3GXAA

Crystal structure of gna1946
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
239
Chain Sequence
KEIVFGTTVGDFGDMVKEQIQPELEKKGYTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVKDGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFAVVNGNYAISSGMKLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of lipoprotein GNA1946 from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Protein binding
molecule keywords Outer membrane lipoprotein GNA1946
total genus 71
structure length 239
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gxaA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3gxaA01
1FTMA 4QFLA 4OZ9A 3GLBA 5EHSA 5I2KA 3V83A 4KFQA 1PDAA 3FJGA 3IAZA 1Y1MA 1HSLA 2R71A 4KCCA 1MXYA 4OERA 4JWXA 1B6HA 1LAGE 3EHTA 5A5XB 5CBSA 1B3FA 3L6GA 5DEXA 1OLCA 2HAUA 2B3BA 1B05A 2O68A 3EQ1A 5EHMA 1GV8A 3TKDA 5AA3A 1SI1A 3TZAA 1USYE 1Y3QA 1B32A 3JV9A 5TPAA 1T0KA 3P7IA 3SETA 4ZE9A 2Y7PA 1SD3A 4H8IA 3TFLA 1P99A 1P1NA 4WXJA 5FTHA 1B5JA 4XKQA 2O84X 4LONB 4F31B 4U1OA 1SYIA 1BP5A 1OQHA 2WKYA 2OCUA 3O28A 4LA9A 4U2RA 1XVXA 1LAHE 3U8QA 4FORA 3TCGA 4QFKA 3H4ZA 1Y1ZA 3N6UA 1AIVA 1TFDA 3FATA 4U4XA 3Q26A 3R26A 2XXXA 3ILUB 3RUMA 4R6YA 3RQTA 3KJTA 3V5AA 3LUYA 1DPPA 1S9TA 5H8NA 2ZXTA 3CI8A 1R6ZA 1M5BA 1UTBB 4R73A 2QJEA 4R9FA 1Y4CA 1LB9A 3VE1B 3AXFA 4XKRA 3S4UA 5KCJB 3CFLA 1UIVA 3CRBA 2H25A 5L9MA 3RLFE 1N7XA 1IUDA 5CMCA 2Z22A 1LSTA 4ZEFA 3TTLA 1A7LA 1N04A 3O97A 4KD5A 1OMPA 3C35A 5DTBA 3HCQA 3CG1A 3V8XB 1N3WA 3QUFA 3W15C 1Y20A 2F6PA 3PMVA 3I3VA 3ZS6A 1LGBC 2HQ0A 1FCKA 1RYXA 3E3KA 4JB7A 4N13A 4ZZEA 1H43A 2G29A 3C31A 3IB0A 3KN7A 4GXSB 2XXHA 4I62A 5EYFA 3SEVA 3UK4A 5B7DA 2YJPA 4R2BA 2F7BA 4KPTA 4KQPA 1B0LA 2XXPA 4H65A 4BDMA 1NNKA 3H6UA 3KZGA 2PX1A 1ZLQA 3LSFB 1RKMA 1MPCA 3H6TA 3MZ1A 4QSCA 4IO7A 1PEBA 3UIFA 5ISUA 4LZ8A 3RPWA 3TEPA 1SYHA 1JW1A 1ZBMA 4H1XA 3FVGA 1BKAA 5AA2A 4XKNA 4RA1A 1US5A 2F35A 3R6UA 1XT8A 5FTIA 5KDTB 2ZNTA 4P0GA 2FNCA 1MDQA 1I6AA 1VR5A 5I59B 2ZYKA 2I0BA 1B0HA 2HZLA 3T93B 1NH8A 3H3GA 4YZZA 4MBPA 1EH3A 2E1SA 1B5HA 3K0VA 2RF1A 3KG2A 4EXLA 5AE4A 2QPQA 4IO3A 2UVHA 3MW0A 2W7YA 2GHAA 1ELJA 2DSFA 2Z8DA 2QS3A 1F9BA 1S7YA 2ABHA 3MAMA 1QW0A 3OENA 3Q29A 2UXAA 4NF5A 3OMBA 3QXMA 3MBPA 4UACA 4IY5A 3MVWA 4GIZA 1CE2A 3FASA 3MPLA 4IGTA 5H8HB 4ZEBA 1A55A 1VSOA 1QUIA 3ILTB 3PMXA 3USDA 2GH9A 2X7QA 2B65A 2VGQA 3TAJA 3G3FA 3PUZE 4BDNA 4F29A 1FTLA 1R9LA 1TT1A 1XVYA 2HZKA 1SVXB 3MP8A 4YICA 3U72A 4FEBA 4Q30B 3SEXA 2OLBA 2F5XA 3G3JA 4DLDA 3MVZA 3VLWA 3Q25A 3CR9A 3O6IA 3TQLA 2RC8A 3VVFA 3FV2A 4IB2A 3FZVA 3G7WA 2XX7A 2XXYA 4U22A 5TP9B 1YTVA 2IEEA 5I58B 2DS9A 3OEMA 4F3BA 1ZIUA 3K00A 4EQBA 3D4CA 4LQ5A 4F3PA 4KYEA 4I8CA 4QSDA 3U94A 4DCYA 5DT6A 1DTZA 3H6WA 1DPEA 4F3SA 3O6HA 2R6GE 3SEWA 4YKPA 5LOMA 1XS5A 2Z8EA 3ECRA 2F78A 2RC7A 3K6XA 3S9LC 2UVGA 3KEIA 3PD9A 4EDPA 2H99A 2XX9A 5AA4B 3G3IA 3RT8A 4K3FA 2D21A 3WAEA 1DOTA 4KCDA 3THIA 1JW4A 4HCWA 1A40A 2XD2A 3RN8A 1QULA 4EXKA 4NF4B 3FUZA 1MM6A 3HSTA 4U4SA 3RTWB 5FHMA 3EF7A 3BKIB 3PPPA 1VFEA 2P0SA 2H5YA 2X26A 4H5FA 4OESA 2H98A 2O1MA 1MRPA 1ZMGA 3G3HA 3H06B 3PD8A 4FEDA 5H8QB 4AB6A 1AOVA 1NFTA 1WVJA 2GRVA 1EU8A 2A5TB 1I6QA 3KOTA 2I49A 5CRYA 1Y4TA 4LZ5A 1URGA 4ECFA 3M8UA 2V25A 3C4MA 1HSEA 2DWJA 3DLNA 4GD5A 4M1VA 2XXQA 3N5LA 3QYTA 4JBZA 1O64A 2UYFA 3N26A 2DXRA 5KZTA 5HBCA 2PT1A 4F2OA 3MUQA 3QIMA 2DWAA 2OWSA 1URSA 5I2KB 4PP0A 1N0TA 2DVZA 1WDNA 3EN3A 4FATA 3BFTA 3KSXA 1UTHA 4KI0E 1FTKA 4YMBA 4G77A 4R6KA 1JEVA 4M4GA 4LVQA 1B7UA 4OEVA 2O6AA 4L17A 4LP2B 2CMOA 2HAVA 4RYAA 1QJMA 3OSRA 5IAIA 1XC1A 4PFWA 1TFAA 2DE4A 2F36A 1ZJLA 4PETA 1MQDA 1IXHA 1QUJA 3ZKLA 4NF5B 2ONKE 5AA4A 5CBRA 2KLFA 1IXIA 2BJJX 3MVYA 1OQGA 4H6DA 5M2VA 3C34A 1A8FA 2DE3A 2ZNSA 1PB8A 4LUBA 1N76A 4YB7A 4LATA 3EHSA 2I58A 4OTEA 3FD3A 3A3UA 1B4ZA 2Z8FA 3C32A 3K6VA 1URDA 3MP6A 2OBGA 3IOWA 2AIXA 2GHBA 3SEYA 4DIGA 5JEIA 1CB6A 2RC9A 1B1HA 5K2XA 1B52A 3O66A 1QUKA 4JWYA 3S9EA 1L5TA 2ONRA 3TTNA 4Z7EA 1P1QA 1IITA 3DP6A 2I48A 3T9XB 4THIA 3FXQA 2XXIA 4KR5A 1B3LA 4OQOA 4PFTA 1FQAA 4XKPA 1FQDA 5F1QA 3OOAA 3VVEA 2HEUA 5I59A 2QS1A 1N7WA 2GFEA 1FQCA 1PC3A 1IXGA 3BBRA 3LR1A 4POWA 3TELA 4Q0CA 1JQFA 5H8FA 4POXA 1IEJA 3EHUA 2PYYA 3KFMA 4F22A 3CIJA 3IOUA 3K6UA 4R2FA 3ZSFA 1NKXA 4QRZA 1JNFA 5DVJA 4MLQA 5L8DA 5L9OA 3MVXA 3LSWA 4GOTA 3MQ9A 3TPAA 4F1VA 3RNNA 3TTMA 2QRYA 2R9JA 2Y7IA 3CSBA 3M3FA 3PV0E 4EUOA 1MXVA 3C33A 3IR1A 3CFZA 5I56B 3D4GA 4H67A 1D3KA 2DE2A 2DP8A 3F11A 2HCAA 2ANJA 5AA1A 4ONYA 4R74A 3JYRA 1A54A 4G68C 1B3HA 3H6VA 1SBPA 1FQEA 4PFYA 1S50A 3ZKKA 1RYOA 2VOZA 4OETA 4BDLA 5KDTA 3LSXA 2DWHA 4G8NA 4GRKA 5JK4A 4KYDA 3TTRA 1MG1A 3DP8A 2UVJA 3WAFA 1MY4A 4EQ9A 3SESA 3PUWE 1AH5A 1VE4A 1GVCA 1YCJA 3B6TA 1I6BA 4ZEIA 1MY2A 4DDDA 4BDQA 4N07A 4QFOA 2Y7RA 3K4UA 3O29A 1LB8A 4G4PA 4OVJA 4WEPA 1ANFA 2PT2A 4X1BA 4YKJA 4ZE8A 2NWJA 2NUVA 4MF3A 2DOJA 2RCBA 4JSOA 1SW1A 3B6WA 2DWIA 1H3DA 4TLMB 4WKMA 2ZNUA 3GZGA 2Z23A 3IB2A 2IA4A 1IXCA 1JW5A 2UYEA 3IX1A 5CMKA 4KHZE 3FJ7A 2ESNA 3HN0A 1US4A 4IO5A 3IO4A 2E0SA 2OWTA 3OD7A 4N6PA 3DELB 4IY6A 4P0IA 1O63A 1USYH 3CFXA 3K1PA 1H45A 2V3QA 1B7HA 3PUVE 4JWOA 3H7MA 3VFJA 1IZ1A 3TODA 2XX8A 1B9JA 1DTGA 5I2NB 1NNPA 4OHNA 4EF1A 1WODA 3PMWA 2VD2A 1NL5A 3OSQA 4GL0A 4OFJA 4OXVA 3T22A 5JTYA 5L9SA 1M5CA 1PBPA 1TWYA 1UTBA 3U1OA 1LCTA 2XXWA 2NXOA 4GLIA 4R75A 1MDP1 2QMXA 3UN6A 4QHQA 1II5A 3K1NA 2X7PA 3HHFA 1P1OA 3VXBA 3I5OA 2V93A 3IO6A 3DM0A 3K01A 3RTFB 4BDRA 3IORA 5I2NA 4NF6A 5I56A 3IOTA 3QUJA 2Q89A 1MQIA 3HO7A 4MH5A 4ISUA 4RK9A 1KWHA 3UORA 5H8QA 4ZDMA 3S9MC 3C36A 4QF9A 3TUSA 4ND9A 2XHDA 5DVFA 4F1UA 4FJPA 5K2YA 1MQJA 1B2HA 1H76A 3FGSA 1FQFA 3KN8A 3A09A 3OO7A 4PFUA 4UA8A 3MC2A 4O3AA 3K02A 5I58A 3TCHA 5HPQA 1MQGA 3IOVA 3VXCA 1N84A 2ZYMA 1MH4A 2Q2AA 3FIRA 3RY3A 4RNSA 1B3GA 1EZ9A 3KOSA 5FHOA 1I69A 3JZJA 5CMBA 1A8EA 2XXUA 4QFPA 3MP1A 4DE8A 4NWDA 4RXLA 4RJZA 1OIBA 4PQJA 3UP9A 5ITOA 3KBRA 4IO2A 1OVTA 3G3GA 3RT6B 3T96B 2V3UA 4DXBA 1JVYA 2H9BA 2YPNA 2OK2A 4DCXA 1LAFE 1SW5A 4ELRA 2REGA 3T66A 2I6EA 4G68A 4R9GA 3SERA 5A5XA 3M3LA 3Q27A 3PGFA 3UA8A 4XTCQ 3KJ7A 1D4NA 1B51A 1Q1KA 3E4RA 2XD3A 4P11A 1LLSA 3C9HA 3SKPA 4QFNA 5CM6A 2B3FA 4MLVA 3MZBA 3T9VA 4EQ7A 4OMBA 4DZ1A 4F3GA 4OEUA 1OVBA 3FJMA 1M5FA 2REJA 4JSDA 3M3KA 4NF6B 4H0WA 4DXUA 5AA2B 2ALUA 3IL1B 2XXTA 4NF8A 3VLVA 2DVCA 2NVUB 3FXRA 1POY1 3MPKA 3FVOA 4YKKA 1BTJA 3FVKA 5TU0A 2AL5A 1QVSA 1SDXA 2Y7WA 4H8JA 4NE4A 2QL3A 1Z7NE 3T9UA 3GXAA 5H8FB 1B40A 2DXYA 1JETA 1MH3A 1A99A 2QMWA 1FW0A 3W9WA 3CG3A 4IO4A 4BLAA 3U93A 4ELOA 4NWCA 3O9PA 4GWOA 2ZMBA 3GBBA 3IJXB 1MY1A 1NH7A 3QSLA 4XXUA 4G8HA 2F6GA 2Q9TA 3KN3A 5H8SA 3PPQA 1LFGA 3DP4A 3IJOB 2I4BA 4GFRA 1B4HA 3HV1A 3OELA 3V89B 4NMYA 4TLLB 5BWJA 4LQ2A 2F34A 3E13X 4RPOA 1D9YA 1J1NA 2ONSA 5I84A 1LBCA 4YB6A 4C1TA 2VHAA 1M5DA 2XXRA 3PUXE 4NEDA 3PUYE 3CSGA 3ONMA 2AL4A 4U23A 1Q35A 5ELVA 5BUUA 2DQVA 5H8NB 3KGCA 3SDFA 3T9HB 2PMSA 1H44A 1ZU0A 2P2AA 1D9VA 2RINA 2Y84A 3PPNA 4HCYA 3K2DA 1QKAA 3N6TA 4C0RA 1MXXA 4F18A 4FE8A 1NMUA 1R1NA 3TMGA 5DYHA 4TOZA 3H03A 1R9QA 3Q28A 4OFLA 2I0CA 5H8HA 5CMMA 1IQ7A 3MWBA 3TYHA 1HSJA 5F7VA 3SEUA 4ESWA 5ITPA 3FV1A 1M5EA 1MPBA 4IGRA 3R7XA 3PPOA 2V84A 3OO8A 3U92A 3W9VA 4RK2A 4C1UA 1P1WA 4F19A 4GXAA 1ZKBA 1BIYA 4X1DA 3VVDA 1BLFA 1ZTYA 4HTGA 4OYVA 4RPNA 5ICQA 3S9NC 2PBWA 2O69A 3K6WA 1PB9A 4RY1A 3TTKA 3PU5A 4R6HA 4LZ7A 1GTKA 3BFUA 4ELQA 1EZOA 1B7ZA 4G2ZA 4WEDA 2RKMA 1ATGA 4IO6A 2Y7KA 2Q8JA 4AQ4A 2O1LA 4I1DA 5KCJA 1XHYA 2CZLA 2QSXA 1Y3NA 1N3XA 3TDJA 4Q8RA 2O7UA 1JEUA 1PB7A 2FYIA 5AA2D 1TXFA 1DMBA 2I4CA 2A5SA 2ZYNA 1MXZA 3K1MA 3OXNA 4JDFA 4EF2A 4HW8A 4ZEKA 3CVGA 4Z0IA 5IKBA 1DSNA 1AL3A 2PVUA 1VFDA 3LC8A 4GQOA 3RGYA 1NNFA 3IB1A 3EPEA 2AYSA 1QKBA 2P1SA 3FXUA 2G93A 1SQYA 2VD3A 4X9TA 3UGWA 4F1YA 5DVIA 5J1DA 3IK6B 2O7IA 2F97A 4I9DA 2THIA 1XOCA 2F7CA 4KYSA 1LBBA 3B7DA 3O6GA 4U21A 1MPDA 3VDFA 4BDOA 4FAJA 4GVOA 2O51A 5CI5A 4YU0A 2Q88A 4MFIA 4ELPA 4NF4A 2HFBA 4O3CA 1MM7A 4F2QA 1FTJA 3OO9A 4U1ZA 4OFOA 1B46A 3I6VA 4G68B 3MJNA 4OWDA 4XIGQ 2OJTA 1GR2A 5HM4B 1LFIA 4Q5TA 4G8MA 4X48A 3ODBA 4YKIA 2NOOA 2M8CA 4ZS9A 2FA7A 3S2VA 1MY3A 4YAHX 4PE5B 5JTYB 1MY0A 2OZZA 3E9XA 1MS7A 1B1XA 3G3KA 1B3EA 1MQHA 1SW4A 3L6HA 3GBAA 3LBSA 1UTHB 2A5TA 2D3IA 3PPRA 4FECA 3FVNA 3MZ9A 4QSEA 1NNTA 3TQWA 4E0XA 1LAXA 1UIUA 3QAXA 5TPAB 3N94A 1PBQA 2I3WA 1FQBA 4O3BA 4YB5A 5TP9A 3QK6A 1SW2A 5I57B 1UQWA 2D5WA 3HHGA 4R72A 1Y3PA 5FHNA 3HPIA 1AMFA 4NF8B 1MXUA 4NTLA 4DXCA 2V3TA 4ZZAA 4OENA 1OLAA 4ZEDA 1POTA 2DYXA 1B58A 2QS4A 2YLNA 3OO6A 4HS7A 4ESXA 3O2AA 5DEXB 1YPNA 1LCFA 1IIWA 2HXWA 2Q2CA 2RCAA 2VP1A 4GF8A 1Y9UA 4GL8A 2F8DA 5I57A 2XXVA 3KSJA 4AB5A 4E0WA 4TQUQ 5ICTA 1P1UA 1O7TA 1YAEA 2I3VA 1MXWA 2UVIA 2ZYOA 4JXIA 3VLUA 4YMAA 5B70A 5CC2A 4FIMA 1EZPA 1B5IA 4H5GA 4F39A 4ZECA 1JVXA 3VV5A 3OEKA 3A3CA 1SI0A 1Z7ME 2F7AA 2LAOA 1FTOA 3B6QA 3TCFA 1GGGA 3LSLA 2QS2A 2H4IA 1LFHA
chains in the Genus database with same CATH superfamily
4OZ9A 3V83A 1PDAA 1HSLA 4OERA 1MXYA 5A5XB 4FBPA 2CEXA 5EHMA 1IMEA 3TZAA 1Y3QA 5TPAA 3SETA 5I7IA 4XKQA 2O84X 4F31B 3RPLB 1OQHA 4N6KA 4U4XA 3ILUB 4R6YA 3LUYA 5H8NA 2ZXTA 4R73A 5IGAA 1Y4CA 4GWXA 3S4UA 3CFLA 5CMCA 3TTLA 4KD5A 3V8XB 4NX1A 2F6PA 2HQ0A 1FCKA 4ZZEA 1H43A 2G29A 3C31A 4R2BA 3IFCA 4KPTA 4KQPA 4PFIA 4H65A 4MNCA 1MPCA 3H6TA 3UIFA 3TEPA 1ZBMA 5AA2A 3FVGA 4XKNA 4RA1A 1XT8A 5KDTB 4P0GA 2FNCA 1MDQA 1I6AA 3T93B 3H3GA 5AE4A 2UVHA 1ELJA 4KYSA 2ABHA 4H46A 4UACA 3QXMA 2L5VA 1CE2A 5H8HB 1A55A 1YXIA 3USDA 3PMXA 3G3FA 1TT1A 1XVYA 2F3BA 2OLBA 4DLDA 4H45A 2XA5A 3O6IA 3Q25A 3FV2A 3KC1A 2IEEA 4I8CA 3U94A 1DTZA 1DPEA 2HXRA 3O6HA 1FJ9A 2GQ1A 5EQ8A 1G0HA 4MX6A 4K3FA 2D21A 1DOTA 1JW4A 1A40A 4EXKA 4PCDA 3HSTA 5LDZA 1FPGA 3PPPA 1VFEA 4OESA 2H98A 2O1MA 2GRVA 5CRYA 3KOTA 1URGA 3DLNA 4OYVA 4YB5A 3N5LA 4JBZA 2PT1A 1SPIA 5I2KB 2FHYA 3EN3A 3BFTA 1UTHA 4X8RA 1FTKA 4N15A 4LVQA 2O6AA 4L17A 1QJMA 1XC1A 1IMCA 4GBVA 4NF5B 3ZKLA 4MCOA 1IXIA 4N91A 5M2VA 3C34A 2DE3A 4HXVA 4LUBA 3FD3A 2OBGA 2AIXA 2GHBA 3SEYA 4DIGA 1CB6A 1B52A 4JWYA 3S9EA 3TTNA 3DP6A 3T9XB 1LBWA 2XXIA 4OQOA 4PTKA 5I59A 2QS1A 1FQCA 3LR1A 4POWA 4Q0CA 1JQFA 3EHUA 3KFMA 4F22A 3K6UA 4QRZA 4MLQA 5L9OA 5I56B 1XI6A 1D3KA 2DE2A 3F11A 2ANJA 4OA4A 4ONYA 4GBWA 2VOZA 4BDLA 2QVVA 5JK4A 1MG1A 1AH5A 1VE4A 4N07A 4OVJA 1ANFA 4JSOA 4NQ8A 2CZKA 2ZNUA 1JW5A 3IX1A 4JVDA 3IO4A 4ZS9A 1H45A 2XWKA 3PMWA 3OSQA 1NL5A 4HE2A 5JTYA 1M5CA 1TWYA 3VVEA 2NXOA 2QMXA 2B4MA 2X7PA 3HHFA 1P1OA 3I5OA 2V93A 3IFAA 4BDRA 3IOTA 3QUJA 4MH5A 1MQIA 2XWVA 3HO7A 4ZDMA 2XHDA 5K2YA 1MQJA 4PAKA 1B2HA 1K9ZA 3KN8A 3A09A 3EKIA 3MC2A 5LTCA 3K02A 5ESYA 4RNSA 4QFPA 4NWDA 4P3LA 3UP9A 5ITOA 3G3GA 2YPNA 1NUYA 1LAFE 1SW5A 3Q27A 4XTCQ 3KJ7A 1LLSA 4DZ1A 2REJA 4JSDA 3M3KA 3FXRA 5J16A 1SDXA 4H8JA 2QL3A 1Z7NE 3T9UA 1FW0A 3U93A 3O9PA 4GWOA 3QSLA 5EQAA 2I4BA 3CHGA 1LBCA 4YB6A 4C1TA 2VHAA 4PGPA 3PUXE 3PUYE 3CSGA 1Q35A 5ELVA 2DQVA 3KGCA 3T9HB 1H44A 2P2AA 1D9VA 3K2DA 5DYHA 2QVUA 5I3SA 5CMMA 1IQ7A 4IGRA 3U92A 2P3NA 4RK2A 1P1WA 4C1UA 4GXAA 3S9NC 5ICQA 3PU5A 1NUXA 2MKZA 1DCUA 2RKMA 2ZZXA 2Q8JA 1XHYA 1DMBA 3K1MA 2A5SA 3OXNA 4Z0IA 1DSNA 4GQOA 4O8MA 2P1SA 2P3VA 2F97A 2THIA 3VDFA 3BIHA 4KXPA 3OO9A 4U1ZA 1B46A 3I6VA 4OVPA 1GR2A 1LFIA 3ODBA 2M8CA 4P8BA 2FA7A 4PE5B 3E9XA 1B3EA 1SW4A 4FECA 1KA1A 1NNTA 1FQBA 5TP9A 3QK6A 2JJKA 1UQWA 2D5WA 2FBPA 5FHNA 1NV6A 4NTLA 1POTA 1YPNA 1LCFA 4PE3A 2XXVA 3KSJA 1YAEA 1MXWA 5B70A 5CC2A 4F39A 4GWWA 4ZECA 3OEKA 2F7AA 3TCFA 2QS2A 2CZIA 1FTMA 5EHSA 4KFQA 1Y1MA 4JWXA 1LAGE 5DEXA 2B3BA 1SI1A 3HFUA 1USYE 3JV9A 3PTYA 2Y7PA 1P1NA 1B5JA 1BP5A 4U2RA 1LAHE 3U8QA 1AIVA 3FATA 4PF6A 3R26A 3RUMA 1YYZA 3V5AA 1DPPA 1S9TA 1UTBB 2QJEA 4XKRA 1UIVA 3RLFE 2H25A 2VPOA 1OMPA 3C35A 3CG1A 1Y20A 3ZS6A 4N13A 1RYXA 3E3KA 4GXSB 4MEVA 2YJPA 1B0LA 3H6UA 3KZGA 3LSFB 1RKMA 4IO7A 4OANA 4H1XA 1BKAA 3R6UA 2ZNTA 1VR5A 1CNQA 2HZLA 4I40A 4MBPA 3GYYA 2W7YA 2Z8DA 3MAMA 1S7YA 3OENA 3Q29A 4GIZA 3FASA 3MPLA 4IGTA 1VSOA 5ET7A 3TAJA 4F29A 1YZ0A 1SVXB 3U72A 2KQZA 4IB2A 5TP9B 1YTVA 5I58B 4EQBA 3D4CA 4LQ5A 4F3PA 4DCYA 5DT6A 2Z8EA 1EYIA 3PD9A 2WX9A 1FBPA 2XD2A 3RN8A 5FHMA 3EF7A 3BKIB 2X26A 4H5FA 1MRPA 3H06B 3PD8A 1WVJA 1EU8A 1I6QA 4ECFA 2V25A 1HSEA 4GD5A 4O3AA 4P56A 3QYTA 1FPKA 2UYFA 3FBPA 5KZTA 1FPDA 4F2OA 3QIMA 4PP0A 4FATA 4G77A 1JEVA 4M4GA 4OEVA 2QVRA 4RYAA 3OSRA 1TFAA 4PETA 5CBRA 3MVYA 2ZNSA 4YB7A 4LATA 4OTEA 2I58A 4N8YA 5I5PA 3MP6A 3IOWA 5JEIA 2RC9A 1B1HA 5EYGA 2ONRA 1P1QA 1IITA 5F1QA 1FQAA 4PGNA 2GFEA 1PC3A 2V4CA 3CIJA 3IOUA 4R2FA 1NKXA 1VDWA 2CZHA 3MVXA 3TTMA 2Y7IA 4EUOA 1MXVA 3C33A 3IR1A 3CFZA 4H67A 2DP8A 3H6VA 4PFYA 1FQEA 1NV4A 1S50A 3MSTA 4LN5A 4GRKA 1FJ6A 2UVJA 3SESA 4NHBA 4ZEIA 1I6BA 1MY2A 4QFOA 2Y7RA 3O29A 4G4PA 2PT2A 2Z23A 2IA4A 4PAIA 1IXCA 2UYEA 5CMKA 4KHZE 2ESNA 3HN0A 1US4A 3OD7A 4P0IA 3TODA 2XX8A 1NNPA 4EF1A 5EQ7A 3U1OA 1UTBA 3QMFA 2XXWA 3K01A 5I2NA 3IORA 5I56A 3UORA 2Q89A 1DBZA 3TUSA 1FBCA 1FQFA 5ET6A 4PC9A 5I58A 3TCHA 5HPQA 2ZYMA 2XXUA 4RJZA 1OIBA 3KBZA 4IO2A 4X04A 4DXBA 4ELRA 2REGA 3SERA 5A5XA 3UA8A 1D4NA 1Q1KA 3E4RA 3SKPA 2B3FA 4MLVA 2Q8MA 3A29A 4OEUA 3FJMA 4NF6B 5AA2B 2XXTA 4N4UA 3RPLA 4OVQA 4YKKA 3FVOA 1BTJA 2Y5KA 3FVKA 2AL5A 5H8FB 1B40A 1JETA 3E78A 2QFLA 1EYJA 4ELOA 4XXUA 1RDYA 2Q9TA 1LFGA 1LBVA 3HV1A 5BWJA 4RPOA 2ONSA 5EYHA 5I84A 1M5DA 2XXRA 4NEDA 4U23A 3SDFA 4MJOA 1ZU0A 2RINA 4P9KA 1QKAA 5A5LA 1MXXA 1NMUA 1R1NA 1G0IA 3H03A 1R9QA 3Q28A 4OFLA 1IMBA 3SEUA 4JVCA 3FV1A 1M5EA 3OO8A 1ZKBA 4X1DA 3VVDA 4UABA 3K6WA 1PB9A 3TTKA 1GTKA 3BFUA 1EZOA 4P1EA 1ATGA 4IO6A 1N3XA 3TDJA 4Q8RA 1JEUA 1PB7A 3KC0A 1MXZA 4HW8A 4MMPA 4QBAA 1VFDA 3LC8A 3EPEA 4X9TA 2G93A 1SQYA 5DVIA 1XOCA 4U21A 4FAJA 3B7DA 2O51A 4MFIA 2HFBA 4OFOA 5FBPA 2OJTA 2NOOA 1MY3A 4PBHA 1MY0A 4OVSA 1MQHA 2A5TA 3MZ9A 4E0XA 3QAXA 3MYUA 1PBQA 1SW2A 4R72A 1AMFA 4NF8B 4DXCA 2WBBA 3O2AA 2Q2CA 2HXWA 1Y9UA 4GL8A 4MNIA 5I57A 4O7MA 1FPEA 4AB5A 4E0WA 1P1UA 4JXIA 4H5GA 3A3CA 2LAOA 1NV7A 3FJGA 3IAZA 2R71A 4KCCA 1B6HA 3EHTA 3L6GA 1OLCA 1B05A 1GV8A 4GWYA 1T0KA 3P7IA 4ZE9A 1SD3A 3TFLA 4WXJA 4U1OA 2WKYA 2OCUA 3O28A 2WYKA 3TCGA 3H4ZA 1Y1ZA 3N6UA 1TFDA 3Q26A 1LEVA 2XXXA 3RQTA 3CI8A 1R6ZA 4R9FA 1LB9A 3AXFA 3CRBA 1N7XA 4BDMA 2Z22A 2ZZVA 1N3WA 3W15C 3I3VA 1LGBC 4I62A 3UK4A 2XXHA 5B7DA 2DDKA 2XXPA 4QSCA 2PX1A 3MZ1A 1PEBA 1JW1A 2F35A 2ZYKA 2I0BA 1INPA 1NV1A 4YZZA 3K0VA 2RF1A 3KG2A 3BIGA 3MW0A 4LZ5A 1F9BA 1QW0A 4ESWA 3OMBA 3MVWA 4ZEBA 2GH9A 2X7QA 2B65A 3PUZE 4BDNA 1R9LA 3SEXA 3G3JA 3MVZA 2ZZWA 3VLWA 3TQLA 2RC8A 3VVFA 1NI9A 3FZVA 3D1RA 4U22A 2DS9A 3OEMA 1ZIUA 1JP4A 4KYEA 4QSDA 3H6WA 2R6GE 3SEWA 1XS5A 1NV5A 3ECRA 1KZ8A 2F78A 3K6XA 3RT8A 3B50A 4KCDA 1QULA 4NF4B 3FUZA 1MM6A 4U4SA 3RTWB 4FEDA 3G3HA 1ZMGA 4AB6A 1AOVA 5H8QB 2A5TB 2I49A 3C4MA 1O64A 2DXRA 5HBCA 4I3EA 3MUQA 2DWAA 2OWSA 2DVZA 5IZ3B 4YMBA 1B7UA 2HAVA 5IAIA 4PFWA 5EQ9A 1MQDA 1FPFA 2ONKE 1OQGA 1NV0A 1LBXA 3EHSA 1B4ZA 2Z8FA 3C32A 3K6VA 1FBDA 1QUKA 4Z7EA 3FXQA 4PFTA 4GWSA 2HEUA 1FPJA 3TELA 1IXGA 1IEJA 2PYYA 3ZSFA 4N17A 5DVJA 4GOTA 3LSWA 3MQ9A 4HE0A 3TPAA 3RNNA 2R9JA 3M3FA 3PV0E 1FBFA 2Y5LA 1FPIA 1A54A 1B3HA 1RYOA 1FRPA 4G8NA 4KYDA 3DP8A 4EQ9A 2Q74A 1GVCA 4XF5A 1YCJA 3B6TA 4MHFA 4BDQA 3K4UA 1LB8A 4WEPA 2R8TA 4X1BA 4YKJA 2NUVA 4WKMA 3B6WA 1H3DA 3GZGA 3IB2A 4PF8A 4IO5A 4N6PA 2E0SA 3DELB 1O63A 1USYH 3CFXA 3PUVE 1IZ1A 1EYKA 4OHNA 2VD2A 4GL0A 5L9SA 1LCTA 1MDP1 2XXKA 4QHQA 3K1NA 3DM0A 4RK9A 4PDHA 4ISUA 1KWHA 5H8QA 3C36A 4ND9A 5DVFA 4FJPA 3IOVA 4GX4A 1N84A 2XWOA 2Q2AA 4I3YA 1B3GA 1EZ9A 5FHOA 1I69A 4PFRA 4RXLA 4PQJA 2PCRA 3T96B 2V3UA 1FBGA 2OK2A 3T66A 4O7IA 3PGFA 1B51A 2XD3A 3MZBA 4EQ7A 4F3GA 4H0WA 4DXUA 2ALUA 2DVCA 4MIJA 1POY1 3MPKA 4NE4A 4N6DA 2DXYA 4XFEA 2QMWA 3W9WA 4IO4A 4BLAA 4NWCA 2ZMBA 3GBBA 1MY1A 1NH7A 4G8HA 2PFYA 3PPQA 3IJOB 4GFRA 1B4HA 3OELA 3V89B 4NMYA 1AWBA 3E13X 3LUZA 1D9YA 1J1NA 2AL4A 5BUUA 5H8NB 2PMSA 3PPNA 4GWZA 4F18A 4P47A 4FE8A 3TMGA 3TYHA 5ITPA 1MPBA 4PAFA 3R7XA 1BLFA 1ZTYA 4HTGA 4RPNA 2PBWA 4NGUA 4LZ7A 1B7ZA 1K9YA 2O1LA 4I1DA 2CZLA 2QSXA 1Y3NA 2FYIA 1TXFA 2I4CA 4JDFA 4ZEKA 5IKBA 3RGYA 1NNFA 3IB1A 3T0JA 3UGWA 5J1DA 4I9DA 4PFBA 2F7CA 1LBBA 3O6GA 4HE1A 1MPDA 4GVOA 4YU0A 4ELPA 2Q88A 1MM7A 4F2QA 3LV0A 4G68B 4OWDA 4XIGQ 1IMFA 4Q5TA 4AS5A 4X48A 1IMAA 4YKIA 3S2VA 4YAHX 5JTYB 2OZZA 1DK4A 1B1XA 3L6HA 3GBAA 3PPRA 4QSEA 3TQWA 2I3WA 3NOHA 1MXUA 2V3TA 4ZZAA 1OLAA 4P1LA 4HS7A 2YLNA 1IIWA 2RCAA 2VP1A 4GF8A 5ICTA 4TQUQ 2I3VA 4YMAA 2UVIA 2ZYOA 1QGXA 1FPBA 4FIMA 1EZPA 1B5IA 1SI0A 1Z7ME 1FTOA 1GGGA 2H4IA 1LFHA 4QFLA 3GLBA 5I2KA 2WEFA 5CBSA 1B3FA 2HAUA 5AA3A 3EQ1A 2O68A 3TKDA 3ISPA 1B32A 4H8IA 1P99A 5FTHA 4LONB 1SYIA 3ROJA 2PFZA 4LA9A 1XVXA 4FORA 4QFKA 4NN3A 1D9QA 3KJTA 1M5BA 3VE1B 3T1BA 5KCJB 5L9MA 1IUDA 4ZEFA 1LSTA 1A7LA 1N04A 3O97A 2CEYA 5DTBA 3HCQA 2OWZA 3QUFA 3PMVA 4JB7A 3KN7A 3IB0A 3SEVA 5EYFA 2F7BA 1NV2A 1NNKA 1ZLQA 5ISUA 4LZ8A 3RPWA 1SYHA 1LBZA 1US5A 5FTIA 5I59B 1B0HA 1NH8A 1EH3A 2E1SA 1B5HA 4EXLA 2QPQA 4IO3A 2GHAA 2DSFA 2QS3A 4NF5A 2UXAA 3MBPA 4IY5A 4JVIA 1QUIA 3ILTB 2VGQA 1FTLA 2HZKA 3MP8A 4YICA 4FEBA 4Q30B 2F5XA 3CR9A 1FSAA 1FBEA 4O94A 3G7WA 2XX7A 2XXYA 4F3BA 3K00A 2B4LA 4F3SA 4YKPA 5T3JA 2BJIA 5LOMA 2RC7A 3S9LC 2UVGA 3KEIA 4EDPA 2H99A 2XX9A 5AA4B 3G3IA 3RYDA 3WAEA 3THIA 4HCWA 2P0SA 2H5YA 1NFTA 2WYPA 1Y4TA 3M8UA 2DWJA 4M1VA 2XXQA 3N26A 1URSA 5F24A 1N0TA 1WDNA 3KSXA 4KI0E 4R6KA 5ET5A 4LP2B 2HPGA 2CMOA 4DI3D 1BK4A 2DE4A 2F36A 1ZJLA 1IXHA 1QUJA 5AA4A 2KLFA 2BJJX 4H6DA 1A8FA 1PB8A 1N76A 3A3UA 1URDA 5K2XA 3O66A 1L5TA 2I48A 4THIA 4KR5A 1B3LA 4XKPA 1FQDA 3OOAA 1N7WA 5H8FA 3BBRA 4POXA 1JNFA 5L8DA 4N8GA 4F1VA 4QXDA 2QRYA 3CSBA 3D4GA 1FBHA 5AA1A 2HCAA 4R74A 3JYRA 4G68C 1FTAA 3ZKKA 1SBPA 2F3DA 1RDZA 4OETA 4NF0A 5KDTA 3LSXA 2DWHA 3TTRA 3WAFA 1MY4A 3PUWE 4DDDA 3B8BA 4AS4A 4ZE8A 2NWJA 4MF3A 2DOJA 2RCBA 4TLMB 1SW1A 2DWIA 2VT5A 2WBDA 3FJ7A 2OWTA 4IY6A 3K1PA 4JWOA 3VFJA 2V3QA 1B7HA 3H7MA 1B9JA 1DTGA 5I2NB 4MAGA 1WODA 4OFJA 4OXVA 3T22A 1PBPA 4GLIA 4R75A 3UN6A 3VXBA 1II5A 3IO6A 3RTFB 4NF6A 2VPNA 4GX3A 4NAPA 5IZ3A 3S9MC 4QF9A 4F1UA 1H76A 3FGSA 3OO7A 4PFUA 4UA8A 2FIXA 1MQGA 3VXCA 1MH4A 3RY3A 3FIRA 3KOSA 5CMBA 3JZJA 1A8EA 4DE8A 3MP1A 2KR0A 3KBRA 1OVTA 3RT6B 1JVYA 2H9BA 4DCXA 3FXBA 2I6EA 4G68A 4R9GA 3M3LA 4P11A 3C9HA 5CM6A 4QFNA 1Q9DA 3T9VA 4OMBA 1OVBA 1M5FA 4G61A 3IL1B 4NF8A 1NUZA 3VLVA 2NVUB 4GX6A 5TU0A 1QVSA 2Y7WA 4GWUA 3GXAA 3E79A 2XWIA 1MH3A 1A99A 3CG3A 5IZ1A 1IMDA 4MNPA 3IJXB 2F6GA 3KN3A 5H8SA 3DP4A 1NV3A 4TLLB 5DW8A 4LQ2A 2F34A 5IZZA 4XEQA 3ONMA 2FVZA 4OVTA 2Y84A 4NG7A 4HCYA 3N6TA 4C0RA 4TOZA 2I0CA 5H8HA 1RDXA 3MWBA 1HSJA 5F7VA 3PPOA 2V84A 2HHMA 3W9VA 4F19A 1BIYA 2O69A 4RY1A 4R6HA 4ELQA 4G2ZA 4WEDA 2Y7KA 4AQ4A 5KCJA 4OVRA 2O7UA 5AA2D 2ZYNA 4EF2A 3CVGA 5ET8A 1AL3A 2PVUA 4DI4B 2AYSA 1QKBA 3FXUA 4F1YA 2VD3A 3U65A 3SZPA 1KA0A 3IK6B 2O7IA 4IR8A 4BDOA 5CI5A 4NF4A 4O3CA 1FTJA 4N81A 1NUWA 3MJNA 4PDDA 1FPLA 5HM4B 4G8MA 1LBYA 1MS7A 3G3KA 3LBSA 1UTHB 2D3IA 3FVNA 1LAXA 1UIUA 5TPAB 3N94A 4O3BA 5I57B 3HHGA 1Y3PA 3HPIA 4PBQA 4OENA 4ZEDA 2DYXA 2FIEA 1B58A 2QS4A 3OO6A 4ESXA 5DEXB 2F8DA 1O7TA 3VLUA 1JVXA 2OX3A 5IM2A 3VV5A 3B6QA 3LSLA
chains in the Genus database with same CATH topology
1FTMA 4QFLA 4OZ9A 3GLBA 5EHSA 5I2KA 3V83A 4KFQA 1PDAA 3FJGA 3IAZA 1Y1MA 1HSLA 2R71A 4KCCA 1MXYA 4OERA 4JWXA 1B6HA 1LAGE 3EHTA 5A5XB 5CBSA 1B3FA 3L6GA 5DEXA 1OLCA 2HAUA 2B3BA 1B05A 2O68A 3EQ1A 5EHMA 1GV8A 3TKDA 5AA3A 1SI1A 3TZAA 1USYE 1Y3QA 1B32A 3JV9A 5TPAA 1T0KA 3P7IA 3SETA 4ZE9A 2Y7PA 1SD3A 4H8IA 3TFLA 1P99A 1P1NA 4WXJA 5FTHA 1B5JA 4XKQA 2O84X 4LONB 4F31B 4U1OA 1SYIA 1BP5A 1OQHA 2WKYA 2OCUA 3O28A 4LA9A 4U2RA 1XVXA 1LAHE 3U8QA 4FORA 3TCGA 4QFKA 3H4ZA 1Y1ZA 3N6UA 1AIVA 1TFDA 3FATA 4U4XA 3Q26A 3R26A 2XXXA 3ILUB 3RUMA 4R6YA 3RQTA 3KJTA 3V5AA 3LUYA 1DPPA 1S9TA 5H8NA 2ZXTA 3CI8A 1R6ZA 1M5BA 1UTBB 4R73A 2QJEA 4R9FA 1Y4CA 1LB9A 3VE1B 3AXFA 4XKRA 3S4UA 5KCJB 3CFLA 1UIVA 3CRBA 2H25A 5L9MA 3RLFE 1N7XA 1IUDA 5CMCA 2Z22A 1LSTA 4ZEFA 3TTLA 1A7LA 1N04A 3O97A 4KD5A 1OMPA 3C35A 5DTBA 3HCQA 3CG1A 3V8XB 1N3WA 3QUFA 3W15C 1Y20A 2F6PA 3PMVA 3I3VA 3ZS6A 1LGBC 2HQ0A 1FCKA 1RYXA 3E3KA 4JB7A 4N13A 4ZZEA 1H43A 2G29A 3C31A 3IB0A 3KN7A 4GXSB 2XXHA 4I62A 5EYFA 3SEVA 3UK4A 5B7DA 2YJPA 4R2BA 2F7BA 4KPTA 4KQPA 1B0LA 2XXPA 4H65A 4BDMA 1NNKA 3H6UA 3KZGA 2PX1A 1ZLQA 3LSFB 1RKMA 1MPCA 3H6TA 3MZ1A 4QSCA 4IO7A 1PEBA 3UIFA 5ISUA 4LZ8A 3RPWA 3TEPA 1SYHA 1JW1A 1ZBMA 4H1XA 3FVGA 1BKAA 5AA2A 4XKNA 4RA1A 1US5A 2F35A 3R6UA 1XT8A 5FTIA 5KDTB 2ZNTA 4P0GA 2FNCA 1MDQA 1I6AA 1VR5A 5I59B 2ZYKA 2I0BA 1B0HA 2HZLA 3T93B 1NH8A 3H3GA 4YZZA 4MBPA 1EH3A 2E1SA 1B5HA 3K0VA 2RF1A 3KG2A 4EXLA 5AE4A 2QPQA 4IO3A 2UVHA 3MW0A 2W7YA 2GHAA 1ELJA 2DSFA 2Z8DA 2QS3A 1F9BA 1S7YA 2ABHA 3MAMA 1QW0A 3OENA 3Q29A 2UXAA 4NF5A 3OMBA 3QXMA 3MBPA 4UACA 4IY5A 3MVWA 4GIZA 1CE2A 3FASA 3MPLA 4IGTA 5H8HB 4ZEBA 1A55A 1VSOA 1QUIA 3ILTB 3PMXA 3USDA 2GH9A 2X7QA 2B65A 2VGQA 3TAJA 3G3FA 3PUZE 4BDNA 4F29A 1FTLA 1R9LA 1TT1A 1XVYA 2HZKA 1SVXB 3MP8A 4YICA 3U72A 4FEBA 4Q30B 3SEXA 2OLBA 2F5XA 3G3JA 4DLDA 3MVZA 3VLWA 3Q25A 3CR9A 3O6IA 3TQLA 2RC8A 3VVFA 3FV2A 4IB2A 3FZVA 3G7WA 2XX7A 2XXYA 4U22A 5TP9B 1YTVA 2IEEA 5I58B 2DS9A 3OEMA 4F3BA 1ZIUA 3K00A 4EQBA 3D4CA 4LQ5A 4F3PA 4KYEA 4I8CA 4QSDA 3U94A 4DCYA 5DT6A 1DTZA 3H6WA 1DPEA 4F3SA 3O6HA 2R6GE 3SEWA 4YKPA 5LOMA 1XS5A 2Z8EA 3ECRA 2F78A 2RC7A 3K6XA 3S9LC 2UVGA 3KEIA 3PD9A 4EDPA 2H99A 2XX9A 5AA4B 3G3IA 3RT8A 4K3FA 2D21A 3WAEA 1DOTA 4KCDA 3THIA 1JW4A 4HCWA 1A40A 2XD2A 3RN8A 1QULA 4EXKA 4NF4B 3FUZA 1MM6A 3HSTA 4U4SA 3RTWB 5FHMA 3EF7A 3BKIB 3PPPA 1VFEA 2P0SA 2H5YA 2X26A 4H5FA 4OESA 2H98A 2O1MA 1MRPA 1ZMGA 3G3HA 3H06B 3PD8A 4FEDA 5H8QB 4AB6A 1AOVA 1NFTA 1WVJA 2GRVA 1EU8A 2A5TB 1I6QA 3KOTA 2I49A 5CRYA 1Y4TA 4LZ5A 1URGA 4ECFA 3M8UA 2V25A 3C4MA 1HSEA 2DWJA 3DLNA 4GD5A 4M1VA 2XXQA 3N5LA 3QYTA 4JBZA 1O64A 2UYFA 3N26A 2DXRA 5KZTA 5HBCA 2PT1A 4F2OA 3MUQA 3QIMA 2DWAA 2OWSA 1URSA 5I2KB 4PP0A 1N0TA 2DVZA 1WDNA 3EN3A 4FATA 3BFTA 3KSXA 1UTHA 4KI0E 1FTKA 4YMBA 4G77A 4R6KA 1JEVA 4M4GA 4LVQA 1B7UA 4OEVA 2O6AA 4L17A 4LP2B 2CMOA 2HAVA 4RYAA 1QJMA 3OSRA 5IAIA 1XC1A 4PFWA 1TFAA 2DE4A 2F36A 1ZJLA 4PETA 1MQDA 1IXHA 1QUJA 3ZKLA 4NF5B 2ONKE 5AA4A 5CBRA 2KLFA 1IXIA 2BJJX 3MVYA 1OQGA 4H6DA 5M2VA 3C34A 1A8FA 2DE3A 2ZNSA 1PB8A 4LUBA 1N76A 4YB7A 4LATA 3EHSA 2I58A 4OTEA 3FD3A 3A3UA 1B4ZA 2Z8FA 3C32A 3K6VA 1URDA 3MP6A 2OBGA 3IOWA 2AIXA 2GHBA 3SEYA 4DIGA 5JEIA 1CB6A 2RC9A 1B1HA 5K2XA 1B52A 3O66A 1QUKA 4JWYA 3S9EA 1L5TA 2ONRA 3TTNA 4Z7EA 1P1QA 1IITA 3DP6A 2I48A 3T9XB 4THIA 3FXQA 2XXIA 4KR5A 1B3LA 4OQOA 4PFTA 1FQAA 4XKPA 1FQDA 5F1QA 3OOAA 3VVEA 2HEUA 5I59A 2QS1A 1N7WA 2GFEA 1FQCA 1PC3A 1IXGA 3BBRA 3LR1A 4POWA 3TELA 4Q0CA 1JQFA 5H8FA 4POXA 1IEJA 3EHUA 2PYYA 3KFMA 4F22A 3CIJA 3IOUA 3K6UA 4R2FA 3ZSFA 1NKXA 4QRZA 1JNFA 5DVJA 4MLQA 5L8DA 5L9OA 3MVXA 3LSWA 4GOTA 3MQ9A 3TPAA 4F1VA 3RNNA 3TTMA 2QRYA 2R9JA 2Y7IA 3CSBA 3M3FA 3PV0E 4EUOA 1MXVA 3C33A 3IR1A 3CFZA 5I56B 3D4GA 4H67A 1D3KA 2DE2A 2DP8A 3F11A 2HCAA 2ANJA 5AA1A 4ONYA 4R74A 3JYRA 1A54A 4G68C 1B3HA 3H6VA 1SBPA 1FQEA 4PFYA 1S50A 3ZKKA 1RYOA 2VOZA 4OETA 4BDLA 5KDTA 3LSXA 2DWHA 4G8NA 4GRKA 5JK4A 4KYDA 3TTRA 1MG1A 3DP8A 2UVJA 3WAFA 1MY4A 4EQ9A 3SESA 3PUWE 1AH5A 1VE4A 1GVCA 1YCJA 3B6TA 1I6BA 4ZEIA 1MY2A 4DDDA 4BDQA 4N07A 4QFOA 2Y7RA 3K4UA 3O29A 1LB8A 4G4PA 4OVJA 4WEPA 1ANFA 2PT2A 4X1BA 4YKJA 4ZE8A 2NWJA 2NUVA 4MF3A 2DOJA 2RCBA 4JSOA 1SW1A 3B6WA 2DWIA 1H3DA 4TLMB 4WKMA 2ZNUA 3GZGA 2Z23A 3IB2A 2IA4A 1IXCA 1JW5A 2UYEA 3IX1A 5CMKA 4KHZE 3FJ7A 2ESNA 3HN0A 1US4A 4IO5A 3IO4A 2E0SA 2OWTA 3OD7A 4N6PA 3DELB 4IY6A 4P0IA 1O63A 1USYH 3CFXA 3K1PA 1H45A 2V3QA 1B7HA 3PUVE 4JWOA 3H7MA 3VFJA 1IZ1A 3TODA 2XX8A 1B9JA 1DTGA 5I2NB 1NNPA 4OHNA 4EF1A 1WODA 3PMWA 2VD2A 1NL5A 3OSQA 4GL0A 4OFJA 4OXVA 3T22A 5JTYA 5L9SA 1M5CA 1PBPA 1TWYA 1UTBA 3U1OA 1LCTA 2XXWA 2NXOA 4GLIA 4R75A 1MDP1 2QMXA 3UN6A 4QHQA 1II5A 3K1NA 2X7PA 3HHFA 1P1OA 3VXBA 3I5OA 2V93A 3IO6A 3DM0A 3K01A 3RTFB 4BDRA 3IORA 5I2NA 4NF6A 5I56A 3IOTA 3QUJA 2Q89A 1MQIA 3HO7A 4MH5A 4ISUA 4RK9A 1KWHA 3UORA 5H8QA 4ZDMA 3S9MC 3C36A 4QF9A 3TUSA 4ND9A 2XHDA 5DVFA 4F1UA 4FJPA 5K2YA 1MQJA 1B2HA 1H76A 3FGSA 1FQFA 3KN8A 3A09A 3OO7A 4PFUA 4UA8A 3MC2A 4O3AA 3K02A 5I58A 3TCHA 5HPQA 1MQGA 3IOVA 3VXCA 1N84A 2ZYMA 1MH4A 2Q2AA 3FIRA 3RY3A 4RNSA 1B3GA 1EZ9A 3KOSA 5FHOA 1I69A 3JZJA 5CMBA 1A8EA 2XXUA 4QFPA 3MP1A 4DE8A 4NWDA 4RXLA 4RJZA 1OIBA 4PQJA 3UP9A 5ITOA 3KBRA 4IO2A 1OVTA 3G3GA 3RT6B 3T96B 2V3UA 4DXBA 1JVYA 2H9BA 2YPNA 2OK2A 4DCXA 1LAFE 1SW5A 4ELRA 2REGA 3T66A 2I6EA 4G68A 4R9GA 3SERA 5A5XA 3M3LA 3Q27A 3PGFA 3UA8A 4XTCQ 3KJ7A 1D4NA 1B51A 1Q1KA 3E4RA 2XD3A 4P11A 1LLSA 3C9HA 3SKPA 4QFNA 5CM6A 2B3FA 4MLVA 3MZBA 3T9VA 4EQ7A 4OMBA 4DZ1A 4F3GA 4OEUA 1OVBA 3FJMA 1M5FA 2REJA 4JSDA 3M3KA 4NF6B 4H0WA 4DXUA 5AA2B 2ALUA 3IL1B 2XXTA 4NF8A 3VLVA 2DVCA 2NVUB 3FXRA 1POY1 3MPKA 3FVOA 4YKKA 1BTJA 3FVKA 5TU0A 2AL5A 1QVSA 1SDXA 2Y7WA 4H8JA 4NE4A 2QL3A 1Z7NE 3T9UA 3GXAA 5H8FB 1B40A 2DXYA 1JETA 1MH3A 1A99A 2QMWA 1FW0A 3W9WA 3CG3A 4IO4A 4BLAA 3U93A 4ELOA 4NWCA 3O9PA 4GWOA 2ZMBA 3GBBA 3IJXB 1MY1A 1NH7A 3QSLA 4XXUA 4G8HA 2F6GA 2Q9TA 3KN3A 5H8SA 3PPQA 1LFGA 3DP4A 3IJOB 2I4BA 4GFRA 1B4HA 3HV1A 3OELA 3V89B 4NMYA 4TLLB 5BWJA 4LQ2A 2F34A 3E13X 4RPOA 1D9YA 1J1NA 2ONSA 5I84A 1LBCA 4YB6A 4C1TA 2VHAA 1M5DA 2XXRA 3PUXE 4NEDA 3PUYE 3CSGA 3ONMA 2AL4A 4U23A 1Q35A 5ELVA 5BUUA 2DQVA 5H8NB 3KGCA 3SDFA 3T9HB 2PMSA 1H44A 1ZU0A 2P2AA 1D9VA 2RINA 2Y84A 3PPNA 4HCYA 3K2DA 1QKAA 3N6TA 4C0RA 1MXXA 4F18A 4FE8A 1NMUA 1R1NA 3TMGA 5DYHA 4TOZA 3H03A 1R9QA 3Q28A 4OFLA 2I0CA 5H8HA 5CMMA 1IQ7A 3MWBA 3TYHA 1HSJA 5F7VA 3SEUA 4ESWA 5ITPA 3FV1A 1M5EA 1MPBA 4IGRA 3R7XA 3PPOA 2V84A 3OO8A 3U92A 3W9VA 4RK2A 4C1UA 1P1WA 4F19A 4GXAA 1ZKBA 1BIYA 4X1DA 3VVDA 1BLFA 1ZTYA 4HTGA 4OYVA 4RPNA 5ICQA 3S9NC 2PBWA 2O69A 3K6WA 1PB9A 4RY1A 3TTKA 3PU5A 4R6HA 4LZ7A 1GTKA 3BFUA 4ELQA 1EZOA 1B7ZA 4G2ZA 4WEDA 2RKMA 1ATGA 4IO6A 2Y7KA 2Q8JA 4AQ4A 2O1LA 4I1DA 5KCJA 1XHYA 2CZLA 2QSXA 1Y3NA 1N3XA 3TDJA 4Q8RA 2O7UA 1JEUA 1PB7A 2FYIA 5AA2D 1TXFA 1DMBA 2I4CA 2A5SA 2ZYNA 1MXZA 3K1MA 3OXNA 4JDFA 4EF2A 4HW8A 4ZEKA 3CVGA 4Z0IA 5IKBA 1DSNA 1AL3A 2PVUA 1VFDA 3LC8A 4GQOA 3RGYA 1NNFA 3IB1A 3EPEA 2AYSA 1QKBA 2P1SA 3FXUA 2G93A 1SQYA 2VD3A 4X9TA 3UGWA 4F1YA 5DVIA 5J1DA 3IK6B 2O7IA 2F97A 4I9DA 2THIA 1XOCA 2F7CA 4KYSA 1LBBA 3B7DA 3O6GA 4U21A 1MPDA 3VDFA 4BDOA 4FAJA 4GVOA 2O51A 5CI5A 4YU0A 2Q88A 4MFIA 4ELPA 4NF4A 2HFBA 4O3CA 1MM7A 4F2QA 1FTJA 3OO9A 4U1ZA 4OFOA 1B46A 3I6VA 4G68B 3MJNA 4OWDA 4XIGQ 2OJTA 1GR2A 5HM4B 1LFIA 4Q5TA 4G8MA 4X48A 3ODBA 4YKIA 2NOOA 2M8CA 4ZS9A 2FA7A 3S2VA 1MY3A 4YAHX 4PE5B 5JTYB 1MY0A 2OZZA 3E9XA 1MS7A 1B1XA 3G3KA 1B3EA 1MQHA 1SW4A 3L6HA 3GBAA 3LBSA 1UTHB 2A5TA 2D3IA 3PPRA 4FECA 3FVNA 3MZ9A 4QSEA 1NNTA 3TQWA 4E0XA 1LAXA 1UIUA 3QAXA 5TPAB 3N94A 1PBQA 2I3WA 1FQBA 4O3BA 4YB5A 5TP9A 3QK6A 1SW2A 5I57B 1UQWA 2D5WA 3HHGA 4R72A 1Y3PA 5FHNA 3HPIA 1AMFA 4NF8B 1MXUA 4NTLA 4DXCA 2V3TA 4ZZAA 4OENA 1OLAA 4ZEDA 1POTA 2DYXA 1B58A 2QS4A 2YLNA 3OO6A 4HS7A 4ESXA 3O2AA 5DEXB 1YPNA 1LCFA 1IIWA 2HXWA 2Q2CA 2RCAA 2VP1A 4GF8A 1Y9UA 4GL8A 2F8DA 5I57A 2XXVA 3KSJA 4AB5A 4E0WA 4TQUQ 5ICTA 1P1UA 1O7TA 1YAEA 2I3VA 1MXWA 2UVIA 2ZYOA 4JXIA 3VLUA 4YMAA 5B70A 5CC2A 4FIMA 1EZPA 1B5IA 4H5GA 4F39A 4ZECA 1JVXA 3VV5A 3OEKA 3A3CA 1SI0A 1Z7ME 2F7AA 2LAOA 1FTOA 3B6QA 3TCFA 1GGGA 3LSLA 2QS2A 2H4IA 1LFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTM A;  4QFL A;  4OZ9 A;  3GLB A;  5EHS A;  5I2K A;  3V83 A;  4KFQ A;  1PDA A;  3FJG A;  3IAZ A;  1Y1M A;  1HSL A;  2R71 A;  4KCC A;  1MXY A;  4OER A;  4JWX A;  1B6H A;  1LAG E;  3EHT A;  5A5X B;  5CBS A;  1B3F A;  3L6G A;  5DEX A;  1OLC A;  2HAU A;  2B3B A;  1B05 A;  2O68 A;  3EQ1 A;  5EHM A;  1GV8 A;  3TKD A;  5AA3 A;  1SI1 A;  3TZA A;  1USY E;  1Y3Q A;  1B32 A;  3JV9 A;  5TPA A;  1T0K A;  3P7I A;  3SET A;  4ZE9 A;  2Y7P A;  1SD3 A;  4H8I A;  3TFL A;  1P99 A;  1P1N A;  4WXJ A;  5FTH A;  1B5J A;  4XKQ A;  2O84 X;  4LON B;  4F31 B;  4U1O A;  1SYI A;  1BP5 A;  1OQH A;  2WKY A;  2OCU A;  3O28 A;  4LA9 A;  4U2R A;  1XVX A;  1LAH E;  3U8Q A;  4FOR A;  3TCG A;  4QFK A;  3H4Z A;  1Y1Z A;  3N6U A;  1AIV A;  1TFD A;  3FAT A;  4U4X A;  3Q26 A;  3R26 A;  2XXX A;  3ILU B;  3RUM A;  4R6Y A;  3RQT A;  3KJT A;  3V5A A;  3LUY A;  1DPP A;  1S9T A;  5H8N A;  2ZXT A;  3CI8 A;  1R6Z A;  1M5B A;  1UTB B;  4R73 A;  2QJE A;  4R9F A;  1Y4C A;  1LB9 A;  3VE1 B;  3AXF A;  4XKR A;  3S4U A;  5KCJ B;  3CFL A;  1UIV A;  3CRB A;  2H25 A;  5L9M A;  3RLF E;  1N7X A;  1IUD A;  5CMC A;  2Z22 A;  1LST A;  4ZEF A;  3TTL A;  1A7L A;  1N04 A;  3O97 A;  4KD5 A;  1OMP A;  3C35 A;  5DTB A;  3HCQ A;  3CG1 A;  3V8X B;  1N3W A;  3QUF A;  3W15 C;  1Y20 A;  2F6P A;  3PMV A;  3I3V A;  3ZS6 A;  1LGB C;  2HQ0 A;  1FCK A;  1RYX A;  3E3K A;  4JB7 A;  4N13 A;  4ZZE A;  1H43 A;  2G29 A;  3C31 A;  3IB0 A;  3KN7 A;  4GXS B;  2XXH A;  4I62 A;  5EYF A;  3SEV A;  3UK4 A;  5B7D A;  2YJP A;  4R2B A;  2F7B A;  4KPT A;  4KQP A;  1B0L A;  2XXP A;  4H65 A;  4BDM A;  1NNK A;  3H6U A;  3KZG A;  2PX1 A;  1ZLQ A;  3LSF B;  1RKM A;  1MPC A;  3H6T A;  3MZ1 A;  4QSC A;  4IO7 A;  1PEB A;  3UIF A;  5ISU A;  4LZ8 A;  3RPW A;  3TEP A;  1SYH A;  1JW1 A;  1ZBM A;  4H1X A;  3FVG A;  1BKA A;  5AA2 A;  4XKN A;  4RA1 A;  1US5 A;  2F35 A;  3R6U A;  1XT8 A;  5FTI A;  5KDT B;  2ZNT A;  4P0G A;  2FNC A;  1MDQ A;  1I6A A;  1VR5 A;  5I59 B;  2ZYK A;  2I0B A;  1B0H A;  2HZL A;  3T93 B;  1NH8 A;  3H3G A;  4YZZ A;  4MBP A;  1EH3 A;  2E1S A;  1B5H A;  3K0V A;  2RF1 A;  3KG2 A;  4EXL A;  5AE4 A;  2QPQ A;  4IO3 A;  2UVH A;  3MW0 A;  2W7Y A;  2GHA A;  1ELJ A;  2DSF A;  2Z8D A;  2QS3 A;  1F9B A;  1S7Y A;  2ABH A;  3MAM A;  1QW0 A;  3OEN A;  3Q29 A;  2UXA A;  4NF5 A;  3OMB A;  3QXM A;  3MBP A;  4UAC A;  4IY5 A;  3MVW A;  4GIZ A;  1CE2 A;  3FAS A;  3MPL A;  4IGT A;  5H8H B;  4ZEB A;  1A55 A;  1VSO A;  1QUI A;  3ILT B;  3PMX A;  3USD A;  2GH9 A;  2X7Q A;  2B65 A;  2VGQ A;  3TAJ A;  3G3F A;  3PUZ E;  4BDN A;  4F29 A;  1FTL A;  1R9L A;  1TT1 A;  1XVY A;  2HZK A;  1SVX B;  3MP8 A;  4YIC A;  3U72 A;  4FEB A;  4Q30 B;  3SEX A;  2OLB A;  2F5X A;  3G3J A;  4DLD A;  3MVZ A;  3VLW A;  3Q25 A;  3CR9 A;  3O6I A;  3TQL A;  2RC8 A;  3VVF A;  3FV2 A;  4IB2 A;  3FZV A;  3G7W A;  2XX7 A;  2XXY A;  4U22 A;  5TP9 B;  1YTV A;  2IEE A;  5I58 B;  2DS9 A;  3OEM A;  4F3B A;  1ZIU A;  3K00 A;  4EQB A;  3D4C A;  4LQ5 A;  4F3P A;  4KYE A;  4I8C A;  4QSD A;  3U94 A;  4DCY A;  5DT6 A;  1DTZ A;  3H6W A;  1DPE A;  4F3S A;  3O6H A;  2R6G E;  3SEW A;  4YKP A;  5LOM A;  1XS5 A;  2Z8E A;  3ECR A;  2F78 A;  2RC7 A;  3K6X A;  3S9L C;  2UVG A;  3KEI A;  3PD9 A;  4EDP A;  2H99 A;  2XX9 A;  5AA4 B;  3G3I A;  3RT8 A;  4K3F A;  2D21 A;  3WAE A;  1DOT A;  4KCD A;  3THI A;  1JW4 A;  4HCW A;  1A40 A;  2XD2 A;  3RN8 A;  1QUL A;  4EXK A;  4NF4 B;  3FUZ A;  1MM6 A;  3HST A;  4U4S A;  3RTW B;  5FHM A;  3EF7 A;  3BKI B;  3PPP A;  1VFE A;  2P0S A;  2H5Y A;  2X26 A;  4H5F A;  4OES A;  2H98 A;  2O1M A;  1MRP A;  1ZMG A;  3G3H A;  3H06 B;  3PD8 A;  4FED A;  5H8Q B;  4AB6 A;  1AOV A;  1NFT A;  1WVJ A;  2GRV A;  1EU8 A;  2A5T B;  1I6Q A;  3KOT A;  2I49 A;  5CRY A;  1Y4T A;  4LZ5 A;  1URG A;  4ECF A;  3M8U A;  2V25 A;  3C4M A;  1HSE A;  2DWJ A;  3DLN A;  4GD5 A;  4M1V A;  2XXQ A;  3N5L A;  3QYT A;  4JBZ A;  1O64 A;  2UYF A;  3N26 A;  2DXR A;  5KZT A;  5HBC A;  2PT1 A;  4F2O A;  3MUQ A;  3QIM A;  2DWA A;  2OWS A;  1URS A;  5I2K B;  4PP0 A;  1N0T A;  2DVZ A;  1WDN A;  3EN3 A;  4FAT A;  3BFT A;  3KSX A;  1UTH A;  4KI0 E;  1FTK A;  4YMB A;  4G77 A;  4R6K A;  1JEV A;  4M4G A;  4LVQ A;  1B7U A;  4OEV A;  2O6A A;  4L17 A;  4LP2 B;  2CMO A;  2HAV A;  4RYA A;  1QJM A;  3OSR A;  5IAI A;  1XC1 A;  4PFW A;  1TFA A;  2DE4 A;  2F36 A;  1ZJL A;  4PET A;  1MQD A;  1IXH A;  1QUJ A;  3ZKL A;  4NF5 B;  2ONK E;  5AA4 A;  5CBR A;  2KLF A;  1IXI A;  2BJJ X;  3MVY A;  1OQG A;  4H6D A;  5M2V A;  3C34 A;  1A8F A;  2DE3 A;  2ZNS A;  1PB8 A;  4LUB A;  1N76 A;  4YB7 A;  4LAT A;  3EHS A;  2I58 A;  4OTE A;  3FD3 A;  3A3U A;  1B4Z A;  2Z8F A;  3C32 A;  3K6V A;  1URD A;  3MP6 A;  2OBG A;  3IOW A;  2AIX A;  2GHB A;  3SEY A;  4DIG A;  5JEI A;  1CB6 A;  2RC9 A;  1B1H A;  5K2X A;  1B52 A;  3O66 A;  1QUK A;  4JWY A;  3S9E A;  1L5T A;  2ONR A;  3TTN A;  4Z7E A;  1P1Q A;  1IIT A;  3DP6 A;  2I48 A;  3T9X B;  4THI A;  3FXQ A;  2XXI A;  4KR5 A;  1B3L A;  4OQO A;  4PFT A;  1FQA A;  4XKP A;  1FQD A;  5F1Q A;  3OOA A;  3VVE A;  2HEU A;  5I59 A;  2QS1 A;  1N7W A;  2GFE A;  1FQC A;  1PC3 A;  1IXG A;  3BBR A;  3LR1 A;  4POW A;  3TEL A;  4Q0C A;  1JQF A;  5H8F A;  4POX A;  1IEJ A;  3EHU A;  2PYY A;  3KFM A;  4F22 A;  3CIJ A;  3IOU A;  3K6U A;  4R2F A;  3ZSF A;  1NKX A;  4QRZ A;  1JNF A;  5DVJ A;  4MLQ A;  5L8D A;  5L9O A;  3MVX A;  3LSW A;  4GOT A;  3MQ9 A;  3TPA A;  4F1V A;  3RNN A;  3TTM A;  2QRY A;  2R9J A;  2Y7I A;  3CSB A;  3M3F A;  3PV0 E;  4EUO A;  1MXV A;  3C33 A;  3IR1 A;  3CFZ A;  5I56 B;  3D4G A;  4H67 A;  1D3K A;  2DE2 A;  2DP8 A;  3F11 A;  2HCA A;  2ANJ A;  5AA1 A;  4ONY A;  4R74 A;  3JYR A;  1A54 A;  4G68 C;  1B3H A;  3H6V A;  1SBP A;  1FQE A;  4PFY A;  1S50 A;  3ZKK A;  1RYO A;  2VOZ A;  4OET A;  4BDL A;  5KDT A;  3LSX A;  2DWH A;  4G8N A;  4GRK A;  5JK4 A;  4KYD A;  3TTR A;  1MG1 A;  3DP8 A;  2UVJ A;  3WAF A;  1MY4 A;  4EQ9 A;  3SES A;  3PUW E;  1AH5 A;  1VE4 A;  1GVC A;  1YCJ A;  3B6T A;  1I6B A;  4ZEI A;  1MY2 A;  4DDD A;  4BDQ A;  4N07 A;  4QFO A;  2Y7R A;  3K4U A;  3O29 A;  1LB8 A;  4G4P A;  4OVJ A;  4WEP A;  1ANF A;  2PT2 A;  4X1B A;  4YKJ A;  4ZE8 A;  2NWJ A;  2NUV A;  4MF3 A;  2DOJ A;  2RCB A;  4JSO A;  1SW1 A;  3B6W A;  2DWI A;  1H3D A;  4TLM B;  4WKM A;  2ZNU A;  3GZG A;  2Z23 A;  3IB2 A;  2IA4 A;  1IXC A;  1JW5 A;  2UYE A;  3IX1 A;  5CMK A;  4KHZ E;  3FJ7 A;  2ESN A;  3HN0 A;  1US4 A;  4IO5 A;  3IO4 A;  2E0S A;  2OWT A;  3OD7 A;  4N6P A;  3DEL B;  4IY6 A;  4P0I A;  1O63 A;  1USY H;  3CFX A;  3K1P A;  1H45 A;  2V3Q A;  1B7H A;  3PUV E;  4JWO A;  3H7M A;  3VFJ A;  1IZ1 A;  3TOD A;  2XX8 A;  1B9J A;  1DTG A;  5I2N B;  1NNP A;  4OHN A;  4EF1 A;  1WOD A;  3PMW A;  2VD2 A;  1NL5 A;  3OSQ A;  4GL0 A;  4OFJ A;  4OXV A;  3T22 A;  5JTY A;  5L9S A;  1M5C A;  1PBP A;  1TWY A;  1UTB A;  3U1O A;  1LCT A;  2XXW A;  2NXO A;  4GLI A;  4R75 A;  1MDP 1;  2QMX A;  3UN6 A;  4QHQ A;  1II5 A;  3K1N A;  2X7P A;  3HHF A;  1P1O A;  3VXB A;  3I5O A;  2V93 A;  3IO6 A;  3DM0 A;  3K01 A;  3RTF B;  4BDR A;  3IOR A;  5I2N A;  4NF6 A;  5I56 A;  3IOT A;  3QUJ A;  2Q89 A;  1MQI A;  3HO7 A;  4MH5 A;  4ISU A;  4RK9 A;  1KWH A;  3UOR A;  5H8Q A;  4ZDM A;  3S9M C;  3C36 A;  4QF9 A;  3TUS A;  4ND9 A;  2XHD A;  5DVF A;  4F1U A;  4FJP A;  5K2Y A;  1MQJ A;  1B2H A;  1H76 A;  3FGS A;  1FQF A;  3KN8 A;  3A09 A;  3OO7 A;  4PFU A;  4UA8 A;  3MC2 A;  4O3A A;  3K02 A;  5I58 A;  3TCH A;  5HPQ A;  1MQG A;  3IOV A;  3VXC A;  1N84 A;  2ZYM A;  1MH4 A;  2Q2A A;  3FIR A;  3RY3 A;  4RNS A;  1B3G A;  1EZ9 A;  3KOS A;  5FHO A;  1I69 A;  3JZJ A;  5CMB A;  1A8E A;  2XXU A;  4QFP A;  3MP1 A;  4DE8 A;  4NWD A;  4RXL A;  4RJZ A;  1OIB A;  4PQJ A;  3UP9 A;  5ITO A;  3KBR A;  4IO2 A;  1OVT A;  3G3G A;  3RT6 B;  3T96 B;  2V3U A;  4DXB A;  1JVY A;  2H9B A;  2YPN A;  2OK2 A;  4DCX A;  1LAF E;  1SW5 A;  4ELR A;  2REG A;  3T66 A;  2I6E A;  4G68 A;  4R9G A;  3SER A;  5A5X A;  3M3L A;  3Q27 A;  3PGF A;  3UA8 A;  4XTC Q;  3KJ7 A;  1D4N A;  1B51 A;  1Q1K A;  3E4R A;  2XD3 A;  4P11 A;  1LLS A;  3C9H A;  3SKP A;  4QFN A;  5CM6 A;  2B3F A;  4MLV A;  3MZB A;  3T9V A;  4EQ7 A;  4OMB A;  4DZ1 A;  4F3G A;  4OEU A;  1OVB A;  3FJM A;  1M5F A;  2REJ A;  4JSD A;  3M3K A;  4NF6 B;  4H0W A;  4DXU A;  5AA2 B;  2ALU A;  3IL1 B;  2XXT A;  4NF8 A;  3VLV A;  2DVC A;  2NVU B;  3FXR A;  1POY 1;  3MPK A;  3FVO A;  4YKK A;  1BTJ A;  3FVK A;  5TU0 A;  2AL5 A;  1QVS A;  1SDX A;  2Y7W A;  4H8J A;  4NE4 A;  2QL3 A;  1Z7N E;  3T9U A;  3GXA A;  5H8F B;  1B40 A;  2DXY A;  1JET A;  1MH3 A;  1A99 A;  2QMW A;  1FW0 A;  3W9W A;  3CG3 A;  4IO4 A;  4BLA A;  3U93 A;  4ELO A;  4NWC A;  3O9P A;  4GWO A;  2ZMB A;  3GBB A;  3IJX B;  1MY1 A;  1NH7 A;  3QSL A;  4XXU A;  4G8H A;  2F6G A;  2Q9T A;  3KN3 A;  5H8S A;  3PPQ A;  1LFG A;  3DP4 A;  3IJO B;  2I4B A;  4GFR A;  1B4H A;  3HV1 A;  3OEL A;  3V89 B;  4NMY A;  4TLL B;  5BWJ A;  4LQ2 A;  2F34 A;  3E13 X;  4RPO A;  1D9Y A;  1J1N A;  2ONS A;  5I84 A;  1LBC A;  4YB6 A;  4C1T A;  2VHA A;  1M5D A;  2XXR A;  3PUX E;  4NED A;  3PUY E;  3CSG A;  3ONM A;  2AL4 A;  4U23 A;  1Q35 A;  5ELV A;  5BUU A;  2DQV A;  5H8N B;  3KGC A;  3SDF A;  3T9H B;  2PMS A;  1H44 A;  1ZU0 A;  2P2A A;  1D9V A;  2RIN A;  2Y84 A;  3PPN A;  4HCY A;  3K2D A;  1QKA A;  3N6T A;  4C0R A;  1MXX A;  4F18 A;  4FE8 A;  1NMU A;  1R1N A;  3TMG A;  5DYH A;  4TOZ A;  3H03 A;  1R9Q A;  3Q28 A;  4OFL A;  2I0C A;  5H8H A;  5CMM A;  1IQ7 A;  3MWB A;  3TYH A;  1HSJ A;  5F7V A;  3SEU A;  4ESW A;  5ITP A;  3FV1 A;  1M5E A;  1MPB A;  4IGR A;  3R7X A;  3PPO A;  2V84 A;  3OO8 A;  3U92 A;  3W9V A;  4RK2 A;  4C1U A;  1P1W A;  4F19 A;  4GXA A;  1ZKB A;  1BIY A;  4X1D A;  3VVD A;  1BLF A;  1ZTY A;  4HTG A;  4OYV A;  4RPN A;  5ICQ A;  3S9N C;  2PBW A;  2O69 A;  3K6W A;  1PB9 A;  4RY1 A;  3TTK A;  3PU5 A;  4R6H A;  4LZ7 A;  1GTK A;  3BFU A;  4ELQ A;  1EZO A;  1B7Z A;  4G2Z A;  4WED A;  2RKM A;  1ATG A;  4IO6 A;  2Y7K A;  2Q8J A;  4AQ4 A;  2O1L A;  4I1D A;  5KCJ A;  1XHY A;  2CZL A;  2QSX A;  1Y3N A;  1N3X A;  3TDJ A;  4Q8R A;  2O7U A;  1JEU A;  1PB7 A;  2FYI A;  5AA2 D;  1TXF A;  1DMB A;  2I4C A;  2A5S A;  2ZYN A;  1MXZ A;  3K1M A;  3OXN A;  4JDF A;  4EF2 A;  4HW8 A;  4ZEK A;  3CVG A;  4Z0I A;  5IKB A;  1DSN A;  1AL3 A;  2PVU A;  1VFD A;  3LC8 A;  4GQO A;  3RGY A;  1NNF A;  3IB1 A;  3EPE A;  2AYS A;  1QKB A;  2P1S A;  3FXU A;  2G93 A;  1SQY A;  2VD3 A;  4X9T A;  3UGW A;  4F1Y A;  5DVI A;  5J1D A;  3IK6 B;  2O7I A;  2F97 A;  4I9D A;  2THI A;  1XOC A;  2F7C A;  4KYS A;  1LBB A;  3B7D A;  3O6G A;  4U21 A;  1MPD A;  3VDF A;  4BDO A;  4FAJ A;  4GVO A;  2O51 A;  5CI5 A;  4YU0 A;  2Q88 A;  4MFI A;  4ELP A;  4NF4 A;  2HFB A;  4O3C A;  1MM7 A;  4F2Q A;  1FTJ A;  3OO9 A;  4U1Z A;  4OFO A;  1B46 A;  3I6V A;  4G68 B;  3MJN A;  4OWD A;  4XIG Q;  2OJT A;  1GR2 A;  5HM4 B;  1LFI A;  4Q5T A;  4G8M A;  4X48 A;  3ODB A;  4YKI A;  2NOO A;  2M8C A;  4ZS9 A;  2FA7 A;  3S2V A;  1MY3 A;  4YAH X;  4PE5 B;  5JTY B;  1MY0 A;  2OZZ A;  3E9X A;  1MS7 A;  1B1X A;  3G3K A;  1B3E A;  1MQH A;  1SW4 A;  3L6H A;  3GBA A;  3LBS A;  1UTH B;  2A5T A;  2D3I A;  3PPR A;  4FEC A;  3FVN A;  3MZ9 A;  4QSE A;  1NNT A;  3TQW A;  4E0X A;  1LAX A;  1UIU A;  3QAX A;  5TPA B;  3N94 A;  1PBQ A;  2I3W A;  1FQB A;  4O3B A;  4YB5 A;  5TP9 A;  3QK6 A;  1SW2 A;  5I57 B;  1UQW A;  2D5W A;  3HHG A;  4R72 A;  1Y3P A;  5FHN A;  3HPI A;  1AMF A;  4NF8 B;  1MXU A;  4NTL A;  4DXC A;  2V3T A;  4ZZA A;  4OEN A;  1OLA A;  4ZED A;  1POT A;  2DYX A;  1B58 A;  2QS4 A;  2YLN A;  3OO6 A;  4HS7 A;  4ESX A;  3O2A A;  5DEX B;  1YPN A;  1LCF A;  1IIW A;  2HXW A;  2Q2C A;  2RCA A;  2VP1 A;  4GF8 A;  1Y9U A;  4GL8 A;  2F8D A;  5I57 A;  2XXV A;  3KSJ A;  4AB5 A;  4E0W A;  4TQU Q;  5ICT A;  1P1U A;  1O7T A;  1YAE A;  2I3V A;  1MXW A;  2UVI A;  2ZYO A;  4JXI A;  3VLU A;  4YMA A;  5B70 A;  5CC2 A;  4FIM A;  1EZP A;  1B5I A;  4H5G A;  4F39 A;  4ZEC A;  1JVX A;  3VV5 A;  3OEK A;  3A3C A;  1SI0 A;  1Z7M E;  2F7A A;  2LAO A;  1FTO A;  3B6Q A;  3TCF A;  1GGG A;  3LSL A;  2QS2 A;  2H4I A;  1LFH A; 
#chains in the Genus database with same CATH topology
 4OZ9 A;  3V83 A;  1PDA A;  1HSL A;  4OER A;  1MXY A;  5A5X B;  4FBP A;  2CEX A;  5EHM A;  1IME A;  3TZA A;  1Y3Q A;  5TPA A;  3SET A;  5I7I A;  4XKQ A;  2O84 X;  4F31 B;  3RPL B;  1OQH A;  4N6K A;  4U4X A;  3ILU B;  4R6Y A;  3LUY A;  5H8N A;  2ZXT A;  4R73 A;  5IGA A;  1Y4C A;  4GWX A;  3S4U A;  3CFL A;  5CMC A;  3TTL A;  4KD5 A;  3V8X B;  4NX1 A;  2F6P A;  2HQ0 A;  1FCK A;  4ZZE A;  1H43 A;  2G29 A;  3C31 A;  4R2B A;  3IFC A;  4KPT A;  4KQP A;  4PFI A;  4H65 A;  4MNC A;  1MPC A;  3H6T A;  3UIF A;  3TEP A;  1ZBM A;  5AA2 A;  3FVG A;  4XKN A;  4RA1 A;  1XT8 A;  5KDT B;  4P0G A;  2FNC A;  1MDQ A;  1I6A A;  3T93 B;  3H3G A;  5AE4 A;  2UVH A;  1ELJ A;  4KYS A;  2ABH A;  4H46 A;  4UAC A;  3QXM A;  2L5V A;  1CE2 A;  5H8H B;  1A55 A;  1YXI A;  3USD A;  3PMX A;  3G3F A;  1TT1 A;  1XVY A;  2F3B A;  2OLB A;  4DLD A;  4H45 A;  2XA5 A;  3O6I A;  3Q25 A;  3FV2 A;  3KC1 A;  2IEE A;  4I8C A;  3U94 A;  1DTZ A;  1DPE A;  2HXR A;  3O6H A;  1FJ9 A;  2GQ1 A;  5EQ8 A;  1G0H A;  4MX6 A;  4K3F A;  2D21 A;  1DOT A;  1JW4 A;  1A40 A;  4EXK A;  4PCD A;  3HST A;  5LDZ A;  1FPG A;  3PPP A;  1VFE A;  4OES A;  2H98 A;  2O1M A;  2GRV A;  5CRY A;  3KOT A;  1URG A;  3DLN A;  4OYV A;  4YB5 A;  3N5L A;  4JBZ A;  2PT1 A;  1SPI A;  5I2K B;  2FHY A;  3EN3 A;  3BFT A;  1UTH A;  4X8R A;  1FTK A;  4N15 A;  4LVQ A;  2O6A A;  4L17 A;  1QJM A;  1XC1 A;  1IMC A;  4GBV A;  4NF5 B;  3ZKL A;  4MCO A;  1IXI A;  4N91 A;  5M2V A;  3C34 A;  2DE3 A;  4HXV A;  4LUB A;  3FD3 A;  2OBG A;  2AIX A;  2GHB A;  3SEY A;  4DIG A;  1CB6 A;  1B52 A;  4JWY A;  3S9E A;  3TTN A;  3DP6 A;  3T9X B;  1LBW A;  2XXI A;  4OQO A;  4PTK A;  5I59 A;  2QS1 A;  1FQC A;  3LR1 A;  4POW A;  4Q0C A;  1JQF A;  3EHU A;  3KFM A;  4F22 A;  3K6U A;  4QRZ A;  4MLQ A;  5L9O A;  5I56 B;  1XI6 A;  1D3K A;  2DE2 A;  3F11 A;  2ANJ A;  4OA4 A;  4ONY A;  4GBW A;  2VOZ A;  4BDL A;  2QVV A;  5JK4 A;  1MG1 A;  1AH5 A;  1VE4 A;  4N07 A;  4OVJ A;  1ANF A;  4JSO A;  4NQ8 A;  2CZK A;  2ZNU A;  1JW5 A;  3IX1 A;  4JVD A;  3IO4 A;  4ZS9 A;  1H45 A;  2XWK A;  3PMW A;  3OSQ A;  1NL5 A;  4HE2 A;  5JTY A;  1M5C A;  1TWY A;  3VVE A;  2NXO A;  2QMX A;  2B4M A;  2X7P A;  3HHF A;  1P1O A;  3I5O A;  2V93 A;  3IFA A;  4BDR A;  3IOT A;  3QUJ A;  4MH5 A;  1MQI A;  2XWV A;  3HO7 A;  4ZDM A;  2XHD A;  5K2Y A;  1MQJ A;  4PAK A;  1B2H A;  1K9Z A;  3KN8 A;  3A09 A;  3EKI A;  3MC2 A;  5LTC A;  3K02 A;  5ESY A;  4RNS A;  4QFP A;  4NWD A;  4P3L A;  3UP9 A;  5ITO A;  3G3G A;  2YPN A;  1NUY A;  1LAF E;  1SW5 A;  3Q27 A;  4XTC Q;  3KJ7 A;  1LLS A;  4DZ1 A;  2REJ A;  4JSD A;  3M3K A;  3FXR A;  5J16 A;  1SDX A;  4H8J A;  2QL3 A;  1Z7N E;  3T9U A;  1FW0 A;  3U93 A;  3O9P A;  4GWO A;  3QSL A;  5EQA A;  2I4B A;  3CHG A;  1LBC A;  4YB6 A;  4C1T A;  2VHA A;  4PGP A;  3PUX E;  3PUY E;  3CSG A;  1Q35 A;  5ELV A;  2DQV A;  3KGC A;  3T9H B;  1H44 A;  2P2A A;  1D9V A;  3K2D A;  5DYH A;  2QVU A;  5I3S A;  5CMM A;  1IQ7 A;  4IGR A;  3U92 A;  2P3N A;  4RK2 A;  1P1W A;  4C1U A;  4GXA A;  3S9N C;  5ICQ A;  3PU5 A;  1NUX A;  2MKZ A;  1DCU A;  2RKM A;  2ZZX A;  2Q8J A;  1XHY A;  1DMB A;  3K1M A;  2A5S A;  3OXN A;  4Z0I A;  1DSN A;  4GQO A;  4O8M A;  2P1S A;  2P3V A;  2F97 A;  2THI A;  3VDF A;  3BIH A;  4KXP A;  3OO9 A;  4U1Z A;  1B46 A;  3I6V A;  4OVP A;  1GR2 A;  1LFI A;  3ODB A;  2M8C A;  4P8B A;  2FA7 A;  4PE5 B;  3E9X A;  1B3E A;  1SW4 A;  4FEC A;  1KA1 A;  1NNT A;  1FQB A;  5TP9 A;  3QK6 A;  2JJK A;  1UQW A;  2D5W A;  2FBP A;  5FHN A;  1NV6 A;  4NTL A;  1POT A;  1YPN A;  1LCF A;  4PE3 A;  2XXV A;  3KSJ A;  1YAE A;  1MXW A;  5B70 A;  5CC2 A;  4F39 A;  4GWW A;  4ZEC A;  3OEK A;  2F7A A;  3TCF A;  2QS2 A;  2CZI A;  1FTM A;  5EHS A;  4KFQ A;  1Y1M A;  4JWX A;  1LAG E;  5DEX A;  2B3B A;  1SI1 A;  3HFU A;  1USY E;  3JV9 A;  3PTY A;  2Y7P A;  1P1N A;  1B5J A;  1BP5 A;  4U2R A;  1LAH E;  3U8Q A;  1AIV A;  3FAT A;  4PF6 A;  3R26 A;  3RUM A;  1YYZ A;  3V5A A;  1DPP A;  1S9T A;  1UTB B;  2QJE A;  4XKR A;  1UIV A;  3RLF E;  2H25 A;  2VPO A;  1OMP A;  3C35 A;  3CG1 A;  1Y20 A;  3ZS6 A;  4N13 A;  1RYX A;  3E3K A;  4GXS B;  4MEV A;  2YJP A;  1B0L A;  3H6U A;  3KZG A;  3LSF B;  1RKM A;  4IO7 A;  4OAN A;  4H1X A;  1BKA A;  3R6U A;  2ZNT A;  1VR5 A;  1CNQ A;  2HZL A;  4I40 A;  4MBP A;  3GYY A;  2W7Y A;  2Z8D A;  3MAM A;  1S7Y A;  3OEN A;  3Q29 A;  4GIZ A;  3FAS A;  3MPL A;  4IGT A;  1VSO A;  5ET7 A;  3TAJ A;  4F29 A;  1YZ0 A;  1SVX B;  3U72 A;  2KQZ A;  4IB2 A;  5TP9 B;  1YTV A;  5I58 B;  4EQB A;  3D4C A;  4LQ5 A;  4F3P A;  4DCY A;  5DT6 A;  2Z8E A;  1EYI A;  3PD9 A;  2WX9 A;  1FBP A;  2XD2 A;  3RN8 A;  5FHM A;  3EF7 A;  3BKI B;  2X26 A;  4H5F A;  1MRP A;  3H06 B;  3PD8 A;  1WVJ A;  1EU8 A;  1I6Q A;  4ECF A;  2V25 A;  1HSE A;  4GD5 A;  4O3A A;  4P56 A;  3QYT A;  1FPK A;  2UYF A;  3FBP A;  5KZT A;  1FPD A;  4F2O A;  3QIM A;  4PP0 A;  4FAT A;  4G77 A;  1JEV A;  4M4G A;  4OEV A;  2QVR A;  4RYA A;  3OSR A;  1TFA A;  4PET A;  5CBR A;  3MVY A;  2ZNS A;  4YB7 A;  4LAT A;  4OTE A;  2I58 A;  4N8Y A;  5I5P A;  3MP6 A;  3IOW A;  5JEI A;  2RC9 A;  1B1H A;  5EYG A;  2ONR A;  1P1Q A;  1IIT A;  5F1Q A;  1FQA A;  4PGN A;  2GFE A;  1PC3 A;  2V4C A;  3CIJ A;  3IOU A;  4R2F A;  1NKX A;  1VDW A;  2CZH A;  3MVX A;  3TTM A;  2Y7I A;  4EUO A;  1MXV A;  3C33 A;  3IR1 A;  3CFZ A;  4H67 A;  2DP8 A;  3H6V A;  4PFY A;  1FQE A;  1NV4 A;  1S50 A;  3MST A;  4LN5 A;  4GRK A;  1FJ6 A;  2UVJ A;  3SES A;  4NHB A;  4ZEI A;  1I6B A;  1MY2 A;  4QFO A;  2Y7R A;  3O29 A;  4G4P A;  2PT2 A;  2Z23 A;  2IA4 A;  4PAI A;  1IXC A;  2UYE A;  5CMK A;  4KHZ E;  2ESN A;  3HN0 A;  1US4 A;  3OD7 A;  4P0I A;  3TOD A;  2XX8 A;  1NNP A;  4EF1 A;  5EQ7 A;  3U1O A;  1UTB A;  3QMF A;  2XXW A;  3K01 A;  5I2N A;  3IOR A;  5I56 A;  3UOR A;  2Q89 A;  1DBZ A;  3TUS A;  1FBC A;  1FQF A;  5ET6 A;  4PC9 A;  5I58 A;  3TCH A;  5HPQ A;  2ZYM A;  2XXU A;  4RJZ A;  1OIB A;  3KBZ A;  4IO2 A;  4X04 A;  4DXB A;  4ELR A;  2REG A;  3SER A;  5A5X A;  3UA8 A;  1D4N A;  1Q1K A;  3E4R A;  3SKP A;  2B3F A;  4MLV A;  2Q8M A;  3A29 A;  4OEU A;  3FJM A;  4NF6 B;  5AA2 B;  2XXT A;  4N4U A;  3RPL A;  4OVQ A;  4YKK A;  3FVO A;  1BTJ A;  2Y5K A;  3FVK A;  2AL5 A;  5H8F B;  1B40 A;  1JET A;  3E78 A;  2QFL A;  1EYJ A;  4ELO A;  4XXU A;  1RDY A;  2Q9T A;  1LFG A;  1LBV A;  3HV1 A;  5BWJ A;  4RPO A;  2ONS A;  5EYH A;  5I84 A;  1M5D A;  2XXR A;  4NED A;  4U23 A;  3SDF A;  4MJO A;  1ZU0 A;  2RIN A;  4P9K A;  1QKA A;  5A5L A;  1MXX A;  1NMU A;  1R1N A;  1G0I A;  3H03 A;  1R9Q A;  3Q28 A;  4OFL A;  1IMB A;  3SEU A;  4JVC A;  3FV1 A;  1M5E A;  3OO8 A;  1ZKB A;  4X1D A;  3VVD A;  4UAB A;  3K6W A;  1PB9 A;  3TTK A;  1GTK A;  3BFU A;  1EZO A;  4P1E A;  1ATG A;  4IO6 A;  1N3X A;  3TDJ A;  4Q8R A;  1JEU A;  1PB7 A;  3KC0 A;  1MXZ A;  4HW8 A;  4MMP A;  4QBA A;  1VFD A;  3LC8 A;  3EPE A;  4X9T A;  2G93 A;  1SQY A;  5DVI A;  1XOC A;  4U21 A;  4FAJ A;  3B7D A;  2O51 A;  4MFI A;  2HFB A;  4OFO A;  5FBP A;  2OJT A;  2NOO A;  1MY3 A;  4PBH A;  1MY0 A;  4OVS A;  1MQH A;  2A5T A;  3MZ9 A;  4E0X A;  3QAX A;  3MYU A;  1PBQ A;  1SW2 A;  4R72 A;  1AMF A;  4NF8 B;  4DXC A;  2WBB A;  3O2A A;  2Q2C A;  2HXW A;  1Y9U A;  4GL8 A;  4MNI A;  5I57 A;  4O7M A;  1FPE A;  4AB5 A;  4E0W A;  1P1U A;  4JXI A;  4H5G A;  3A3C A;  2LAO A;  1NV7 A;  3FJG A;  3IAZ A;  2R71 A;  4KCC A;  1B6H A;  3EHT A;  3L6G A;  1OLC A;  1B05 A;  1GV8 A;  4GWY A;  1T0K A;  3P7I A;  4ZE9 A;  1SD3 A;  3TFL A;  4WXJ A;  4U1O A;  2WKY A;  2OCU A;  3O28 A;  2WYK A;  3TCG A;  3H4Z A;  1Y1Z A;  3N6U A;  1TFD A;  3Q26 A;  1LEV A;  2XXX A;  3RQT A;  3CI8 A;  1R6Z A;  4R9F A;  1LB9 A;  3AXF A;  3CRB A;  1N7X A;  4BDM A;  2Z22 A;  2ZZV A;  1N3W A;  3W15 C;  3I3V A;  1LGB C;  4I62 A;  3UK4 A;  2XXH A;  5B7D A;  2DDK A;  2XXP A;  4QSC A;  2PX1 A;  3MZ1 A;  1PEB A;  1JW1 A;  2F35 A;  2ZYK A;  2I0B A;  1INP A;  1NV1 A;  4YZZ A;  3K0V A;  2RF1 A;  3KG2 A;  3BIG A;  3MW0 A;  4LZ5 A;  1F9B A;  1QW0 A;  4ESW A;  3OMB A;  3MVW A;  4ZEB A;  2GH9 A;  2X7Q A;  2B65 A;  3PUZ E;  4BDN A;  1R9L A;  3SEX A;  3G3J A;  3MVZ A;  2ZZW A;  3VLW A;  3TQL A;  2RC8 A;  3VVF A;  1NI9 A;  3FZV A;  3D1R A;  4U22 A;  2DS9 A;  3OEM A;  1ZIU A;  1JP4 A;  4KYE A;  4QSD A;  3H6W A;  2R6G E;  3SEW A;  1XS5 A;  1NV5 A;  3ECR A;  1KZ8 A;  2F78 A;  3K6X A;  3RT8 A;  3B50 A;  4KCD A;  1QUL A;  4NF4 B;  3FUZ A;  1MM6 A;  4U4S A;  3RTW B;  4FED A;  3G3H A;  1ZMG A;  4AB6 A;  1AOV A;  5H8Q B;  2A5T B;  2I49 A;  3C4M A;  1O64 A;  2DXR A;  5HBC A;  4I3E A;  3MUQ A;  2DWA A;  2OWS A;  2DVZ A;  5IZ3 B;  4YMB A;  1B7U A;  2HAV A;  5IAI A;  4PFW A;  5EQ9 A;  1MQD A;  1FPF A;  2ONK E;  1OQG A;  1NV0 A;  1LBX A;  3EHS A;  1B4Z A;  2Z8F A;  3C32 A;  3K6V A;  1FBD A;  1QUK A;  4Z7E A;  3FXQ A;  4PFT A;  4GWS A;  2HEU A;  1FPJ A;  3TEL A;  1IXG A;  1IEJ A;  2PYY A;  3ZSF A;  4N17 A;  5DVJ A;  4GOT A;  3LSW A;  3MQ9 A;  4HE0 A;  3TPA A;  3RNN A;  2R9J A;  3M3F A;  3PV0 E;  1FBF A;  2Y5L A;  1FPI A;  1A54 A;  1B3H A;  1RYO A;  1FRP A;  4G8N A;  4KYD A;  3DP8 A;  4EQ9 A;  2Q74 A;  1GVC A;  4XF5 A;  1YCJ A;  3B6T A;  4MHF A;  4BDQ A;  3K4U A;  1LB8 A;  4WEP A;  2R8T A;  4X1B A;  4YKJ A;  2NUV A;  4WKM A;  3B6W A;  1H3D A;  3GZG A;  3IB2 A;  4PF8 A;  4IO5 A;  4N6P A;  2E0S A;  3DEL B;  1O63 A;  1USY H;  3CFX A;  3PUV E;  1IZ1 A;  1EYK A;  4OHN A;  2VD2 A;  4GL0 A;  5L9S A;  1LCT A;  1MDP 1;  2XXK A;  4QHQ A;  3K1N A;  3DM0 A;  4RK9 A;  4PDH A;  4ISU A;  1KWH A;  5H8Q A;  3C36 A;  4ND9 A;  5DVF A;  4FJP A;  3IOV A;  4GX4 A;  1N84 A;  2XWO A;  2Q2A A;  4I3Y A;  1B3G A;  1EZ9 A;  5FHO A;  1I69 A;  4PFR A;  4RXL A;  4PQJ A;  2PCR A;  3T96 B;  2V3U A;  1FBG A;  2OK2 A;  3T66 A;  4O7I A;  3PGF A;  1B51 A;  2XD3 A;  3MZB A;  4EQ7 A;  4F3G A;  4H0W A;  4DXU A;  2ALU A;  2DVC A;  4MIJ A;  1POY 1;  3MPK A;  4NE4 A;  4N6D A;  2DXY A;  4XFE A;  2QMW A;  3W9W A;  4IO4 A;  4BLA A;  4NWC A;  2ZMB A;  3GBB A;  1MY1 A;  1NH7 A;  4G8H A;  2PFY A;  3PPQ A;  3IJO B;  4GFR A;  1B4H A;  3OEL A;  3V89 B;  4NMY A;  1AWB A;  3E13 X;  3LUZ A;  1D9Y A;  1J1N A;  2AL4 A;  5BUU A;  5H8N B;  2PMS A;  3PPN A;  4GWZ A;  4F18 A;  4P47 A;  4FE8 A;  3TMG A;  3TYH A;  5ITP A;  1MPB A;  4PAF A;  3R7X A;  1BLF A;  1ZTY A;  4HTG A;  4RPN A;  2PBW A;  4NGU A;  4LZ7 A;  1B7Z A;  1K9Y A;  2O1L A;  4I1D A;  2CZL A;  2QSX A;  1Y3N A;  2FYI A;  1TXF A;  2I4C A;  4JDF A;  4ZEK A;  5IKB A;  3RGY A;  1NNF A;  3IB1 A;  3T0J A;  3UGW A;  5J1D A;  4I9D A;  4PFB A;  2F7C A;  1LBB A;  3O6G A;  4HE1 A;  1MPD A;  4GVO A;  4YU0 A;  4ELP A;  2Q88 A;  1MM7 A;  4F2Q A;  3LV0 A;  4G68 B;  4OWD A;  4XIG Q;  1IMF A;  4Q5T A;  4AS5 A;  4X48 A;  1IMA A;  4YKI A;  3S2V A;  4YAH X;  5JTY B;  2OZZ A;  1DK4 A;  1B1X A;  3L6H A;  3GBA A;  3PPR A;  4QSE A;  3TQW A;  2I3W A;  3NOH A;  1MXU A;  2V3T A;  4ZZA A;  1OLA A;  4P1L A;  4HS7 A;  2YLN A;  1IIW A;  2RCA A;  2VP1 A;  4GF8 A;  5ICT A;  4TQU Q;  2I3V A;  4YMA A;  2UVI A;  2ZYO A;  1QGX A;  1FPB A;  4FIM A;  1EZP A;  1B5I A;  1SI0 A;  1Z7M E;  1FTO A;  1GGG A;  2H4I A;  1LFH A;  4QFL A;  3GLB A;  5I2K A;  2WEF A;  5CBS A;  1B3F A;  2HAU A;  5AA3 A;  3EQ1 A;  2O68 A;  3TKD A;  3ISP A;  1B32 A;  4H8I A;  1P99 A;  5FTH A;  4LON B;  1SYI A;  3ROJ A;  2PFZ A;  4LA9 A;  1XVX A;  4FOR A;  4QFK A;  4NN3 A;  1D9Q A;  3KJT A;  1M5B A;  3VE1 B;  3T1B A;  5KCJ B;  5L9M A;  1IUD A;  4ZEF A;  1LST A;  1A7L A;  1N04 A;  3O97 A;  2CEY A;  5DTB A;  3HCQ A;  2OWZ A;  3QUF A;  3PMV A;  4JB7 A;  3KN7 A;  3IB0 A;  3SEV A;  5EYF A;  2F7B A;  1NV2 A;  1NNK A;  1ZLQ A;  5ISU A;  4LZ8 A;  3RPW A;  1SYH A;  1LBZ A;  1US5 A;  5FTI A;  5I59 B;  1B0H A;  1NH8 A;  1EH3 A;  2E1S A;  1B5H A;  4EXL A;  2QPQ A;  4IO3 A;  2GHA A;  2DSF A;  2QS3 A;  4NF5 A;  2UXA A;  3MBP A;  4IY5 A;  4JVI A;  1QUI A;  3ILT B;  2VGQ A;  1FTL A;  2HZK A;  3MP8 A;  4YIC A;  4FEB A;  4Q30 B;  2F5X A;  3CR9 A;  1FSA A;  1FBE A;  4O94 A;  3G7W A;  2XX7 A;  2XXY A;  4F3B A;  3K00 A;  2B4L A;  4F3S A;  4YKP A;  5T3J A;  2BJI A;  5LOM A;  2RC7 A;  3S9L C;  2UVG A;  3KEI A;  4EDP A;  2H99 A;  2XX9 A;  5AA4 B;  3G3I A;  3RYD A;  3WAE A;  3THI A;  4HCW A;  2P0S A;  2H5Y A;  1NFT A;  2WYP A;  1Y4T A;  3M8U A;  2DWJ A;  4M1V A;  2XXQ A;  3N26 A;  1URS A;  5F24 A;  1N0T A;  1WDN A;  3KSX A;  4KI0 E;  4R6K A;  5ET5 A;  4LP2 B;  2HPG A;  2CMO A;  4DI3 D;  1BK4 A;  2DE4 A;  2F36 A;  1ZJL A;  1IXH A;  1QUJ A;  5AA4 A;  2KLF A;  2BJJ X;  4H6D A;  1A8F A;  1PB8 A;  1N76 A;  3A3U A;  1URD A;  5K2X A;  3O66 A;  1L5T A;  2I48 A;  4THI A;  4KR5 A;  1B3L A;  4XKP A;  1FQD A;  3OOA A;  1N7W A;  5H8F A;  3BBR A;  4POX A;  1JNF A;  5L8D A;  4N8G A;  4F1V A;  4QXD A;  2QRY A;  3CSB A;  3D4G A;  1FBH A;  5AA1 A;  2HCA A;  4R74 A;  3JYR A;  4G68 C;  1FTA A;  3ZKK A;  1SBP A;  2F3D A;  1RDZ A;  4OET A;  4NF0 A;  5KDT A;  3LSX A;  2DWH A;  3TTR A;  3WAF A;  1MY4 A;  3PUW E;  4DDD A;  3B8B A;  4AS4 A;  4ZE8 A;  2NWJ A;  4MF3 A;  2DOJ A;  2RCB A;  4TLM B;  1SW1 A;  2DWI A;  2VT5 A;  2WBD A;  3FJ7 A;  2OWT A;  4IY6 A;  3K1P A;  4JWO A;  3VFJ A;  2V3Q A;  1B7H A;  3H7M A;  1B9J A;  1DTG A;  5I2N B;  4MAG A;  1WOD A;  4OFJ A;  4OXV A;  3T22 A;  1PBP A;  4GLI A;  4R75 A;  3UN6 A;  3VXB A;  1II5 A;  3IO6 A;  3RTF B;  4NF6 A;  2VPN A;  4GX3 A;  4NAP A;  5IZ3 A;  3S9M C;  4QF9 A;  4F1U A;  1H76 A;  3FGS A;  3OO7 A;  4PFU A;  4UA8 A;  2FIX A;  1MQG A;  3VXC A;  1MH4 A;  3RY3 A;  3FIR A;  3KOS A;  5CMB A;  3JZJ A;  1A8E A;  4DE8 A;  3MP1 A;  2KR0 A;  3KBR A;  1OVT A;  3RT6 B;  1JVY A;  2H9B A;  4DCX A;  3FXB A;  2I6E A;  4G68 A;  4R9G A;  3M3L A;  4P11 A;  3C9H A;  5CM6 A;  4QFN A;  1Q9D A;  3T9V A;  4OMB A;  1OVB A;  1M5F A;  4G61 A;  3IL1 B;  4NF8 A;  1NUZ A;  3VLV A;  2NVU B;  4GX6 A;  5TU0 A;  1QVS A;  2Y7W A;  4GWU A;  3GXA A;  3E79 A;  2XWI A;  1MH3 A;  1A99 A;  3CG3 A;  5IZ1 A;  1IMD A;  4MNP A;  3IJX B;  2F6G A;  3KN3 A;  5H8S A;  3DP4 A;  1NV3 A;  4TLL B;  5DW8 A;  4LQ2 A;  2F34 A;  5IZZ A;  4XEQ A;  3ONM A;  2FVZ A;  4OVT A;  2Y84 A;  4NG7 A;  4HCY A;  3N6T A;  4C0R A;  4TOZ A;  2I0C A;  5H8H A;  1RDX A;  3MWB A;  1HSJ A;  5F7V A;  3PPO A;  2V84 A;  2HHM A;  3W9V A;  4F19 A;  1BIY A;  2O69 A;  4RY1 A;  4R6H A;  4ELQ A;  4G2Z A;  4WED A;  2Y7K A;  4AQ4 A;  5KCJ A;  4OVR A;  2O7U A;  5AA2 D;  2ZYN A;  4EF2 A;  3CVG A;  5ET8 A;  1AL3 A;  2PVU A;  4DI4 B;  2AYS A;  1QKB A;  3FXU A;  4F1Y A;  2VD3 A;  3U65 A;  3SZP A;  1KA0 A;  3IK6 B;  2O7I A;  4IR8 A;  4BDO A;  5CI5 A;  4NF4 A;  4O3C A;  1FTJ A;  4N81 A;  1NUW A;  3MJN A;  4PDD A;  1FPL A;  5HM4 B;  4G8M A;  1LBY A;  1MS7 A;  3G3K A;  3LBS A;  1UTH B;  2D3I A;  3FVN A;  1LAX A;  1UIU A;  5TPA B;  3N94 A;  4O3B A;  5I57 B;  3HHG A;  1Y3P A;  3HPI A;  4PBQ A;  4OEN A;  4ZED A;  2DYX A;  2FIE A;  1B58 A;  2QS4 A;  3OO6 A;  4ESX A;  5DEX B;  2F8D A;  1O7T A;  3VLU A;  1JVX A;  2OX3 A;  5IM2 A;  3VV5 A;  3B6Q A;  3LSL A; 
#chains in the Genus database with same CATH homology
 1FTM A;  4QFL A;  4OZ9 A;  3GLB A;  5EHS A;  5I2K A;  3V83 A;  4KFQ A;  1PDA A;  3FJG A;  3IAZ A;  1Y1M A;  1HSL A;  2R71 A;  4KCC A;  1MXY A;  4OER A;  4JWX A;  1B6H A;  1LAG E;  3EHT A;  5A5X B;  5CBS A;  1B3F A;  3L6G A;  5DEX A;  1OLC A;  2HAU A;  2B3B A;  1B05 A;  2O68 A;  3EQ1 A;  5EHM A;  1GV8 A;  3TKD A;  5AA3 A;  1SI1 A;  3TZA A;  1USY E;  1Y3Q A;  1B32 A;  3JV9 A;  5TPA A;  1T0K A;  3P7I A;  3SET A;  4ZE9 A;  2Y7P A;  1SD3 A;  4H8I A;  3TFL A;  1P99 A;  1P1N A;  4WXJ A;  5FTH A;  1B5J A;  4XKQ A;  2O84 X;  4LON B;  4F31 B;  4U1O A;  1SYI A;  1BP5 A;  1OQH A;  2WKY A;  2OCU A;  3O28 A;  4LA9 A;  4U2R A;  1XVX A;  1LAH E;  3U8Q A;  4FOR A;  3TCG A;  4QFK A;  3H4Z A;  1Y1Z A;  3N6U A;  1AIV A;  1TFD A;  3FAT A;  4U4X A;  3Q26 A;  3R26 A;  2XXX A;  3ILU B;  3RUM A;  4R6Y A;  3RQT A;  3KJT A;  3V5A A;  3LUY A;  1DPP A;  1S9T A;  5H8N A;  2ZXT A;  3CI8 A;  1R6Z A;  1M5B A;  1UTB B;  4R73 A;  2QJE A;  4R9F A;  1Y4C A;  1LB9 A;  3VE1 B;  3AXF A;  4XKR A;  3S4U A;  5KCJ B;  3CFL A;  1UIV A;  3CRB A;  2H25 A;  5L9M A;  3RLF E;  1N7X A;  1IUD A;  5CMC A;  2Z22 A;  1LST A;  4ZEF A;  3TTL A;  1A7L A;  1N04 A;  3O97 A;  4KD5 A;  1OMP A;  3C35 A;  5DTB A;  3HCQ A;  3CG1 A;  3V8X B;  1N3W A;  3QUF A;  3W15 C;  1Y20 A;  2F6P A;  3PMV A;  3I3V A;  3ZS6 A;  1LGB C;  2HQ0 A;  1FCK A;  1RYX A;  3E3K A;  4JB7 A;  4N13 A;  4ZZE A;  1H43 A;  2G29 A;  3C31 A;  3IB0 A;  3KN7 A;  4GXS B;  2XXH A;  4I62 A;  5EYF A;  3SEV A;  3UK4 A;  5B7D A;  2YJP A;  4R2B A;  2F7B A;  4KPT A;  4KQP A;  1B0L A;  2XXP A;  4H65 A;  4BDM A;  1NNK A;  3H6U A;  3KZG A;  2PX1 A;  1ZLQ A;  3LSF B;  1RKM A;  1MPC A;  3H6T A;  3MZ1 A;  4QSC A;  4IO7 A;  1PEB A;  3UIF A;  5ISU A;  4LZ8 A;  3RPW A;  3TEP A;  1SYH A;  1JW1 A;  1ZBM A;  4H1X A;  3FVG A;  1BKA A;  5AA2 A;  4XKN A;  4RA1 A;  1US5 A;  2F35 A;  3R6U A;  1XT8 A;  5FTI A;  5KDT B;  2ZNT A;  4P0G A;  2FNC A;  1MDQ A;  1I6A A;  1VR5 A;  5I59 B;  2ZYK A;  2I0B A;  1B0H A;  2HZL A;  3T93 B;  1NH8 A;  3H3G A;  4YZZ A;  4MBP A;  1EH3 A;  2E1S A;  1B5H A;  3K0V A;  2RF1 A;  3KG2 A;  4EXL A;  5AE4 A;  2QPQ A;  4IO3 A;  2UVH A;  3MW0 A;  2W7Y A;  2GHA A;  1ELJ A;  2DSF A;  2Z8D A;  2QS3 A;  1F9B A;  1S7Y A;  2ABH A;  3MAM A;  1QW0 A;  3OEN A;  3Q29 A;  2UXA A;  4NF5 A;  3OMB A;  3QXM A;  3MBP A;  4UAC A;  4IY5 A;  3MVW A;  4GIZ A;  1CE2 A;  3FAS A;  3MPL A;  4IGT A;  5H8H B;  4ZEB A;  1A55 A;  1VSO A;  1QUI A;  3ILT B;  3PMX A;  3USD A;  2GH9 A;  2X7Q A;  2B65 A;  2VGQ A;  3TAJ A;  3G3F A;  3PUZ E;  4BDN A;  4F29 A;  1FTL A;  1R9L A;  1TT1 A;  1XVY A;  2HZK A;  1SVX B;  3MP8 A;  4YIC A;  3U72 A;  4FEB A;  4Q30 B;  3SEX A;  2OLB A;  2F5X A;  3G3J A;  4DLD A;  3MVZ A;  3VLW A;  3Q25 A;  3CR9 A;  3O6I A;  3TQL A;  2RC8 A;  3VVF A;  3FV2 A;  4IB2 A;  3FZV A;  3G7W A;  2XX7 A;  2XXY A;  4U22 A;  5TP9 B;  1YTV A;  2IEE A;  5I58 B;  2DS9 A;  3OEM A;  4F3B A;  1ZIU A;  3K00 A;  4EQB A;  3D4C A;  4LQ5 A;  4F3P A;  4KYE A;  4I8C A;  4QSD A;  3U94 A;  4DCY A;  5DT6 A;  1DTZ A;  3H6W A;  1DPE A;  4F3S A;  3O6H A;  2R6G E;  3SEW A;  4YKP A;  5LOM A;  1XS5 A;  2Z8E A;  3ECR A;  2F78 A;  2RC7 A;  3K6X A;  3S9L C;  2UVG A;  3KEI A;  3PD9 A;  4EDP A;  2H99 A;  2XX9 A;  5AA4 B;  3G3I A;  3RT8 A;  4K3F A;  2D21 A;  3WAE A;  1DOT A;  4KCD A;  3THI A;  1JW4 A;  4HCW A;  1A40 A;  2XD2 A;  3RN8 A;  1QUL A;  4EXK A;  4NF4 B;  3FUZ A;  1MM6 A;  3HST A;  4U4S A;  3RTW B;  5FHM A;  3EF7 A;  3BKI B;  3PPP A;  1VFE A;  2P0S A;  2H5Y A;  2X26 A;  4H5F A;  4OES A;  2H98 A;  2O1M A;  1MRP A;  1ZMG A;  3G3H A;  3H06 B;  3PD8 A;  4FED A;  5H8Q B;  4AB6 A;  1AOV A;  1NFT A;  1WVJ A;  2GRV A;  1EU8 A;  2A5T B;  1I6Q A;  3KOT A;  2I49 A;  5CRY A;  1Y4T A;  4LZ5 A;  1URG A;  4ECF A;  3M8U A;  2V25 A;  3C4M A;  1HSE A;  2DWJ A;  3DLN A;  4GD5 A;  4M1V A;  2XXQ A;  3N5L A;  3QYT A;  4JBZ A;  1O64 A;  2UYF A;  3N26 A;  2DXR A;  5KZT A;  5HBC A;  2PT1 A;  4F2O A;  3MUQ A;  3QIM A;  2DWA A;  2OWS A;  1URS A;  5I2K B;  4PP0 A;  1N0T A;  2DVZ A;  1WDN A;  3EN3 A;  4FAT A;  3BFT A;  3KSX A;  1UTH A;  4KI0 E;  1FTK A;  4YMB A;  4G77 A;  4R6K A;  1JEV A;  4M4G A;  4LVQ A;  1B7U A;  4OEV A;  2O6A A;  4L17 A;  4LP2 B;  2CMO A;  2HAV A;  4RYA A;  1QJM A;  3OSR A;  5IAI A;  1XC1 A;  4PFW A;  1TFA A;  2DE4 A;  2F36 A;  1ZJL A;  4PET A;  1MQD A;  1IXH A;  1QUJ A;  3ZKL A;  4NF5 B;  2ONK E;  5AA4 A;  5CBR A;  2KLF A;  1IXI A;  2BJJ X;  3MVY A;  1OQG A;  4H6D A;  5M2V A;  3C34 A;  1A8F A;  2DE3 A;  2ZNS A;  1PB8 A;  4LUB A;  1N76 A;  4YB7 A;  4LAT A;  3EHS A;  2I58 A;  4OTE A;  3FD3 A;  3A3U A;  1B4Z A;  2Z8F A;  3C32 A;  3K6V A;  1URD A;  3MP6 A;  2OBG A;  3IOW A;  2AIX A;  2GHB A;  3SEY A;  4DIG A;  5JEI A;  1CB6 A;  2RC9 A;  1B1H A;  5K2X A;  1B52 A;  3O66 A;  1QUK A;  4JWY A;  3S9E A;  1L5T A;  2ONR A;  3TTN A;  4Z7E A;  1P1Q A;  1IIT A;  3DP6 A;  2I48 A;  3T9X B;  4THI A;  3FXQ A;  2XXI A;  4KR5 A;  1B3L A;  4OQO A;  4PFT A;  1FQA A;  4XKP A;  1FQD A;  5F1Q A;  3OOA A;  3VVE A;  2HEU A;  5I59 A;  2QS1 A;  1N7W A;  2GFE A;  1FQC A;  1PC3 A;  1IXG A;  3BBR A;  3LR1 A;  4POW A;  3TEL A;  4Q0C A;  1JQF A;  5H8F A;  4POX A;  1IEJ A;  3EHU A;  2PYY A;  3KFM A;  4F22 A;  3CIJ A;  3IOU A;  3K6U A;  4R2F A;  3ZSF A;  1NKX A;  4QRZ A;  1JNF A;  5DVJ A;  4MLQ A;  5L8D A;  5L9O A;  3MVX A;  3LSW A;  4GOT A;  3MQ9 A;  3TPA A;  4F1V A;  3RNN A;  3TTM A;  2QRY A;  2R9J A;  2Y7I A;  3CSB A;  3M3F A;  3PV0 E;  4EUO A;  1MXV A;  3C33 A;  3IR1 A;  3CFZ A;  5I56 B;  3D4G A;  4H67 A;  1D3K A;  2DE2 A;  2DP8 A;  3F11 A;  2HCA A;  2ANJ A;  5AA1 A;  4ONY A;  4R74 A;  3JYR A;  1A54 A;  4G68 C;  1B3H A;  3H6V A;  1SBP A;  1FQE A;  4PFY A;  1S50 A;  3ZKK A;  1RYO A;  2VOZ A;  4OET A;  4BDL A;  5KDT A;  3LSX A;  2DWH A;  4G8N A;  4GRK A;  5JK4 A;  4KYD A;  3TTR A;  1MG1 A;  3DP8 A;  2UVJ A;  3WAF A;  1MY4 A;  4EQ9 A;  3SES A;  3PUW E;  1AH5 A;  1VE4 A;  1GVC A;  1YCJ A;  3B6T A;  1I6B A;  4ZEI A;  1MY2 A;  4DDD A;  4BDQ A;  4N07 A;  4QFO A;  2Y7R A;  3K4U A;  3O29 A;  1LB8 A;  4G4P A;  4OVJ A;  4WEP A;  1ANF A;  2PT2 A;  4X1B A;  4YKJ A;  4ZE8 A;  2NWJ A;  2NUV A;  4MF3 A;  2DOJ A;  2RCB A;  4JSO A;  1SW1 A;  3B6W A;  2DWI A;  1H3D A;  4TLM B;  4WKM A;  2ZNU A;  3GZG A;  2Z23 A;  3IB2 A;  2IA4 A;  1IXC A;  1JW5 A;  2UYE A;  3IX1 A;  5CMK A;  4KHZ E;  3FJ7 A;  2ESN A;  3HN0 A;  1US4 A;  4IO5 A;  3IO4 A;  2E0S A;  2OWT A;  3OD7 A;  4N6P A;  3DEL B;  4IY6 A;  4P0I A;  1O63 A;  1USY H;  3CFX A;  3K1P A;  1H45 A;  2V3Q A;  1B7H A;  3PUV E;  4JWO A;  3H7M A;  3VFJ A;  1IZ1 A;  3TOD A;  2XX8 A;  1B9J A;  1DTG A;  5I2N B;  1NNP A;  4OHN A;  4EF1 A;  1WOD A;  3PMW A;  2VD2 A;  1NL5 A;  3OSQ A;  4GL0 A;  4OFJ A;  4OXV A;  3T22 A;  5JTY A;  5L9S A;  1M5C A;  1PBP A;  1TWY A;  1UTB A;  3U1O A;  1LCT A;  2XXW A;  2NXO A;  4GLI A;  4R75 A;  1MDP 1;  2QMX A;  3UN6 A;  4QHQ A;  1II5 A;  3K1N A;  2X7P A;  3HHF A;  1P1O A;  3VXB A;  3I5O A;  2V93 A;  3IO6 A;  3DM0 A;  3K01 A;  3RTF B;  4BDR A;  3IOR A;  5I2N A;  4NF6 A;  5I56 A;  3IOT A;  3QUJ A;  2Q89 A;  1MQI A;  3HO7 A;  4MH5 A;  4ISU A;  4RK9 A;  1KWH A;  3UOR A;  5H8Q A;  4ZDM A;  3S9M C;  3C36 A;  4QF9 A;  3TUS A;  4ND9 A;  2XHD A;  5DVF A;  4F1U A;  4FJP A;  5K2Y A;  1MQJ A;  1B2H A;  1H76 A;  3FGS A;  1FQF A;  3KN8 A;  3A09 A;  3OO7 A;  4PFU A;  4UA8 A;  3MC2 A;  4O3A A;  3K02 A;  5I58 A;  3TCH A;  5HPQ A;  1MQG A;  3IOV A;  3VXC A;  1N84 A;  2ZYM A;  1MH4 A;  2Q2A A;  3FIR A;  3RY3 A;  4RNS A;  1B3G A;  1EZ9 A;  3KOS A;  5FHO A;  1I69 A;  3JZJ A;  5CMB A;  1A8E A;  2XXU A;  4QFP A;  3MP1 A;  4DE8 A;  4NWD A;  4RXL A;  4RJZ A;  1OIB A;  4PQJ A;  3UP9 A;  5ITO A;  3KBR A;  4IO2 A;  1OVT A;  3G3G A;  3RT6 B;  3T96 B;  2V3U A;  4DXB A;  1JVY A;  2H9B A;  2YPN A;  2OK2 A;  4DCX A;  1LAF E;  1SW5 A;  4ELR A;  2REG A;  3T66 A;  2I6E A;  4G68 A;  4R9G A;  3SER A;  5A5X A;  3M3L A;  3Q27 A;  3PGF A;  3UA8 A;  4XTC Q;  3KJ7 A;  1D4N A;  1B51 A;  1Q1K A;  3E4R A;  2XD3 A;  4P11 A;  1LLS A;  3C9H A;  3SKP A;  4QFN A;  5CM6 A;  2B3F A;  4MLV A;  3MZB A;  3T9V A;  4EQ7 A;  4OMB A;  4DZ1 A;  4F3G A;  4OEU A;  1OVB A;  3FJM A;  1M5F A;  2REJ A;  4JSD A;  3M3K A;  4NF6 B;  4H0W A;  4DXU A;  5AA2 B;  2ALU A;  3IL1 B;  2XXT A;  4NF8 A;  3VLV A;  2DVC A;  2NVU B;  3FXR A;  1POY 1;  3MPK A;  3FVO A;  4YKK A;  1BTJ A;  3FVK A;  5TU0 A;  2AL5 A;  1QVS A;  1SDX A;  2Y7W A;  4H8J A;  4NE4 A;  2QL3 A;  1Z7N E;  3T9U A;  3GXA A;  5H8F B;  1B40 A;  2DXY A;  1JET A;  1MH3 A;  1A99 A;  2QMW A;  1FW0 A;  3W9W A;  3CG3 A;  4IO4 A;  4BLA A;  3U93 A;  4ELO A;  4NWC A;  3O9P A;  4GWO A;  2ZMB A;  3GBB A;  3IJX B;  1MY1 A;  1NH7 A;  3QSL A;  4XXU A;  4G8H A;  2F6G A;  2Q9T A;  3KN3 A;  5H8S A;  3PPQ A;  1LFG A;  3DP4 A;  3IJO B;  2I4B A;  4GFR A;  1B4H A;  3HV1 A;  3OEL A;  3V89 B;  4NMY A;  4TLL B;  5BWJ A;  4LQ2 A;  2F34 A;  3E13 X;  4RPO A;  1D9Y A;  1J1N A;  2ONS A;  5I84 A;  1LBC A;  4YB6 A;  4C1T A;  2VHA A;  1M5D A;  2XXR A;  3PUX E;  4NED A;  3PUY E;  3CSG A;  3ONM A;  2AL4 A;  4U23 A;  1Q35 A;  5ELV A;  5BUU A;  2DQV A;  5H8N B;  3KGC A;  3SDF A;  3T9H B;  2PMS A;  1H44 A;  1ZU0 A;  2P2A A;  1D9V A;  2RIN A;  2Y84 A;  3PPN A;  4HCY A;  3K2D A;  1QKA A;  3N6T A;  4C0R A;  1MXX A;  4F18 A;  4FE8 A;  1NMU A;  1R1N A;  3TMG A;  5DYH A;  4TOZ A;  3H03 A;  1R9Q A;  3Q28 A;  4OFL A;  2I0C A;  5H8H A;  5CMM A;  1IQ7 A;  3MWB A;  3TYH A;  1HSJ A;  5F7V A;  3SEU A;  4ESW A;  5ITP A;  3FV1 A;  1M5E A;  1MPB A;  4IGR A;  3R7X A;  3PPO A;  2V84 A;  3OO8 A;  3U92 A;  3W9V A;  4RK2 A;  4C1U A;  1P1W A;  4F19 A;  4GXA A;  1ZKB A;  1BIY A;  4X1D A;  3VVD A;  1BLF A;  1ZTY A;  4HTG A;  4OYV A;  4RPN A;  5ICQ A;  3S9N C;  2PBW A;  2O69 A;  3K6W A;  1PB9 A;  4RY1 A;  3TTK A;  3PU5 A;  4R6H A;  4LZ7 A;  1GTK A;  3BFU A;  4ELQ A;  1EZO A;  1B7Z A;  4G2Z A;  4WED A;  2RKM A;  1ATG A;  4IO6 A;  2Y7K A;  2Q8J A;  4AQ4 A;  2O1L A;  4I1D A;  5KCJ A;  1XHY A;  2CZL A;  2QSX A;  1Y3N A;  1N3X A;  3TDJ A;  4Q8R A;  2O7U A;  1JEU A;  1PB7 A;  2FYI A;  5AA2 D;  1TXF A;  1DMB A;  2I4C A;  2A5S A;  2ZYN A;  1MXZ A;  3K1M A;  3OXN A;  4JDF A;  4EF2 A;  4HW8 A;  4ZEK A;  3CVG A;  4Z0I A;  5IKB A;  1DSN A;  1AL3 A;  2PVU A;  1VFD A;  3LC8 A;  4GQO A;  3RGY A;  1NNF A;  3IB1 A;  3EPE A;  2AYS A;  1QKB A;  2P1S A;  3FXU A;  2G93 A;  1SQY A;  2VD3 A;  4X9T A;  3UGW A;  4F1Y A;  5DVI A;  5J1D A;  3IK6 B;  2O7I A;  2F97 A;  4I9D A;  2THI A;  1XOC A;  2F7C A;  4KYS A;  1LBB A;  3B7D A;  3O6G A;  4U21 A;  1MPD A;  3VDF A;  4BDO A;  4FAJ A;  4GVO A;  2O51 A;  5CI5 A;  4YU0 A;  2Q88 A;  4MFI A;  4ELP A;  4NF4 A;  2HFB A;  4O3C A;  1MM7 A;  4F2Q A;  1FTJ A;  3OO9 A;  4U1Z A;  4OFO A;  1B46 A;  3I6V A;  4G68 B;  3MJN A;  4OWD A;  4XIG Q;  2OJT A;  1GR2 A;  5HM4 B;  1LFI A;  4Q5T A;  4G8M A;  4X48 A;  3ODB A;  4YKI A;  2NOO A;  2M8C A;  4ZS9 A;  2FA7 A;  3S2V A;  1MY3 A;  4YAH X;  4PE5 B;  5JTY B;  1MY0 A;  2OZZ A;  3E9X A;  1MS7 A;  1B1X A;  3G3K A;  1B3E A;  1MQH A;  1SW4 A;  3L6H A;  3GBA A;  3LBS A;  1UTH B;  2A5T A;  2D3I A;  3PPR A;  4FEC A;  3FVN A;  3MZ9 A;  4QSE A;  1NNT A;  3TQW A;  4E0X A;  1LAX A;  1UIU A;  3QAX A;  5TPA B;  3N94 A;  1PBQ A;  2I3W A;  1FQB A;  4O3B A;  4YB5 A;  5TP9 A;  3QK6 A;  1SW2 A;  5I57 B;  1UQW A;  2D5W A;  3HHG A;  4R72 A;  1Y3P A;  5FHN A;  3HPI A;  1AMF A;  4NF8 B;  1MXU A;  4NTL A;  4DXC A;  2V3T A;  4ZZA A;  4OEN A;  1OLA A;  4ZED A;  1POT A;  2DYX A;  1B58 A;  2QS4 A;  2YLN A;  3OO6 A;  4HS7 A;  4ESX A;  3O2A A;  5DEX B;  1YPN A;  1LCF A;  1IIW A;  2HXW A;  2Q2C A;  2RCA A;  2VP1 A;  4GF8 A;  1Y9U A;  4GL8 A;  2F8D A;  5I57 A;  2XXV A;  3KSJ A;  4AB5 A;  4E0W A;  4TQU Q;  5ICT A;  1P1U A;  1O7T A;  1YAE A;  2I3V A;  1MXW A;  2UVI A;  2ZYO A;  4JXI A;  3VLU A;  4YMA A;  5B70 A;  5CC2 A;  4FIM A;  1EZP A;  1B5I A;  4H5G A;  4F39 A;  4ZEC A;  1JVX A;  3VV5 A;  3OEK A;  3A3C A;  1SI0 A;  1Z7M E;  2F7A A;  2LAO A;  1FTO A;  3B6Q A;  3TCF A;  1GGG A;  3LSL A;  2QS2 A;  2H4I A;  1LFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...