3GXEA

Complex of a low affinity collagen site with the fibronectin 8-9fni domain pair
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
DQCIVDDITYNVQDTFHKKHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibronectin
publication title Structural analysis of collagen type I interactions with human fibronectin reveals a cooperative binding mode
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3gxeA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3gxeA02
1ZJKA 2QY0A 1VVDA 2JRAA 4C16A 1QO6A 1NWVA 1HFHA 2XRDA 3O8EB 3RJ3D 2MCYA 2RLQA 4IGDA 4PZ5A 1GHQB 1E5GA 2CG6A 4AYEA 3TVJA 1OK9A 4ONTD 3GXEA 4DJZA 3L89M 1U5MA 3MQLA 1E88A 4F4OC 5HYTB 3OXUD 1G4FA 4ZH1D 1OJVA 4JHSA 5HYPA 4KKDA 5JPMG 4WJG2 2XWBF 4B2RA 1H03P 3OEDC 2LOJA 2WIIC 1QGBA 1OK1A 2JGXA 2YRAA 2YBYA 1PPQA 1TPNA 2KMSA 4B2SA 2RKZA 3KZJA 3NFPI 1MD8A 1H2PP 4AYDA 2IZ4A 2EHFA 1G4GA 2XWJI 3OP8A 3ZD2A 4YNXA 5HZPB 3KXVA 1OK3A 3SW0X 2BZMA 1Z92B 2ERJA 2UWNA 3IX0A 1SRZA 1GKGA 1CKLA 2G7IA 1UOTP 1TPMA 3M7PA 4K12A 1HCCA 1SS2A 2CG7A 2IZ3A 2RLPA 2RL0A 1C1ZA 3ZRZA 3T5OA 1OJWA 1TPGA 2XRBA 4AYMA 1MD7A 1O9AA 1ELVA 3CALA 2JGWA 1OJYA 4AYIA 4MUCA 2W80A 2V8EA 1QUBA 2B5ID 1E8BA 1H2QP 2MCZA 3IU3I 1GKNA 1H04P 1FBRA 2RKYA 2O39C 3INBC 3GOVA 1VVCA 4LOSA 4A5WB 1OK2A 2W81A 1LY2A 5I0QB 5HYUB 2CKUA 4J38B 4CSYA 3ZD1A 3ERBA 5FO8C 3R62A 2EC3A 2KRIA 1HFIA 2XQWC 4FXGG 1GPZA 1Q3XA 2A55A 3EJHA 4LOTA
chains in the Genus database with same CATH superfamily
1ZJKA 2QY0A 1VVDA 2JRAA 3FGRA 4C16A 1QO6A 1NWVA 1HFHA 2XRDA 3O8EB 3RJ3D 2MCYA 2RLQA 4IGDA 4PZ5A 1GHQB 1E5GA 2CG6A 4AYEA 3TVJA 1OK9A 4ONTD 3GXEA 4DJZA 3FGTA 3L89M 3WSYA 1U5MA 2Y8SA 3MQLA 1E88A 4F4OC 5HYTB 3OXUD 4MSLA 1G4FA 3F6KA 4ZH1D 1OJVA 4JHSA 5HYPA 4KKDA 5JPMG 4WJG2 2XWBF 4B2RA 1H03P 3OEDC 2LOJA 2WIIC 1QGBA 1OK1A 2JGXA 2YRAA 4YIZA 2YBYA 3K3TA 1PPQA 1TPNA 2KMSA 4B2SA 2RKZA 3KZJA 3NFPI 1MD8A 1H2PP 4AYDA 2IZ4A 2EHFA 1G4GA 2XWJI 3OP8A 3ZD2A 4YNXA 5HZPB 3KXVA 1OK3A 3SW0X 2BZMA 1Z92B 2ERJA 2UWNA 3IX0A 4PO7A 1SRZA 1GKGA 1CKLA 3ZLDA 2G7IA 1UOTP 1TPMA 3M7PA 4K12A 1HCCA 1SS2A 2CG7A 2IZ3A 2RLPA 5DN4A 3WSXA 2RL0A 1C1ZA 3ZRZA 3T5OA 1OJWA 4APLA 1TPGA 2XRBA 4AYMA 2I2LA 4BWCA 1MD7A 1O9AA 1ELVA 3CALA 2JGWA 1OJYA 4AYIA 4MUCA 2W80A 1RLHA 2V8EA 1QUBA 2B5ID 1E8BA 1H2QP 2MCZA 3IU3I 1GKNA 1H04P 3CI0J 1FBRA 2RKYA 2Y8RA 2O39C 3INBC 3GOVA 1VVCA 4LOSA 4A5WB 1OK2A 2W81A 1LY2A 5I0QB 2Y8TA 2ZYCA 5HYUB 2CKUA 4J38B 4N7EA 4CSYA 3VWOA 3ERBA 5FO8C 3ZD1A 3R62A 2EC3A 2KRIA 1HFIA 2XQWC 3NJAA 4FXGG 1GPZA 2X2ZA 3ZLEA 1Q3XA 5DN5A 2A55A 3EJHA 4LOTA
chains in the Genus database with same CATH topology
1ZJKA 2QY0A 1VVDA 2JRAA 4C16A 1QO6A 1NWVA 1HFHA 2XRDA 3O8EB 3RJ3D 2MCYA 2RLQA 4IGDA 4PZ5A 1GHQB 1E5GA 2CG6A 4AYEA 3TVJA 1OK9A 4ONTD 3GXEA 4DJZA 3L89M 1U5MA 3MQLA 1E88A 4F4OC 5HYTB 3OXUD 1G4FA 4ZH1D 1OJVA 4JHSA 5HYPA 4KKDA 5JPMG 4WJG2 2XWBF 4B2RA 1H03P 3OEDC 2LOJA 2WIIC 1QGBA 1OK1A 2JGXA 2YRAA 2YBYA 1PPQA 1TPNA 2KMSA 4B2SA 2RKZA 3KZJA 3NFPI 1MD8A 1H2PP 4AYDA 2IZ4A 2EHFA 1G4GA 2XWJI 3OP8A 3ZD2A 4YNXA 5HZPB 3KXVA 1OK3A 3SW0X 2BZMA 1Z92B 2ERJA 2UWNA 3IX0A 1SRZA 1GKGA 1CKLA 2G7IA 1UOTP 1TPMA 3M7PA 4K12A 1HCCA 1SS2A 2CG7A 2IZ3A 2RLPA 2RL0A 1C1ZA 3ZRZA 3T5OA 1OJWA 1TPGA 2XRBA 4AYMA 1MD7A 1O9AA 1ELVA 3CALA 2JGWA 1OJYA 4AYIA 4MUCA 2W80A 2V8EA 1QUBA 2B5ID 1E8BA 1H2QP 2MCZA 3IU3I 1GKNA 1H04P 1FBRA 2RKYA 2O39C 3INBC 3GOVA 1VVCA 4LOSA 4A5WB 1OK2A 2W81A 1LY2A 5I0QB 5HYUB 2CKUA 4J38B 4CSYA 3ZD1A 3ERBA 5FO8C 3R62A 2EC3A 2KRIA 1HFIA 2XQWC 4FXGG 1GPZA 1Q3XA 2A55A 3EJHA 4LOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJK A;  2QY0 A;  1VVD A;  2JRA A;  4C16 A;  1QO6 A;  1NWV A;  1HFH A;  2XRD A;  3O8E B;  3RJ3 D;  2MCY A;  2RLQ A;  4IGD A;  4PZ5 A;  1GHQ B;  1E5G A;  2CG6 A;  4AYE A;  3TVJ A;  1OK9 A;  4ONT D;  3GXE A;  4DJZ A;  3L89 M;  1U5M A;  3MQL A;  1E88 A;  4F4O C;  5HYT B;  3OXU D;  1G4F A;  4ZH1 D;  1OJV A;  4JHS A;  5HYP A;  4KKD A;  5JPM G;  4WJG 2;  2XWB F;  4B2R A;  1H03 P;  3OED C;  2LOJ A;  2WII C;  1QGB A;  1OK1 A;  2JGX A;  2YRA A;  2YBY A;  1PPQ A;  1TPN A;  2KMS A;  4B2S A;  2RKZ A;  3KZJ A;  3NFP I;  1MD8 A;  1H2P P;  4AYD A;  2IZ4 A;  2EHF A;  1G4G A;  2XWJ I;  3OP8 A;  3ZD2 A;  4YNX A;  5HZP B;  3KXV A;  1OK3 A;  3SW0 X;  2BZM A;  1Z92 B;  2ERJ A;  2UWN A;  3IX0 A;  1SRZ A;  1GKG A;  1CKL A;  2G7I A;  1UOT P;  1TPM A;  3M7P A;  4K12 A;  1HCC A;  1SS2 A;  2CG7 A;  2IZ3 A;  2RLP A;  2RL0 A;  1C1Z A;  3ZRZ A;  3T5O A;  1OJW A;  1TPG A;  2XRB A;  4AYM A;  1MD7 A;  1O9A A;  1ELV A;  3CAL A;  2JGW A;  1OJY A;  4AYI A;  4MUC A;  2W80 A;  2V8E A;  1QUB A;  2B5I D;  1E8B A;  1H2Q P;  2MCZ A;  3IU3 I;  1GKN A;  1H04 P;  1FBR A;  2RKY A;  2O39 C;  3INB C;  3GOV A;  1VVC A;  4LOS A;  4A5W B;  1OK2 A;  2W81 A;  1LY2 A;  5I0Q B;  5HYU B;  2CKU A;  4J38 B;  4CSY A;  3ZD1 A;  3ERB A;  5FO8 C;  3R62 A;  2EC3 A;  2KRI A;  1HFI A;  2XQW C;  4FXG G;  1GPZ A;  1Q3X A;  2A55 A;  3EJH A;  4LOT A; 
#chains in the Genus database with same CATH topology
 1ZJK A;  2QY0 A;  1VVD A;  2JRA A;  3FGR A;  4C16 A;  1QO6 A;  1NWV A;  1HFH A;  2XRD A;  3O8E B;  3RJ3 D;  2MCY A;  2RLQ A;  4IGD A;  4PZ5 A;  1GHQ B;  1E5G A;  2CG6 A;  4AYE A;  3TVJ A;  1OK9 A;  4ONT D;  3GXE A;  4DJZ A;  3FGT A;  3L89 M;  3WSY A;  1U5M A;  2Y8S A;  3MQL A;  1E88 A;  4F4O C;  5HYT B;  3OXU D;  4MSL A;  1G4F A;  3F6K A;  4ZH1 D;  1OJV A;  4JHS A;  5HYP A;  4KKD A;  5JPM G;  4WJG 2;  2XWB F;  4B2R A;  1H03 P;  3OED C;  2LOJ A;  2WII C;  1QGB A;  1OK1 A;  2JGX A;  2YRA A;  4YIZ A;  2YBY A;  3K3T A;  1PPQ A;  1TPN A;  2KMS A;  4B2S A;  2RKZ A;  3KZJ A;  3NFP I;  1MD8 A;  1H2P P;  4AYD A;  2IZ4 A;  2EHF A;  1G4G A;  2XWJ I;  3OP8 A;  3ZD2 A;  4YNX A;  5HZP B;  3KXV A;  1OK3 A;  3SW0 X;  2BZM A;  1Z92 B;  2ERJ A;  2UWN A;  3IX0 A;  4PO7 A;  1SRZ A;  1GKG A;  1CKL A;  3ZLD A;  2G7I A;  1UOT P;  1TPM A;  3M7P A;  4K12 A;  1HCC A;  1SS2 A;  2CG7 A;  2IZ3 A;  2RLP A;  5DN4 A;  3WSX A;  2RL0 A;  1C1Z A;  3ZRZ A;  3T5O A;  1OJW A;  4APL A;  1TPG A;  2XRB A;  4AYM A;  2I2L A;  4BWC A;  1MD7 A;  1O9A A;  1ELV A;  3CAL A;  2JGW A;  1OJY A;  4AYI A;  4MUC A;  2W80 A;  1RLH A;  2V8E A;  1QUB A;  2B5I D;  1E8B A;  1H2Q P;  2MCZ A;  3IU3 I;  1GKN A;  1H04 P;  3CI0 J;  1FBR A;  2RKY A;  2Y8R A;  2O39 C;  3INB C;  3GOV A;  1VVC A;  4LOS A;  4A5W B;  1OK2 A;  2W81 A;  1LY2 A;  5I0Q B;  2Y8T A;  2ZYC A;  5HYU B;  2CKU A;  4J38 B;  4N7E A;  4CSY A;  3VWO A;  3ERB A;  5FO8 C;  3ZD1 A;  3R62 A;  2EC3 A;  2KRI A;  1HFI A;  2XQW C;  3NJA A;  4FXG G;  1GPZ A;  2X2Z A;  3ZLE A;  1Q3X A;  5DN5 A;  2A55 A;  3EJH A;  4LOT A; 
#chains in the Genus database with same CATH homology
 1ZJK A;  2QY0 A;  1VVD A;  2JRA A;  4C16 A;  1QO6 A;  1NWV A;  1HFH A;  2XRD A;  3O8E B;  3RJ3 D;  2MCY A;  2RLQ A;  4IGD A;  4PZ5 A;  1GHQ B;  1E5G A;  2CG6 A;  4AYE A;  3TVJ A;  1OK9 A;  4ONT D;  3GXE A;  4DJZ A;  3L89 M;  1U5M A;  3MQL A;  1E88 A;  4F4O C;  5HYT B;  3OXU D;  1G4F A;  4ZH1 D;  1OJV A;  4JHS A;  5HYP A;  4KKD A;  5JPM G;  4WJG 2;  2XWB F;  4B2R A;  1H03 P;  3OED C;  2LOJ A;  2WII C;  1QGB A;  1OK1 A;  2JGX A;  2YRA A;  2YBY A;  1PPQ A;  1TPN A;  2KMS A;  4B2S A;  2RKZ A;  3KZJ A;  3NFP I;  1MD8 A;  1H2P P;  4AYD A;  2IZ4 A;  2EHF A;  1G4G A;  2XWJ I;  3OP8 A;  3ZD2 A;  4YNX A;  5HZP B;  3KXV A;  1OK3 A;  3SW0 X;  2BZM A;  1Z92 B;  2ERJ A;  2UWN A;  3IX0 A;  1SRZ A;  1GKG A;  1CKL A;  2G7I A;  1UOT P;  1TPM A;  3M7P A;  4K12 A;  1HCC A;  1SS2 A;  2CG7 A;  2IZ3 A;  2RLP A;  2RL0 A;  1C1Z A;  3ZRZ A;  3T5O A;  1OJW A;  1TPG A;  2XRB A;  4AYM A;  1MD7 A;  1O9A A;  1ELV A;  3CAL A;  2JGW A;  1OJY A;  4AYI A;  4MUC A;  2W80 A;  2V8E A;  1QUB A;  2B5I D;  1E8B A;  1H2Q P;  2MCZ A;  3IU3 I;  1GKN A;  1H04 P;  1FBR A;  2RKY A;  2O39 C;  3INB C;  3GOV A;  1VVC A;  4LOS A;  4A5W B;  1OK2 A;  2W81 A;  1LY2 A;  5I0Q B;  5HYU B;  2CKU A;  4J38 B;  4CSY A;  3ZD1 A;  3ERB A;  5FO8 C;  3R62 A;  2EC3 A;  2KRI A;  1HFI A;  2XQW C;  4FXG G;  1GPZ A;  1Q3X A;  2A55 A;  3EJH A;  4LOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...