSJA 5CAHA 4AEEA 3L4ZA 3HOJA 2AL1A 1FHVA 5HUPA 3W76A 2PS2A 4S3CA 1TR1A 4KFPA 2FGZA 5BXTA 2YCKX 2WJFA 3F5KA 4OECA 3QW3A 1PIFA 2CBIA 3GH4A 4Y9AA 4AWSA 1JF5A 3W3OA 2VEFA 1E4LA 4RL3A 1KA9F 3QKZA 3W23A 3LG3A 3VX1A 1DPMA 5JH2A 3PB2A 5JBEA 1EUAA 4KGLA 3VIGA 4JDBA 5BCAA 1ONRA 3BLPX 1CEOA 4FP1A 5F4WA 1JI1A 2PDWA 2WMFA 1LJYA 5HANA 1LBFA 2V38A 4E2BA 3QPZA 4MJ2A 2PP1A 4EWND