3GX9A

Structure of morphinone reductase n189a mutant in complex with tetrahydronad
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
369
structure length
364
Chain Sequence
b'NPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAAAACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Morphinone reductase
publication title Parallel Pathways and Free-Energy Landscapes for Enzymatic Hydride Transfer Probed by Hydrostatic Pressure
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 134
structure length 364
sequence length 369
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3gx9A00
3FJ6A 3H53A 5LKYA 1H63A 3TUUA 1W3NA 4Y96A 2YPIA 1TSIA 3STCA 5DLCA 4HHPA 2ZA1A 1RD5A 4GUFA 1DJQA 1ADOA 1SR9A 5D33A 4PODA 3P5ZA 3GB6A 2QDHA 4RR4A 1O95A 1TPUA 4M6PA 4UXDA 1YPFA 3TV8A 3NQVA 5HR6A 3A24A 4LUIA 3HF3A 1DV7A 3BGGA 3HPSA 3C3NA 1YTDA 4MLJA 3EX6A 5D04C 3IIVA 4JTEA 3FEMA 5FEZA 4JTSA 1C8VA 2Q3OA 3O05A 2ABAA 1TQJA 4MPQA 4QM1A 2GVGA 5J5RA 1J2WA 5SWUA 3DHFA 3LCFA 3H55A 3LTYA 2EPHA 5D09A 1A5CA 1O4UA 3OA3A 4NT0A 2ZRWA 2B7PA 5AC8A 3M6YA 1TPDA 4ADUA 4GFSA 1VLWA 2WOQA 3G8RA 1VCFA 3GR7A 1G4PA 2YX0A 4NVTA 1QAPA 2I14A 3W83A 1JUBA 4BF9A 4K37A 3TW6A 4LC8A 5AHNA 4B5NA 5K9CA 3TCEA 2HMCA 1EP2A 4X3ZA 3MI6A 2GOUA 2ZRYA 3CHVA 1MXSA 1DQXA 2RFGA 5AC6A 3KAOA 4JTKA 2VFHA 3UZJA 1PL9A 3LLFA 3BG3A 4XKYA 4I7UA 5H91A 5CKSA 2V0TA 3E9AA 3PG8A 4QNWA 3W1PA 1JCNA 2NUYA 3L67A 5DBUA 2ISVA 5F4SA 3MO7A 1TPWA 3LCXA 4ORMA 1YYAA 4NQ1A 3T4CA 2GVLA 4IPIA 1FXPA 4LV9A 5AOUA 3UY8A 3W7KA 4XBSA 4ZQPA 5AN7A 4UIOA 2FFCA 1QR7A 1DBTA 4FB7A 3N9SA 1T99A 1VYSX 1FWNA 4KWVA 1QOPA 1OVDA 3BK0A 3ABOA 3P8JA 1MEWA 4FNTA 3UWWA 3EKZA 4WUIA 4AAJA 5LNSA 4LRSA 2V9DA 4JX5A 2CWNA 1GTHA 4OWGA 3LV6A 5K7JA 3G22A 2WNQA 4JYDA 2PRHA 1W0MA 3AO0A 3EXSA 4OV9A 3L9CA 1H7OA 4FX8A 4I7WA 1TV8A 3O06A 2E68A 1LRQA 2XN1A 1TPVA 3NL6A 1YLVA 3E12A 4DEFA 3W7QA 3WJWA 3LHWA 1GYNA 2NLIA 4I7VA 3QH2A 3CPRA 3TFXA 3TAKA 4N9DA 3S9YA 3C56A 3W87A 1IXOA 3NVTA 3C2VA 1FDJA 4HSOA 5TBOA 4UTMA 2V8ZA 3FKRA 1MEHA 2ZFAA 1KV8A 3KVLA 4N6FA 4MY8A 3HIJA 4XZ9A 4JTUA 1KFLA 2QCNA 4LUJA 1SSDA 3S5OA 5DXXA 1EUAA 1OX4B 2FIQA 3RNDA 1K3UA 4BFAA 3USBA 2BZNA 3LBMA 2Y7EA 1LYXA 4PL1A 1L6WA 4ML9A 3NR0A 1W1ZA 4PEKA 3EWBX 5DBTA 3W70A 4O1DA 1BKSA 5K3VA 1RVGA 3L0KA 1OJXA 4R53A 4NJHA 1WQ5A 1EB3A 3G1XA 2H8ZA 1HG3A 4NX0A 2XN0A 3MHGA 3OIXA 3NDOA 1IGSA 4O1AA 3H54A 2E77A 3TJXA 4BR1A 3L21A 3R12A 2ATMA 3W7NA 3WJXA 4O1CA 3SGZA 2D73A 1GQNA 2TYSA 2E1DA 3TE9A 2CZDA 4JGDA 1TTQA 4FNQA 3BLIA 5A8GA 3TNOA 1QPNA 4BI6A 2OJPA 3BLFA 4ICNA 1I2RA 2C16A 5U4NA 2WSRA 5KMYA 5G4EA 4MFDA 4RV8A 1EX5A 3WJZA 3W1UA 2TMDA 2HSAA 3W1MA 1K8XA 1F73A 4GXMA 5AHMA 5AYXA 1HL2A 2LLEA 1W37A 1TTIA 3SSJA 1EIXA 2W6RA 4NJKA 4FXRA 1VR6A 2VEPA 3KRSA 2FPTA 4LVAA 3CTLA 2HTMA 1WBHA 3Q37A 4GBUA 4EF9A 4UMAA 3TSDA 1XFBA 3NQFA 1LBLA 3EKLA 5C5YA 3KX6A 1XDMA 1X7FA 3O07A 3QQ1A 3W1XA 5F4WA 3MI3A 1WDWA 3TC7A 4X22A 3LRLA 5F2LA 4IWWA 3GXNA 3UWUA 1EWEA 4MUZA 1ZCOA 3FJLA 5CZ0A 3L65A 1OFOA 2FJKA 4K8EA 2CLEA 3W72A 3GKFA 1PHQA 4S2BA 1HTIA 4O13A 1M6JA 3IGSA 4UMBA 1T96A 1KM1A 3LXAA 1W8SA 1OF8A 3GDRA 1RZMA 4IPJA 1DJNA 1DORA 2RHGA 5ABTA 3MW7A 5BNKA 2I9EA 3PSVA 1HO4A 2DZSA 1G6CA 2YSWA 2J27A 3ABQA 3O6CA 4DQWA 5G2IA 2QDGA 3W71A 4GNJA 2C14A 6TIMA 1Z41A 4CLMA 3VNDA 4UTJA 4MJMA 3QJAA 4PH6A 1I4NA 3O8AA 3NA8A 3DH7A 4QISA 4LWWA 1IF2A 3C2RA 5L9FA 2Z1BA 3W86A 3TSBA 1B4KA 4IMCA 4MZ8A 5K4ZA 3B03A 4JYEA 3GNDA 3NG3A 2NV1A 1EP3A 3NM3A 1DHPA 1CX9A 1LLWA 3WK0A 1GVOA 4K8HA 3KVMA 1W56A 4N9CA 5AHIA 3BV4A 2QEZA 3THAA 4EVZA 1PV8A 1OFDA 4HIBA 4BK9A 3HMJG 5L6UA 1X1OA 1SO3A 1CI1A 1SW7A 3IRDA 1LBMA 3LHYA 3LI0A 4QNEA 1AW2A 1MO0A 4LS1A 1TREA 3A9IA 4IUOA 3DAQA 1QPOA 3LX9A 5K2ZA 1GEQA 4R34A 4Y8FA 2E6AA 1AL7A 3TIMA 3P61A 2CU0A 3LM7A 4JYFA 3UQNA 4K7YA 4RXFA 3OHIA 4A2SA 3W2NA 3L5LA 1QPRA 3E49A 2JBMA 3A21A 2ZA2A 3N19B 1FDZA 1TPH1 4YWIA 4JDBA 2VFGA 2XN2A 1TPFA 1LM1A 4ZMGA 2OCZA 3HBLA 1AW5A 3GZ3A 3M16A 2PURA 2X1RA 5EMUA 3HJZA 2VEIA 2PRMA 5CPLA 4TIMA 2CFFA 1Z48A 4LT9A 2Y62A 2F84A 3ATZA 4FNPA 2Q8LA 1IXPA 3ELFA 3FYPA 5FI8A 3M44A 4A22A 3MHUA 2VFFA 3ANYA 1XBYA 5AHFA 1QWGA 3UXAA 1VJIA 5LNRA 2B7OA 2Y89A 3CEPA 3B04A 3C0JA 2A7PA 4OHQA 1K7XA 4KFOA 2GUUA 3BPWA 4E38A 2ZZ1A 2NZLA 4BI5A 1I2OA 4HPJA 3NM1A 3VE9A 2Q3RA 3GNNA 2YYUA 3DI1A 4U28A 3W7OA 2DZTA 5CPNA 3MWAA 3IVTA 4DO6A 2ZTKA 1KM0A 4IMGA 2YW3A 1QO2A 2YCEA 4IX0A 2A6LA 3LCLA 2YYTA 3LTPA 4N9BA 2NWSA 3OVQA 4LC6A 4EOUA 4CNOA 3IIOA 1X6UA 4S1FA 3N2XA 5KSWA 2A5HA 3PWAA 2QCFA 2DJXA 1FBAA 3S42A 4C1LA 3CLMA 1JUEA 4FXSA 1NF7A 4NXSA 3SGUA 2JGQA 3GDKA 3LRKA 5HQEA 1HUVA 1RQHA 5HUOA 1A5AA 3W2MA 3TROA 4WY0F 3GDTA 4QAIA 4EIVA 2JGYA 5G1YA 2C0AA 1TJPA 4AF0B 2A0NA 4UTUA 1KM5A 2Z0IA 3LOTA 1O5KA 1NVMA 4HPXA 3KRUA 1RQEA 3JR2A 4AHOA 4O52A 4YCPA 1EPXA 4XKYB 3L5MA 2X1UA 1O5XA 1LZOA 5KZDA 5FF2A 1PIIA 1KTBA 3P81A 5D37A 3HG4A 4JY9A 2QR6A 3KHJA 1G4SA 1AL8A 2H8XA 1OHLA 1TQXA 3RF9A 1JCYA 3VKJA 4D2JA 2YFNA 1L6YA 4G1KA 5EL1A 3T44A 2VKZG 4NJIA 4TMCA 5C55A 3GKAA 4O0ZA 4R7JA 4AH7A 2QF7A 5DCEA 4ZQMA 1SZEA 3NQ2A 1M5WA 2NX3A 1R2TA 3PUOA 3U8GA 3JS3A 3PBVA 1YXYA 4LW7A 4A3UA 3UWYA 3CM4A 3EWZA 3MMTA 3QFEA 1QOQA 4NNBA 1OFEA 3KVKA 1F5ZA 3C61A 2F7FA 3CEUA 1WA3A 3EWYA 3LHVA 2WNNA 1W5MA 2BXVA 1G69A 1OFRA 3GDMA 5E0KA 2B4GA 1V7YA 2CZ5A 4O15A 3W7MA 3N14A 4GUHA 2A21A 3NQ8A 5DCDA 5MHBA 4WXZA 4Z1CA 4JTTA 5BRBA 4FEZA 3P5YA 3CC1A 4N2YA 1DKWA 5BMWA 4ZQOA 4IXXA 3CWOX 2VXNA 3HQ1A 1T8XA 1LP6A 2NXIA 1N7KA 4ZZ9A 1ZAJA 4OBTA 3QZEA 1H1YA 1GT8A 1WYIA 4OT7A 3M1ZA 2WKJA 4Y9AA 4LY8A 5KINA 1LOQA 4UMCA 4C1KA 3B0VC 3OVPA 2Y63A 4Y90A 3M5XA 1PS9A 2X30A 3MP3A 4MYAA 3LI1A 1ZAIA 3HG2A 4JD4A 3PULA 1Q45A 4AVFA 3NNTA 4WQ6A 3TH6A 3WJSA 3TMQA 3RU6A 1QPQA 1LRNA 1J5TA 3T7VA 2NV2A 2Y61A 3LDVA 4OGZA 2QCHA 1W3TA 5GVJA 1VYRA 5F2IA 4IMEA 2CZFA 1PE1A 4M7SA 2OZ0A 3PR2A 1KW1A 1G7VA 1KTNA 4HNTA 2H3BA 1SW3A 4X2RA 3QSTA 3HG5A 4EWND 1DOSA 4E2DA 3LBCA 2WPBA 3GR8A 2E6YA 1Z44A 4JR5A 5HUPA 3DENA 1TPB1 1R46A 1M7OA 1Q6LA 3QC3A 1V5XA 1DL3A 3ABRA 4LOCA 2A4AA 3W22A 1O94A 3PM6A 4XQ6A 3B06A 5HWMA 4PFMA 1SQ7A 3UD6A 2DZVA 3TX9A 3IEBA 2TRSA 3HGSA 1TYGA 1LROA 1FCQA 2VENA 5HWJA 4DO4A 1H7NA 1WBJA 3F4WA 4RXGA 4DBEA 3U2OA 4AHQA 3NQMA 3P62A 1XXXA 2B0MA 1XKYA 3Q58A 2R14A 4IJBA 4P61A 4WJEA 4TX9A 2HS6A 4UR8A 5A5WA 3QQ0A 1FQ0A 2V5BA 3UWZA 3C52A 5I3JA 1Z42A 4X9SA 2VEKA 3LCGA 3BW2A 4ZQCA 1W5NA 3FOKA 3QSRA 2V5LA 2QCDA 3PUDA 2FQIA 1OFQA 3NL3A 1NF0A 1XBXA 1K02A 1S5WA 4ONVA 2H6RA 1VLIA 2AQWA 2CLMA 2CLIA 5G4WA 4HT3A 2Q8ZA 2BLEA 4O17A 1F7BA 3C2OA 3A22A 3MI2A 4K7VA 1VCVA 3W1QA 2OT0A 4FO4A 1ZFJA 3STEA 1P4CA 1THFD 1VZWA 1XBZA 1XM3A 3NL2A 4AEOA 3RLUA 1KM4A 1ZJIA 1TV5A 2G5WA 1WXJA 3M41A 5LGZA 2FB3A 4K6AA 4JY8A 4BI7A 2GVJA 5CGQA 3C2FA 3B05A 3SW6A 1QCWA 1F2JA 3G24A 1TIMA 1G4TA 3E02A 4H4IA 1SZGA 5I3IA 5EY5A 5D2VA 3NYZA 3G8EA 4DXVA 2O7QA 1ZNNA 1WAUA 3OEXA 2BX7A 3GIYA 2WSQA 2A7NA 1TRDA 2DORA 1BEUA 5EA9A 3GYEA 1FCVA 2AGKA 2TSYA 3IIPA 3I7RA 3IVUA 1F76A 3HGJA 4O16A 2PC4A 5KITA 2Y85A 4DF2A 2H90A 3NPUA 3SJ3A 4W9TA 1EA0A 5D30A 1H7XA 1XI3A 3P74A 4UTKA 5I3FA 4O1BA 1UBSA 1W5QA 1MSSA 5AC7A 1W3IA 1VRDA 2A1YA 3T78A 3NOEA 4WZHA 2PRLA 3UNDA 3DU0A 3G1FA 4IX2A 4AWTA 3MHFA 3HOJA 2ZZ5A 2WQPA 1GG0A 2ISSA 4FX6M 1UJPA 3O6YX 4RJEA 3TK7A 3IIXA 1OX6A 1ZALA 4E2BA 2IQTA 4FF7A 4FHAA 1JR1A 8TIMA 4I9AA 3C2EA 3GAYA 4MKNA 1GVRA 4LU0A 4DPQA 4LS0A 2V2HA 3VE7A 4FNRA 3LB0A 5H2ZA 2YFOA 5D05A 2QCEA 5K9DA 2TPSA 2NUWA 1GWJA 1GVFA 2CLKA 1YTKA 2X16A 1H7RA 2QCMA 1OYAA 3I7QA 3T40A 4WXYA 3TAOA 4M6QA 3RK8A 3EXRA 3QPZA 1IIHA 1TCDA 3LTSA 4LS2A 4DPPA 1LBFA 2EF9A 5LHEA 3S0CA 4FIQA 3L0NA 4UFKA 5LNWA 3LHZA 1ICPA 4LTSA 1MZHA 3EWXA 5HR7A 1A50A 1WOAA 3M9YA 2YW4A 3LXCA 4Z0JA 1BTMA 5F4XA 4NJGA 2ISWA 4GUIA 4UR7A 3ZWTA 1RR2A 4JTJA 2V2CA 5F1UA 3NXFA 1ME9A 3FIGA 1UUOA 4JIPA 3TA6A 3QF0A 5DN1A 1OX4A 1S5TA 3LCHA 2ZRVA 1VC4A 3W7IA 1G7UA 3UPBA 1ALDA 3S6DA 4OE7A 1IXQA 3TW7A 1SSGA 2WSYA 5CPOA 3QMRA 1XUUA 2J9ZA 3N2MA 4N02A 1B9BA 5T26A 4XUGA 3TQ0A 4JTFA 2GJLA 2ALDA 1R2RA 3NZ1A 3C6CA 4RX0A 3NZRA 4LVBA 4FNSA 1SZNA 1ICQA 3KOFA 3D0CA 3EB2A 4GUGA 4Q33A 3HPXA 2DZPA 4O19A 3PF3A 4OV4A 2QAFA 1SPQA 4MYXA 3UWVA 4NUWA 2G95A 3P7YA 5D38A 1YPIA 5G5IA 3P8IA 4H6KA 4TU1A 4Z1BA 3S1VA 1X8FA 1OYBA 4JNMA 1ICSA 3M5ZA 3KXQA 3TXZA 1J4EA 3BO9A 4NXKA 3SECA 1KM3A 3FA5A 1UASA 1GVSA 2W79A 1VCGA 2UV8G 5D32A 3R2GA 3FLUA 4Z08A 2R8WA 4RKAA 3W7LA 3DFNA 3RLVA 3DFTA 5I3HA 3UWQA 4XTIA 1LLZA 1SW0A 3Q2DA 4POCA 3TDFA 4UFJA 3MJYA 3KVJA 1VQTA 1FWWA 1H60A 2ZRUA 4UTWC 1EEPA 3DKLA 5CPMA 2BTMA 1VGAA 4MY1A 2EKCA 2FTPA 3VCRA 2YXGA 3N3MA 5FEPA 3LHTA 1ML1A 1NFBA 5BW6A 4O8RA 3MUXA 5AHEA 3P80A 1H1ZA 1PHWA 3I6RA 2QUUA 1IXNA 2ZA3A 2ZZ6A 2RDUA 3CT7A 3W1NA 2Y7GA 4JS3A 3DGRA 1HO1A 3CU2A 3EXTA 1KFCA 4DF0A 2G97A 1YXCA 1ME7A 2Y6ZA 5F1VA 2EAWA 3S1XA 4UTHA 2V2DA 4WY0A 1YADA 3MBFA 1U5JA 2NXHA 1TJRA 4XWUA 5I3GA 5I3KA 3QMTA 2CLFA 1K8YA 2O7SA 3SR7A 4MOZA 2E5CA 4O53A 3N34A 4KWWA 3W84A 4Z1AA 1H50A 4N6EA 4XTDA 3DKJA 3LERA 3LCWA 3OVRA 1JCLA 3YPIA 2QJGA 3R13A 1CW2A 4FNUA 3W7HA 4UTLA 4JTHA 4O14A 3QM3A 1VHNA 3MBDA 2QJHA 4KFPA 3C8FA 1GJPA 2I1OA 3PC0A 2VFIA 2JKAA 5EKYA 5EYWA 4P2VA 5C6MA 3S5YA 3G1VA 3KRZA 5G2HA 2FB2A 3W7PA 1OK6A 4N4QA 2Z6IA 3BW4A 3TSMA 3HO8A 3LRMA 2QJIA 2CW6A 1H61A 3W75A 3TQKA 1YDVA 3TQVA 3G1YA 2C6QA 3GVGA 3IGXA 5CSRA 1AK5A 1MEIA 2EHHA 4NZFA 4LNYA 4J9JA 4YMZA 5K9XA 3P84A 5AYYA 4EF8A 3TC6A 1KTCA 3W6YA 3QMSA 3PSWA 3LHUA 4A29A 3AJXA 5EBUA 4JDYA 1WOBA 2PCQA 2ZTJA 3LXBA 4UFMA 4IOTA 1K7FA 4O0KA 3DI0A 2A2IA 1GPWA 5CZJA 1F74A 2QUVA 3U6WA 1RQBA 3TMLA 3NQ7A 3DFPA 3LV5A 4YL2A 1WV2A 2P10A 4GJ1A 1B4EA 1PCWA 2Y88A 1QNVA 2GJNA 2WO5A 2ZCGA 4AWUA 1FCBA 2JK2A 1FXQA 1P0KA 5DELA 1L6SA 3E96A 5IM51 1H7WA 4PC8A 5U7SA 3O6DA 3STGA 1SO5A 5CG7A 3CB8A 1ME8A 5FEXA 2KZHA 2V81A 4O18A 1P1XA 4NNCA 3TR2A 3EEGA 4JX4A 3EWWA 2ZDRA 3UXDA 3G1SA 4IGHA 1FCUA 6ALDA 1UCWA 3JRKA 4M6VA 1JCXA 1D3GA 1KV5A 3O63A 5CZSA 2JKPA 1DVJA 1JUKA 1C29A 4GC4A 5C54A 2FDSA 1JQXA 2B7NA 4K38A 5F2GA 1IIGA 1R2SA 2QCDB 1HFBA 3QEZA 1H5YA 1XBVA 3IV3A 3FS2A 3ZR4A 3EWUA 3R89A 1K8ZA 2YR1A 1ZHAA 1VHCA 5IBXC 3W73A 4AB4A 3LLDA 4HNUA 5HWNA 1UB3A 4WX2A 5LNUA 5BMXA 1T0OA 3PBYA 3QW3A 3GXPA 4UTWA 3PBWA 2RH9A 4LRTA 1LORA 3R5EA 1OFBA 2CLOA 3PS7A 4HNVA 1FY6A 3IVSA 2Y7DA 4UTTC 2E5DA 4ZQNA 1D3HA 4NX5A 5DY3A 1VYPX 1FUYA 4TO8A 3W7GA 3PUEA 3TJLA 1SFLA 1ONRA 3WK3A 2B7QA 3HGOA 2FPYA 3M47A 1AG1O 4YCOA 3ZWSA 1W5OA 1OFPA 3BG5A 3W88A 4CCEA 4DF1A 2BSLA 3RMJA 1NEYA 4A2RA 5KTLA 1TMHA 2ZRZA 3N73A 4AMAA 4JX6A 3S5ZA 2VELA 3NO5A 3SIZA 2QKFA 3NQGA 2V82A 4AF0A 4NZJA 3G0XA 4RLIA 1LOLA 1OK4A 1Q6RA 3L0GA 3ZFHA 3B0UX 2WNZA 2ZQ0A 1KA9F 3CWNA 3NEVA 2JKEA 1OFAA 1TTPA 1KM6A 3EX1A 4CCDA 3STFA 1OYCA 1OG0A 1XUZA 3KFTA 2FLIA 3OBKA 2YDAA 1Y0EA 4RZ5A 3W1AA 1XCFA 5D2WA 2GPTA 4KFNA 4HKPA 2AAMA 2YZRA 2BWGA 3M5YA 4ADSA 3I7SA 3W76A 3W2LA 3W7EA 5AHLA 1JCJA 3QPYA 1AW1A 3S5NA 3M5VA 4JXCA 3B8DA 3QYQA 1GOXA 3IGUA 4O50A 3G1DA 4FIRA 3GLCA 3GDLA 1JCMP 1M7PA 1I2PA 1FX6A 4ZVJA 1ZY9A 1EP1A 3EX2A 4UCGA 3DZ1A 3LCIA 2GQAA 5E93A 4JTLA 3A5VA 4MLRA 2P0OA 3DBPA 3BVJA 3W3OA 2EGZA 3M43A 3HB9A 3PVFA 2WV8A 1B57A 1A53A 4UFLA 3W1LA 1KBIA 3BG9A 3W7RA 5AB3A 3G0SA 1GG1A 1DQWA 2CLHA 3DHDA 5KZMA 1VPXA 1TB3A 3NAVA 3PB2A 3THQA 3W23A 1X1ZA 1YDOA 3GX9A 4ORIA 3DFQA 3B4UA 2QCLA 1QDSA 1XL9A 1N55A 4IQLA 1GTEA 2DJLA 2J6XA 5FF3A 1L2UA 1FDYA 4DO5A 1JRBA 3HPZA 2NUXA 4U4MA 4L4LA 2W0UA 5D2TA 3VFLA 3MYOA 4O54A 1KLZA 2VFEA 4RZ4A 5D2YA 4NNAA 1S5VA 4S2CA 5LGXA 1SO4A 3PG9A 3NPWA 4O10A 1JVNA 1LRTA 5LSMA 3V75A 1NSJA 3NPVA 5IBXA 3G0UA 5BOOA 2WJZA 3SY5A 3S1WA 4WOQA 2R91A 4HNNA 5DXYA 1P5BA 4LVDA 1BWKA 3HGRA 4UFHA 1GYLA 3UZ5A 1E51A 3M7WA 4GE8A 1W31A 3W85A 3N9RA 3QRHA 2C3ZA 2OT1A 3LGEA 1XC4A 3I65A 4ZQRA 1N8FA 4O28A 3DXIA 4GWEA 5CZTA 4UTTA 1F6PA 3BLEA 1PVNA 4JEQA 1W54A 4Q32A 3W7DA 5C2XA 4GRSA 1G67A 4IMFA 3ABSA 3B0PA 2E6FA 2NWRA 3P67A 5DCBA 5FF7A 4PA8A 2Y70A 1F6KA 4DBDA 1YDNA 3O16A 4MJZA 2A6NA 1JQVA 4YXGA 1JRCA 3NQ6A 4N9EA 3W2KA 1VS1A 4JICA 1LOSA 1SU5A 2DU2A 5HJLA 1SZFA 1O60A 1KM2A 3MP5A 4TR9A 1I2QA 3CQ0A 3DFSA 4O4VA 3W1RA 2V30A 1QFEA 2PE4A 1H7PA 4MIMA 5KZEA 3W07A 4CCCA 3ATYA 2CZEA 3P60A 5HMSA 3K30A 4CQ8A 4JN6A 3SI9A 4JTGA 3V1PA 1VH7A 5F2MA 1H62A 1ZAHA 5J5DA 1Q6QA 3NQDA 1YXDA 1U83A 1EUNA 1P0NA 1R47A 3BARA 3F03K 1L9WA 4O57A 2A7RA 1KFBA 1W5PA 2P1FA 5FF0A 4O11A 4WY0B 3MP4A 2ZYFA 2ABBA 2NX1A 2Y7FA 2Z6JA 4MFEA 2R94A 5CSSA 1LTDA 3WFAA 1YTEA 1K7EA 2E09A 4JIQA 2G96A 2HS8A 2RDWA 3NGJA 3EX4A 4Y6GA 2NX9A 1XDLA 1TV7A 3S8HA 5E1QA 4RK8A 3TFCA 1OX5A 2ZZ3A 5HINA 3PY2A 5HULA 3DFOA 4BWLC 3BW3A 4MZ1A 3PAJA 4WD0A 3TXVA 4K39A 5DY2A 3T55A 4LVFA 4L4MA 1R30A 4R33A 5AFDA 5D03A 2VC6A 4MZYA 1KLYA 3FFSA 3E0IA 2NXGA 5LHFA 1TRIA 1SO6A 1FWRA 4N4PA 1QMLA 3L68A 4H3DA 2QCGA 4NJJA 3L2IA 2OX1A 2CLLA 3TU9A 3G1HA 3HG3A 2DP3A 1C9DA 4Q4KA 4QIUA 3FYOA 3R8RA 5FEWA 3VI2A 5LZLA 4UTIA 5HNRA 2QAPA 1A5BA 4M7TA 1AMKA 2ATSA 4Z0SA 2XFWA 2A85A 3QW4B 3MYPA 4O4WA 1QO5A 4A21A 1D9EA 1S3HA 1BWLA 3CIXA 3G18A 3Q94A 3WJYA 4QQ3A 2DZUA 1WX0A 4WOZA 2YGYA 4TMBA 2Z2UA 2ZRXA 4M5PA 1SFJA 2ZZ2A 1UUMA 2X1TA 4QSHA 2J9XA 3FKKA 5FF4A 5EPDA 5TIMA 3S1UA 1EWDA 4ALDA 3GAKA 5AYZA 4UC5A 4PTNA 1LCOA 2C19A 1FWTA 2ZZ7A 5K4XA 4O12A 4OU1A 2OMAA 5G1TA 2C18A 1I8JA 2VFDA 4IMDA 3NQAA 3EX3A 4LV4A 3O1NA 2J24A 1I45A 3OG3A 4HSNA 4NU7A 2GQ8A 3INPA 4RZ6A 4LVGA 1OABA 1GVQA 4CQAA 2E5BA 1GZGA 3I68A 4CQ9A 4QITA 3A5FA 3PBUA 5G2WA 1FWSA 3W74A 3NQCA 4ZL1A 2ZZ4A 2RKXA 1SUXA 4YLWA 1I2NA 3UPWA 3SFKA 1H51A 1F05A 3W2JA 3RFAA 4Z1DA 3G3MA 3TKFA 3W7CA 4KKXA 3ZS4A 2VEMA 1LDCA 2C13A 2J9YA 3W2UA 2DZWA 5FESA 4XBKA 3GXTA 1TPEA 3WK1A 1Q3NA 3O15A 2J88A 4AXKA 7TIMA 2DZXA 3UYCA 2RDTA 3PB0A 4IXHA 2C15A 1OF6A 2C1HA 2ZBTA 4UNKA 4QJ1A 1KFJA 4AWSA 4UNLA 1RPXA 5TQLA 4RCXA 1JULA 5D2XA 1TPC1 4JTIA 2GQ9A 4PL2A 1K03A 1ZENA 5LNVA 3W9ZA 3L66A 3P82A 2VOMA 4CNPA 3NL5A 1PCKA 4PCFA 3WK2A 1TO3A 1NAL1 1A5SA 3SZ8A 2E6DA 4CNNA 5D02A 3BGJA 2H3DA 2QCCA 4AHPA 2FPVA 4FX7A 3L5AA 1KBJA 4K36A 3GK0A 4ADTA 4OQVA 4BWLA 3W1TA 2X2GA 4GUJA 1Q6OA 1TTJA 1KFKA 3F1QA 3NPXA 1B3OA 3W7JA 3A23A 1JJKA 2X1SA 3C4UA 4UFIA 3NQEA 4HN4A 4UUIA 1G4EA 4MY9A 3IIZA 1RV8A 3G1AA 3F4NA 3UY7A 4DELA 3G3DA 3CIWA 4MVAA 4M19A 1KFEA 2QUTA 3M0ZA 4E0CA
chains in the Genus database with same CATH superfamily
3FJ6A 4B16A 3H53A 1Q13A 1GJWA 2YPIA 4RE2A 1TSIA 4XAFA 3MZNA 3MO4A 1NWSA 3HM7A 5DLCA 1KBBA 1EOKA 2WMFA 4PODA 3WLTA 1X39A 3GB6A 2QDHA 4K1GA 1DWIM 2HBXA 3IJ8A 4U10A 4RR4A 1O95A 1TPUA 1YPFA 3TV8A 3NQVA 2QXWA 3MUCA 2E8YA 1DV7A 3BGGA 3C3NA 1YTDA 4MLJA 4JTEA 5FEZA 4JTSA 3DCPA 2ABAA 3NYDA 1J2WA 1A47A 5SWUA 4NP7A 3U57A 3LTYA 1XRSA 3GIPA 3GU1A 5D09A 2W5FA 4DYJA 4ZE5A 1UWQA 3G8RA 4DHGA 1Y8BA 3VNZA 2YX0A 3ZSSA 4NVTA 3WNKA 2I14A 3TW6A 1EP2A 4UZUA 4PMRA 2GOUA 1X97A 2ZRYA 1MXSA 2RFGA 5AC6A 4PB4A 2PU0A 2VFHA 2ZX9A 4JQ3A 3UEQA 4I7UA 2EXOA 5EMJA 3EA3A 3PG8A 3W1PA 3CMGA 3PPHA 3QPEA 5DBUA 3CO8A 5F4SA 1KR0A 2F8QA 3JZEA 3MO7A 1TPWA 4ORMA 2O55A 2VDHA 3ZXWA 2GVLA 1AFSA 4EAYA 4ZBCA 4LV9A 5AOUA 3UY8A 5LA2A 3W7KA 4XBSA 4ZQPA 4PRTA 2FFCA 4NZ3A 3PNZA 4DBWA 3WQGA 1T99A 3SB0A 1SFTA 4KWVA 3NO1A 1QOPA 3BK0A 4JEJA 3ABOA 3ZT5A 2QJNA 3PZNA 2CWNA 4QE5A 5CCZA 2GSHA 5E6ZA 1S2UA 2NQLA 1QPKA 2G3JA 5HNUA 4OV9A 1F9CA 1H7OA 1ONXA 1OGSA 4FX8A 3O06A 2E68A 3NL6A 4DEFA 3W7QA 3WJWA 3LHWA 2BV9A 3GHUA 3TFXA 3C56A 4E8CA 4S23A 3T0AA 3RXZA 1FOBA 1IXOA 3TONA 2DQXA 2VJXA 3FKRA 3UA4A 4GYPC 4XZ9A 1P7TB 4LUJA 4BY3A 1TKKA 1EUAA 2XH2A 3SUWA 1R0MA 3TZFA 1M03A 3USBA 3LBMA 2Y7EA 1LYXA 3EDFA 3NR0A 3UXKA 1YMYA 3BWWA 3THDA 5RUBA 1BKSA 1FKXA 5K3VA 1OGGA 2VCCA 3D3FA 4K68A 3EZ4A 1HG3A 4F2UA 1E4MM 2XN0A 2E77A 4JNZA 3L21A 4CEXC 3GNPA 2O4MA 4S3EA 4O1CA 3SGZA 2FH6A 5FJPA 4QCFA 4FNQA 3PP7A 3KBMA 4U2ZA 4B90A 3GY1A 4A8IA 5FL0A 3BCDA 2WLYA 3TLLA 2Z27A 4EPBC 4MFDA 4IQJA 1VENA 2UY5A 1V8EA 1UMLA 4GXMA 5AYXA 1HL2A 1TTIA 3T2OA 1AH0A 1EIXA 4NJKA 4FXRA 1TX2A 3KRSA 3WFZA 3CTLA 1WBHA 4GBUA 4U33A 2AL2A 4UMAA 2OXNA 3TSDA 1XFBA 5GJNA 1XDMA 3L7RA 5F4WA 3MI3A 1E6QM 4X22A 3DUGA 4IWWA 3GXNA 1Z6KA 4MUZA 5CZ0A 4K8EA 3V35A 4L7ZA 1GK8A 1WDPA 1WZMA 3GKFA 1PHQA 1CNVA 2ASHA 1UR2A 1WE5A 2QS8A 3WQ5A 3JUGA 1KM1A 1W8SA 4WSKA 1RZMA 5REQA 2Y8UA 4FALA 1HQTA 2OX4A 2RHGA 1HXJA 4MKSA 2J27A 3ABQA 3N9KA 3O6CA 3EPNA 2HEJA 2YIHA 2ZIDA 4PMVA 3JW7A 1Z41A 3JU2A 4UTJA 3KOXA 3QJAA 2IPWA 4YHGA 1EJUC 3KZSA 3WLHA 1IF2A 3K1DA 3DG6A 3W86A 3TSBA 3CAQA 1GPFA 4NZCA 4MZ8A 4FLOA 3GR4A 3ZR6A 2XDFA 3FDKA 5A95A 1I75A 4C65A 3N6HA 3NM3A 1HKKA 1LLWA 4GC3A 3BSMA 4HQVA 1NOUA 3UP8A 2CHRA 4K8HA 3CAVA 4JTCA 3KVMA 1JAKA 4GYPA 2AL1A 4LB3A 2X7WA 1R3VA 2Q09A 1CI1A 5CC3A 2BXZA 3MSGA 1AW2A 1MO0A 4LS1A 1TREA 1J5SA 3CV1A 2DVTA 1EXPA 4OFCA 4AY7A 3EMCA 1VFLA 4R34A 4JZ5A 4M3PA 2E6AA 1IZKA 3TIMA 1CXHA 1EA9C 1MWOA 3CUIA 2ZXQA 2W66A 3OLGA 2J77A 3VPLA 3OHIA 4A2SA 3W2NA 1OGBA 1TX0A 4R27A 3E49A 2JBMA 3NSMA 2DIEA 1IT8A 4JQ4A 1OG6A 4EE9A 2XGBA 1DJIA 4N42A 3SJNA 4GYJA 1JPKA 3HBLA 2HK0A 3AXXA 2PURA 1R7OA 3PZVA 4ZFCA 2DT2A 3MUAA 4D8AA 3PTDA 3WZ0E 3WDHA 1FWFC 1IXPA 3WQVA 2V69A 5FI8A 3M44A 4A22A 3MHUA 1EZ2A 6ENLA 5LNRA 3V36A 1XLIA 4XBJA 3GH7A 4PMOA 3ES8A 2ZICA 1F3EA 1JZ3A 4PTDA 1EIBA 3QHMA 4D72A 3BPWA 4E38A 2ZZ1A 1I2OA 2Q3RA 3GNNA 1E5JA 2WC3A 4U28A 1DJXA 1TFVA 3AZRA 1UKQA 3IVTA 2ZTKA 3BGAA 1YE6A 4IMGA 2YW3A 4GKTA 1Q85A 2HXTA 3AJ7A 4IX0A 3LCLA 3CTTA 1WZAA 3RX3A 4ZSUA 3IIOA 1A5MC 3SCVA 1X6UA 3N2XA 5KSWA 1VAHA 2A5HA 4FLQA 3RX4A 4DVOA 2QCFA 3GYCA 4LAMA 2BHYA 3PANA 1FBAA 1PX3A 4C1LA 4CU8A 3CLMA 4D6JA 4EAMA 1JUEA 3MUIA 4FXSA 3SGUA 1XISA 2PAJA 1F4AA 1HUVA 1UZHA 1NWRA 5CC6A 5HUOA 1A5AA 1A0EA 1NFPA 3ANUA 4BQ5A 4L6DA 1BVZA 5CBBA 1KM5A 2Z0IA 1O5KA 1NVMA 1UP0A 3AIBA 3JR2A 4YCPA 1EPXA 4INFA 3ARYA 2X1UA 4YPJA 4MKVA 1PIIA 1KTBA 1LF1A 3HG4A 2INZA 4XG1A 2QR6A 3KHJA 1G4SA 1O7AA 3RF9A 3VKJA 4PMJA 3P2VA 1TA3B 5EL1A 3GW3A 3BV7A 2UY2A 3QY7A 4LAKA 3I4KA 3GKAA 3BLPX 2QF7A 1OSEA 4M8UA 2NX3A 4YTRA 3URNA 3ARZA 3PUOA 1YXYA 3OJGA 3BANA 4R7WA 3CM4A 4Q6XA 1WA3A 3NURA 3EWYA 4EXAA 2JEQA 4QR6A 2BXVA 1Q7MA 5E0KA 3GDMA 1V7YA 3E2SA 1XPYA 2C71A 2V3EA 4JTQA 2DY3A 3PNUA 1WKFA 1VRXA 5DCDA 5EMMA 4HU8A 2PDCA 3LBOA 4FEZA 6CGTA 3T08A 3WUBA 2ZC8A 4C5YA 1GQIA 3HQ1A 3ZR5A 3V0SA 4RW3A 4NI8A 4JTAA 4OT7A 4X0NA 3LM3A 4ZEPA 3S9IA 4EPDC 1KXQA 2ZWZA 4EXBA 2GSJA 4UMCA 3W27A 3AWOA 3B0VC 2Y63A 2X30A 1Q4NX 3AYTA 4RE0A 1ZAIA 3HG2A 3SCWA 4JD4A 3R6IA 1Q45A 4AVFA 3LQLA 4PE8A 4J3VA 3NNTA 3VABA 1PXGA 3GNRA 3EYPA 2NV2A 1R3RA 4F3HA 5F2IA 4IMEA 4ZXOA 3WH5A 4MUPA 1NP2A 3H4WA 3T9PA 1CECA 2H3BA 1TWWA 4CN1A 3LBCA 1CGWA 3AXKA 1XX1A 4IPLA 1TPB1 3L4VA 1RBLA 5I00A 4H7ZA 3H7RA 1DL3A 4CNTA 1NQKA 4NRSA 4PFHA 4B3LA 1Q66A 3UD6A 2DZVA 4XZMX 3IEBA 4D8ZA 3WELA 3NEHA 1CLVA 1QJWA 1TYGA 5I3DA 5HWJA 4W8BA 1PZ0A 2FJUB 4RXGA 4HB7A 4DBEA 4DI9A 4KH2A 2B0MA 4P61A 4IJBA 1RSCA 4UR8A 5EBAA 1FQ0A 2OKOA 5GPRA 1JPDX 3RGTA 5I3JA 1Z42A 1YX1A 2ACRA 1AJ0A 1V6TA 3LEPA 2W63A 5IFTA 3FOKA 1OC6A 2QCDA 1W9VA 2ZE0A 4S3BA 2FQIA 3BMVA 4K2SA 1NF0A 1XBXA 3KCLA 2GUBA 1XICA 1OZMA 4B9YA 4HT3A 2Q8ZA 4O17A 3C2OA 3KOWA 3NWRA 3W1QA 3WEMA 1P4CA 1THFD 4JHOA 4IFKB 2ZUNA 4R85A 1L6FA 1XBZA 3NL2A 2XFYA 1LG2A 3CWHA 3T0TA 1HW6A 2OG9A 1Q5MA 3LD5A 4G7EB 4JY8A 5FSEC 3GXFA 3C2FA 2GJXA 2VNCA 1F2JA 3ZZ1A 1XIHA 4GCAA 2YDRA 1G4TA 2PF8A 3O2LA 1SZGA 3CAWA 4HOXA 4DXVA 2O7QA 1E70M 3OZMA 1B3ZA 5LXEA 1J0JA 2WSKA 4AUBA 4QFUA 1B9ZA 4K3ZA 5H1WA 4OKDA 5EA9A 3KP0A 2X0YA 2BY1A 2TSYA 4HHLA 3AZTA 3IVUA 1F76A 1Z32X 3F2BA 1XYAA 5KITA 4D9PA 1PBGA 4L5ZA 2H90A 4W9TA 1EA0A 4S3FA 5HMFA 2NSXA 1UBSA 2UBPC 3ICJA 2VR5A 3PJUA 5JMUA 3NOEA 3G1FA 4Q8VA 2JIEA 2ISSA 4FX6M 1UJPA 1T5AA 4BF7A 1MW2A 4DRSA 3DERA 1ADSA 2GLKA 4RJEA 4Q8QA 4IPNB 4E2BA 4FF7A 4FHAA 4MAZA 4HMDA 1YE4A 8TIMA 3GAYA 2XIBA 1PKNA 3MQTA 2PGEA 4DPQA 2UZ9A 2QCEA 1JNEA 2VR2A 3DECA 1GVFA 2CLKA 1YTKA 2HBVA 2X16A 3RYSA 1H7RA 2VD8A 3N17A 3I7QA 4IP7A 1UD6A 4NZ4A 3EXRA 1TCDA 3KBNA 1LBFA 2R9RA 2EF9A 2WMKA 3S0CA 4DJDD 4C6FA 1MZRA 4BEQA 3VGBA 3MDUA 1U2YA 1ICPA 1E9YB 3EWXA 1ONWA 3CZ8A 2PWHA 4MG4A 2QYGA 4UR7A 1OCBA 2O9PA 1F4HA 1RR2A 3FIGA 4JIPA 3RPTA 5DN1A 4KEUA 1OX4A 3MMDA 1S5TA 3LCHA 3ALFA 2ZRVA 1VC4A 3W7IA 3ARXA 2EPOA 3S6DA 2J78A 1J8VA 1MW0A 4I9MA 3GG7A 2WSYA 2WANA 3QMRA 1AMYA 1LT7A 3TQ0A 4JTFA 1OWQA 1EYEA 3LSCA 4MPKA 1E3ZA 1ZPTA 4HA0A 3QKEA 3U3HA 3EB3A 4U5IA 4PUNA 1CXKA 3ZJ6A 5CEWA 3KOFA 3W00A 4C60A 4H9ZA 4EXQA 4D6EA 3MKKA 2XPKA 3PF3A 1H3GA 2QAFA 2WMJA 5C9XA 1Y5WA 3T0DA 1TE1A 1PX8A 1G1YA 4BZYA 5T91A 3S46A 3S1VA 2VCBA 1J0ZA 1Y5VA 4NXKA 3AXHA 2VX6A 2POZA 3FA5A 1GVSA 2W79A 3R2GA 3SRHA 2R8WA 4P7LA 4RKAA 3W7LA 4WDWA 2C8NA 1R3YA 3ORWA 3DFNA 1QWKA 1US2A 1XRVA 3SCOA 4ATLA 3UWQA 4XTIA 3TDFA 1FWWA 1EEPA 2BTMA 1B3YA 2EKCA 4E3TA 1GZ1A 2BMBA 2FTPA 1S2WA 2YXGA 4CCZA 3SADA 3VMNA 5FEPA 4CVUA 1WNOA 3UXLA 4KRUA 1JPIA 4L1XA 5AHEA 3MUXA 1HP4A 3CHCA 3M07A 2QUUA 1MNSA 2ZZ6A 3CT7A 4MM1A 1KGWA 4JS3A 2J8GA 4ACZA 2J8FA 3EXTA 1KFCA 1YXCA 4HK6A 4F0KA 2EAWA 4LBUA 4HK5A 1TJRA 1KQZA 4XWUA 3QMTA 2CLFA 1UP2A 2NT0A 2Y1HA 4MOZA 2R24A 5CC7A 3FY1A 3ARTA 2VC5A 4WK9A 2G37A 3AHTA 4GZEA 4Z1AA 3ONBA 3DKJA 3LERA 3LCWA 1ITUA 2CIPA 1JCLA 3SRKA 5HMDA 3G6LA 3B0YA 3DYMA 3I4EA 3FX4A 1JAEA 1UR9A 1P6CA 4O14A 3VNYA 4AW7A 2HVOA 2D20A 5I7GA 3PC0A 3WEOA 2JKAA 2E67A 5FACA 1QNPA 1Y5XA 2HJPA 1OY0A 4W88A 1W9UA 3P0XA 5EYWA 2FB2A 3W7PA 1C7SA 4UNIA 4W8LA 2Z6IA 1K6WA 3BW4A 3LRMA 4DYKA 2QJIA 5AC4A 1E0TA 3HA1A 3TQKA 2C6QA 3DN5A 3LPOA 5CSRA 1QUMA 3NXLA 5FCZA 2F6UA 4AZHA 4ASTA 2EHHA 4A6GA 3TTQA 3B40A 1E4IA 3MDWA 4IZGA 1DXIA 4KPLA 5E70A 3LK6A 3R58A 2XISA 1NARA 4F66A 4EF8A 1J11A 3PSWA 2P76A 1W3KA 4JDYA 2FZ9A 2ZTJA 3T4WA 3U4AA 3C0SA 5CJNA 4WCJA 4MSSA 3NQ7A 4D6FA 2VC7A 1M04A 1PCWA 2H9AB 2PTXA 2GJNA 4GI9A 1JD9A 1FCBA 1KGUA 1E0WA 1MXDA 2JK2A 5AY7A 5A2AA 3WLLA 4PSPA 2REQB 4AX7A 3AMDA 1H7WA 3ARRA 2ZVRA 3O6DA 3EPMA 3FGCA 4GPNA 2V81A 3H26A 1UWSA 2YL5A 4E4PA 5I77A 4JX4A 3EWWA 3Q65A 4QSFA 2WZMA 2ZE3A 3UXDA 3G1SA 3QV9A 3N4FA 1JCXA 5CZSA 1KXHA 2VURA 3J7HA 4A35A 4ZO6A 4D1IA 4ZSTA 1S38A 3QEZA 3IV3A 1K4HA 1K8ZA 1VHCA 3LLDA 3N2BA 2EJAA 4JL2A 2QV4A 5HWNA 4US5A 5LNUA 5BMXA 5DMNA 2RH9A 4LRTA 3WFLA 2OZ3A 1VIZA 4LUTA 4IG2B 4JNYA 4LGXA 2DEPA 3IVSA 1LQ0A 3DYPA 4HTYA 4P5UA 2GDVA 2Z1VA 5C9ZA 1VYPX 4OECA 4M29A 1SFLA 3HGOA 2FPYA 4YCOA 4A3QA 3ZWSA 1W5OA 2Z2BA 3BG5A 3PZTA 1BF6A 1KWGA 2BSLA 4MHBA 2Z00A 1XW8A 3WQDA 1KD0A 1XQKA 1JXJA 3LN3A 1TMHA 3A12A 3E0LA 3QGVA 1L2QA 4NAEA 4JX6A 2VELA 3NO5A 2X42A 2V82A 4NZJA 1V0MA 1LOLA 1Q6RA 3B0UX 2WNZA 4LAOA 9XIMA 4P8UA 4IGSA 3STFA 1ELSA 2X40A 2YDAA 4C90A 3N2TA 4LYRA 1KB3A 1GUVA 2YBTA 3A13A 2XUCA 1RJRA 4V15A 4KFNA 4RDWA 4HKPA 3T05A 4BS0A 1RUSA 1SR0A 3EWDA 3M5YA 4GINA 2D69A 4B2DD 3FJNA 3ZYZA 3QPYA 1HKVA 3SY8A 3D6NA 2AL2B 2EPMX 2WZTA 4URIA 3E38A 3K5XA 3IGUA 3ZLHA 2J7HA 1JF5A 1XV8A 3OGRA 5JQ9A 2PDQA 1UWUA 2HISA 4IGMA 4ZVJA 3LGGA 1ZY9A 2PDJA 3EX2A 2X0SA 4UCGA 5T8GA 2FVMA 4H2CA 4PMXA 3WF3A 4JTLA 3A5VA 4CN6A 2D24A 1XG3A 3PPFA 4NF7A 3PVFA 3OW1A 1A4LA 4C6JA 1B57A 1R9YA 2PBOA 4UFLA 5AB3A 2D2OA 4EPEC 1VPXA 1TB3A 5FAGA 3K1GA 1XL9A 1AQHA 2XGIA 3EDEA 1XRTA 1N55A 4GVIA 4IQLA 5MKGB 2J6XA 4IHCA 3BE7A 4B92A 1FDYA 4QLKA 4F2BA 3VD5A 1BYCA 4U4MA 2X7VA 3KP1A 4L4LA 4O54A 2XWDA 2VFEA 3SCRA 2WKLA 3AROA 4NNAA 1HGWA 5LGXA 3PG9A 1ZQ5A 3NPWA 1EO5A 3ITYA 1YDYA 4AD0A 3V75A 4ACYA 2R91A 4HNNA 1BWKA 1FHUA 3HGRA 3V18A 1GYLA 3PN8A 1MFVA 1W31A 1R9XA 4YNGA 1XC4A 2JF6A 4GWEA 3FVMA 3GHRA 3BLDA 3MSYA 3XISA 5LIUX 1V3MA 1W54A 4Q32A 3LPPA 1CDGA 5C2XA 4GRSA 5HQLA 1G67A 2DUAA 2D1ZA 4IMFA 5E6YA 4FOKA 2MUCA 4W86A 1JZ6A 5DCBA 4KS0A 4MJZA 2NVDA 1DJHA 1JQVA 4O1EA 8RUCA 4N9EA 1V7AA 4ENLA 1TIWA 2QNEA 5BOEA 1VS1A 4GBDA 1IWPA 1QK2A 5TD4A 2WWCA 2QGYA 3C5QA 5DFAA 4FAMA 4MWAB 3IRSA 4C6BA 3OIHA 5ENLA 2RJHA 4F8XA 5HJLA 5A6MA 2WZEA 1KM2A 3BICA 1I2QA 3CQ0A 4O4VA 3W1RA 1H7PA 5CPQA 3W07A 4CCCA 3ATYA 3TTSA 4JN6A 3SI9A 7PTDA 4QE4A 5CH9A 2P50A 1HGYA 1VH7A 3TR9A 5IOBA 1Q6CA 2X2YA 4C6NA 1ZAHA 4GZ7A 2NVCA 1JZ2A 9XIAA 1EUNA 1P0NA 2Z2AA 2PWVA 3F03K 4ZTXA 3ZVIA 5DEZA 3W02A 2A7RA 2Q8XA 3AMLA 4XIAA 2QPUA 3MP4A 4J40A 2ABBA 2NX1A 2AQVA 2V5CA 3F5JA 3UR7A 2QUNA 3AU2A 4Q7NA 3EDDA 3IJLA 2G96A 2RDWA 4J3TA 2RGMA 1C8YA 1YRRA 3UPMA 1TV7A 2D2JA 5HINA 4AIEA 3PY2A 4H2HA 4Q4QA 3DFOA 4BWLC 3GM8A 1YQ2A 2PS2A 3PAJA 1GOKA 3UA3A 4S3DA 1M3UA 3P14A 4WR3A 4L65A 1A5NC 4HHMA 3AHZA 4YYFA 1IEIA 2OQHA 3FFSA 2NXGA 5LHFA 4HCDA 2QUMA 3VIKA 1K77A 2VVNA 2TAAA 1FFQA 1RJPA 3N12A 2R1KA 3SCTA 2CLLA 3I3DA 1QHPA 5AECA 1VFOA 4QQUA 2DP3A 1X38A 3FYOA 1B3VA 3HQPA 3DGBA 1SMAA 2A85A 3QW4B 1G0CA 4O4WA 3QC0A 3F5KA 1D9EA 4LSBA 1BWLA 3CIXA 4YTTA 1W3HA 1EGZA 5KEZA 3KOZA 4QQ3A 1GKRA 3H2EA 3JZUA 5EFDA 3TJ4A 2B81A 2BS9A 1EWDA 4ALDA 1XLHA 4O8AA 5C7HA 3O9NA 1DEDA 1QOXA 3M46A 1LCOA 4AIUA 2ZZ7A 4OU1A 1OCNA 4NASA 1OQFA 4E8GA 3NQAA 2YLAA 3K2GA 3STPA 1V79A 4LV4A 1EFZA 1A3HA 1NDYA 1I45A 3UYIA 3OG3A 1E0UA 4TVCA 4PB5A 3GSMA 4LVGA 3IPWA 2GGEA 2OU4A 1EZWA 1GVQA 3T0CA 4AISA 4CQAA 2E5BA 3F4DA 1GZGA 2PGRA 3I68A 2F6KA 3W74A 3W38A 1W1IE 2ZZ4A 1VBJA 2RKXA 1SUXA 2XYLA 1U5VA 3XIMA 4IH3A 3SFKA 1F05A 3RFAA 3KL5A 4Z1DA 1FA2A 3W7CA 3KM8A 2VEMA 2PDIA 3TP4A 2C13A 1XD0A 4RNJA 3F4VA 4H41A 3GXTA 4DWSB 2GYIA 1W9XA 1Q3NA 1PWLA 2PU1A 4AXKA 4UTFA 2RDTA 3PB0A 3T8LA 2DT0A 2C1HA 4QJ1A 3RCNA 1QI3A 4E5TA 1KFJA 1RPXA 2NQ5A 3UJSA 1C90A 2Z25A 2GQ9A 2A3HA 4Z2IA 3NL5A 4PCFA 1NAL1 2DW6A 1A5SA 3E2VA 3SQSA 3BGJA 4QJ3B 1SJAA 3L5AA 1Q8AA 3O6AA 2Q01A 2QT3A 2MANA 3W1TA 4BWLA 1Q6OA 4C6OA 3F1QA 1B3OA 3AISA 4Q7IA 5BCAA 4HN4A 2JFEX 3G1AA 1FVPA 4C6EA 1FKWA 3V16A 4DAFA 2ACSA 4AYGA 4DELA 3G3DA 1Z8AA 2XH4A 3WJZA 4RZBA 1GPWA 2OO6A 5HNTA 2P8BA 3GU2A 1GW9A 1H63A 1KCLA 1XLAA 4DUXA 4Y96A 4YTUA 4GZIA 4H7VA 2NW0A 4D6IA 1VD6A 4HHPA 2ZA1A 1RD5A 4GUFA 1DJQA 3PHAA 4F0RA 3P5ZA 3HQOA 4M6PA 4UXDA 4UOQA 2ZXAA 5HR6A 3QTPA 1UR4A 4LUIA 3MV01 3HPSA 1UWAA 1Y7VA 5D04C 3VGGA 1EHNA 1WDDA 1PX4A 3EOOA 2Q3OA 3O05A 3T1GA 3S47A 5CQ1A 1TQJA 1V6UA 3OHMB 3LCFA 1QHOA 1YNQA 3R94A 2EPHA 3QHOA 4LEQA 2ZOXA 1O4UA 3VD3A 3VIPA 3M6YA 1O1HA 3N11A 3GR7A 3N18A 3ANVA 3UVAA 3RRXA 2G50A 1QAPA 1WZLA 2D23A 1JUBA 1C91A 2HMCA 3MI6A 3WD2A 3UJRA 1ITXA 3KZPA 2WM0A 3VM7A 5G1MA 4JTKA 2EEXA 3BJFA 3F7JA 2VP8A 4Q4OA 2PDPA 3MA8A 3VDHA 5H91A 3ABXA 5CKSA 3ZLFA 2V0TA 4QNWA 1JZ4A 1EBGA 4IICA 5D9MA 2ISVA 3CXOA 2D3NA 4V2XA 5FIPA 4V27A 3ZSTA 1VFTA 5JIWA 1FP9A 3GE7A 3WH8A 4UIOA 4PN2A 2ZX7A 4Q8PA 1FWGC 2D22A 2V68A 2FHCA 1CENA 1OVDA 1YW1A 3EKZA 4WUIA 4XX6A 1DJYA 2V9DA 4DJFD 2ZUVA 1QW8A 2PZNA 4LAZA 4PRWA 1POJA 4OWGA 1K4GA 1Y65A 3D47A 3W37A 5K7JA 4ERIA 3G22A 4K8GA 1RCQA 1ITCA 3AO0A 4V1XA 1UR3M 4I7WA 1LRQA 1O5QA 4AD4A 1TPVA 4GGBA 3N25A 3RM4A 4I7VA 4GO9A 3TAKA 3CH0A 3S9YA 3W87A 3PZGA 1RH9A 1FDJA 3T0BA 1GZJA 2VI0A 5A6BD 2L5HA 3TOYA 1O6IA 4B4HA 1JYVA 4WKHA 5DXXA 2BG5A 5AYBA 1IQ8A 1OX4B 1K3UA 2BZNA 1V6XA 4PL1A 2BNJA 1WKEA 4HU4A 1W1ZA 4PEKA 3AFBA 5C8BB 1LUCA 1XGDA 3VKAA 5DBTA 1IEXA 4U31A 2Z1SA 3S2JA 2BDQA 1OJXA 2VX4A 1EB3A 2GK1B 3OG2A 4NX0A 1KCKA 3MHGA 3NDOA 3WL1A 4JN7A 1LQAA 3H7VA 4Z1YA 2WMHA 3TJXA 2XIQA 3W7NA 4PUJA 5BRQA 4FXFA 1VBRA 5E0CA 4M1BA 1XCWA 2Y5SA 1UOZA 3TNOA 4BI6A 3AHYA 2YBVA 1I1WA 1E72M 5IHRA 2PZ0A 1UD5A 4F79A 1JGMA 1BQGA 3VK5A 5G4EA 4RV8A 4AWEA 3NQBA 2XHYA 3ZQ9A 3APYA 1V0NA 2INEA 1E3XA 4RDZA 1SZRA 5J8LA 4B5TA 2I5QA 4LVAA 2HTMA 3OLDA 2XVPA 4EF9A 2NV9A 4FLRA 1V3LA 3FNDA 4H1ZA 2VGFA 3NQFA 3UW6A 3T2PA 4B91A 2PDLA 1PJ9A 1CPUA 2PLJA 3W1XA 3QQ1A 1WDWA 5C9UA 2HQAA 3UWUA 3UXIA 1ZCOA 1J93A 3FJLA 1OFOA 1O68A 2CLEA 3W72A 4HA4A 3VIFA 1AD4A 1GOMA 4GYFA 3WKZA 4O13A 3VAVA 4UMBA 1OF8A 3NZGA 3MVTA 2ALRA 1DJNA 4G7FA 2A3EA 2DZSA 1G6CA 3BSGA 2W61A 5G2IA 1UW9A 3W71A 4US6A 6TIMA 4PMNA 3S1GA 3WQ8A 4MJMA 4PTVA 1D7FA 4DBUA 1V02E 3KDNA 3NA8A 3DH7A 2Z7KA 1A0CA 4Q4RA 2DIJA 2E8ZA 2QW5A 3N6QA 1QASA 5EMKA 3EA2A 7REQA 3SRFA 4LB4A 1B4KA 4GIYA 4GJJA 4GQBA 3F5LA 3KWXA 5FJOA 3T8QA 5HK4A 2EO7A 3PTKA 1H2JA 1FH8A 3E2RA 1REQA 5KETA 4HMNA 4EKJA 1CX9A 3WK0A 1GVOA 2J66A 4UQBA 3WQ6A 1IHIA 1W9PA 4N9CA 4TV6A 3RN6A 1BHGA 3THAA 4EVZA 4H19A 1JYWA 1PV8A 1OFDA 3EDJA 3T42A 3EWCA 3VKBA 3M0XA 2GDUA 4HK7A 5H6HA 3NZPA 3WDJA 3EA1A 1X1OA 3IRDA 1LBMA 4ZOBA 1S46A 3LI0A 4IUOA 3LX9A 5K2ZA 3U9IA 1GEQA 4Y8FA 3IJ6A 3P61A 2XIOA 4JYFA 1EF3A 6REQA 3UQNA 3SIMA 4RXFA 4NIRA 2AOSA 4QGCA 1QPRA 1GW1A 2ZA2A 2WBKA 1LWIA 1OINA 3I6TA 2EG6A 4YWIA 1KRCC 5I0DA 5DT7A 4JDBA 2XN2A 3FGCB 3W82A 2KAUC 4ZMGA 3CJPA 2OCZA 1TV4A 1AW5A 1NDWA 2PRMA 1XH0A 3VOJA 3UG3A 4BF5A 1XLKA 4LT9A 1E73M 2Y62A 2F84A 1AJZA 3DDMA 1GOQA 3FYPA 4DZHA 3ANYA 5AHFA 1U33A 1V02A 5CAHA 2B7OA 1NTHA 3B0XA 3C0JA 2A7PA 4OHQA 4KFOA 1VPQA 2NZLA 4HPJA 3VE9A 5CJ5A 5H8MA 3VNJA 3QR0A 3CB3A 2DZTA 4DI8A 1P0EA 4DO6A 5M5DA 4LUTB 1KM0A 1L0PA 4I90A 2J75A 2W3ZA 1S5NA 1BRLA 2A6LA 3LTPA 3O7UA 4JPGA 4CNOA 3APGA 4RPQA 2YZ5A 3LSBA 3BOFA 1X98A 3C2YA 4E4UA 3AIRA 3A3HA 4XZNX 4KQNA 1KRBC 1B3XA 4PUUA 4KMQA 1NF7A 4NXSA 1GKQA 1XRFA 2VGBA 2GQ3A 4ERGA 1QXLA 2FZBA 2DH3A 3HPFA 3PAOA 2IS7A 1F61A 3SGGA 1CXLA 2HPMA 3QYSA 2XWEA 4AZ7A 3GDTA 2ZVIA 4QAIA 4EIVA 1FHDA 2PDBA 1TJPA 3B8UA 4UTUA 3FYYA 2XH7A 3FXYA 1XLDA 2BOEX 4KCTA 4AG0A 4ZXLA 5C7VA 1T6MA 4XKYB 1I0BA 1O5XA 5FF2A 4AVOA 4HHHA 1NWTA 5D37A 3WQOA 2H8XA 1PB0A 1JCYA 4G1KA 2NQHA 3T44A 2VKZG 4CEUC 3A4XA 5CLTA 1V77A 1GQLA 3B8WA 3PJTA 3VIHA 4B5WA 3CS2A 5D9NA 3ZM8A 1ECEA 1R2TA 1MI3A 2Y8KA 4EP8C 4RDVA 1GVIA 2PP0A 3JS3A 3PBVA 4L56A 3QQWA 4DLMA 1LWHA 1YHTA 5BZAA 2NSOA 4NNBA 2XVGA 1R3QA 1VF8A 1F5ZA 2F7FA 1RJQA 2PA6A 4PULA 5EB8A 1TZZA 2WNNA 3BLKA 1RY8A 1OFRA 3AXIA 1YKWA 4O15A 2CZ5A 3M7SA 4YS1A 3KLKA 1DWFM 2PWGA 4IM4A 2A21A 3UG4A 4W5UA 2ACQA 4WXZA 3MMUA 3R7MA 4DLFA 4Z1CA 5B80A 3CC1A 3VYLA 3GTFA 4QS6A 3BDKA 2OGJA 2OQYA 3CWOX 4AZGA 4DJDC 3AS2A 1T8XA 2NXIA 5I07A 1ZAJA 3KTSA 4C7FA 2JF7A 1H1YA 2IXUA 3C8NA 1L8PA 3BQ6A 1XYMA 1EQPA 2HCVA 1DP0A 2D2HA 5J04A 1EC8A 4YN5A 1H09A 1XLCA 3CUXA 3CZEA 1FWBC 3KWSA 3TH6A 3WJSA 1YIXA 1X8CA 2VDIA 1QTWA 3TYCA 3URAA 3T7VA 4OGZA 3EKGA 1VYRA 2I17A 4AZCB 1PE1A 4XIMA 3BAYA 3PR2A 4M7SA 4UQCA 2DW7A 4HNTA 2XTKA 2NVAA 3UJEA 3PPCA 3NDZA 4OIFA 4XD6A 2GWGA 2WPBA 1CZ1A 3DENA 1R46A 4KRZA 2OZTA 4QEHA 4JL1A 2FVLA 4C7GA 4XQ6A 2PDKA 3B06A 1FWIC 5HWMA 4PFMA 4I9TA 4YHEA 1SQ7A 3VIJA 2WHKA 1V3KA 3HGSA 3KW3A 1WZKA 2OODA 3UU0A 4HD5A 1H7NA 4U5KA 1ZUAX 4R88A 1TUXA 4X61A 4XVEA 2E4TA 4AHQA 3P62A 1XXXA 3Q58A 2R14A 4WJEA 5A5WA 4GI6A 4KT2A 3C52A 3KHDA 4X9SA 3WEZA 1MQRA 4DY1A 3MS8A 4HN8A 1JI1A 4TVUA 3LPFA 2V5LA 5T9BG 1UJQA 4RNIA 3NGFA 3H2FA 1RPKA 5H8PA 5LA0A 4ONVA 1VLIA 2NT1A 2AQWA 2DSKA 1PDZA 3THCA 1JDEA 1W3LA 5G4WA 1E6SM 1F7BA 2PTZA 1FH9A 4S38A 2VL4A 4MAVA 3TLQA 1W1A1 1XM3A 3GQYA 4AEOA 3M41A 2HVMA 3WLPA 3N6JA 4BA0A 1EQCA 3ZVHA 4DM1A 3SW6A 5JIPA 1J12A 3KBSA 3E02A 4H4IA 5D2VA 1GEHA 3G8EA 3AUOA 4QS5A 3M0LA 2YCKX 1CXEA 2R1LA 2PDFA 2DORA 1UIPA 2AGKA 3I7RA 1N82A 3CPGA 4BEUA 4AZBA 4DF2A 2IKHA 3AQUA 1JYNA 3SJ3A 2I5IA 1H7XA 4AIBA 3B8SA 2OB3A 1LL6A 2A1YA 3EEZA 2PRLA 3DU0A 4IX2A 3MHFA 2ZZ5A 1BSIA 2WQPA 5A6LA 3O6YX 3CV7A 3S2LA 5D9PA 4QBXA 1BSLA 1JR1A 4W85A 2X8RA 1T7LA 1VBUA 5I09A 3QFWA 2BVDA 3TYEA 2HNEA 3IS4A 4HNCA 4LU0A 2FHFA 1K9TA 1ZBVA 1AA1B 2V2HA 2WPGA 3PZUA 3WD0A 3WQPA 4FNRA 7TAAA 5H2ZA 2V67A 1Z3NA 2OZ8A 3S5SA 4XO6A 1RD6A 3NDYA 4WXYA 1E6ZA 4DJEA 4LEFA 3TYAA 2QPXA 4JIHA 5HNNA 5LHEA 4FK9A 1Q8JA 1ODUA 5CAKA 3W6LA 4UFKA 4D71A 2O0TA 5LNWA 3WLOA 3LHZA 5HR7A 1E1EA 1A50A 1TWZA 2YW4A 1JDDA 5F4XA 4AD3A 4NJGA 4H9XA 5CGTA 1BGGA 4H6QA 2WVVA 4QG6A 3UJ2A 4DUOA 3VNIA 3TA6A 2V38A 1R5YA 1Z69A 3RHGA 2CYGA 1LQ2A 1IWBA 5HATA 4XZWA 1OC7A 4IPPA 4NG3A 3SRDA 2AKMA 3RM9A 3N2MA 2J9ZA 5T26A 1B9BA 4XUGA 4XAGA 3RO8A 3RITA 2ALDA 4W8AA 1RK6A 3SQMA 4ZE4A 3C6CA 3NZRA 5IDIA 4FNSA 1ZS2A 3QLDA 1ICQA 3QXBA 3D0CA 3EB2A 2DPEA 4GUGA 3SCUA 3PJXA 3W81A 2YCLB 3HPXA 4GABA 1MMFA 1BLIA 3K4DA 4Q8OA 3KBVA 2I7GA 4MYXA 4TVDA 1R7AA 1N8WA 2WLZA 2WMIA 3WD4A 5D38A 4UOZA 5G5IA 3WBWA 1W2PA 4H6KA 4TX8A 3MZ2A 2EPNA 1W9DM 4JNMA 3BO9A 3CO4A 1KM3A 1VCGA 1FTXA 2XZ9A 3DFTA 1XF0A 1YNYA 3CQKA 3MJYA 1VQTA 3DKLA 3ISIX 3TWBA 1E55A 5I02A 3EPOA 3GUGA 2J8TA 1S2VA 3LHTA 1NFBA 5I23A 4B3KA 1CLKA 3AIQA 4OUIA 3P80A 1US3A 2OOFA 1DTUA 1IXNA 3TVAA 4DZAA 3DGRA 4DF0A 5DT5A 3D3AA 1E6PA 5F1VA 4JAWA 3S1XA 2GGHA 1XKJA 2V2DA 4WY0A 3WQFA 3XINA 1YADA 3CMFA 3UJFA 1U5JA 4Q3MA 4HNOA 4LJ3A 4Z2KA 3H24A 1ZSXA 3EBVA 3TJIA 4ZGYA 1IGWA 4O53A 2ESCA 3N34A 4KWWA 3W84A 1CIUA 4N6EA 2CXGA 4PTWA 3UR2A 3YPIA 4MWAD 4X9YA 1CW2A 4QEEA 4ROPA 1W1VA 1AJ2A 4JTHA 1UD8A 1KCXA 3QM3A 3N1AA 4KFPA 4C6MA 3C8FA 3RAOA 1BG9A 1WDRA 1ZTVA 4KEMA 4MNLA 2BHZA 3KS6A 2Z24A 3GU9A 1J96A 2YL9A 3G1VA 3VOCA 3CL8A 1B30A 1OK6A 1OCQA 1UD3A 3TSMA 3HO8A 2ZUMA 4Y8EA 4LBSA 2CW6A 1H61A 1JDAA 2FFIA 3W75A 3BCJA 3PTMA 1YDVA 1PSCA 3K8LA 5E9AA 4OOUA 3ABZA 4LNYA 4LNCA 4J9JA 1A4MA 1KTCA 3VZZA 3W6YA 1F07A 2WCSA 3WF2A 3PZQA 4NYUA 4C6IA 4PEEA 1DJGA 1WOBA 2XIIA 3LXBA 3DI0A 2A2IA 4WSJA 1JZ5A 1F74A 2QUVA 4FMVA 1YNPA 1B3WA 3RO6A 2PTWA 1ISWA 1PEZA 4B5SA 3LV5A 1Q63A 4XK2A 1WV2A 4HU0A 1QNVA 1L6SA 1P0KA 3M0YA 3E96A 3CZLA 2ZWYA 3STGA 1SO5A 3ARVA 4IL0A 1ME8A 1ZZMA 3I6EA 3IUDA 3WO8A 4B5VA 3EOUA 3C3UA 1U22A 1FCUA 2QLYA 6ALDA 3DEQA 1UCWA 1QBAA 2FDSA 2B7NA 5F2GA 1IIGA 1R2SA 1L8NA 1BVWA 1XBVA 3WL0A 3FS2A 2YR1A 4AB4A 5DMLA 2QJMA 3W28A 4XO7A 5IHSA 2DFAA 4GK8A 3S2NA 1T0OA 1W91A 1LORA 1O66A 3WBEA 1OFBA 2CLOA 4HU3A 1JL8A 3SSZA 1JZ8A 4JQ1A 3ARSA 2HDJA 5BXRA 2PF0A 4W4QA 1FUYA 4TO8A 4HCLA 3WK3A 3M0IA 4UCFA 2B7QA 2Q71A 4A3HA 4GX9A 4B2DA 4HZMA 4RNFA 3W88A 1S5MA 4R9OA 2XIJA 2O4QA 2CNCA 3D5HA 2YB4A 1SJCA 5KTLA 4GD0A 2ZRZA 2HRWA 8CGTA 2QKFA 5ABHA 5DF0A 2J47A 3G0XA 3CL7A 4HNLA 1OK4A 4V28A 1BG4A 2ZQ0A 3CT2A 3NEVA 2JKEA 3WMLA 1ITQA 1RALA 1LG1A 2OEMA 1KM6A 3EX1A 3BJSA 1OG0A 5I24A 2POTA 2ON3A 3KFTA 2FLIA 3B97A 3BTNA 3SCNA 1Y0EA 1J18A 1VKFA 4DWSD 3W1AA 5D2WA 4X63A 2IMRA 4QTGA 2BWGA 4D6GA 4KCVA 1JCJA 3E0FA 1S2AA 3S5NA 5XINA 5DANA 1S39A 4JXCA 2MNRA 3R1ZA 4ERAA 1HJVA 3Q67A 2WCGA 3GLCA 4CQDA 3GDLA 4NY2A 1M7PA 3WDQA 1GOWA 1I2PA 1E0XA 1FX6A 1NIUA 7XIMA 1V4YA 5TNVA 1P0BA 2ZX5A 2GQAA 2Y0FA 1PZ2A 3W3OA 3M43A 3HB9A 2OLSA 4HTBA 1A53A 3W1LA 4H00A 1MRAA 1KBIA 3HZ3A 1L6GA 1BD0A 1GORA 3K4WA 4LFYA 2C0HA 3G0SA 1XJBA 3TOPA 1FWCC 5KZMA 3M0HA 3EB4A 2FGBA 2W27A 4LF2A 3NAVA 3PB2A 4J4KA 1GONA 2R6OA 3THQA 3GX9A 3B4UA 1D8CA 1IR2A 3WLJA 3MB9A 2DJLA 1L2UA 1KFWA 4DO5A 4Q22A 3OGVA 1BYAA 1UQZA 5ABFB 3VNLA 7REQB 1UMYA 3HFTA 1AVAA 3MYOA 1KLZA 4QDPA 5D2YA 1S5VA 3G1RA 2WHJA 4JCLA 1REQB 5LSMA 3P0WA 2DVUA 1BQCA 2WJZA 2XVKA 3SY5A 2YDQA 3S1WA 6XIAA 1R38A 4LVDA 1U30A 4UFHA 3M0VA 1EGMA 1E51A 3GTNA 3M7WA 2OPJA 3ONCA 4Q8WA 2OT1A 3LMYA 3I65A 4ZQRA 4GXWA 1N8FA 3WLSA 1H1NA 3D46A 3H70A 5AYIA 4JEQA 1PVNA 5HBFA 2HV5A 3W7DA 2EPLX 3KS5A 2ZUTA 3B0PA 3MCOA 1ISXA 1O12A 1ZCCA 2E6FA 3SUTA 5D4YA 5FF7A 2DIKA 3NQ6A 3N15A 3B9EA 3VFCA 6REQB 1EDTA 1LOSA 2CERA 2UY4A 4X2PA 1SU5A 4JQ2A 4B3ZA 3ZLGA 3QGAC 2DU2A 3COTA 3ZIZA 4TR9A 1ZLPA 3DFSA 2V30A 1QFEA 5KZEA 2J79A 1XH1A 1CB7B 2VR4A 5D8WA 3P60A 4JHZA 3DHUA 4I5RA 3GFZA 4W93A 2NQJA 5A1AA 1H62A 2J62A 1Q6QA 2ZDSA 1U83A 2XIMA 1R86A 1A5OC 4GY0A 5A8NA 1P7TA 3VINA 5IFPA 1KKRA 3BMXA 1A5KC 2Z6JA 1TV3A 2DDXA 1YTEA 4PYSA 2VT0A 4RDYA 1BXBA 1XDLA 3DESA 1W1TA 2ZZ3A 3CL6A 4ZO7A 5IRPA 4MZ1A 3APTA 1JD7A 3TXVA 3S4TA 3TN4A 4K39A 5DY2A 3SDOA 3T55A 4L4MA 4Z2GA 2A3LA 3PPGA 3GBDA 4Y2WA 3VGHA 3E0VA 3E0IA 4JFUA 2GWNA 3VM5A 1SO6A 1RLCL 3V1HA 5C2GA 3B8VA 4HP5A 1QMLA 1P48A 1XR2A 2OX1A 2FH8A 3G1HA 5AC5A 3LNMA 4PBEA 1C9DA 4QIUA 5FEWA 4UTIA 1E1CA 4ICCX 1AMKA 2ATSA 2PDXA 4AFYA 5GJMA 2VUNA 4A21A 3BCFA 4M82A 4LPCA 4FZIA 3Q94A 4KCUA 3WJYA 3BXWA 2YGYA 2OWWA 4TMBA 1KXVA 4H83A 2ZRXA 1S1RA 1SFJA 4DN1A 3IJ9A 3OGSA 3WNNA 4UQ9A 1J10A 1OC5A 4NKCA 2CC0A 4UC5A 3BLOA 1D8WA 1W6TA 3IJDA 5GQBA 2DZAA 1FWTA 4XB3A 4PMZA 1XLBA 2Q6ZA 4JFWA 4GI4A 4QCEA 3UFYA 3FCPA 3R0KA 4IMDA 3POCA 3L4ZA 2BP1A 3O1NA 1R9ZA 1T40A 4NL1A 4DJFC 3INPA 4KW2A 3W24A 2ADAA 2VQUA 3UZXA 7A3HA 3GZAA 4CQ9A 3DOPA 3A5FA 5G2WA 1UWTA 3NQCA 4ZL1A 3CV2A 4J3SA 4YLWA 2PP1A 4UOJA 3UPWA 1H51A 4MNMA 5BWAA 1EDQA 1JEZA 2ICSA 3P93A 1WO2A 4Q8NA 1LDCA 2F2HA 1ISZA 2Y5EA 2DZWA 1V6WA 5M2FX 4MADA 4AZIA 3R79A 3O15A 7TIMA 2DZXA 1DE6A 4IXHA 5M3WA 2YXXA 1OF6A 1K6AA 2XM1A 4M24A 4UNLA 1W1PA 3W25A 1BPLB 4PL2A 1K03A 3L12A 2PD9A 4E8DA 4F4RA 3NOYA 3VKCA 5D02A 3SCSA 2H3DA 3OZOA 4NZ1A 2FPVA 4ADTA 2PDNA 3LY0A 4L9ZA 1LL4A 4OQVA 4HOWA 1TTJA 3EOEA 4YU1A 3A23A 1JJKA 3A6OA 2UY3A 4UFIA 3A4WA 3NQEA 2OSXA 4UUIA 4MY9A 3AC0A 4J7RA 5A6JA 3UY7A 2OOGA 3GVQA 3R0UA 3OQ8A 4MVAA 5CG0A 3M0ZA 2YCJA 1WDSA 1FWEC 5GNZA 3BMWA 1UIOA 4FS9A 5LKYA 3WENA 1F3WA 1W3NA 2WC4A 3UETA 2WXDM 3UR5A 1UKSA 1GVEA 4A4AA 1TELA 1HKIA 1XFCA 1ADOA 4E2OA 5AZ1A 1R3SA 1V3HA 3VNKA 3M64A 2PWFA 3K46A 4HOZA 3VKKA 3HF3A 2XG9A 3EX6A 3RCYA 3W29A 3FEMA 3B8TA 4TQTA 4YIWA 1XIDA 3RU8X 1HZYA 4MPQA 2GVGA 3RRAA 1E6XM 2CBUA 4LALA 3L4WA 4DZIA 2J7CA 3FJ4A 1BGAA 4MB1A 4DNMA 4HPGA 1A5CA 4NT0A 4KETA 3G5EA 5AC8A 4Z42C 4GFSA 2WOQA 1A3WA 1VCFA 2BY0A 2VZOA 1ZP4A 3W83A 4DJFA 5BXSA 4LC8A 5AHNA 2E0PA 4B5NA 5K9CA 3TCEA 4X3ZA 3NO3A 3CHVA 4QG8A 4IGNA 3H7UA 3KBJA 1U1UA 1EH9A 1PL9A 3OQEA 3VDGA 2WZIA 3AYSA 1JCNA 2NUYA 3L67A 2F6XA 1B90A 3LCXA 2RDXA 3AS1A 1TA3A 1FXPA 1Q6GA 4GACA 2Q02A 4E2VA 5I78A 1DBTA 2PMQA 3II1A 3N9SA 1VYSX 1HJQA 1FWNA 3QV7A 1FFRA 2HXUA 1M68A 3P8JA 4FNTA 3UWWA 4LRSA 5M1TA 2EPKX 1Z9AA 3JVAA 3LV6A 3CPUA 4KIEA 2WNQA 2PRHA 2E25A 1W0MA 3EXSA 1T8QA 1RHCA 5CSYA 2Y4SA 1R3TA 1OZQA 2VD9A 2Z26A 4LYKA 2Y8VA 5CC5A 5BU9A 2AAAA 1IZCA 4CKQA 1GYNA 2NLIA 3VX1A 1RK5A 1GQKA 1TE6A 3IARA 3R0DA 2WYSA 2PP3A 3GHTA 3QZ6A 3NVTA 3C2VA 3HMCA 4HSOA 1MW3A 5TBOA 1KV8A 4N6FA 3WD3A 3PWIA 3HIJA 1PIGA 4JTUA 1KFLA 3H2MA 1ONEA 1SSDA 3S5OA 3IUHA 3GDBA 5HXMA 3RNDA 3G6MA 1TWSA 3GFXA 5C0QA 2Z1XA 2XFFA 1W8GA 3EWBX 1CGTA 3L0KA 2Y5JA 1MRQA 5JBDA 1WQ5A 3G1XA 3E5BA 1ZU8A 2H8ZA 3OIXA 1SGJA 3ARWA 4QAWA 2P3ZA 3GC4A 4M81A 4LYPA 1AH4A 1BYBA 2ATMA 4Q4SA 3ITOA 3WJXA 1GQNA 2E1DA 4C1NA 1NELA 3TE9A 4PCTA 5LIKX 1QPNA 4F0MA 2XZ7A 4QG9A 4WEVX 4AU0A 4REQB 2WMIB 3BLFA 5U4NA 5KMYA 1EX5A 2ODOA 3W1UA 2Z29A 4AD5A 1MW1A 1K8XA 3GG0A 4I5UA 3WDPP 5AHMA 1VB9A 4FR6A 3CASA 2QMJA 1W37A 1I0DA 4DXXA 1SVDA 1GHSA 1VR6A 2VEPA 4ZA0A 2WJFA 4L6HA 2FPTA 3RCMA 3OLIA 5A94A 4GMEA 4JIRA 1ZB5A 3LQGA 3UGRA 2ZX6A 3EKLA 3KX6A 3WMCA 1X7FA 3O07A 4XZIA 9RUBA 3LRLA 3NFUA 1GGOA 1EWEA 1EJTC 3L65A 2FJKA 4H9MA 1J0YA 3UCQA 3KTXA 1K9FA 1K9EA 4S2BA 1EJWC 3IGSA 1T96A 3LXAA 2G3IA 2GGJA 2PGFA 2CBJA 4IPJA 4IFKA 1DORA 3VTRA 5ABTA 3MW7A 5BNKA 2I9EA 1HO4A 3HV8A 3RR1A 2YSWA 1XGZA 3AXMA 3WLIA 2QDGA 2C14A 2OQLA 4G7EA 4I6KA 2YOCA 3VNDA 1KGXA 3MPGA 1JF6A 4XD4A 1PUDA 4QISA 5KZ6A 5FJRA 4D6HA 4GA8A 2YA2A 4LWWA 4F9JA 3TYUA 3C2RA 1V93A 3RDKA 1XCXA 2IPFA 1UZ1A 1NQ6A 4IMCA 4FOUA 3WNMA 3B03A 4JYEA 3CUZA 4GO8A 4IT1A 3NG3A 2NV1A 3WMBA 1HN1A 5EMYA 1C7TA 1K70A 2WAGA 1DHPA 2EG7A 4ZB0A 1WAWA 1F3XA 4D1JA 1FWDC 1W56A 5C71A 3BV4A 2QEZA 3KCJA 2G8ZA 4IIDA 1S3TC 4IL2A 1SMDA 1XYCA 1SO3A 2J7BA 4GIAA 3LHYA 4JKLA 4QNEA 1BF2A 2OELA 4H9TA 3F4CA 1AQMA 3DAQA 1QPOA 2DUXA 3F2CA 3AUJA 2FZMA 2PGWA 4L4OA 1AL7A 3N2OA 2DQWA 4QLJA 2OR2A 3LM7A 1A49A 4M1RA 3OODA 5ABGA 4AZ5A 2PFHA 1WUEA 4WVXA 1ZJAA 3WNOA 1RBOB 4LF1A 3PJWA 3A21A 4PCSA 2PPGA 2BVTA 4CNSA 2V6AA 2VFGA 4WJ8A 4Y9PA 3DIPA 3GZ3A 2PDUA 2X1RA 1V03A 1G5AA 5A6TC 3HJZA 5CPLA 1Z48A 3IGHX 1NH6A 2Q8LA 3ELFA 4O1FA 1QK0A 1EX1A 4HZ6A 2Y89A 3CEPA 3B04A 3FA4A 4UBPC 1J6PA 4TTGA 3AIWA 3MC5A 4F2TA 2VWTA 3NM1A 3BAJA 3DI1A 1IEQA 4H9YA 5JH1A 3W7OA 2X41A 3MWAA 3REQA 2VCAA 1UZ4A 3TC3A 1QO2A 3PFRA 2C79A 2DZBA 4N9BA 1CWYA 1E71M 4EOUA 3EMQA 1JCTA 3BOXA 3PWAA 4KF1A 2DJXA 1T41A 3S42A 1UD4A 4GNVA 3AAMA 3V0UA 1RAKA 4S3AA 4UWMA 3GDKA 2J7DA 3LRKA 2BGSA 5HQEA 3TNBA 1MUWA 1RQHA 3K13A 1V0LA 3EAUA 3W2MA 3AIVA 2Y2WA 3TROA 3ARUA 2PEVA 3MJMA 2JGYA 1E5NA 2C0AA 4C6PA 3ZJKA 2A0NA 1UH4A 3VU2A 3LOTA 4HPXA 2JEPA 4WSHA 3CHDA 3G77A 1LZOA 4U3AA 3P81A 4JY9A 2IQDA 3T09A 1AL8A 4HCHA 3AMCA 2BB0A 2YFNA 3P6LA 1QW7A 4BCEA 3U2CA 1CGVA 2V5KA 1A3XA 4O0ZA 1JYXA 4Q7BA 5ECVA 1M5WA 3B8IA 3U48A 2OSYA 3U8GA 4LW7A 4A3UA 3UWYA 4HJWA 3CMJA 1OFEA 2QULA 1N8IA 3C61A 1RA5A 3S6OA 1W9BM 3MKVA 5GNXA 1C9WA 1G69A 2ZC1A 2CKRA 2B4GA 4GVFA 1HKJA 2YJQA 3TYBA 4XUYA 3NQ8A 3VD4A 1B0IA 1QRQA 4JTTA 5BRBA 3P5YA 1UKOA 4N2YA 1DKWA 4ZQOA 1PKLA 3BL3A 3C86A 2VXNA 8A3HA 1FHLA 2QJJA 1LP6A 2YA0A 4ZZ9A 5XIAA 4OBTA 4AXNA 2WC7A 3QZEA 2D0HA 1GT8A 2YLLA 1WYIA 2WKJA 4ES4A 5E09A 1LOQA 4C1KA 3OVPA 4Y90A 1H0IA 4JBRA 3M5XA 1HJWA 1AD1A 1OIMA 2WNWA 3SAZA 3LI1A 3T07A 1NDZA 1V6YA 3TMQA 2OWCA 3RU6A 5HA7A 2QCHA 1W3TA 5GVJA 1LT8A 1V51A 4HA1A 5LA1A 2CZFA 2VO5A 1RA0A 4IISA 1R6WA 1KW1A 5M17A 3WLNA 1SW3A 4CU7A 1U1JA 3VA8A 1MNZA 4CD8A 3GR8A 2E6YA 1TR1A 3EOSA 1QNOA 4JR5A 4W89A 4P7RA 1Q6LA 3OZPA 1V5XA 1YBQA 3NSNA 3QC3A 3UT0A 3BQ5A 4A3RA 3ABRA 4LOCA 1O94A 3TW9A 2H9AA 3SUUA 1VEMA 3WF4A 4M0XA 2TRSA 2REQA 1ZBCA 3FDGA 1FCQA 3BC9A 4DO4A 4P8WA 1XWYA 3F4WA 3E3HA 3IUIA 1Z7AA 1JXKA 4FA3A 3NQMA 4TX9A 2HS6A 1DWJM 2V5BA 4GQQA 3UWZA 3ZMRA 3LCGA 4ZQCA 3WQ4A 2OVLA 3PUDA 1SM9A 3WNPA 4H04A 1OFQA 2YB1A 2PB1A 1UPPA 2VMFA 5CLWA 1S5WA 2WBGA 1GYMA 2H6RA 1KC7A 2CLMA 2BLEA 3MI2A 3IANA 4K7VA 1VCVA 4CUCA 5REQB 3STEA 4V1YA 4AD2A 4K1WA 1VZWA 1WKDA 4IG2A 3RLUA 1ZJIA 1W1B1 2GFTA 1XINA 5LGZA 2FB3A 4K6AA 4XSMA 4ECLA 1I60A 3AMKA 3FA3A 1M9HA 3RUBL 3G24A 2B31A 5JUVA 1TIMA 4GQRA 2C1IA 3O0KA 3E6EA 2ZX8A 1EGVA 5EY5A 3NYZA 4GHRA 2QQ6A 2ZUUA 3UZYA 1ZNNA 1PTAA 1M7XA 1UPMB 4MWAC 2A7NA 3CUGA 1C93A 1TRDA