3GXAA

Crystal structure of gna1946
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
KEIVFGTTVGDFGDMVKEQIQPELEKKGYTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFAVVNGNYAISSGMKLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane lipoprotein GNA1946
publication title Crystal structure of lipoprotein GNA1946 from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
total genus 71
structure length 239
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gxaA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gxaA01
4JXIA 1GGGA 3ZS6A 1MS7A 4NF5B 2BJJX 3SKPA 1IXIA 5B70A 3IL1B 2IEEA 1M5EA 1D4NA 3TTMA 4ZEDA 3TCHA 3G3GA 1YTVA 5JK4A 1FTMA 1B7HA 4FATA 3H6UA 3M3FA 4HTGA 2I3VA 3B6WA 1P1OA 3RTWB 4U21A 1II5A 2OBGA 4IO3A 1SQYA 4AB6A 3KSXA 3KOTA 4OFOA 3FVNA 4DCXA 2XXIA 4FEBA 3FVGA 1SDXA 4QSCA 2I49A 3IAZA 1BTJA 3PPOA 1MQIA 5DVIA 1Y20A 5CBSA 4LZ8A 4IO2A 3LUYA 1IQ7A 2HEUA 2NWJA 4MH5A 1FTKA 4DCYA 1A99A 4YKPA 3R26A 3FXRA 3VLUA 5FTIA 3G3JA 3RPWA 4IGRA 1ZTYA 3LR1A 1IUDA 3C4MA 4G8HA 1VSOA 2XXHA 3K1PA 3ILTB 4EUOA 1Q1KA 3E13X 3PPPA 4F18A 5KDTB 5I58B 3MVXA 4ZEKA 1M5FA 2Q2CA 1JW5A 3PGFA 4M1VA 4F3SA 1WVJA 3KSJA 4ELOA 2R9JA 1B5IA 1XC1A 1RKMA 4F3BA 4RPOA 1Y3NA 2F6PA 5L9MA 5DTBA 4OTEA 2H9BA 2P2AA 4XKPA 3TYHA 5JTYA 3UIFA 2XXVA 3SEVA 5KCJA 1JVXA 4IB2A 1Y3QA 3I5OA 4TLLB 3MVWA 5FHNA 3H6TA 1LAGE 4GRKA 1JW1A 1R9LA 5B7DA 3MP6A 1MXXA 2I0BA 4N07A 3O2AA 3CG1A 5AA4B 3MP1A 3T9HB 2XX8A 3TCFA 3V83A 3S2VA 5H8HB 3MP8A 1MPDA 4OVJA 1FQFA 4HS7A 1B5HA 4XXUA 1B3LA 2RC7A 3AXFA 4PE5B 1MXVA 1J1NA 1DOTA 4MFIA 1B1XA 3P7IA 4PFYA 5HBCA 5EYFA 3E9XA 3ECRA 4X9TA 4PFTA 2UVJA 1CB6A 3T93B 3MVZA 1N3XA 2AYSA 3VXCA 1S9TA 4GF8A 3S9LC 3EN3A 1YPNA 2A5TB 2QL3A 4BLAA 4N13A 2O51A 4F31B 3EF7A 4YKJA 4U1ZA 1P1QA 4ZE8A 1FCKA 3U94A 4Z7EA 3KN3A 1MM7A 4HCYA 4OXVA 2Y84A 4BDLA 3DP6A 3Q28A 1NH7A 3TELA 2NUVA 1LAXA 3G3IA 4IO7A 3OSQA 4LP2B 3KFMA 1MY1A 3TTLA 1WODA 4RPNA 1S7YA 2UYFA 1NMUA 1EZPA 3TUSA 4OQOA 3RGYA 4NMYA 5ITPA 2P1SA 4QSDA 1A8EA 4KD5A 2I48A 3RUMA 3WAFA 2XXTA 1YAEA 4NF5A 1DPEA 1B52A 4IY5A 4G68B 1A8FA 1B2HA 1B3GA 1DTGA 2XXQA 1FQBA 5H8FB 4NEDA 3PUZE 5ITOA 3H7MA 2QS4A 2R6GE 1VE4A 4BDNA 4NF4A 2B3FA 5H8QB 4F1YA 4N6PA 2HQ0A 5CMCA 1A7LA 2DP8A 1OLAA 4ISUA 4ELQA 2F35A 4TLMB 3TAJA 2O84X 3FVOA 3ZKLA 2OLBA 1IXGA 1ZJLA 3ZSFA 3SETA 5CMMA 3RT8A 3K1NA 4PFUA 4OFJA 1PDAA 3CSGA 3Q25A 4X1BA 3OMBA 1P1NA 1B5JA 3TEPA 5FHMA 3SERA 3KG2A 1H45A 3D4CA 3DP8A 4R6KA 1LFIA 1VFEA 4IO6A 2WKYA 1B05A 1XVYA 2RCBA 2ZYMA 1TXFA 1Z7ME 3OXNA 3OOAA 3Q27A 1ZMGA 5DVFA 1R6ZA 2DWAA 4P11A 4ESWA 1RYXA 2HZKA 3VLWA 2DOJA 4QF9A 2HFBA 3FZVA 2VHAA 2OWSA 4ESXA 3VFJA 1ZKBA 4H67A 3ZKKA 2ABHA 3O97A 3GLBA 1SW2A 3S9NC 2ZYNA 4WKMA 3QAXA 5ELVA 1MH3A 2ZMBA 4ND9A 5I56B 4POWA 5KDTA 4R9GA 5I58A 4KI0E 4BDQA 3OO9A 3K2DA 1NH8A 3DLNA 4O3AA 3B7DA 4LZ5A 1O64A 3C31A 1POY1 3M8UA 4DXCA 2VD3A 4QFPA 4RK9A 3MJNA 4F29A 2RCAA 4KYDA 3L6HA 1B32A 3TTKA 3IOTA 2Q89A 3GZGA 2D21A 1P1WA 4QFKA 4LQ2A 1TFDA 3GBBA 3LBSA 3TTNA 4JWOA 2X26A 1QUJA 1XVXA 2REGA 2XXWA 3U93A 1B40A 2CMOA 2X7QA 4O3BA 4RNSA 4H5GA 1USYE 2DXYA 2I58A 2UXAA 2ZXTA 5CMKA 3IB1A 4YB6A 3K6UA 2I4CA 3SESA 5DVJA 1MQGA 1SW4A 5H8HA 3N94A 3FJMA 3RQTA 5L9OA 1A54A 3H4ZA 4E0WA 3OEMA 3IO6A 1PEBA 4R2BA 2Y7WA 3N26A 3CRBA 4HCWA 3IR1A 4RYAA 2ZNSA 2H25A 1GTKA 3IORA 3PUVE 2F34A 3THIA 3MZ1A 2B3BA 3I6VA 5I59B 1A55A 4ZS9A 4NF4B 2XXUA 3O6GA 1QUIA 3MQ9A 3SDFA 3PD8A 1B4HA 1N84A 3PD9A 1PBPA 1MH4A 4F39A 4DXBA 1PB7A 1GR2A 2A5TA 2F8DA 2V3QA 3PMVA 1B1HA 2VGQA 5DYHA 1LCFA 4FECA 1EZ9A 4JDFA 2LAOA 3PUYE 3O29A 2PMSA 2V93A 1AIVA 3I3VA 5CC2A 5L8DA 1ELJA 1LBBA 1F9BA 3K1MA 2HAVA 1PB8A 3FJGA 4R2FA 2RINA 4OFLA 4R73A 3O9PA 1R1NA 3VXBA 1MY3A 5I84A 2DXRA 4BDOA 4UA8A 3T9XB 2O7IA 5M2VA 4F1UA 5I2KA 2DQVA 2VOZA 1XS5A 1OQGA 4R72A 2ONSA 2I0CA 3KZGA 2VD2A 4G68A 2GFEA 2O69A 2AIXA 3C34A 4IGTA 5H8FA 1NNPA 1D3KA 4H8JA 3K6VA 5BWJA 1JEVA 5H8QA 1LB9A 1US5A 4Z0IA 1AL3A 3A09A 1S50A 2FA7A 1ZU0A 3V5AA 4MLQA 4R75A 3K02A 2QS1A 4F19A 2AL4A 1FQAA 3PPRA 2QMWA 1NL5A 4Q30B 1PC3A 3BBRA 3WAEA 4AQ4A 2X7PA 3VV5A 5LOMA 1URSA 1B7UA 4UACA 2DE2A 2UVHA 1IZ1A 3VVFA 4HW8A 1MXYA 3KN8A 2UVGA 2NOOA 1N3WA 4DZ1A 1UTBA 4NF6B 1XT8A 1M5CA 5EHSA 3TFLA 4R6HA 4C1UA 3N6TA 5TP9B 4GD5A 1VR5A 4XIGQ 3IOWA 3LSLA 4NE4A 4IO4A 1O7TA 3FATA 1B3EA 1OVBA 5F7VA 3LSXA 5AA2D 4F1VA 2DVZA 3DELB 1LB8A 2QSXA 3TPAA 1Y1MA 2R71A 1MXWA 2A5SA 5I56A 1XOCA 3IJOB 2YJPA 4RJZA 3VLVA 1SD3A 1BKAA 4YZZA 3FIRA 1H43A 3CIJA 3VVEA 1DMBA 4U4SA 4YB5A 1QJMA 4OWDA 2VP1A 4L17A 3CR9A 2XXXA 3IJXB 1NNTA 4R74A 1MY2A 4LUBA 3H6WA 4H1XA 1ANFA 4KYSA 1B4ZA 1FQCA 3K0VA 2O6AA 2REJA 4IO5A 4OMBA 4XKRA 1OMPA 1N7XA 3EHSA 3W9VA 5A5XB 1GV8A 3UA8A 4JSDA 3F11A 1MRPA 5EHMA 1M5DA 3E3KA 3U72A 2Y7KA 3B6QA 4EQ9A 4ZE9A 2F7CA 1I6AA 4H65A 3TKDA 3QK6A 1MQHA 2G29A 1Y9UA 5I2KB 3T22A 1D9VA 1I69A 1ATGA 1KWHA 2OWTA 2Y7RA 2Q2AA 5DEXB 1Q35A 3U8QA 1LFHA 4RK2A 4G68C 4KFQA 3PPQA 3O6HA 2F97A 2UYEA 2GH9A 4U22A 3K00A 5I59A 4GXAA 4XKNA 3S9MC 4ZEBA 4NF8B 4LVQA 2E1SA 5IKBA 2DYXA 2F5XA 2UVIA 1ZIUA 3SEUA 2HXWA 3N5LA 2HAUA 3JZJA 2Z8DA 4JWXA 1OIBA 3FXQA 1Y4CA 3RLFE 3UORA 5L9SA 1FTJA 2XX7A 3C35A 1UTHB 1MY4A 3EPEA 4X48A 4KQPA 4OERA 4FE8A 5DT6A 1LAFE 1MPCA 3R7XA 5IAIA 1JEUA 1QVSA 4X1DA 3CFZA 5AA1A 1UTBB 3D4GA 4IY6A 2V84A 1IIWA 2H5YA 3TZAA 4GQOA 2GHAA 1SI1A 1MM6A 2QMXA 5FHOA 4XTCQ 5I57B 4KR5A 3TCGA 3SEXA 4F2QA 2ZNUA 5KZTA 1B7ZA 3EQ1A 3QUJA 2AL5A 3T66A 3S4UA 1QKBA 4FEDA 4O3CA 2XD2A 3G3KA 2NXOA 2DE4A 4RXLA 3MZ9A 4EDPA 5JEIA 4GXSB 4QHQA 4QFOA 3FJ7A 4K3FA 4H8IA 3USDA 1TWYA 1EU8A 4FAJA 1TFAA 2V3TA 3L6GA 2GHBA 5CRYA 4I8CA 4Q5TA 4MLVA 1SW5A 4JBZA 4H0WA 2O7UA 4R9FA 1JNFA 2XD3A 2FNCA 2XXPA 1A40A 4M4GA 3CI8A 1B58A 4Q0CA 1CE2A 3IB2A 1LFGA 3V8XB 4DE8A 2F78A 3M3LA 4G8NA 1Y3PA 3SEWA 2M8CA 4C0RA 4OZ9A 1DSNA 4GL8A 4KHZE 3QIMA 1AMFA 4NF6A 4YKIA 4EF1A 2ESNA 4PQJA 1B9JA 3U1OA 4ONYA 3H06B 1URGA 2XXRA 5CMBA 3HO7A 4MF3A 3UK4A 5TP9A 3ONMA 1ZLQA 4U2RA 1FTOA 4KCDA 4H5FA 4RA1A 4DXUA 4U1OA 3TODA 1O63A 1LGBC 3OEKA 4F3PA 1B0HA 2RC9A 2I4BA 2V3UA 1L5TA 4EF2A 3T9VA 3TQWA 5ICQA 2ONRA 4YMAA 5TPAA 3DM0A 1LSTA 3U92A 3RT6B 3RNNA 4FIMA 4ZECA 3MW0A 1BP5A 1IITA 1LAHE 3KN7A 3FASA 2I6EA 4DDDA 2H99A 4OETA 1UIVA 2HZLA 3IB0A 2OK2A 4THIA 4I9DA 2PX1A 1JQFA 4NWCA 2QJEA 4QFLA 1YCJA 4OHNA 2XX9A 3OELA 1ZBMA 3HCQA 2D5WA 4BDMA 4YICA 3VE1B 3KJTA 1HSLA 5K2YA 3QUFA 4GWOA 5TU0A 3GBAA 3MUQA 2OCUA 5A5XA 2W7YA 3A3CA 2PT2A 2Z22A 4DLDA 2O1MA 4WXJA 4JWYA 1H44A 1Z7NE 3VVDA 1QKAA 2XXYA 3CSBA 4JSOA 3MC2A 1M5BA 3IOUA 2NVUB 1SW1A 2RKMA 5J1DA 1N0TA 2Q88A 3JYRA 3RN8A 1WDNA 3HHFA 2E0SA 5DEXA 5F1QA 4FJPA 1B46A 3HSTA 1N76A 2DWHA 3KOSA 2PBWA 3PV0E 5H8NB 3UP9A 5AE4A 4G2ZA 2OZZA 1B3HA 3OO6A 1POTA 2ANJA 3TDJA 1AH5A 3MVYA 1B51A 5CI5A 3QXMA 2I3WA 1MXUA 4NF8A 1UQWA 1IXHA 3ILUB 1BLFA 4EXKA 2P0SA 1XHYA 1MXZA 1SYHA 1EH3A 4PP0A 4ZDMA 3H03A 2ALUA 4YAHX 1DTZA 4C1TA 1UTHA 5AA2B 4RY1A 3LC8A 3FV2A 1QUKA 4ELPA 3O66A 3H6VA 4OESA 3A3UA 2DSFA 5I2NA 2CZLA 2IA4A 3R6UA 3OD7A 2THIA 4QRZA 4GIZA 3HPIA 3LSWA 2ZYKA 5CBRA 3MWBA 1P99A 5I57A 2ZYOA 3SEYA 3O6IA 3KBRA 4F22A 2YPNA 3UN6A 3KGCA 4U4XA 1B6HA 4I1DA 4YKKA 2DVCA 3Q26A 5TPAB 5K2XA 2PVUA 4F3GA 3C32A 1B0LA 4ZEFA 1LBCA 4PFWA 3C33A 4BDRA 3QYTA 3Q29A 4GFRA 2Z8FA 1N7WA 2QS3A 3G3HA 3T9UA 1R9QA 2F7BA 3OENA 3KJ7A 4NWDA 4U23A 2H98A 2RF1A 3TTRA 1MQJA 1TT1A 4PETA 1FQDA 3IX1A 4LZ7A 3EHUA 1JETA 3RY3A 2D3IA 4ZZEA 3BFTA 3IO4A 2H4IA 3FD3A 3RTFB 1VFDA 2F6GA 3KEIA 4Q8RA 3N6UA 3K6WA 4YMBA 3CFXA 1US4A 4G77A 3E4RA 3JV9A 4E0XA 4WEPA 4GOTA 3IK6B 1QULA 4KCCA 3C9HA 3QSLA 1NKXA 3CG3A 1FW0A 1HSEA 1MY0A 3OSRA 3OO8A 3W15C 1MDQA 4GLIA 3PUXE 4H6DA 1H3DA 1QW0A 1PB9A 2Z23A 2HCAA 1UIUA 1SYIA 1MQDA 4EXLA 1NFTA 1D9YA 1OQHA 3TQLA 1SBPA 3FGSA 4P0IA 2OJTA 5ISUA 4LQ5A 1H76A 4KYEA 3G7WA 1IXCA 4GL0A 3FVKA 4OEUA 3UGWA 4OENA 3S9EA 3HN0A 4NTLA 4EQBA 4LONB 4QFNA 1Y1ZA 2XHDA 1JVYA 4GVOA 4AB5A 2PT1A 2B65A 3K01A 2FYIA 2Q8JA 3PU5A 2ONKE 4YB7A 1DPPA 4ZEIA 2Q9TA 2GRVA 1HSJA 1SVXB 5CM6A 2O1LA 3DP4A 3V89B 5JTYB 4MBPA 4JB7A 5KCJB 1P1UA 5I2NB 3MPKA 1PBQA 5H8SA 3HV1A 1AOVA 3FUZA 1IEJA 3IOVA 4LA9A 1JW4A 2PYYA 2KLFA 5FTHA 1NNFA 3BKIB 5ICTA 2Y7IA 4OYVA 1I6BA 1EZOA 1FTLA 1BIYA 3PPNA 1T0KA 1USYH 3ODBA 1OLCA 2QPQA 2DWJA 3K6XA 3B6TA 3MBPA 1Y4TA 1URDA 3FXUA 5H8NA 5BUUA 3H3GA 3O28A 1MPBA 2DE3A 4FORA 3VDFA 1LCTA 3M3KA 4R6YA 3K4UA 4QSEA 2QRYA 1NNKA 4YU0A 4DIGA 3HHGA 3G3FA 2F7AA 3GXAA 1LLSA 4KPTA 4G4PA 4ECFA 2G93A 1SI0A 3MZBA 1RYOA 5AA3A 3MPLA 1MG1A 4P0GA 4LATA 4ELRA 4WEDA 5HM4B 3FV1A 3CFLA 1B3FA 4TOZA 4TQUQ 3TMGA 1GVCA 1I6QA 5AA2A 3LSFB 2RC8A 4OEVA 2QS2A 4G8MA 3EHTA 3PUWE 2Z8EA 3MAMA 3CVGA 1MDP1 3PMWA 2ZNTA 3BFUA 2F36A 3C36A 4EQ7A 5AA4A 4I62A 4F2OA 1N04A 3W9WA 2DWIA 2V25A 2Y7PA 3OO7A 2YLNA 4POXA 5HPQA 1OVTA 2DS9A 1FQEA 4XKQA 3PMXA 4ZZAA 3T96B 2O68A
chains in the Genus database with same CATH superfamily
4JXIA 1GGGA 3ZS6A 1MS7A 4NF5B 2BJJX 3SKPA 1IXIA 5B70A 3IL1B 4GX4A 2IEEA 1M5EA 1D4NA 3TTMA 4ZEDA 3HFUA 2Q8MA 3TCHA 3G3GA 1YTVA 5JK4A 1FTMA 1B7HA 1NV0A 4FATA 3EKIA 3H6UA 3M3FA 5F24A 4HTGA 2I3VA 3B6WA 1P1OA 3RTWB 4U21A 2Q74A 1II5A 2OBGA 4IO3A 1SQYA 4AB6A 3KSXA 3KOTA 4OFOA 3FVNA 4DCXA 2XXIA 4FEBA 3FVGA 1SDXA 4QSCA 2I49A 3IAZA 2WBBA 1BTJA 3PPOA 1MQIA 5DVIA 1Y20A 1LEVA 5CBSA 4GWZA 4LZ8A 4IO2A 1AWBA 3LUYA 1IQ7A 4MX6A 2HEUA 2NWJA 4MH5A 4PGNA 5DW8A 1FTKA 4DCYA 1A99A 4YKPA 3R26A 3FXRA 3VLUA 2B4MA 5FTIA 3G3JA 3RPWA 4IGRA 4PC9A 2PFZA 1ZTYA 3LR1A 1FJ9A 1IUDA 3C4MA 4G8HA 4KXPA 2ZZWA 1VSOA 2XXHA 3K1PA 4QBAA 3ILTB 4EUOA 1Q1KA 3E13X 3PPPA 4F18A 5KDTB 5I58B 3MVXA 4ZEKA 1M5FA 2Q2CA 3ISPA 4GBWA 1JW5A 3PGFA 4M1VA 4F3SA 1WVJA 2HXRA 3KSJA 4ELOA 2R9JA 1B5IA 1XC1A 1RKMA 4F3BA 4RPOA 1RDZA 1Y3NA 2F6PA 5L9MA 5DTBA 4OTEA 2H9BA 2P2AA 4GWYA 4XKPA 3TYHA 5JTYA 3UIFA 1SPIA 2XXVA 3SEVA 5KCJA 1JVXA 4IB2A 1Y3QA 1NUXA 3I5OA 4TLLB 3MVWA 5FHNA 2B4LA 3H6TA 1LAGE 4GRKA 1JW1A 1R9LA 5B7DA 3MP6A 1MXXA 2I0BA 4N07A 3O2AA 3CG1A 5AA4B 3MP1A 3T9HB 2XX8A 3TCFA 3V83A 3S2VA 4N15A 5H8HB 3MP8A 1MPDA 4OVJA 1FQFA 4HS7A 1B5HA 4XXUA 1B3LA 2RC7A 3AXFA 4PE5B 1MXVA 1J1NA 1DOTA 4P1LA 4MFIA 2JJKA 1B1XA 3P7IA 4PFYA 5HBCA 5EYFA 3E9XA 3ECRA 4X9TA 4PFTA 2UVJA 1CB6A 1LBWA 3MSTA 3T93B 3MVZA 2XWVA 1RDYA 1N3XA 2AYSA 3VXCA 1S9TA 4GF8A 3S9LC 3EN3A 1YPNA 2A5TB 1LBZA 4MNPA 2QL3A 2F3BA 4BLAA 4N13A 2O51A 4F31B 2KQZA 3EF7A 5I3SA 4YKJA 4U1ZA 1P1QA 4ZE8A 4OVSA 1FCKA 3U94A 4Z7EA 3KN3A 1MM7A 4HCYA 4OXVA 2Y84A 4BDLA 2V4CA 1NV3A 3ROJA 3DP6A 3Q28A 1NH7A 3TELA 2NUVA 1LAXA 1NUYA 3G3IA 4IO7A 3OSQA 4LP2B 1LBYA 3KFMA 1MY1A 3TTLA 4P8BA 1WODA 4RPNA 1VDWA 1S7YA 3KBZA 2FHYA 2XWOA 3QMFA 2UYFA 1NMUA 5IGAA 1EZPA 3TUSA 4OQOA 5IZ1A 3RGYA 4NMYA 5ITPA 2P1SA 4QSDA 1A8EA 4KD5A 2I48A 3RUMA 3WAFA 1KA1A 2XXTA 1YAEA 4NF5A 1DPEA 1B52A 4IY5A 4G68B 1FBFA 1A8FA 1B2HA 1B3GA 4N81A 1DTGA 2XXQA 1FQBA 5H8FB 4NEDA 3PUZE 5ITOA 3H7MA 2QS4A 2R6GE 5EQAA 1VE4A 2FBPA 2QVVA 4BDNA 4NF4A 2B3FA 5H8QB 4F1YA 4N6PA 4PAFA 2HQ0A 5CMCA 1A7LA 2DP8A 1OLAA 4ISUA 5ET5A 4MIJA 4ELQA 2F35A 4TLMB 3TAJA 4PBQA 2O84X 3IFCA 3FVOA 3ZKLA 2OLBA 1IXGA 2QVRA 1ZJLA 3ZSFA 3SETA 5CMMA 3RT8A 3K1NA 4PFUA 4OFJA 1PDAA 3CSGA 3Q25A 3OMBA 4X1BA 1P1NA 1B5JA 3TEPA 5FHMA 2PCRA 3SERA 4MCOA 3KG2A 1H45A 1FPEA 3D4CA 3DP8A 4PCDA 4R6KA 1LFIA 1XI6A 1VFEA 4IO6A 4N6DA 2WKYA 1B05A 1XVYA 2RCBA 2ZYMA 1TXFA 1Z7ME 3OXNA 3OOAA 1FPFA 1NV6A 3Q27A 1ZMGA 5DVFA 1R6ZA 2DWAA 4P11A 4ESWA 1RYXA 2HZKA 3VLWA 2DOJA 4QF9A 2HFBA 3FZVA 2VHAA 2OWSA 4PBHA 4ESXA 2OX3A 3VFJA 1ZKBA 4H67A 3ZKKA 2ABHA 3O97A 3GLBA 1SW2A 3S9NC 2L5VA 2P3VA 2ZYNA 4WKMA 3QAXA 3U65A 5ELVA 1MH3A 1NV1A 2ZMBA 4ND9A 5A5LA 5I56B 5IZ3A 4POWA 5KDTA 4R9GA 5I58A 4GWWA 4KI0E 4BDQA 3OO9A 1IMCA 3K2DA 1NH8A 4MEVA 4GX3A 3DLNA 4O3AA 3B7DA 4LZ5A 1O64A 3C31A 1POY1 3M8UA 4DXCA 4PFBA 2VD3A 4QFPA 4RK9A 3MJNA 4F29A 2RCAA 4KYDA 3L6HA 1B32A 3TTKA 3IOTA 2Q89A 3GZGA 2D21A 1P1WA 4QFKA 4LQ2A 1TFDA 3GBBA 3LBSA 3TTNA 4JWOA 2X26A 1QUJA 1XVXA 1FBPA 2REGA 2XXWA 3U93A 1B40A 2CMOA 2X7QA 4O3BA 4RNSA 4H5GA 1USYE 2DXYA 1FPJA 2I58A 2UXAA 1LBXA 2ZXTA 5CMKA 3IB1A 4YB6A 3BIGA 3K6UA 2I4CA 3SESA 5DVJA 1MQGA 1SW4A 5H8HA 2FIXA 3N94A 3FJMA 5EYHA 3RQTA 5L9OA 2KR0A 1A54A 3H4ZA 4JVDA 4E0WA 3OEMA 3E78A 3IO6A 4HE2A 1PEBA 4R2BA 2Y7WA 3N26A 3CRBA 4HCWA 4P47A 3IR1A 4RYAA 2ZNSA 5EYGA 2H25A 1GTKA 3IORA 3PUVE 2F34A 3THIA 3MZ1A 1NV5A 2B3BA 3I6VA 5I59B 1A55A 4ZS9A 4OVPA 4NF4B 2XXUA 3O6GA 1QUIA 3FBPA 3MQ9A 4HE1A 3SDFA 3PD8A 1B4HA 1N84A 3PD9A 4PF6A 1PBPA 1MH4A 4F39A 4AS5A 1KA0A 4DXBA 1PB7A 1GR2A 2A5TA 1CNQA 2F8DA 2V3QA 3PMVA 1B1HA 2VGQA 5DYHA 2CZIA 1LCFA 4FECA 1EZ9A 4JDFA 2PFYA 2WYKA 2LAOA 1QGXA 2WBDA 3PUYE 5IZZA 5I7IA 3O29A 2PMSA 2V93A 5LTCA 1AIVA 3I3VA 5CC2A 5L8DA 1ELJA 1LBBA 2VPOA 1F9BA 3K1MA 2HAVA 1PB8A 3FJGA 4GBVA 4R2FA 2RINA 4OFLA 4R73A 2FVZA 3O9PA 1R1NA 3VXBA 4PAIA 1MY3A 5I84A 2DXRA 4BDOA 4UA8A 3T9XB 2O7IA 5M2VA 4F1UA 5I2KA 4PGPA 2DQVA 3B8BA 2VOZA 1XS5A 1LBVA 1OQGA 4R72A 1Q9DA 2ONSA 2I0CA 3KZGA 2VD2A 4G68A 1EYJA 2GFEA 2O69A 5IZ3B 2AIXA 3T1BA 4NHBA 3C34A 3LV0A 4IGTA 5H8FA 1NNPA 1D3KA 4H8JA 2R8TA 3K6VA 4DI3D 5BWJA 1JEVA 5H8QA 1LB9A 1US5A 4Z0IA 1AL3A 3SZPA 3A09A 1S50A 2FA7A 1ZU0A 3V5AA 4MLQA 4R75A 3K02A 2WX9A 2QS1A 4F19A 2AL4A 1FQAA 3PPRA 2QMWA 1NL5A 4Q30B 1YXIA 1PC3A 3BBRA 3WAEA 4AQ4A 2X7PA 1NUZA 3VV5A 5LOMA 1URSA 1B7UA 4UACA 2DE2A 2UVHA 1IZ1A 3VVFA 4HW8A 1MXYA 1FTAA 3KN8A 2UVGA 2NOOA 1N3WA 3D1RA 4DZ1A 1UTBA 4NF6B 1XT8A 2VPNA 1M5CA 5EHSA 3TFLA 4R6HA 1YZ0A 4DI4B 4GWUA 3N6TA 4C1UA 5TP9B 4GD5A 1VR5A 4XIGQ 3IOWA 3LSLA 4NE4A 4IO4A 1DBZA 1O7TA 3FATA 1B3EA 1OVBA 5F7VA 3LSXA 1RDXA 5AA2D 4F1VA 3A29A 2DVZA 3DELB 1NV7A 1LB8A 2QSXA 4I3YA 3TPAA 4MMPA 1Y1MA 2R71A 1G0IA 4PE3A 5EQ9A 4NX1A 1FBDA 1MXWA 2A5SA 5EQ8A 5I56A 1FSAA 1XOCA 3IJOB 2YJPA 4RJZA 3VLVA 1SD3A 1BKAA 4YZZA 2Y5LA 3FIRA 1H43A 3CIJA 3VVEA 1DMBA 4U4SA 4YB5A 1QJMA 4OWDA 2VP1A 4L17A 2GQ1A 2CEXA 3CR9A 2XXXA 3IJXB 1NNTA 4R74A 1MY2A 4LUBA 3H6WA 4H1XA 1ANFA 4KYSA 1B4ZA 1FQCA 3K0VA 2O6AA 2REJA 4IO5A 4OMBA 4XKRA 1OMPA 4X04A 1N7XA 3EHSA 3W9VA 2QFLA 3NOHA 5A5XB 1GV8A 4PTKA 3UA8A 4JSDA 3F11A 1MRPA 5EHMA 1M5DA 3E3KA 3U72A 3E79A 2Y7KA 3B6QA 4EQ9A 4ZE9A 2DDKA 2F7CA 1I6AA 2VT5A 4H65A 1FPGA 3TKDA 3QK6A 1MQHA 2G29A 1Y9UA 5I2KB 3T22A 1D9VA 1I69A 1ATGA 1KWHA 2OWTA 2Y7RA 2Q2AA 5DEXB 1Q35A 1FBCA 3U8QA 1LFHA 1NUWA 4RK2A 4G68C 4KFQA 4GX6A 3PPQA 3O6HA 2F97A 2UYEA 2GH9A 4U22A 2F3DA 3K00A 5I59A 3KC1A 4GXAA 4P9KA 4XKNA 3S9MC 4N8YA 4ZEBA 4NF8B 4LVQA 2E1SA 4NGUA 4OVQA 2DYXA 2F5XA 5IKBA 2UVIA 1ZIUA 3SEUA 2HXWA 3N5LA 2HAUA 3JZJA 2Z8DA 4JWXA 2XXKA 1OIBA 3FXQA 1Y4CA 3RLFE 3UORA 5L9SA 1FTJA 2XX7A 3C35A 1UTHB 1MY4A 3EPEA 4X48A 4N6KA 4KQPA 4OERA 1K9ZA 4FE8A 5DT6A 1LAFE 1MPCA 5IM2A 3R7XA 5IAIA 1JEUA 1QVSA 4X1DA 1JP4A 3CFZA 5AA1A 1UTBB 4NF0A 3D4GA 4IY6A 2V84A 4NAPA 1IIWA 1IMDA 2H5YA 4PFRA 3TZAA 2ZZVA 4GQOA 2GHAA 1SI1A 1MM6A 2QMXA 5FHOA 4XTCQ 5I57B 2FIEA 4KR5A 1IMEA 3TCGA 3SEXA 2CEYA 4F2QA 2ZNUA 5KZTA 1B7ZA 3EQ1A 4PF8A 3QUJA 4OANA 2XA5A 2AL5A 3T66A 3S4UA 3T0JA 1QKBA 4FEDA 4O3CA 5LDZA 2XD2A 3G3KA 2NXOA 2DE4A 3IFAA 1FPKA 4RXLA 3GYYA 3MZ9A 4XFEA 4EDPA 5JEIA 4GXSB 3MYUA 4QHQA 1EYIA 4QXDA 4QFOA 3FJ7A 4K3FA 4H8IA 4H45A 3USDA 1TWYA 1EU8A 4FAJA 1TFAA 2V3TA 1FPLA 3L6GA 2GHBA 5CRYA 4I8CA 4Q5TA 4MLVA 1SW5A 4JBZA 4H0WA 2O7UA 4R9FA 1JNFA 2XD3A 2FNCA 2XXPA 3RPLB 1YYZA 1A40A 4M4GA 3CI8A 1B58A 4Q0CA 1CE2A 3IB2A 1LFGA 3V8XB 1DCUA 4FBPA 4DE8A 2F78A 3M3LA 4G8NA 1Y3PA 3SEWA 2M8CA 4C0RA 4OZ9A 3B50A 1DSNA 4GL8A 4KHZE 3QIMA 1AMFA 4NF6A 4YKIA 4EF1A 2ESNA 4JVCA 4PQJA 1B9JA 3U1OA 4ONYA 3H06B 1URGA 2XXRA 5CMBA 3HO7A 2ZZXA 4MF3A 4N91A 3UK4A 5TP9A 3ONMA 1ZLQA 4U2RA 1FTOA 4KCDA 4H5FA 4RA1A 4DXUA 4PDDA 4U1OA 4MNCA 3TODA 1O63A 1LGBC 3OEKA 4F3PA 1B0HA 2RC9A 2I4BA 2V3UA 4PAKA 1L5TA 4EF2A 3T9VA 3TQWA 5ICQA 2ONRA 4YMAA 5TPAA 3DM0A 4MJOA 1LSTA 3U92A 3RT6B 3RNNA 4FIMA 4ZECA 3MW0A 1BP5A 1IITA 1LAHE 5EQ7A 5FBPA 3KN7A 4O7IA 3FASA 2I6EA 4DDDA 2H99A 4OETA 1UIVA 2HZLA 3IB0A 2OK2A 4GWSA 4I3EA 4THIA 4I9DA 2PX1A 1JQFA 4NWCA 2QJEA 4QFLA 1IMAA 1YCJA 4LN5A 4OHNA 2XX9A 3OELA 2HPGA 1ZBMA 3HCQA 2D5WA 4BDMA 4YICA 3VE1B 3KJTA 1HSLA 3QUFA 4GWOA 4IR8A 5K2YA 5TU0A 1DK4A 3GBAA 3MUQA 2OCUA 5A5XA 1FBGA 2W7YA 3A3CA 2PT2A 2Z22A 4DLDA 2O1MA 4WXJA 4JWYA 1H44A 5ET6A 1Z7NE 2WYPA 3LUZA 3VVDA 1FJ6A 1QKAA 2XXYA 2XWKA 3CSBA 4JSOA 3MC2A 1M5BA 3IOUA 4P3LA 2NVUB 1SW1A 4O8MA 2RKMA 5J1DA 1N0TA 2Q88A 3JYRA 4OVTA 3RN8A 1WDNA 3HHFA 2E0SA 5DEXA 5F1QA 4FJPA 1B46A 3HSTA 3RYDA 4N17A 1N76A 2DWHA 3KOSA 1FPDA 1IMFA 2PBWA 3PV0E 5H8NB 3UP9A 5AE4A 4G2ZA 2OZZA 4PDHA 1B3HA 3OO6A 1POTA 2ANJA 3TDJA 1AH5A 3MVYA 1B51A 5CI5A 3QXMA 2I3WA 1MXUA 4NF8A 4O94A 1UQWA 4P56A 1IXHA 3ILUB 1BLFA 4EXKA 2P0SA 2WEFA 1XHYA 1MXZA 1SYHA 1EH3A 1EYKA 4PP0A 4ZDMA 3H03A 2ALUA 4H46A 4YAHX 1NV2A 1FBHA 1DTZA 4C1TA 1UTHA 5AA2B 4RY1A 3LC8A 3CHGA 4MHFA 3FV2A 4G61A 1D9QA 1QUKA 4ELPA 3O66A 3H6VA 4NG7A 4OESA 3A3UA 2DSFA 5I2NA 4JVIA 2CZLA 2IA4A 3R6UA 3OD7A 2THIA 4QRZA 4GIZA 4MNIA 3HPIA 3LSWA 2ZYKA 5CBRA 2XWIA 3MWBA 4NQ8A 1P99A 5I57A 2ZYOA 3SEYA 3O6IA 4HXVA 3KBRA 4F22A 2YPNA 3UN6A 3KGCA 4U4XA 1B6HA 4I1DA 4YKKA 2DVCA 3Q26A 5ET8A 5TPAB 5K2XA 2PVUA 4F3GA 3C32A 1B0LA 4ZEFA 1LBCA 4PFWA 3C33A 4BDRA 3QYTA 3Q29A 4GFRA 2Z8FA 1N7WA 2QS3A 3G3HA 3T9UA 1R9QA 2F7BA 3OENA 5J16A 3KJ7A 4NWDA 4U23A 2H98A 2RF1A 3TTRA 1MQJA 1TT1A 4HE0A 4PETA 1KZ8A 1FQDA 3IX1A 4LZ7A 3EHUA 1JETA 3RY3A 2D3IA 4ZZEA 4GWXA 3BFTA 3RPLA 4XEQA 3IO4A 2H4IA 3FD3A 3RTFB 1VFDA 2F6GA 3KEIA 4Q8RA 3N6UA 3K6WA 4YMBA 3CFXA 4OA4A 5ESYA 1US4A 4G77A 3E4RA 3JV9A 4E0XA 4WEPA 4GOTA 3IK6B 1FPIA 1QULA 4KCCA 3C9HA 3QSLA 1NKXA 3CG3A 1FW0A 1HSEA 1MY0A 3OSRA 3OO8A 3W15C 1MDQA 4GLIA 3PUXE 1INPA 4H6DA 1H3DA 1QW0A 1PB9A 2Z23A 2HCAA 1UIUA 1SYIA 1MQDA 4EXLA 1NFTA 1D9YA 1OQHA 3TQLA 1SBPA 3FGSA 4P0IA 2OJTA 5ISUA 4LQ5A 3PTYA 1H76A 4KYEA 3G7WA 1IXCA 4GL0A 3FVKA 4OEUA 3BIHA 3UGWA 4OENA 3S9EA 3HN0A 4NTLA 4EQBA 4LONB 4QFNA 4GVOA 1Y1ZA 1JVYA 2XHDA 4AB5A 2PT1A 2B65A 3K01A 2FYIA 2Q8JA 3PU5A 2ONKE 4YB7A 1DPPA 4ZEIA 2Q9TA 2GRVA 1HSJA 1SVXB 5CM6A 2O1LA 3DP4A 1K9YA 5T3JA 3V89B 4X8RA 5JTYB 4MBPA 4N8GA 2P3NA 4JB7A 5KCJB 1P1UA 5I2NB 2HHMA 3MPKA 1PBQA 5H8SA 3HV1A 1AOVA 3FUZA 3KC0A 1IEJA 3IOVA 4LA9A 1JW4A 4O7MA 2PYYA 1FPBA 4UABA 2KLFA 5FTHA 1NNFA 3BKIB 5ICTA 2Y7IA 2Y5KA 4OYVA 1I6BA 1BK4A 1FRPA 1EZOA 1FTLA 1BIYA 1NI9A 3PPNA 1T0KA 1USYH 3ODBA 1OLCA 2QPQA 2DWJA 3K6XA 3B6TA 3MBPA 1Y4TA 1URDA 4XF5A 3FXUA 5H8NA 5BUUA 3H3GA 3O28A 1MPBA 2DE3A 4FORA 3VDFA 1LCTA 3M3KA 4R6YA 5ET7A 3K4UA 4QSEA 2QRYA 1NNKA 4YU0A 4DIGA 3HHGA 3G3FA 2F7AA 3GXAA 1LLSA 4KPTA 4G4PA 3FXBA 4ECFA 5I5PA 1NV4A 2G93A 1SI0A 3MZBA 1RYOA 5AA3A 3MPLA 1MG1A 4P0GA 4LATA 4ELRA 4WEDA 5HM4B 3FV1A 3CFLA 2CZHA 1B3FA 4TOZA 4TQUQ 3TMGA 4MAGA 1G0HA 4I40A 1GVCA 1I6QA 5AA2A 4PFIA 3LSFB 2RC8A 4OEVA 4AS4A 4N4UA 1FBEA 2QS2A 4G8MA 3EHTA 3PUWE 2Z8EA 3MAMA 3CVGA 2CZKA 1MDP1 3PMWA 2ZNTA 3BFUA 4OVRA 2OWZA 2F36A 3C36A 4EQ7A 5AA4A 4I62A 1IMBA 4P1EA 4F2OA 1N04A 3W9WA 2DWIA 2V25A 2MKZA 2Y7PA 3OO7A 2YLNA 4POXA 4NN3A 5HPQA 1OVTA 2QVUA 2DS9A 1FQEA 2BJIA 4XKQA 3PMXA 4ZZAA 3T96B 2O68A
chains in the Genus database with same CATH topology
4JXIA 1GGGA 3ZS6A 1MS7A 4NF5B 2BJJX 3SKPA 1IXIA 5B70A 3IL1B 2IEEA 1M5EA 1D4NA 3TTMA 4ZEDA 3TCHA 3G3GA 1YTVA 5JK4A 1FTMA 1B7HA 4FATA 3H6UA 3M3FA 4HTGA 2I3VA 3B6WA 1P1OA 3RTWB 4U21A 1II5A 2OBGA 4IO3A 1SQYA 4AB6A 3KSXA 3KOTA 4OFOA 3FVNA 4DCXA 2XXIA 4FEBA 3FVGA 1SDXA 4QSCA 2I49A 3IAZA 1BTJA 3PPOA 1MQIA 5DVIA 1Y20A 5CBSA 4LZ8A 4IO2A 3LUYA 1IQ7A 2HEUA 2NWJA 4MH5A 1FTKA 4DCYA 1A99A 4YKPA 3R26A 3FXRA 3VLUA 5FTIA 3G3JA 3RPWA 4IGRA 1ZTYA 3LR1A 1IUDA 3C4MA 4G8HA 1VSOA 2XXHA 3K1PA 3ILTB 4EUOA 1Q1KA 3E13X 3PPPA 4F18A 5KDTB 5I58B 3MVXA 4ZEKA 1M5FA 2Q2CA 1JW5A 3PGFA 4M1VA 4F3SA 1WVJA 3KSJA 4ELOA 2R9JA 1B5IA 1XC1A 1RKMA 4F3BA 4RPOA 1Y3NA 2F6PA 5L9MA 5DTBA 4OTEA 2H9BA 2P2AA 4XKPA 3TYHA 5JTYA 3UIFA 2XXVA 3SEVA 5KCJA 1JVXA 4IB2A 1Y3QA 3I5OA 4TLLB 3MVWA 5FHNA 3H6TA 1LAGE 4GRKA 1JW1A 1R9LA 5B7DA 3MP6A 1MXXA 2I0BA 4N07A 3O2AA 3CG1A 5AA4B 3MP1A 3T9HB 2XX8A 3TCFA 3V83A 3S2VA 5H8HB 3MP8A 1MPDA 4OVJA 1FQFA 4HS7A 1B5HA 4XXUA 1B3LA 2RC7A 3AXFA 4PE5B 1MXVA 1J1NA 1DOTA 4MFIA 1B1XA 3P7IA 4PFYA 5HBCA 5EYFA 3E9XA 3ECRA 4X9TA 4PFTA 2UVJA 1CB6A 3T93B 3MVZA 1N3XA 2AYSA 3VXCA 1S9TA 4GF8A 3S9LC 3EN3A 1YPNA 2A5TB 2QL3A 4BLAA 4N13A 2O51A 4F31B 3EF7A 4YKJA 4U1ZA 1P1QA 4ZE8A 1FCKA 3U94A 4Z7EA 3KN3A 1MM7A 4HCYA 4OXVA 2Y84A 4BDLA 3DP6A 3Q28A 1NH7A 3TELA 2NUVA 1LAXA 3G3IA 4IO7A 3OSQA 4LP2B 3KFMA 1MY1A 3TTLA 1WODA 4RPNA 1S7YA 2UYFA 1NMUA 1EZPA 3TUSA 4OQOA 3RGYA 4NMYA 5ITPA 2P1SA 4QSDA 1A8EA 4KD5A 2I48A 3RUMA 3WAFA 2XXTA 1YAEA 4NF5A 1DPEA 1B52A 4IY5A 4G68B 1A8FA 1B2HA 1B3GA 1DTGA 2XXQA 1FQBA 5H8FB 4NEDA 3PUZE 5ITOA 3H7MA 2QS4A 2R6GE 1VE4A 4BDNA 4NF4A 2B3FA 5H8QB 4F1YA 4N6PA 2HQ0A 5CMCA 1A7LA 2DP8A 1OLAA 4ISUA 4ELQA 2F35A 4TLMB 3TAJA 2O84X 3FVOA 3ZKLA 2OLBA 1IXGA 1ZJLA 3ZSFA 3SETA 5CMMA 3RT8A 3K1NA 4PFUA 4OFJA 1PDAA 3CSGA 3Q25A 4X1BA 3OMBA 1P1NA 1B5JA 3TEPA 5FHMA 3SERA 3KG2A 1H45A 3D4CA 3DP8A 4R6KA 1LFIA 1VFEA 4IO6A 2WKYA 1B05A 1XVYA 2RCBA 2ZYMA 1TXFA 1Z7ME 3OXNA 3OOAA 3Q27A 1ZMGA 5DVFA 1R6ZA 2DWAA 4P11A 4ESWA 1RYXA 2HZKA 3VLWA 2DOJA 4QF9A 2HFBA 3FZVA 2VHAA 2OWSA 4ESXA 3VFJA 1ZKBA 4H67A 3ZKKA 2ABHA 3O97A 3GLBA 1SW2A 3S9NC 2ZYNA 4WKMA 3QAXA 5ELVA 1MH3A 2ZMBA 4ND9A 5I56B 4POWA 5KDTA 4R9GA 5I58A 4KI0E 4BDQA 3OO9A 3K2DA 1NH8A 3DLNA 4O3AA 3B7DA 4LZ5A 1O64A 3C31A 1POY1 3M8UA 4DXCA 2VD3A 4QFPA 4RK9A 3MJNA 4F29A 2RCAA 4KYDA 3L6HA 1B32A 3TTKA 3IOTA 2Q89A 3GZGA 2D21A 1P1WA 4QFKA 4LQ2A 1TFDA 3GBBA 3LBSA 3TTNA 4JWOA 2X26A 1QUJA 1XVXA 2REGA 2XXWA 3U93A 1B40A 2CMOA 2X7QA 4O3BA 4RNSA 4H5GA 1USYE 2DXYA 2I58A 2UXAA 2ZXTA 5CMKA 3IB1A 4YB6A 3K6UA 2I4CA 3SESA 5DVJA 1MQGA 1SW4A 5H8HA 3N94A 3FJMA 3RQTA 5L9OA 1A54A 3H4ZA 4E0WA 3OEMA 3IO6A 1PEBA 4R2BA 2Y7WA 3N26A 3CRBA 4HCWA 3IR1A 4RYAA 2ZNSA 2H25A 1GTKA 3IORA 3PUVE 2F34A 3THIA 3MZ1A 2B3BA 3I6VA 5I59B 1A55A 4ZS9A 4NF4B 2XXUA 3O6GA 1QUIA 3MQ9A 3SDFA 3PD8A 1B4HA 1N84A 3PD9A 1PBPA 1MH4A 4F39A 4DXBA 1PB7A 1GR2A 2A5TA 2F8DA 2V3QA 3PMVA 1B1HA 2VGQA 5DYHA 1LCFA 4FECA 1EZ9A 4JDFA 2LAOA 3PUYE 3O29A 2PMSA 2V93A 1AIVA 3I3VA 5CC2A 5L8DA 1ELJA 1LBBA 1F9BA 3K1MA 2HAVA 1PB8A 3FJGA 4R2FA 2RINA 4OFLA 4R73A 3O9PA 1R1NA 3VXBA 1MY3A 5I84A 2DXRA 4BDOA 4UA8A 3T9XB 2O7IA 5M2VA 4F1UA 5I2KA 2DQVA 2VOZA 1XS5A 1OQGA 4R72A 2ONSA 2I0CA 3KZGA 2VD2A 4G68A 2GFEA 2O69A 2AIXA 3C34A 4IGTA 5H8FA 1NNPA 1D3KA 4H8JA 3K6VA 5BWJA 1JEVA 5H8QA 1LB9A 1US5A 4Z0IA 1AL3A 3A09A 1S50A 2FA7A 1ZU0A 3V5AA 4MLQA 4R75A 3K02A 2QS1A 4F19A 2AL4A 1FQAA 3PPRA 2QMWA 1NL5A 4Q30B 1PC3A 3BBRA 3WAEA 4AQ4A 2X7PA 3VV5A 5LOMA 1URSA 1B7UA 4UACA 2DE2A 2UVHA 1IZ1A 3VVFA 4HW8A 1MXYA 3KN8A 2UVGA 2NOOA 1N3WA 4DZ1A 1UTBA 4NF6B 1XT8A 1M5CA 5EHSA 3TFLA 4R6HA 4C1UA 3N6TA 5TP9B 4GD5A 1VR5A 4XIGQ 3IOWA 3LSLA 4NE4A 4IO4A 1O7TA 3FATA 1B3EA 1OVBA 5F7VA 3LSXA 5AA2D 4F1VA 2DVZA 3DELB 1LB8A 2QSXA 3TPAA 1Y1MA 2R71A 1MXWA 2A5SA 5I56A 1XOCA 3IJOB 2YJPA 4RJZA 3VLVA 1SD3A 1BKAA 4YZZA 3FIRA 1H43A 3CIJA 3VVEA 1DMBA 4U4SA 4YB5A 1QJMA 4OWDA 2VP1A 4L17A 3CR9A 2XXXA 3IJXB 1NNTA 4R74A 1MY2A 4LUBA 3H6WA 4H1XA 1ANFA 4KYSA 1B4ZA 1FQCA 3K0VA 2O6AA 2REJA 4IO5A 4OMBA 4XKRA 1OMPA 1N7XA 3EHSA 3W9VA 5A5XB 1GV8A 3UA8A 4JSDA 3F11A 1MRPA 5EHMA 1M5DA 3E3KA 3U72A 2Y7KA 3B6QA 4EQ9A 4ZE9A 2F7CA 1I6AA 4H65A 3TKDA 3QK6A 1MQHA 2G29A 1Y9UA 5I2KB 3T22A 1D9VA 1I69A 1ATGA 1KWHA 2OWTA 2Y7RA 2Q2AA 5DEXB 1Q35A 3U8QA 1LFHA 4RK2A 4G68C 4KFQA 3PPQA 3O6HA 2F97A 2UYEA 2GH9A 4U22A 3K00A 5I59A 4GXAA 4XKNA 3S9MC 4ZEBA 4NF8B 4LVQA 2E1SA 5IKBA 2DYXA 2F5XA 2UVIA 1ZIUA 3SEUA 2HXWA 3N5LA 2HAUA 3JZJA 2Z8DA 4JWXA 1OIBA 3FXQA 1Y4CA 3RLFE 3UORA 5L9SA 1FTJA 2XX7A 3C35A 1UTHB 1MY4A 3EPEA 4X48A 4KQPA 4OERA 4FE8A 5DT6A 1LAFE 1MPCA 3R7XA 5IAIA 1JEUA 1QVSA 4X1DA 3CFZA 5AA1A 1UTBB 3D4GA 4IY6A 2V84A 1IIWA 2H5YA 3TZAA 4GQOA 2GHAA 1SI1A 1MM6A 2QMXA 5FHOA 4XTCQ 5I57B 4KR5A 3TCGA 3SEXA 4F2QA 2ZNUA 5KZTA 1B7ZA 3EQ1A 3QUJA 2AL5A 3T66A 3S4UA 1QKBA 4FEDA 4O3CA 2XD2A 3G3KA 2NXOA 2DE4A 4RXLA 3MZ9A 4EDPA 5JEIA 4GXSB 4QHQA 4QFOA 3FJ7A 4K3FA 4H8IA 3USDA 1TWYA 1EU8A 4FAJA 1TFAA 2V3TA 3L6GA 2GHBA 5CRYA 4I8CA 4Q5TA 4MLVA 1SW5A 4JBZA 4H0WA 2O7UA 4R9FA 1JNFA 2XD3A 2FNCA 2XXPA 1A40A 4M4GA 3CI8A 1B58A 4Q0CA 1CE2A 3IB2A 1LFGA 3V8XB 4DE8A 2F78A 3M3LA 4G8NA 1Y3PA 3SEWA 2M8CA 4C0RA 4OZ9A 1DSNA 4GL8A 4KHZE 3QIMA 1AMFA 4NF6A 4YKIA 4EF1A 2ESNA 4PQJA 1B9JA 3U1OA 4ONYA 3H06B 1URGA 2XXRA 5CMBA 3HO7A 4MF3A 3UK4A 5TP9A 3ONMA 1ZLQA 4U2RA 1FTOA 4KCDA 4H5FA 4RA1A 4DXUA 4U1OA 3TODA 1O63A 1LGBC 3OEKA 4F3PA 1B0HA 2RC9A 2I4BA 2V3UA 1L5TA 4EF2A 3T9VA 3TQWA 5ICQA 2ONRA 4YMAA 5TPAA 3DM0A 1LSTA 3U92A 3RT6B 3RNNA 4FIMA 4ZECA 3MW0A 1BP5A 1IITA 1LAHE 3KN7A 3FASA 2I6EA 4DDDA 2H99A 4OETA 1UIVA 2HZLA 3IB0A 2OK2A 4THIA 4I9DA 2PX1A 1JQFA 4NWCA 2QJEA 4QFLA 1YCJA 4OHNA 2XX9A 3OELA 1ZBMA 3HCQA 2D5WA 4BDMA 4YICA 3VE1B 3KJTA 1HSLA 5K2YA 3QUFA 4GWOA 5TU0A 3GBAA 3MUQA 2OCUA 5A5XA 2W7YA 3A3CA 2PT2A 2Z22A 4DLDA 2O1MA 4WXJA 4JWYA 1H44A 1Z7NE 3VVDA 1QKAA 2XXYA 3CSBA 4JSOA 3MC2A 1M5BA 3IOUA 2NVUB 1SW1A 2RKMA 5J1DA 1N0TA 2Q88A 3JYRA 3RN8A 1WDNA 3HHFA 2E0SA 5DEXA 5F1QA 4FJPA 1B46A 3HSTA 1N76A 2DWHA 3KOSA 2PBWA 3PV0E 5H8NB 3UP9A 5AE4A 4G2ZA 2OZZA 1B3HA 3OO6A 1POTA 2ANJA 3TDJA 1AH5A 3MVYA 1B51A 5CI5A 3QXMA 2I3WA 1MXUA 4NF8A 1UQWA 1IXHA 3ILUB 1BLFA 4EXKA 2P0SA 1XHYA 1MXZA 1SYHA 1EH3A 4PP0A 4ZDMA 3H03A 2ALUA 4YAHX 1DTZA 4C1TA 1UTHA 5AA2B 4RY1A 3LC8A 3FV2A 1QUKA 4ELPA 3O66A 3H6VA 4OESA 3A3UA 2DSFA 5I2NA 2CZLA 2IA4A 3R6UA 3OD7A 2THIA 4QRZA 4GIZA 3HPIA 3LSWA 2ZYKA 5CBRA 3MWBA 1P99A 5I57A 2ZYOA 3SEYA 3O6IA 3KBRA 4F22A 2YPNA 3UN6A 3KGCA 4U4XA 1B6HA 4I1DA 4YKKA 2DVCA 3Q26A 5TPAB 5K2XA 2PVUA 4F3GA 3C32A 1B0LA 4ZEFA 1LBCA 4PFWA 3C33A 4BDRA 3QYTA 3Q29A 4GFRA 2Z8FA 1N7WA 2QS3A 3G3HA 3T9UA 1R9QA 2F7BA 3OENA 3KJ7A 4NWDA 4U23A 2H98A 2RF1A 3TTRA 1MQJA 1TT1A 4PETA 1FQDA 3IX1A 4LZ7A 3EHUA 1JETA 3RY3A 2D3IA 4ZZEA 3BFTA 3IO4A 2H4IA 3FD3A 3RTFB 1VFDA 2F6GA 3KEIA 4Q8RA 3N6UA 3K6WA 4YMBA 3CFXA 1US4A 4G77A 3E4RA 3JV9A 4E0XA 4WEPA 4GOTA 3IK6B 1QULA 4KCCA 3C9HA 3QSLA 1NKXA 3CG3A 1FW0A 1HSEA 1MY0A 3OSRA 3OO8A 3W15C 1MDQA 4GLIA 3PUXE 4H6DA 1H3DA 1QW0A 1PB9A 2Z23A 2HCAA 1UIUA 1SYIA 1MQDA 4EXLA 1NFTA 1D9YA 1OQHA 3TQLA 1SBPA 3FGSA 4P0IA 2OJTA 5ISUA 4LQ5A 1H76A 4KYEA 3G7WA 1IXCA 4GL0A 3FVKA 4OEUA 3UGWA 4OENA 3S9EA 3HN0A 4NTLA 4EQBA 4LONB 4QFNA 1Y1ZA 2XHDA 1JVYA 4GVOA 4AB5A 2PT1A 2B65A 3K01A 2FYIA 2Q8JA 3PU5A 2ONKE 4YB7A 1DPPA 4ZEIA 2Q9TA 2GRVA 1HSJA 1SVXB 5CM6A 2O1LA 3DP4A 3V89B 5JTYB 4MBPA 4JB7A 5KCJB 1P1UA 5I2NB 3MPKA 1PBQA 5H8SA 3HV1A 1AOVA 3FUZA 1IEJA 3IOVA 4LA9A 1JW4A 2PYYA 2KLFA 5FTHA 1NNFA 3BKIB 5ICTA 2Y7IA 4OYVA 1I6BA 1EZOA 1FTLA 1BIYA 3PPNA 1T0KA 1USYH 3ODBA 1OLCA 2QPQA 2DWJA 3K6XA 3B6TA 3MBPA 1Y4TA 1URDA 3FXUA 5H8NA 5BUUA 3H3GA 3O28A 1MPBA 2DE3A 4FORA 3VDFA 1LCTA 3M3KA 4R6YA 3K4UA 4QSEA 2QRYA 1NNKA 4YU0A 4DIGA 3HHGA 3G3FA 2F7AA 3GXAA 1LLSA 4KPTA 4G4PA 4ECFA 2G93A 1SI0A 3MZBA 1RYOA 5AA3A 3MPLA 1MG1A 4P0GA 4LATA 4ELRA 4WEDA 5HM4B 3FV1A 3CFLA 1B3FA 4TOZA 4TQUQ 3TMGA 1GVCA 1I6QA 5AA2A 3LSFB 2RC8A 4OEVA 2QS2A 4G8MA 3EHTA 3PUWE 2Z8EA 3MAMA 3CVGA 1MDP1 3PMWA 2ZNTA 3BFUA 2F36A 3C36A 4EQ7A 5AA4A 4I62A 4F2OA 1N04A 3W9WA 2DWIA 2V25A 2Y7PA 3OO7A 2YLNA 4POXA 5HPQA 1OVTA 2DS9A 1FQEA 4XKQA 3PMXA 4ZZAA 3T96B 2O68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXI A;  1GGG A;  3ZS6 A;  1MS7 A;  4NF5 B;  2BJJ X;  3SKP A;  1IXI A;  5B70 A;  3IL1 B;  2IEE A;  1M5E A;  1D4N A;  3TTM A;  4ZED A;  3TCH A;  3G3G A;  1YTV A;  5JK4 A;  1FTM A;  1B7H A;  4FAT A;  3H6U A;  3M3F A;  4HTG A;  2I3V A;  3B6W A;  1P1O A;  3RTW B;  4U21 A;  1II5 A;  2OBG A;  4IO3 A;  1SQY A;  4AB6 A;  3KSX A;  3KOT A;  4OFO A;  3FVN A;  4DCX A;  2XXI A;  4FEB A;  3FVG A;  1SDX A;  4QSC A;  2I49 A;  3IAZ A;  1BTJ A;  3PPO A;  1MQI A;  5DVI A;  1Y20 A;  5CBS A;  4LZ8 A;  4IO2 A;  3LUY A;  1IQ7 A;  2HEU A;  2NWJ A;  4MH5 A;  1FTK A;  4DCY A;  1A99 A;  4YKP A;  3R26 A;  3FXR A;  3VLU A;  5FTI A;  3G3J A;  3RPW A;  4IGR A;  1ZTY A;  3LR1 A;  1IUD A;  3C4M A;  4G8H A;  1VSO A;  2XXH A;  3K1P A;  3ILT B;  4EUO A;  1Q1K A;  3E13 X;  3PPP A;  4F18 A;  5KDT B;  5I58 B;  3MVX A;  4ZEK A;  1M5F A;  2Q2C A;  1JW5 A;  3PGF A;  4M1V A;  4F3S A;  1WVJ A;  3KSJ A;  4ELO A;  2R9J A;  1B5I A;  1XC1 A;  1RKM A;  4F3B A;  4RPO A;  1Y3N A;  2F6P A;  5L9M A;  5DTB A;  4OTE A;  2H9B A;  2P2A A;  4XKP A;  3TYH A;  5JTY A;  3UIF A;  2XXV A;  3SEV A;  5KCJ A;  1JVX A;  4IB2 A;  1Y3Q A;  3I5O A;  4TLL B;  3MVW A;  5FHN A;  3H6T A;  1LAG E;  4GRK A;  1JW1 A;  1R9L A;  5B7D A;  3MP6 A;  1MXX A;  2I0B A;  4N07 A;  3O2A A;  3CG1 A;  5AA4 B;  3MP1 A;  3T9H B;  2XX8 A;  3TCF A;  3V83 A;  3S2V A;  5H8H B;  3MP8 A;  1MPD A;  4OVJ A;  1FQF A;  4HS7 A;  1B5H A;  4XXU A;  1B3L A;  2RC7 A;  3AXF A;  4PE5 B;  1MXV A;  1J1N A;  1DOT A;  4MFI A;  1B1X A;  3P7I A;  4PFY A;  5HBC A;  5EYF A;  3E9X A;  3ECR A;  4X9T A;  4PFT A;  2UVJ A;  1CB6 A;  3T93 B;  3MVZ A;  1N3X A;  2AYS A;  3VXC A;  1S9T A;  4GF8 A;  3S9L C;  3EN3 A;  1YPN A;  2A5T B;  2QL3 A;  4BLA A;  4N13 A;  2O51 A;  4F31 B;  3EF7 A;  4YKJ A;  4U1Z A;  1P1Q A;  4ZE8 A;  1FCK A;  3U94 A;  4Z7E A;  3KN3 A;  1MM7 A;  4HCY A;  4OXV A;  2Y84 A;  4BDL A;  3DP6 A;  3Q28 A;  1NH7 A;  3TEL A;  2NUV A;  1LAX A;  3G3I A;  4IO7 A;  3OSQ A;  4LP2 B;  3KFM A;  1MY1 A;  3TTL A;  1WOD A;  4RPN A;  1S7Y A;  2UYF A;  1NMU A;  1EZP A;  3TUS A;  4OQO A;  3RGY A;  4NMY A;  5ITP A;  2P1S A;  4QSD A;  1A8E A;  4KD5 A;  2I48 A;  3RUM A;  3WAF A;  2XXT A;  1YAE A;  4NF5 A;  1DPE A;  1B52 A;  4IY5 A;  4G68 B;  1A8F A;  1B2H A;  1B3G A;  1DTG A;  2XXQ A;  1FQB A;  5H8F B;  4NED A;  3PUZ E;  5ITO A;  3H7M A;  2QS4 A;  2R6G E;  1VE4 A;  4BDN A;  4NF4 A;  2B3F A;  5H8Q B;  4F1Y A;  4N6P A;  2HQ0 A;  5CMC A;  1A7L A;  2DP8 A;  1OLA A;  4ISU A;  4ELQ A;  2F35 A;  4TLM B;  3TAJ A;  2O84 X;  3FVO A;  3ZKL A;  2OLB A;  1IXG A;  1ZJL A;  3ZSF A;  3SET A;  5CMM A;  3RT8 A;  3K1N A;  4PFU A;  4OFJ A;  1PDA A;  3CSG A;  3Q25 A;  4X1B A;  3OMB A;  1P1N A;  1B5J A;  3TEP A;  5FHM A;  3SER A;  3KG2 A;  1H45 A;  3D4C A;  3DP8 A;  4R6K A;  1LFI A;  1VFE A;  4IO6 A;  2WKY A;  1B05 A;  1XVY A;  2RCB A;  2ZYM A;  1TXF A;  1Z7M E;  3OXN A;  3OOA A;  3Q27 A;  1ZMG A;  5DVF A;  1R6Z A;  2DWA A;  4P11 A;  4ESW A;  1RYX A;  2HZK A;  3VLW A;  2DOJ A;  4QF9 A;  2HFB A;  3FZV A;  2VHA A;  2OWS A;  4ESX A;  3VFJ A;  1ZKB A;  4H67 A;  3ZKK A;  2ABH A;  3O97 A;  3GLB A;  1SW2 A;  3S9N C;  2ZYN A;  4WKM A;  3QAX A;  5ELV A;  1MH3 A;  2ZMB A;  4ND9 A;  5I56 B;  4POW A;  5KDT A;  4R9G A;  5I58 A;  4KI0 E;  4BDQ A;  3OO9 A;  3K2D A;  1NH8 A;  3DLN A;  4O3A A;  3B7D A;  4LZ5 A;  1O64 A;  3C31 A;  1POY 1;  3M8U A;  4DXC A;  2VD3 A;  4QFP A;  4RK9 A;  3MJN A;  4F29 A;  2RCA A;  4KYD A;  3L6H A;  1B32 A;  3TTK A;  3IOT A;  2Q89 A;  3GZG A;  2D21 A;  1P1W A;  4QFK A;  4LQ2 A;  1TFD A;  3GBB A;  3LBS A;  3TTN A;  4JWO A;  2X26 A;  1QUJ A;  1XVX A;  2REG A;  2XXW A;  3U93 A;  1B40 A;  2CMO A;  2X7Q A;  4O3B A;  4RNS A;  4H5G A;  1USY E;  2DXY A;  2I58 A;  2UXA A;  2ZXT A;  5CMK A;  3IB1 A;  4YB6 A;  3K6U A;  2I4C A;  3SES A;  5DVJ A;  1MQG A;  1SW4 A;  5H8H A;  3N94 A;  3FJM A;  3RQT A;  5L9O A;  1A54 A;  3H4Z A;  4E0W A;  3OEM A;  3IO6 A;  1PEB A;  4R2B A;  2Y7W A;  3N26 A;  3CRB A;  4HCW A;  3IR1 A;  4RYA A;  2ZNS A;  2H25 A;  1GTK A;  3IOR A;  3PUV E;  2F34 A;  3THI A;  3MZ1 A;  2B3B A;  3I6V A;  5I59 B;  1A55 A;  4ZS9 A;  4NF4 B;  2XXU A;  3O6G A;  1QUI A;  3MQ9 A;  3SDF A;  3PD8 A;  1B4H A;  1N84 A;  3PD9 A;  1PBP A;  1MH4 A;  4F39 A;  4DXB A;  1PB7 A;  1GR2 A;  2A5T A;  2F8D A;  2V3Q A;  3PMV A;  1B1H A;  2VGQ A;  5DYH A;  1LCF A;  4FEC A;  1EZ9 A;  4JDF A;  2LAO A;  3PUY E;  3O29 A;  2PMS A;  2V93 A;  1AIV A;  3I3V A;  5CC2 A;  5L8D A;  1ELJ A;  1LBB A;  1F9B A;  3K1M A;  2HAV A;  1PB8 A;  3FJG A;  4R2F A;  2RIN A;  4OFL A;  4R73 A;  3O9P A;  1R1N A;  3VXB A;  1MY3 A;  5I84 A;  2DXR A;  4BDO A;  4UA8 A;  3T9X B;  2O7I A;  5M2V A;  4F1U A;  5I2K A;  2DQV A;  2VOZ A;  1XS5 A;  1OQG A;  4R72 A;  2ONS A;  2I0C A;  3KZG A;  2VD2 A;  4G68 A;  2GFE A;  2O69 A;  2AIX A;  3C34 A;  4IGT A;  5H8F A;  1NNP A;  1D3K A;  4H8J A;  3K6V A;  5BWJ A;  1JEV A;  5H8Q A;  1LB9 A;  1US5 A;  4Z0I A;  1AL3 A;  3A09 A;  1S50 A;  2FA7 A;  1ZU0 A;  3V5A A;  4MLQ A;  4R75 A;  3K02 A;  2QS1 A;  4F19 A;  2AL4 A;  1FQA A;  3PPR A;  2QMW A;  1NL5 A;  4Q30 B;  1PC3 A;  3BBR A;  3WAE A;  4AQ4 A;  2X7P A;  3VV5 A;  5LOM A;  1URS A;  1B7U A;  4UAC A;  2DE2 A;  2UVH A;  1IZ1 A;  3VVF A;  4HW8 A;  1MXY A;  3KN8 A;  2UVG A;  2NOO A;  1N3W A;  4DZ1 A;  1UTB A;  4NF6 B;  1XT8 A;  1M5C A;  5EHS A;  3TFL A;  4R6H A;  4C1U A;  3N6T A;  5TP9 B;  4GD5 A;  1VR5 A;  4XIG Q;  3IOW A;  3LSL A;  4NE4 A;  4IO4 A;  1O7T A;  3FAT A;  1B3E A;  1OVB A;  5F7V A;  3LSX A;  5AA2 D;  4F1V A;  2DVZ A;  3DEL B;  1LB8 A;  2QSX A;  3TPA A;  1Y1M A;  2R71 A;  1MXW A;  2A5S A;  5I56 A;  1XOC A;  3IJO B;  2YJP A;  4RJZ A;  3VLV A;  1SD3 A;  1BKA A;  4YZZ A;  3FIR A;  1H43 A;  3CIJ A;  3VVE A;  1DMB A;  4U4S A;  4YB5 A;  1QJM A;  4OWD A;  2VP1 A;  4L17 A;  3CR9 A;  2XXX A;  3IJX B;  1NNT A;  4R74 A;  1MY2 A;  4LUB A;  3H6W A;  4H1X A;  1ANF A;  4KYS A;  1B4Z A;  1FQC A;  3K0V A;  2O6A A;  2REJ A;  4IO5 A;  4OMB A;  4XKR A;  1OMP A;  1N7X A;  3EHS A;  3W9V A;  5A5X B;  1GV8 A;  3UA8 A;  4JSD A;  3F11 A;  1MRP A;  5EHM A;  1M5D A;  3E3K A;  3U72 A;  2Y7K A;  3B6Q A;  4EQ9 A;  4ZE9 A;  2F7C A;  1I6A A;  4H65 A;  3TKD A;  3QK6 A;  1MQH A;  2G29 A;  1Y9U A;  5I2K B;  3T22 A;  1D9V A;  1I69 A;  1ATG A;  1KWH A;  2OWT A;  2Y7R A;  2Q2A A;  5DEX B;  1Q35 A;  3U8Q A;  1LFH A;  4RK2 A;  4G68 C;  4KFQ A;  3PPQ A;  3O6H A;  2F97 A;  2UYE A;  2GH9 A;  4U22 A;  3K00 A;  5I59 A;  4GXA A;  4XKN A;  3S9M C;  4ZEB A;  4NF8 B;  4LVQ A;  2E1S A;  5IKB A;  2DYX A;  2F5X A;  2UVI A;  1ZIU A;  3SEU A;  2HXW A;  3N5L A;  2HAU A;  3JZJ A;  2Z8D A;  4JWX A;  1OIB A;  3FXQ A;  1Y4C A;  3RLF E;  3UOR A;  5L9S A;  1FTJ A;  2XX7 A;  3C35 A;  1UTH B;  1MY4 A;  3EPE A;  4X48 A;  4KQP A;  4OER A;  4FE8 A;  5DT6 A;  1LAF E;  1MPC A;  3R7X A;  5IAI A;  1JEU A;  1QVS A;  4X1D A;  3CFZ A;  5AA1 A;  1UTB B;  3D4G A;  4IY6 A;  2V84 A;  1IIW A;  2H5Y A;  3TZA A;  4GQO A;  2GHA A;  1SI1 A;  1MM6 A;  2QMX A;  5FHO A;  4XTC Q;  5I57 B;  4KR5 A;  3TCG A;  3SEX A;  4F2Q A;  2ZNU A;  5KZT A;  1B7Z A;  3EQ1 A;  3QUJ A;  2AL5 A;  3T66 A;  3S4U A;  1QKB A;  4FED A;  4O3C A;  2XD2 A;  3G3K A;  2NXO A;  2DE4 A;  4RXL A;  3MZ9 A;  4EDP A;  5JEI A;  4GXS B;  4QHQ A;  4QFO A;  3FJ7 A;  4K3F A;  4H8I A;  3USD A;  1TWY A;  1EU8 A;  4FAJ A;  1TFA A;  2V3T A;  3L6G A;  2GHB A;  5CRY A;  4I8C A;  4Q5T A;  4MLV A;  1SW5 A;  4JBZ A;  4H0W A;  2O7U A;  4R9F A;  1JNF A;  2XD3 A;  2FNC A;  2XXP A;  1A40 A;  4M4G A;  3CI8 A;  1B58 A;  4Q0C A;  1CE2 A;  3IB2 A;  1LFG A;  3V8X B;  4DE8 A;  2F78 A;  3M3L A;  4G8N A;  1Y3P A;  3SEW A;  2M8C A;  4C0R A;  4OZ9 A;  1DSN A;  4GL8 A;  4KHZ E;  3QIM A;  1AMF A;  4NF6 A;  4YKI A;  4EF1 A;  2ESN A;  4PQJ A;  1B9J A;  3U1O A;  4ONY A;  3H06 B;  1URG A;  2XXR A;  5CMB A;  3HO7 A;  4MF3 A;  3UK4 A;  5TP9 A;  3ONM A;  1ZLQ A;  4U2R A;  1FTO A;  4KCD A;  4H5F A;  4RA1 A;  4DXU A;  4U1O A;  3TOD A;  1O63 A;  1LGB C;  3OEK A;  4F3P A;  1B0H A;  2RC9 A;  2I4B A;  2V3U A;  1L5T A;  4EF2 A;  3T9V A;  3TQW A;  5ICQ A;  2ONR A;  4YMA A;  5TPA A;  3DM0 A;  1LST A;  3U92 A;  3RT6 B;  3RNN A;  4FIM A;  4ZEC A;  3MW0 A;  1BP5 A;  1IIT A;  1LAH E;  3KN7 A;  3FAS A;  2I6E A;  4DDD A;  2H99 A;  4OET A;  1UIV A;  2HZL A;  3IB0 A;  2OK2 A;  4THI A;  4I9D A;  2PX1 A;  1JQF A;  4NWC A;  2QJE A;  4QFL A;  1YCJ A;  4OHN A;  2XX9 A;  3OEL A;  1ZBM A;  3HCQ A;  2D5W A;  4BDM A;  4YIC A;  3VE1 B;  3KJT A;  1HSL A;  5K2Y A;  3QUF A;  4GWO A;  5TU0 A;  3GBA A;  3MUQ A;  2OCU A;  5A5X A;  2W7Y A;  3A3C A;  2PT2 A;  2Z22 A;  4DLD A;  2O1M A;  4WXJ A;  4JWY A;  1H44 A;  1Z7N E;  3VVD A;  1QKA A;  2XXY A;  3CSB A;  4JSO A;  3MC2 A;  1M5B A;  3IOU A;  2NVU B;  1SW1 A;  2RKM A;  5J1D A;  1N0T A;  2Q88 A;  3JYR A;  3RN8 A;  1WDN A;  3HHF A;  2E0S A;  5DEX A;  5F1Q A;  4FJP A;  1B46 A;  3HST A;  1N76 A;  2DWH A;  3KOS A;  2PBW A;  3PV0 E;  5H8N B;  3UP9 A;  5AE4 A;  4G2Z A;  2OZZ A;  1B3H A;  3OO6 A;  1POT A;  2ANJ A;  3TDJ A;  1AH5 A;  3MVY A;  1B51 A;  5CI5 A;  3QXM A;  2I3W A;  1MXU A;  4NF8 A;  1UQW A;  1IXH A;  3ILU B;  1BLF A;  4EXK A;  2P0S A;  1XHY A;  1MXZ A;  1SYH A;  1EH3 A;  4PP0 A;  4ZDM A;  3H03 A;  2ALU A;  4YAH X;  1DTZ A;  4C1T A;  1UTH A;  5AA2 B;  4RY1 A;  3LC8 A;  3FV2 A;  1QUK A;  4ELP A;  3O66 A;  3H6V A;  4OES A;  3A3U A;  2DSF A;  5I2N A;  2CZL A;  2IA4 A;  3R6U A;  3OD7 A;  2THI A;  4QRZ A;  4GIZ A;  3HPI A;  3LSW A;  2ZYK A;  5CBR A;  3MWB A;  1P99 A;  5I57 A;  2ZYO A;  3SEY A;  3O6I A;  3KBR A;  4F22 A;  2YPN A;  3UN6 A;  3KGC A;  4U4X A;  1B6H A;  4I1D A;  4YKK A;  2DVC A;  3Q26 A;  5TPA B;  5K2X A;  2PVU A;  4F3G A;  3C32 A;  1B0L A;  4ZEF A;  1LBC A;  4PFW A;  3C33 A;  4BDR A;  3QYT A;  3Q29 A;  4GFR A;  2Z8F A;  1N7W A;  2QS3 A;  3G3H A;  3T9U A;  1R9Q A;  2F7B A;  3OEN A;  3KJ7 A;  4NWD A;  4U23 A;  2H98 A;  2RF1 A;  3TTR A;  1MQJ A;  1TT1 A;  4PET A;  1FQD A;  3IX1 A;  4LZ7 A;  3EHU A;  1JET A;  3RY3 A;  2D3I A;  4ZZE A;  3BFT A;  3IO4 A;  2H4I A;  3FD3 A;  3RTF B;  1VFD A;  2F6G A;  3KEI A;  4Q8R A;  3N6U A;  3K6W A;  4YMB A;  3CFX A;  1US4 A;  4G77 A;  3E4R A;  3JV9 A;  4E0X A;  4WEP A;  4GOT A;  3IK6 B;  1QUL A;  4KCC A;  3C9H A;  3QSL A;  1NKX A;  3CG3 A;  1FW0 A;  1HSE A;  1MY0 A;  3OSR A;  3OO8 A;  3W15 C;  1MDQ A;  4GLI A;  3PUX E;  4H6D A;  1H3D A;  1QW0 A;  1PB9 A;  2Z23 A;  2HCA A;  1UIU A;  1SYI A;  1MQD A;  4EXL A;  1NFT A;  1D9Y A;  1OQH A;  3TQL A;  1SBP A;  3FGS A;  4P0I A;  2OJT A;  5ISU A;  4LQ5 A;  1H76 A;  4KYE A;  3G7W A;  1IXC A;  4GL0 A;  3FVK A;  4OEU A;  3UGW A;  4OEN A;  3S9E A;  3HN0 A;  4NTL A;  4EQB A;  4LON B;  4QFN A;  1Y1Z A;  2XHD A;  1JVY A;  4GVO A;  4AB5 A;  2PT1 A;  2B65 A;  3K01 A;  2FYI A;  2Q8J A;  3PU5 A;  2ONK E;  4YB7 A;  1DPP A;  4ZEI A;  2Q9T A;  2GRV A;  1HSJ A;  1SVX B;  5CM6 A;  2O1L A;  3DP4 A;  3V89 B;  5JTY B;  4MBP A;  4JB7 A;  5KCJ B;  1P1U A;  5I2N B;  3MPK A;  1PBQ A;  5H8S A;  3HV1 A;  1AOV A;  3FUZ A;  1IEJ A;  3IOV A;  4LA9 A;  1JW4 A;  2PYY A;  2KLF A;  5FTH A;  1NNF A;  3BKI B;  5ICT A;  2Y7I A;  4OYV A;  1I6B A;  1EZO A;  1FTL A;  1BIY A;  3PPN A;  1T0K A;  1USY H;  3ODB A;  1OLC A;  2QPQ A;  2DWJ A;  3K6X A;  3B6T A;  3MBP A;  1Y4T A;  1URD A;  3FXU A;  5H8N A;  5BUU A;  3H3G A;  3O28 A;  1MPB A;  2DE3 A;  4FOR A;  3VDF A;  1LCT A;  3M3K A;  4R6Y A;  3K4U A;  4QSE A;  2QRY A;  1NNK A;  4YU0 A;  4DIG A;  3HHG A;  3G3F A;  2F7A A;  3GXA A;  1LLS A;  4KPT A;  4G4P A;  4ECF A;  2G93 A;  1SI0 A;  3MZB A;  1RYO A;  5AA3 A;  3MPL A;  1MG1 A;  4P0G A;  4LAT A;  4ELR A;  4WED A;  5HM4 B;  3FV1 A;  3CFL A;  1B3F A;  4TOZ A;  4TQU Q;  3TMG A;  1GVC A;  1I6Q A;  5AA2 A;  3LSF B;  2RC8 A;  4OEV A;  2QS2 A;  4G8M A;  3EHT A;  3PUW E;  2Z8E A;  3MAM A;  3CVG A;  1MDP 1;  3PMW A;  2ZNT A;  3BFU A;  2F36 A;  3C36 A;  4EQ7 A;  5AA4 A;  4I62 A;  4F2O A;  1N04 A;  3W9W A;  2DWI A;  2V25 A;  2Y7P A;  3OO7 A;  2YLN A;  4POX A;  5HPQ A;  1OVT A;  2DS9 A;  1FQE A;  4XKQ A;  3PMX A;  4ZZA A;  3T96 B;  2O68 A; 
#chains in the Genus database with same CATH topology
 4JXI A;  1GGG A;  3ZS6 A;  1MS7 A;  4NF5 B;  2BJJ X;  3SKP A;  1IXI A;  5B70 A;  3IL1 B;  4GX4 A;  2IEE A;  1M5E A;  1D4N A;  3TTM A;  4ZED A;  3HFU A;  2Q8M A;  3TCH A;  3G3G A;  1YTV A;  5JK4 A;  1FTM A;  1B7H A;  1NV0 A;  4FAT A;  3EKI A;  3H6U A;  3M3F A;  5F24 A;  4HTG A;  2I3V A;  3B6W A;  1P1O A;  3RTW B;  4U21 A;  2Q74 A;  1II5 A;  2OBG A;  4IO3 A;  1SQY A;  4AB6 A;  3KSX A;  3KOT A;  4OFO A;  3FVN A;  4DCX A;  2XXI A;  4FEB A;  3FVG A;  1SDX A;  4QSC A;  2I49 A;  3IAZ A;  2WBB A;  1BTJ A;  3PPO A;  1MQI A;  5DVI A;  1Y20 A;  1LEV A;  5CBS A;  4GWZ A;  4LZ8 A;  4IO2 A;  1AWB A;  3LUY A;  1IQ7 A;  4MX6 A;  2HEU A;  2NWJ A;  4MH5 A;  4PGN A;  5DW8 A;  1FTK A;  4DCY A;  1A99 A;  4YKP A;  3R26 A;  3FXR A;  3VLU A;  2B4M A;  5FTI A;  3G3J A;  3RPW A;  4IGR A;  4PC9 A;  2PFZ A;  1ZTY A;  3LR1 A;  1FJ9 A;  1IUD A;  3C4M A;  4G8H A;  4KXP A;  2ZZW A;  1VSO A;  2XXH A;  3K1P A;  4QBA A;  3ILT B;  4EUO A;  1Q1K A;  3E13 X;  3PPP A;  4F18 A;  5KDT B;  5I58 B;  3MVX A;  4ZEK A;  1M5F A;  2Q2C A;  3ISP A;  4GBW A;  1JW5 A;  3PGF A;  4M1V A;  4F3S A;  1WVJ A;  2HXR A;  3KSJ A;  4ELO A;  2R9J A;  1B5I A;  1XC1 A;  1RKM A;  4F3B A;  4RPO A;  1RDZ A;  1Y3N A;  2F6P A;  5L9M A;  5DTB A;  4OTE A;  2H9B A;  2P2A A;  4GWY A;  4XKP A;  3TYH A;  5JTY A;  3UIF A;  1SPI A;  2XXV A;  3SEV A;  5KCJ A;  1JVX A;  4IB2 A;  1Y3Q A;  1NUX A;  3I5O A;  4TLL B;  3MVW A;  5FHN A;  2B4L A;  3H6T A;  1LAG E;  4GRK A;  1JW1 A;  1R9L A;  5B7D A;  3MP6 A;  1MXX A;  2I0B A;  4N07 A;  3O2A A;  3CG1 A;  5AA4 B;  3MP1 A;  3T9H B;  2XX8 A;  3TCF A;  3V83 A;  3S2V A;  4N15 A;  5H8H B;  3MP8 A;  1MPD A;  4OVJ A;  1FQF A;  4HS7 A;  1B5H A;  4XXU A;  1B3L A;  2RC7 A;  3AXF A;  4PE5 B;  1MXV A;  1J1N A;  1DOT A;  4P1L A;  4MFI A;  2JJK A;  1B1X A;  3P7I A;  4PFY A;  5HBC A;  5EYF A;  3E9X A;  3ECR A;  4X9T A;  4PFT A;  2UVJ A;  1CB6 A;  1LBW A;  3MST A;  3T93 B;  3MVZ A;  2XWV A;  1RDY A;  1N3X A;  2AYS A;  3VXC A;  1S9T A;  4GF8 A;  3S9L C;  3EN3 A;  1YPN A;  2A5T B;  1LBZ A;  4MNP A;  2QL3 A;  2F3B A;  4BLA A;  4N13 A;  2O51 A;  4F31 B;  2KQZ A;  3EF7 A;  5I3S A;  4YKJ A;  4U1Z A;  1P1Q A;  4ZE8 A;  4OVS A;  1FCK A;  3U94 A;  4Z7E A;  3KN3 A;  1MM7 A;  4HCY A;  4OXV A;  2Y84 A;  4BDL A;  2V4C A;  1NV3 A;  3ROJ A;  3DP6 A;  3Q28 A;  1NH7 A;  3TEL A;  2NUV A;  1LAX A;  1NUY A;  3G3I A;  4IO7 A;  3OSQ A;  4LP2 B;  1LBY A;  3KFM A;  1MY1 A;  3TTL A;  4P8B A;  1WOD A;  4RPN A;  1VDW A;  1S7Y A;  3KBZ A;  2FHY A;  2XWO A;  3QMF A;  2UYF A;  1NMU A;  5IGA A;  1EZP A;  3TUS A;  4OQO A;  5IZ1 A;  3RGY A;  4NMY A;  5ITP A;  2P1S A;  4QSD A;  1A8E A;  4KD5 A;  2I48 A;  3RUM A;  3WAF A;  1KA1 A;  2XXT A;  1YAE A;  4NF5 A;  1DPE A;  1B52 A;  4IY5 A;  4G68 B;  1FBF A;  1A8F A;  1B2H A;  1B3G A;  4N81 A;  1DTG A;  2XXQ A;  1FQB A;  5H8F B;  4NED A;  3PUZ E;  5ITO A;  3H7M A;  2QS4 A;  2R6G E;  5EQA A;  1VE4 A;  2FBP A;  2QVV A;  4BDN A;  4NF4 A;  2B3F A;  5H8Q B;  4F1Y A;  4N6P A;  4PAF A;  2HQ0 A;  5CMC A;  1A7L A;  2DP8 A;  1OLA A;  4ISU A;  5ET5 A;  4MIJ A;  4ELQ A;  2F35 A;  4TLM B;  3TAJ A;  4PBQ A;  2O84 X;  3IFC A;  3FVO A;  3ZKL A;  2OLB A;  1IXG A;  2QVR A;  1ZJL A;  3ZSF A;  3SET A;  5CMM A;  3RT8 A;  3K1N A;  4PFU A;  4OFJ A;  1PDA A;  3CSG A;  3Q25 A;  3OMB A;  4X1B A;  1P1N A;  1B5J A;  3TEP A;  5FHM A;  2PCR A;  3SER A;  4MCO A;  3KG2 A;  1H45 A;  1FPE A;  3D4C A;  3DP8 A;  4PCD A;  4R6K A;  1LFI A;  1XI6 A;  1VFE A;  4IO6 A;  4N6D A;  2WKY A;  1B05 A;  1XVY A;  2RCB A;  2ZYM A;  1TXF A;  1Z7M E;  3OXN A;  3OOA A;  1FPF A;  1NV6 A;  3Q27 A;  1ZMG A;  5DVF A;  1R6Z A;  2DWA A;  4P11 A;  4ESW A;  1RYX A;  2HZK A;  3VLW A;  2DOJ A;  4QF9 A;  2HFB A;  3FZV A;  2VHA A;  2OWS A;  4PBH A;  4ESX A;  2OX3 A;  3VFJ A;  1ZKB A;  4H67 A;  3ZKK A;  2ABH A;  3O97 A;  3GLB A;  1SW2 A;  3S9N C;  2L5V A;  2P3V A;  2ZYN A;  4WKM A;  3QAX A;  3U65 A;  5ELV A;  1MH3 A;  1NV1 A;  2ZMB A;  4ND9 A;  5A5L A;  5I56 B;  5IZ3 A;  4POW A;  5KDT A;  4R9G A;  5I58 A;  4GWW A;  4KI0 E;  4BDQ A;  3OO9 A;  1IMC A;  3K2D A;  1NH8 A;  4MEV A;  4GX3 A;  3DLN A;  4O3A A;  3B7D A;  4LZ5 A;  1O64 A;  3C31 A;  1POY 1;  3M8U A;  4DXC A;  4PFB A;  2VD3 A;  4QFP A;  4RK9 A;  3MJN A;  4F29 A;  2RCA A;  4KYD A;  3L6H A;  1B32 A;  3TTK A;  3IOT A;  2Q89 A;  3GZG A;  2D21 A;  1P1W A;  4QFK A;  4LQ2 A;  1TFD A;  3GBB A;  3LBS A;  3TTN A;  4JWO A;  2X26 A;  1QUJ A;  1XVX A;  1FBP A;  2REG A;  2XXW A;  3U93 A;  1B40 A;  2CMO A;  2X7Q A;  4O3B A;  4RNS A;  4H5G A;  1USY E;  2DXY A;  1FPJ A;  2I58 A;  2UXA A;  1LBX A;  2ZXT A;  5CMK A;  3IB1 A;  4YB6 A;  3BIG A;  3K6U A;  2I4C A;  3SES A;  5DVJ A;  1MQG A;  1SW4 A;  5H8H A;  2FIX A;  3N94 A;  3FJM A;  5EYH A;  3RQT A;  5L9O A;  2KR0 A;  1A54 A;  3H4Z A;  4JVD A;  4E0W A;  3OEM A;  3E78 A;  3IO6 A;  4HE2 A;  1PEB A;  4R2B A;  2Y7W A;  3N26 A;  3CRB A;  4HCW A;  4P47 A;  3IR1 A;  4RYA A;  2ZNS A;  5EYG A;  2H25 A;  1GTK A;  3IOR A;  3PUV E;  2F34 A;  3THI A;  3MZ1 A;  1NV5 A;  2B3B A;  3I6V A;  5I59 B;  1A55 A;  4ZS9 A;  4OVP A;  4NF4 B;  2XXU A;  3O6G A;  1QUI A;  3FBP A;  3MQ9 A;  4HE1 A;  3SDF A;  3PD8 A;  1B4H A;  1N84 A;  3PD9 A;  4PF6 A;  1PBP A;  1MH4 A;  4F39 A;  4AS5 A;  1KA0 A;  4DXB A;  1PB7 A;  1GR2 A;  2A5T A;  1CNQ A;  2F8D A;  2V3Q A;  3PMV A;  1B1H A;  2VGQ A;  5DYH A;  2CZI A;  1LCF A;  4FEC A;  1EZ9 A;  4JDF A;  2PFY A;  2WYK A;  2LAO A;  1QGX A;  2WBD A;  3PUY E;  5IZZ A;  5I7I A;  3O29 A;  2PMS A;  2V93 A;  5LTC A;  1AIV A;  3I3V A;  5CC2 A;  5L8D A;  1ELJ A;  1LBB A;  2VPO A;  1F9B A;  3K1M A;  2HAV A;  1PB8 A;  3FJG A;  4GBV A;  4R2F A;  2RIN A;  4OFL A;  4R73 A;  2FVZ A;  3O9P A;  1R1N A;  3VXB A;  4PAI A;  1MY3 A;  5I84 A;  2DXR A;  4BDO A;  4UA8 A;  3T9X B;  2O7I A;  5M2V A;  4F1U A;  5I2K A;  4PGP A;  2DQV A;  3B8B A;  2VOZ A;  1XS5 A;  1LBV A;  1OQG A;  4R72 A;  1Q9D A;  2ONS A;  2I0C A;  3KZG A;  2VD2 A;  4G68 A;  1EYJ A;  2GFE A;  2O69 A;  5IZ3 B;  2AIX A;  3T1B A;  4NHB A;  3C34 A;  3LV0 A;  4IGT A;  5H8F A;  1NNP A;  1D3K A;  4H8J A;  2R8T A;  3K6V A;  4DI3 D;  5BWJ A;  1JEV A;  5H8Q A;  1LB9 A;  1US5 A;  4Z0I A;  1AL3 A;  3SZP A;  3A09 A;  1S50 A;  2FA7 A;  1ZU0 A;  3V5A A;  4MLQ A;  4R75 A;  3K02 A;  2WX9 A;  2QS1 A;  4F19 A;  2AL4 A;  1FQA A;  3PPR A;  2QMW A;  1NL5 A;  4Q30 B;  1YXI A;  1PC3 A;  3BBR A;  3WAE A;  4AQ4 A;  2X7P A;  1NUZ A;  3VV5 A;  5LOM A;  1URS A;  1B7U A;  4UAC A;  2DE2 A;  2UVH A;  1IZ1 A;  3VVF A;  4HW8 A;  1MXY A;  1FTA A;  3KN8 A;  2UVG A;  2NOO A;  1N3W A;  3D1R A;  4DZ1 A;  1UTB A;  4NF6 B;  1XT8 A;  2VPN A;  1M5C A;  5EHS A;  3TFL A;  4R6H A;  1YZ0 A;  4DI4 B;  4GWU A;  3N6T A;  4C1U A;  5TP9 B;  4GD5 A;  1VR5 A;  4XIG Q;  3IOW A;  3LSL A;  4NE4 A;  4IO4 A;  1DBZ A;  1O7T A;  3FAT A;  1B3E A;  1OVB A;  5F7V A;  3LSX A;  1RDX A;  5AA2 D;  4F1V A;  3A29 A;  2DVZ A;  3DEL B;  1NV7 A;  1LB8 A;  2QSX A;  4I3Y A;  3TPA A;  4MMP A;  1Y1M A;  2R71 A;  1G0I A;  4PE3 A;  5EQ9 A;  4NX1 A;  1FBD A;  1MXW A;  2A5S A;  5EQ8 A;  5I56 A;  1FSA A;  1XOC A;  3IJO B;  2YJP A;  4RJZ A;  3VLV A;  1SD3 A;  1BKA A;  4YZZ A;  2Y5L A;  3FIR A;  1H43 A;  3CIJ A;  3VVE A;  1DMB A;  4U4S A;  4YB5 A;  1QJM A;  4OWD A;  2VP1 A;  4L17 A;  2GQ1 A;  2CEX A;  3CR9 A;  2XXX A;  3IJX B;  1NNT A;  4R74 A;  1MY2 A;  4LUB A;  3H6W A;  4H1X A;  1ANF A;  4KYS A;  1B4Z A;  1FQC A;  3K0V A;  2O6A A;  2REJ A;  4IO5 A;  4OMB A;  4XKR A;  1OMP A;  4X04 A;  1N7X A;  3EHS A;  3W9V A;  2QFL A;  3NOH A;  5A5X B;  1GV8 A;  4PTK A;  3UA8 A;  4JSD A;  3F11 A;  1MRP A;  5EHM A;  1M5D A;  3E3K A;  3U72 A;  3E79 A;  2Y7K A;  3B6Q A;  4EQ9 A;  4ZE9 A;  2DDK A;  2F7C A;  1I6A A;  2VT5 A;  4H65 A;  1FPG A;  3TKD A;  3QK6 A;  1MQH A;  2G29 A;  1Y9U A;  5I2K B;  3T22 A;  1D9V A;  1I69 A;  1ATG A;  1KWH A;  2OWT A;  2Y7R A;  2Q2A A;  5DEX B;  1Q35 A;  1FBC A;  3U8Q A;  1LFH A;  1NUW A;  4RK2 A;  4G68 C;  4KFQ A;  4GX6 A;  3PPQ A;  3O6H A;  2F97 A;  2UYE A;  2GH9 A;  4U22 A;  2F3D A;  3K00 A;  5I59 A;  3KC1 A;  4GXA A;  4P9K A;  4XKN A;  3S9M C;  4N8Y A;  4ZEB A;  4NF8 B;  4LVQ A;  2E1S A;  4NGU A;  4OVQ A;  2DYX A;  2F5X A;  5IKB A;  2UVI A;  1ZIU A;  3SEU A;  2HXW A;  3N5L A;  2HAU A;  3JZJ A;  2Z8D A;  4JWX A;  2XXK A;  1OIB A;  3FXQ A;  1Y4C A;  3RLF E;  3UOR A;  5L9S A;  1FTJ A;  2XX7 A;  3C35 A;  1UTH B;  1MY4 A;  3EPE A;  4X48 A;  4N6K A;  4KQP A;  4OER A;  1K9Z A;  4FE8 A;  5DT6 A;  1LAF E;  1MPC A;  5IM2 A;  3R7X A;  5IAI A;  1JEU A;  1QVS A;  4X1D A;  1JP4 A;  3CFZ A;  5AA1 A;  1UTB B;  4NF0 A;  3D4G A;  4IY6 A;  2V84 A;  4NAP A;  1IIW A;  1IMD A;  2H5Y A;  4PFR A;  3TZA A;  2ZZV A;  4GQO A;  2GHA A;  1SI1 A;  1MM6 A;  2QMX A;  5FHO A;  4XTC Q;  5I57 B;  2FIE A;  4KR5 A;  1IME A;  3TCG A;  3SEX A;  2CEY A;  4F2Q A;  2ZNU A;  5KZT A;  1B7Z A;  3EQ1 A;  4PF8 A;  3QUJ A;  4OAN A;  2XA5 A;  2AL5 A;  3T66 A;  3S4U A;  3T0J A;  1QKB A;  4FED A;  4O3C A;  5LDZ A;  2XD2 A;  3G3K A;  2NXO A;  2DE4 A;  3IFA A;  1FPK A;  4RXL A;  3GYY A;  3MZ9 A;  4XFE A;  4EDP A;  5JEI A;  4GXS B;  3MYU A;  4QHQ A;  1EYI A;  4QXD A;  4QFO A;  3FJ7 A;  4K3F A;  4H8I A;  4H45 A;  3USD A;  1TWY A;  1EU8 A;  4FAJ A;  1TFA A;  2V3T A;  1FPL A;  3L6G A;  2GHB A;  5CRY A;  4I8C A;  4Q5T A;  4MLV A;  1SW5 A;  4JBZ A;  4H0W A;  2O7U A;  4R9F A;  1JNF A;  2XD3 A;  2FNC A;  2XXP A;  3RPL B;  1YYZ A;  1A40 A;  4M4G A;  3CI8 A;  1B58 A;  4Q0C A;  1CE2 A;  3IB2 A;  1LFG A;  3V8X B;  1DCU A;  4FBP A;  4DE8 A;  2F78 A;  3M3L A;  4G8N A;  1Y3P A;  3SEW A;  2M8C A;  4C0R A;  4OZ9 A;  3B50 A;  1DSN A;  4GL8 A;  4KHZ E;  3QIM A;  1AMF A;  4NF6 A;  4YKI A;  4EF1 A;  2ESN A;  4JVC A;  4PQJ A;  1B9J A;  3U1O A;  4ONY A;  3H06 B;  1URG A;  2XXR A;  5CMB A;  3HO7 A;  2ZZX A;  4MF3 A;  4N91 A;  3UK4 A;  5TP9 A;  3ONM A;  1ZLQ A;  4U2R A;  1FTO A;  4KCD A;  4H5F A;  4RA1 A;  4DXU A;  4PDD A;  4U1O A;  4MNC A;  3TOD A;  1O63 A;  1LGB C;  3OEK A;  4F3P A;  1B0H A;  2RC9 A;  2I4B A;  2V3U A;  4PAK A;  1L5T A;  4EF2 A;  3T9V A;  3TQW A;  5ICQ A;  2ONR A;  4YMA A;  5TPA A;  3DM0 A;  4MJO A;  1LST A;  3U92 A;  3RT6 B;  3RNN A;  4FIM A;  4ZEC A;  3MW0 A;  1BP5 A;  1IIT A;  1LAH E;  5EQ7 A;  5FBP A;  3KN7 A;  4O7I A;  3FAS A;  2I6E A;  4DDD A;  2H99 A;  4OET A;  1UIV A;  2HZL A;  3IB0 A;  2OK2 A;  4GWS A;  4I3E A;  4THI A;  4I9D A;  2PX1 A;  1JQF A;  4NWC A;  2QJE A;  4QFL A;  1IMA A;  1YCJ A;  4LN5 A;  4OHN A;  2XX9 A;  3OEL A;  2HPG A;  1ZBM A;  3HCQ A;  2D5W A;  4BDM A;  4YIC A;  3VE1 B;  3KJT A;  1HSL A;  3QUF A;  4GWO A;  4IR8 A;  5K2Y A;  5TU0 A;  1DK4 A;  3GBA A;  3MUQ A;  2OCU A;  5A5X A;  1FBG A;  2W7Y A;  3A3C A;  2PT2 A;  2Z22 A;  4DLD A;  2O1M A;  4WXJ A;  4JWY A;  1H44 A;  5ET6 A;  1Z7N E;  2WYP A;  3LUZ A;  3VVD A;  1FJ6 A;  1QKA A;  2XXY A;  2XWK A;  3CSB A;  4JSO A;  3MC2 A;  1M5B A;  3IOU A;  4P3L A;  2NVU B;  1SW1 A;  4O8M A;  2RKM A;  5J1D A;  1N0T A;  2Q88 A;  3JYR A;  4OVT A;  3RN8 A;  1WDN A;  3HHF A;  2E0S A;  5DEX A;  5F1Q A;  4FJP A;  1B46 A;  3HST A;  3RYD A;  4N17 A;  1N76 A;  2DWH A;  3KOS A;  1FPD A;  1IMF A;  2PBW A;  3PV0 E;  5H8N B;  3UP9 A;  5AE4 A;  4G2Z A;  2OZZ A;  4PDH A;  1B3H A;  3OO6 A;  1POT A;  2ANJ A;  3TDJ A;  1AH5 A;  3MVY A;  1B51 A;  5CI5 A;  3QXM A;  2I3W A;  1MXU A;  4NF8 A;  4O94 A;  1UQW A;  4P56 A;  1IXH A;  3ILU B;  1BLF A;  4EXK A;  2P0S A;  2WEF A;  1XHY A;  1MXZ A;  1SYH A;  1EH3 A;  1EYK A;  4PP0 A;  4ZDM A;  3H03 A;  2ALU A;  4H46 A;  4YAH X;  1NV2 A;  1FBH A;  1DTZ A;  4C1T A;  1UTH A;  5AA2 B;  4RY1 A;  3LC8 A;  3CHG A;  4MHF A;  3FV2 A;  4G61 A;  1D9Q A;  1QUK A;  4ELP A;  3O66 A;  3H6V A;  4NG7 A;  4OES A;  3A3U A;  2DSF A;  5I2N A;  4JVI A;  2CZL A;  2IA4 A;  3R6U A;  3OD7 A;  2THI A;  4QRZ A;  4GIZ A;  4MNI A;  3HPI A;  3LSW A;  2ZYK A;  5CBR A;  2XWI A;  3MWB A;  4NQ8 A;  1P99 A;  5I57 A;  2ZYO A;  3SEY A;  3O6I A;  4HXV A;  3KBR A;  4F22 A;  2YPN A;  3UN6 A;  3KGC A;  4U4X A;  1B6H A;  4I1D A;  4YKK A;  2DVC A;  3Q26 A;  5ET8 A;  5TPA B;  5K2X A;  2PVU A;  4F3G A;  3C32 A;  1B0L A;  4ZEF A;  1LBC A;  4PFW A;  3C33 A;  4BDR A;  3QYT A;  3Q29 A;  4GFR A;  2Z8F A;  1N7W A;  2QS3 A;  3G3H A;  3T9U A;  1R9Q A;  2F7B A;  3OEN A;  5J16 A;  3KJ7 A;  4NWD A;  4U23 A;  2H98 A;  2RF1 A;  3TTR A;  1MQJ A;  1TT1 A;  4HE0 A;  4PET A;  1KZ8 A;  1FQD A;  3IX1 A;  4LZ7 A;  3EHU A;  1JET A;  3RY3 A;  2D3I A;  4ZZE A;  4GWX A;  3BFT A;  3RPL A;  4XEQ A;  3IO4 A;  2H4I A;  3FD3 A;  3RTF B;  1VFD A;  2F6G A;  3KEI A;  4Q8R A;  3N6U A;  3K6W A;  4YMB A;  3CFX A;  4OA4 A;  5ESY A;  1US4 A;  4G77 A;  3E4R A;  3JV9 A;  4E0X A;  4WEP A;  4GOT A;  3IK6 B;  1FPI A;  1QUL A;  4KCC A;  3C9H A;  3QSL A;  1NKX A;  3CG3 A;  1FW0 A;  1HSE A;  1MY0 A;  3OSR A;  3OO8 A;  3W15 C;  1MDQ A;  4GLI A;  3PUX E;  1INP A;  4H6D A;  1H3D A;  1QW0 A;  1PB9 A;  2Z23 A;  2HCA A;  1UIU A;  1SYI A;  1MQD A;  4EXL A;  1NFT A;  1D9Y A;  1OQH A;  3TQL A;  1SBP A;  3FGS A;  4P0I A;  2OJT A;  5ISU A;  4LQ5 A;  3PTY A;  1H76 A;  4KYE A;  3G7W A;  1IXC A;  4GL0 A;  3FVK A;  4OEU A;  3BIH A;  3UGW A;  4OEN A;  3S9E A;  3HN0 A;  4NTL A;  4EQB A;  4LON B;  4QFN A;  4GVO A;  1Y1Z A;  1JVY A;  2XHD A;  4AB5 A;  2PT1 A;  2B65 A;  3K01 A;  2FYI A;  2Q8J A;  3PU5 A;  2ONK E;  4YB7 A;  1DPP A;  4ZEI A;  2Q9T A;  2GRV A;  1HSJ A;  1SVX B;  5CM6 A;  2O1L A;  3DP4 A;  1K9Y A;  5T3J A;  3V89 B;  4X8R A;  5JTY B;  4MBP A;  4N8G A;  2P3N A;  4JB7 A;  5KCJ B;  1P1U A;  5I2N B;  2HHM A;  3MPK A;  1PBQ A;  5H8S A;  3HV1 A;  1AOV A;  3FUZ A;  3KC0 A;  1IEJ A;  3IOV A;  4LA9 A;  1JW4 A;  4O7M A;  2PYY A;  1FPB A;  4UAB A;  2KLF A;  5FTH A;  1NNF A;  3BKI B;  5ICT A;  2Y7I A;  2Y5K A;  4OYV A;  1I6B A;  1BK4 A;  1FRP A;  1EZO A;  1FTL A;  1BIY A;  1NI9 A;  3PPN A;  1T0K A;  1USY H;  3ODB A;  1OLC A;  2QPQ A;  2DWJ A;  3K6X A;  3B6T A;  3MBP A;  1Y4T A;  1URD A;  4XF5 A;  3FXU A;  5H8N A;  5BUU A;  3H3G A;  3O28 A;  1MPB A;  2DE3 A;  4FOR A;  3VDF A;  1LCT A;  3M3K A;  4R6Y A;  5ET7 A;  3K4U A;  4QSE A;  2QRY A;  1NNK A;  4YU0 A;  4DIG A;  3HHG A;  3G3F A;  2F7A A;  3GXA A;  1LLS A;  4KPT A;  4G4P A;  3FXB A;  4ECF A;  5I5P A;  1NV4 A;  2G93 A;  1SI0 A;  3MZB A;  1RYO A;  5AA3 A;  3MPL A;  1MG1 A;  4P0G A;  4LAT A;  4ELR A;  4WED A;  5HM4 B;  3FV1 A;  3CFL A;  2CZH A;  1B3F A;  4TOZ A;  4TQU Q;  3TMG A;  4MAG A;  1G0H A;  4I40 A;  1GVC A;  1I6Q A;  5AA2 A;  4PFI A;  3LSF B;  2RC8 A;  4OEV A;  4AS4 A;  4N4U A;  1FBE A;  2QS2 A;  4G8M A;  3EHT A;  3PUW E;  2Z8E A;  3MAM A;  3CVG A;  2CZK A;  1MDP 1;  3PMW A;  2ZNT A;  3BFU A;  4OVR A;  2OWZ A;  2F36 A;  3C36 A;  4EQ7 A;  5AA4 A;  4I62 A;  1IMB A;  4P1E A;  4F2O A;  1N04 A;  3W9W A;  2DWI A;  2V25 A;  2MKZ A;  2Y7P A;  3OO7 A;  2YLN A;  4POX A;  4NN3 A;  5HPQ A;  1OVT A;  2QVU A;  2DS9 A;  1FQE A;  2BJI A;  4XKQ A;  3PMX A;  4ZZA A;  3T96 B;  2O68 A; 
#chains in the Genus database with same CATH homology
 4JXI A;  1GGG A;  3ZS6 A;  1MS7 A;  4NF5 B;  2BJJ X;  3SKP A;  1IXI A;  5B70 A;  3IL1 B;  2IEE A;  1M5E A;  1D4N A;  3TTM A;  4ZED A;  3TCH A;  3G3G A;  1YTV A;  5JK4 A;  1FTM A;  1B7H A;  4FAT A;  3H6U A;  3M3F A;  4HTG A;  2I3V A;  3B6W A;  1P1O A;  3RTW B;  4U21 A;  1II5 A;  2OBG A;  4IO3 A;  1SQY A;  4AB6 A;  3KSX A;  3KOT A;  4OFO A;  3FVN A;  4DCX A;  2XXI A;  4FEB A;  3FVG A;  1SDX A;  4QSC A;  2I49 A;  3IAZ A;  1BTJ A;  3PPO A;  1MQI A;  5DVI A;  1Y20 A;  5CBS A;  4LZ8 A;  4IO2 A;  3LUY A;  1IQ7 A;  2HEU A;  2NWJ A;  4MH5 A;  1FTK A;  4DCY A;  1A99 A;  4YKP A;  3R26 A;  3FXR A;  3VLU A;  5FTI A;  3G3J A;  3RPW A;  4IGR A;  1ZTY A;  3LR1 A;  1IUD A;  3C4M A;  4G8H A;  1VSO A;  2XXH A;  3K1P A;  3ILT B;  4EUO A;  1Q1K A;  3E13 X;  3PPP A;  4F18 A;  5KDT B;  5I58 B;  3MVX A;  4ZEK A;  1M5F A;  2Q2C A;  1JW5 A;  3PGF A;  4M1V A;  4F3S A;  1WVJ A;  3KSJ A;  4ELO A;  2R9J A;  1B5I A;  1XC1 A;  1RKM A;  4F3B A;  4RPO A;  1Y3N A;  2F6P A;  5L9M A;  5DTB A;  4OTE A;  2H9B A;  2P2A A;  4XKP A;  3TYH A;  5JTY A;  3UIF A;  2XXV A;  3SEV A;  5KCJ A;  1JVX A;  4IB2 A;  1Y3Q A;  3I5O A;  4TLL B;  3MVW A;  5FHN A;  3H6T A;  1LAG E;  4GRK A;  1JW1 A;  1R9L A;  5B7D A;  3MP6 A;  1MXX A;  2I0B A;  4N07 A;  3O2A A;  3CG1 A;  5AA4 B;  3MP1 A;  3T9H B;  2XX8 A;  3TCF A;  3V83 A;  3S2V A;  5H8H B;  3MP8 A;  1MPD A;  4OVJ A;  1FQF A;  4HS7 A;  1B5H A;  4XXU A;  1B3L A;  2RC7 A;  3AXF A;  4PE5 B;  1MXV A;  1J1N A;  1DOT A;  4MFI A;  1B1X A;  3P7I A;  4PFY A;  5HBC A;  5EYF A;  3E9X A;  3ECR A;  4X9T A;  4PFT A;  2UVJ A;  1CB6 A;  3T93 B;  3MVZ A;  1N3X A;  2AYS A;  3VXC A;  1S9T A;  4GF8 A;  3S9L C;  3EN3 A;  1YPN A;  2A5T B;  2QL3 A;  4BLA A;  4N13 A;  2O51 A;  4F31 B;  3EF7 A;  4YKJ A;  4U1Z A;  1P1Q A;  4ZE8 A;  1FCK A;  3U94 A;  4Z7E A;  3KN3 A;  1MM7 A;  4HCY A;  4OXV A;  2Y84 A;  4BDL A;  3DP6 A;  3Q28 A;  1NH7 A;  3TEL A;  2NUV A;  1LAX A;  3G3I A;  4IO7 A;  3OSQ A;  4LP2 B;  3KFM A;  1MY1 A;  3TTL A;  1WOD A;  4RPN A;  1S7Y A;  2UYF A;  1NMU A;  1EZP A;  3TUS A;  4OQO A;  3RGY A;  4NMY A;  5ITP A;  2P1S A;  4QSD A;  1A8E A;  4KD5 A;  2I48 A;  3RUM A;  3WAF A;  2XXT A;  1YAE A;  4NF5 A;  1DPE A;  1B52 A;  4IY5 A;  4G68 B;  1A8F A;  1B2H A;  1B3G A;  1DTG A;  2XXQ A;  1FQB A;  5H8F B;  4NED A;  3PUZ E;  5ITO A;  3H7M A;  2QS4 A;  2R6G E;  1VE4 A;  4BDN A;  4NF4 A;  2B3F A;  5H8Q B;  4F1Y A;  4N6P A;  2HQ0 A;  5CMC A;  1A7L A;  2DP8 A;  1OLA A;  4ISU A;  4ELQ A;  2F35 A;  4TLM B;  3TAJ A;  2O84 X;  3FVO A;  3ZKL A;  2OLB A;  1IXG A;  1ZJL A;  3ZSF A;  3SET A;  5CMM A;  3RT8 A;  3K1N A;  4PFU A;  4OFJ A;  1PDA A;  3CSG A;  3Q25 A;  4X1B A;  3OMB A;  1P1N A;  1B5J A;  3TEP A;  5FHM A;  3SER A;  3KG2 A;  1H45 A;  3D4C A;  3DP8 A;  4R6K A;  1LFI A;  1VFE A;  4IO6 A;  2WKY A;  1B05 A;  1XVY A;  2RCB A;  2ZYM A;  1TXF A;  1Z7M E;  3OXN A;  3OOA A;  3Q27 A;  1ZMG A;  5DVF A;  1R6Z A;  2DWA A;  4P11 A;  4ESW A;  1RYX A;  2HZK A;  3VLW A;  2DOJ A;  4QF9 A;  2HFB A;  3FZV A;  2VHA A;  2OWS A;  4ESX A;  3VFJ A;  1ZKB A;  4H67 A;  3ZKK A;  2ABH A;  3O97 A;  3GLB A;  1SW2 A;  3S9N C;  2ZYN A;  4WKM A;  3QAX A;  5ELV A;  1MH3 A;  2ZMB A;  4ND9 A;  5I56 B;  4POW A;  5KDT A;  4R9G A;  5I58 A;  4KI0 E;  4BDQ A;  3OO9 A;  3K2D A;  1NH8 A;  3DLN A;  4O3A A;  3B7D A;  4LZ5 A;  1O64 A;  3C31 A;  1POY 1;  3M8U A;  4DXC A;  2VD3 A;  4QFP A;  4RK9 A;  3MJN A;  4F29 A;  2RCA A;  4KYD A;  3L6H A;  1B32 A;  3TTK A;  3IOT A;  2Q89 A;  3GZG A;  2D21 A;  1P1W A;  4QFK A;  4LQ2 A;  1TFD A;  3GBB A;  3LBS A;  3TTN A;  4JWO A;  2X26 A;  1QUJ A;  1XVX A;  2REG A;  2XXW A;  3U93 A;  1B40 A;  2CMO A;  2X7Q A;  4O3B A;  4RNS A;  4H5G A;  1USY E;  2DXY A;  2I58 A;  2UXA A;  2ZXT A;  5CMK A;  3IB1 A;  4YB6 A;  3K6U A;  2I4C A;  3SES A;  5DVJ A;  1MQG A;  1SW4 A;  5H8H A;  3N94 A;  3FJM A;  3RQT A;  5L9O A;  1A54 A;  3H4Z A;  4E0W A;  3OEM A;  3IO6 A;  1PEB A;  4R2B A;  2Y7W A;  3N26 A;  3CRB A;  4HCW A;  3IR1 A;  4RYA A;  2ZNS A;  2H25 A;  1GTK A;  3IOR A;  3PUV E;  2F34 A;  3THI A;  3MZ1 A;  2B3B A;  3I6V A;  5I59 B;  1A55 A;  4ZS9 A;  4NF4 B;  2XXU A;  3O6G A;  1QUI A;  3MQ9 A;  3SDF A;  3PD8 A;  1B4H A;  1N84 A;  3PD9 A;  1PBP A;  1MH4 A;  4F39 A;  4DXB A;  1PB7 A;  1GR2 A;  2A5T A;  2F8D A;  2V3Q A;  3PMV A;  1B1H A;  2VGQ A;  5DYH A;  1LCF A;  4FEC A;  1EZ9 A;  4JDF A;  2LAO A;  3PUY E;  3O29 A;  2PMS A;  2V93 A;  1AIV A;  3I3V A;  5CC2 A;  5L8D A;  1ELJ A;  1LBB A;  1F9B A;  3K1M A;  2HAV A;  1PB8 A;  3FJG A;  4R2F A;  2RIN A;  4OFL A;  4R73 A;  3O9P A;  1R1N A;  3VXB A;  1MY3 A;  5I84 A;  2DXR A;  4BDO A;  4UA8 A;  3T9X B;  2O7I A;  5M2V A;  4F1U A;  5I2K A;  2DQV A;  2VOZ A;  1XS5 A;  1OQG A;  4R72 A;  2ONS A;  2I0C A;  3KZG A;  2VD2 A;  4G68 A;  2GFE A;  2O69 A;  2AIX A;  3C34 A;  4IGT A;  5H8F A;  1NNP A;  1D3K A;  4H8J A;  3K6V A;  5BWJ A;  1JEV A;  5H8Q A;  1LB9 A;  1US5 A;  4Z0I A;  1AL3 A;  3A09 A;  1S50 A;  2FA7 A;  1ZU0 A;  3V5A A;  4MLQ A;  4R75 A;  3K02 A;  2QS1 A;  4F19 A;  2AL4 A;  1FQA A;  3PPR A;  2QMW A;  1NL5 A;  4Q30 B;  1PC3 A;  3BBR A;  3WAE A;  4AQ4 A;  2X7P A;  3VV5 A;  5LOM A;  1URS A;  1B7U A;  4UAC A;  2DE2 A;  2UVH A;  1IZ1 A;  3VVF A;  4HW8 A;  1MXY A;  3KN8 A;  2UVG A;  2NOO A;  1N3W A;  4DZ1 A;  1UTB A;  4NF6 B;  1XT8 A;  1M5C A;  5EHS A;  3TFL A;  4R6H A;  4C1U A;  3N6T A;  5TP9 B;  4GD5 A;  1VR5 A;  4XIG Q;  3IOW A;  3LSL A;  4NE4 A;  4IO4 A;  1O7T A;  3FAT A;  1B3E A;  1OVB A;  5F7V A;  3LSX A;  5AA2 D;  4F1V A;  2DVZ A;  3DEL B;  1LB8 A;  2QSX A;  3TPA A;  1Y1M A;  2R71 A;  1MXW A;  2A5S A;  5I56 A;  1XOC A;  3IJO B;  2YJP A;  4RJZ A;  3VLV A;  1SD3 A;  1BKA A;  4YZZ A;  3FIR A;  1H43 A;  3CIJ A;  3VVE A;  1DMB A;  4U4S A;  4YB5 A;  1QJM A;  4OWD A;  2VP1 A;  4L17 A;  3CR9 A;  2XXX A;  3IJX B;  1NNT A;  4R74 A;  1MY2 A;  4LUB A;  3H6W A;  4H1X A;  1ANF A;  4KYS A;  1B4Z A;  1FQC A;  3K0V A;  2O6A A;  2REJ A;  4IO5 A;  4OMB A;  4XKR A;  1OMP A;  1N7X A;  3EHS A;  3W9V A;  5A5X B;  1GV8 A;  3UA8 A;  4JSD A;  3F11 A;  1MRP A;  5EHM A;  1M5D A;  3E3K A;  3U72 A;  2Y7K A;  3B6Q A;  4EQ9 A;  4ZE9 A;  2F7C A;  1I6A A;  4H65 A;  3TKD A;  3QK6 A;  1MQH A;  2G29 A;  1Y9U A;  5I2K B;  3T22 A;  1D9V A;  1I69 A;  1ATG A;  1KWH A;  2OWT A;  2Y7R A;  2Q2A A;  5DEX B;  1Q35 A;  3U8Q A;  1LFH A;  4RK2 A;  4G68 C;  4KFQ A;  3PPQ A;  3O6H A;  2F97 A;  2UYE A;  2GH9 A;  4U22 A;  3K00 A;  5I59 A;  4GXA A;  4XKN A;  3S9M C;  4ZEB A;  4NF8 B;  4LVQ A;  2E1S A;  5IKB A;  2DYX A;  2F5X A;  2UVI A;  1ZIU A;  3SEU A;  2HXW A;  3N5L A;  2HAU A;  3JZJ A;  2Z8D A;  4JWX A;  1OIB A;  3FXQ A;  1Y4C A;  3RLF E;  3UOR A;  5L9S A;  1FTJ A;  2XX7 A;  3C35 A;  1UTH B;  1MY4 A;  3EPE A;  4X48 A;  4KQP A;  4OER A;  4FE8 A;  5DT6 A;  1LAF E;  1MPC A;  3R7X A;  5IAI A;  1JEU A;  1QVS A;  4X1D A;  3CFZ A;  5AA1 A;  1UTB B;  3D4G A;  4IY6 A;  2V84 A;  1IIW A;  2H5Y A;  3TZA A;  4GQO A;  2GHA A;  1SI1 A;  1MM6 A;  2QMX A;  5FHO A;  4XTC Q;  5I57 B;  4KR5 A;  3TCG A;  3SEX A;  4F2Q A;  2ZNU A;  5KZT A;  1B7Z A;  3EQ1 A;  3QUJ A;  2AL5 A;  3T66 A;  3S4U A;  1QKB A;  4FED A;  4O3C A;  2XD2 A;  3G3K A;  2NXO A;  2DE4 A;  4RXL A;  3MZ9 A;  4EDP A;  5JEI A;  4GXS B;  4QHQ A;  4QFO A;  3FJ7 A;  4K3F A;  4H8I A;  3USD A;  1TWY A;  1EU8 A;  4FAJ A;  1TFA A;  2V3T A;  3L6G A;  2GHB A;  5CRY A;  4I8C A;  4Q5T A;  4MLV A;  1SW5 A;  4JBZ A;  4H0W A;  2O7U A;  4R9F A;  1JNF A;  2XD3 A;  2FNC A;  2XXP A;  1A40 A;  4M4G A;  3CI8 A;  1B58 A;  4Q0C A;  1CE2 A;  3IB2 A;  1LFG A;  3V8X B;  4DE8 A;  2F78 A;  3M3L A;  4G8N A;  1Y3P A;  3SEW A;  2M8C A;  4C0R A;  4OZ9 A;  1DSN A;  4GL8 A;  4KHZ E;  3QIM A;  1AMF A;  4NF6 A;  4YKI A;  4EF1 A;  2ESN A;  4PQJ A;  1B9J A;  3U1O A;  4ONY A;  3H06 B;  1URG A;  2XXR A;  5CMB A;  3HO7 A;  4MF3 A;  3UK4 A;  5TP9 A;  3ONM A;  1ZLQ A;  4U2R A;  1FTO A;  4KCD A;  4H5F A;  4RA1 A;  4DXU A;  4U1O A;  3TOD A;  1O63 A;  1LGB C;  3OEK A;  4F3P A;  1B0H A;  2RC9 A;  2I4B A;  2V3U A;  1L5T A;  4EF2 A;  3T9V A;  3TQW A;  5ICQ A;  2ONR A;  4YMA A;  5TPA A;  3DM0 A;  1LST A;  3U92 A;  3RT6 B;  3RNN A;  4FIM A;  4ZEC A;  3MW0 A;  1BP5 A;  1IIT A;  1LAH E;  3KN7 A;  3FAS A;  2I6E A;  4DDD A;  2H99 A;  4OET A;  1UIV A;  2HZL A;  3IB0 A;  2OK2 A;  4THI A;  4I9D A;  2PX1 A;  1JQF A;  4NWC A;  2QJE A;  4QFL A;  1YCJ A;  4OHN A;  2XX9 A;  3OEL A;  1ZBM A;  3HCQ A;  2D5W A;  4BDM A;  4YIC A;  3VE1 B;  3KJT A;  1HSL A;  5K2Y A;  3QUF A;  4GWO A;  5TU0 A;  3GBA A;  3MUQ A;  2OCU A;  5A5X A;  2W7Y A;  3A3C A;  2PT2 A;  2Z22 A;  4DLD A;  2O1M A;  4WXJ A;  4JWY A;  1H44 A;  1Z7N E;  3VVD A;  1QKA A;  2XXY A;  3CSB A;  4JSO A;  3MC2 A;  1M5B A;  3IOU A;  2NVU B;  1SW1 A;  2RKM A;  5J1D A;  1N0T A;  2Q88 A;  3JYR A;  3RN8 A;  1WDN A;  3HHF A;  2E0S A;  5DEX A;  5F1Q A;  4FJP A;  1B46 A;  3HST A;  1N76 A;  2DWH A;  3KOS A;  2PBW A;  3PV0 E;  5H8N B;  3UP9 A;  5AE4 A;  4G2Z A;  2OZZ A;  1B3H A;  3OO6 A;  1POT A;  2ANJ A;  3TDJ A;  1AH5 A;  3MVY A;  1B51 A;  5CI5 A;  3QXM A;  2I3W A;  1MXU A;  4NF8 A;  1UQW A;  1IXH A;  3ILU B;  1BLF A;  4EXK A;  2P0S A;  1XHY A;  1MXZ A;  1SYH A;  1EH3 A;  4PP0 A;  4ZDM A;  3H03 A;  2ALU A;  4YAH X;  1DTZ A;  4C1T A;  1UTH A;  5AA2 B;  4RY1 A;  3LC8 A;  3FV2 A;  1QUK A;  4ELP A;  3O66 A;  3H6V A;  4OES A;  3A3U A;  2DSF A;  5I2N A;  2CZL A;  2IA4 A;  3R6U A;  3OD7 A;  2THI A;  4QRZ A;  4GIZ A;  3HPI A;  3LSW A;  2ZYK A;  5CBR A;  3MWB A;  1P99 A;  5I57 A;  2ZYO A;  3SEY A;  3O6I A;  3KBR A;  4F22 A;  2YPN A;  3UN6 A;  3KGC A;  4U4X A;  1B6H A;  4I1D A;  4YKK A;  2DVC A;  3Q26 A;  5TPA B;  5K2X A;  2PVU A;  4F3G A;  3C32 A;  1B0L A;  4ZEF A;  1LBC A;  4PFW A;  3C33 A;  4BDR A;  3QYT A;  3Q29 A;  4GFR A;  2Z8F A;  1N7W A;  2QS3 A;  3G3H A;  3T9U A;  1R9Q A;  2F7B A;  3OEN A;  3KJ7 A;  4NWD A;  4U23 A;  2H98 A;  2RF1 A;  3TTR A;  1MQJ A;  1TT1 A;  4PET A;  1FQD A;  3IX1 A;  4LZ7 A;  3EHU A;  1JET A;  3RY3 A;  2D3I A;  4ZZE A;  3BFT A;  3IO4 A;  2H4I A;  3FD3 A;  3RTF B;  1VFD A;  2F6G A;  3KEI A;  4Q8R A;  3N6U A;  3K6W A;  4YMB A;  3CFX A;  1US4 A;  4G77 A;  3E4R A;  3JV9 A;  4E0X A;  4WEP A;  4GOT A;  3IK6 B;  1QUL A;  4KCC A;  3C9H A;  3QSL A;  1NKX A;  3CG3 A;  1FW0 A;  1HSE A;  1MY0 A;  3OSR A;  3OO8 A;  3W15 C;  1MDQ A;  4GLI A;  3PUX E;  4H6D A;  1H3D A;  1QW0 A;  1PB9 A;  2Z23 A;  2HCA A;  1UIU A;  1SYI A;  1MQD A;  4EXL A;  1NFT A;  1D9Y A;  1OQH A;  3TQL A;  1SBP A;  3FGS A;  4P0I A;  2OJT A;  5ISU A;  4LQ5 A;  1H76 A;  4KYE A;  3G7W A;  1IXC A;  4GL0 A;  3FVK A;  4OEU A;  3UGW A;  4OEN A;  3S9E A;  3HN0 A;  4NTL A;  4EQB A;  4LON B;  4QFN A;  1Y1Z A;  2XHD A;  1JVY A;  4GVO A;  4AB5 A;  2PT1 A;  2B65 A;  3K01 A;  2FYI A;  2Q8J A;  3PU5 A;  2ONK E;  4YB7 A;  1DPP A;  4ZEI A;  2Q9T A;  2GRV A;  1HSJ A;  1SVX B;  5CM6 A;  2O1L A;  3DP4 A;  3V89 B;  5JTY B;  4MBP A;  4JB7 A;  5KCJ B;  1P1U A;  5I2N B;  3MPK A;  1PBQ A;  5H8S A;  3HV1 A;  1AOV A;  3FUZ A;  1IEJ A;  3IOV A;  4LA9 A;  1JW4 A;  2PYY A;  2KLF A;  5FTH A;  1NNF A;  3BKI B;  5ICT A;  2Y7I A;  4OYV A;  1I6B A;  1EZO A;  1FTL A;  1BIY A;  3PPN A;  1T0K A;  1USY H;  3ODB A;  1OLC A;  2QPQ A;  2DWJ A;  3K6X A;  3B6T A;  3MBP A;  1Y4T A;  1URD A;  3FXU A;  5H8N A;  5BUU A;  3H3G A;  3O28 A;  1MPB A;  2DE3 A;  4FOR A;  3VDF A;  1LCT A;  3M3K A;  4R6Y A;  3K4U A;  4QSE A;  2QRY A;  1NNK A;  4YU0 A;  4DIG A;  3HHG A;  3G3F A;  2F7A A;  3GXA A;  1LLS A;  4KPT A;  4G4P A;  4ECF A;  2G93 A;  1SI0 A;  3MZB A;  1RYO A;  5AA3 A;  3MPL A;  1MG1 A;  4P0G A;  4LAT A;  4ELR A;  4WED A;  5HM4 B;  3FV1 A;  3CFL A;  1B3F A;  4TOZ A;  4TQU Q;  3TMG A;  1GVC A;  1I6Q A;  5AA2 A;  3LSF B;  2RC8 A;  4OEV A;  2QS2 A;  4G8M A;  3EHT A;  3PUW E;  2Z8E A;  3MAM A;  3CVG A;  1MDP 1;  3PMW A;  2ZNT A;  3BFU A;  2F36 A;  3C36 A;  4EQ7 A;  5AA4 A;  4I62 A;  4F2O A;  1N04 A;  3W9W A;  2DWI A;  2V25 A;  2Y7P A;  3OO7 A;  2YLN A;  4POX A;  5HPQ A;  1OVT A;  2DS9 A;  1FQE A;  4XKQ A;  3PMX A;  4ZZA A;  3T96 B;  2O68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...