3GY2A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy2A02
2A4OA 2PKSC 1AKSB 2PKAA 1GJ5H 4X6MA 2LNCA 4NA9H 2VIWA 1WYKA 4BANB 1V2NT 1KXAA 1TWXB 3PLPA 3ZVGA 1OKXA 1BTPA 1ZPZA 1UHBB 1AFQC 3RXVA 3MI4A 3MNBA 1HV7A 2VIPA 3KGPA 4TYDA 4K8BA 5PTPA 1DWDH 1UVUH 1ID5H 2FYQA 4BAQB 5EOKA 4X8VH 1W11U 2ZQ2A 1WCZA 4X6PA 4ZUHA 2HPQH 1LTOA 3UR9A 1AB9C 4X6NA 1CT2E 1HFDA 1S6HA 4B71A 2FEQH 1P09A 1B0FA 1T7CA 1EZSC 2TBSA 1IOEA 1W12U 2BHGA 3W94A 2VVVA 2BQ7B 1WOFA 2ZDLA 1NC6A 3MOCA 3HGPA 1P2IA 3NCLA 1FY1A 1ZPCA 3G01A 1GMHF 1ZJKA 4H42U 1TABE 3I78A 4NG9H 1P3EA 1JRTA 2C90B 3BTKE 3SJ8A 1UVSH 1NS3A 1XVOA 4IGDA 1EP5A 1SSXA 2FM2A 1GJ7B 1ELAA 5ESTE 1OSSA 1SOTA 1GHYH 1BT7A 1PPFE 1TGCA 3GCTF 1ZGVA 1YCPM 2ZCLP 3M3VA 2HNTC 1C1QA 3U1JB 1QNJA 1RXPA 1BMMH 2P94A 3DFJA 2FLBH 3RXJA 2V3HH 4AYYB 3QGNB 3GCNA 3NXPA 5EODA 1CGIE 4X8UH 1DSTA 3MU8A 3UIRA 2BY9X 1BTXA 3MH7A 4DURA 7LPRA 1AWFH 2XXLA 1SGYE 4D8NA 2GDEH 1TNGA 2FYRA 4AYVB 2BX4A 4MNVA 4Y11E 2AIPA 1MBMA 9ESTA 1VCWA 3S9AA 1CU1A 1UCYK 5A8XA 2OQ5A 1WQVH 3UR6A 1FXYA 2AGEX 3UUZA 2FO9A 1SHYA 1TNKA 4GCHF 3UNRA 2P3TB 4O03A 3ZZBA 2O8UA 2CN0H 2BTCE 2AS9A 2FX6A 4MNWA 3LGVA 2VGCB 3VFEA 4BAKB 3GY4A 2J2UA 1O31A 3BF6H 1ELBA 1F2SE 1OP2A 4OS1A 3GICB 1O34A 4AGKA 1MCTA 1XUHA 2Y5GA 1K1OA 2OLGA 2RDLA 1IQLA 1Q2WA 1IQJA 1DS2E 3PTBA 3RC6A 1ESTA 4TWYA 2BQ6B 1DDJA 1LPKB 4DIHH 3F9FA 4DGJA 3SJIA 1QFKH 3ZZAA 3MMGA 5HM9A 2GP9B 1HUTH 1E36B 3TVJB 1V6DA 3K65B 1K21H 1IHTH 2XWBI 3TITA 3C27B 1TGBA 3B23B 1GMCF 4JMYA 1TA2A 4BNRA 1BHXF 1KXEA 4O3TA 2BDYA 3SU5A 1THSH 1V2JT 1HBTH 3TIUA 1C2MA 3RXFA 3SJOA 1L2EA 4UONA 1PQ5A 3Q76A 1SFIA 2QXGA 1H1BA 2H9EH 1G36A 1O2OA 3U8TH 3VB7A 1UCYH 4CRGA 1ABIH 1Q3XA 4YLUA 1A61H 4A7IB 1TB6H 1O36A 1EZUC 1QB6A 1YPHC 2OTVA 3GY8A 4AZ2B 4BOHA 1BUIA 4FXGH 3TH4H 1FJSA 4HZHA 4Q7XA 4ZHAA 1GBTA 4AFQA 2PSYA 3P17H 3RXGA 1TMUH 4UDWH 1AY6H 1SHHB 2EC9H 4INKA 1NFWA 1GHZA 1S81A 2BD8A 3V12A 5JB8S 1SI5H 1H8IH 1BTUA 1O0DH 2FOCA 4YZUA 1C5VA 2O9QA 3BIUH 1P01A 1C4V2 2ODPA 3TK9A 1XXDA 1G30B 1AO5A 4MPWA 5C1XA 5K7RA 2XW9A 1MCVA 1HJAB 4NWKA 3P8FA 4CH8B 1ANCA 1DITH 1C9PA 4KKDA 5IYTA 5E0HA 4LZ4B 3MNCA 1GCDA 2J4IA 1ANDA 1J17T 2Z7FE 3UFAA 2OQUA 1TGSZ 1XUFA 3F9GA 3M5NA 1FV9A 2GV7A 4AB8A 1AKSA 1QY6A 1K9OE 2BXTH 2NU4E 3M7QA 3ODDA 1GHWH 3M3TA 1MU6B 4O9VA 1C5WB 1S85A 1C5OH 1QCPA 3QDZB 2ZGBH 2VH6A 2QF0A 4FU7A 4CRFA 4AFSA 1C2KA 1GHVH 2UUYA 2ZFQH 3O8DA 4A1XA 3U9AH 1T4UH 3GCHB 5FX6A 3BIVH 2J34A 2XNIA 1EPTB 4MPUA 3P70B 1ZHRA 1KXDA 3MO6A 3U69H 1C4U2 4GPGA 2B9LA 3QO6A 1L4DA 1C2FA 3ATMA 5FPYA 3LGIA 1N8OB 1GGDC 3A8AA 2BOHB 4U30A 3GDVA 1P2JA 2ZHEH 4NIVA 1BTWA 2PKAB 5CHAB 1FIZA 3P8NA 1AN1E 2VWNA 2SNWA 1RIWC 1ETRH 1FQ3A 1P05A 3V7TA 3W95A 1OP0A 1WU1A 4ZXXH 1AVXA 2TGTA 2Z9IA 1HXEH 4Y0YE 3T26A 1O2WA 1A5IA 1QGFA 2V6NA 5FAHA 3QK1A 2VJ1A 3NUMA 3A7YA 1O2UA 1LVYA 1SFQB 1ORFA 3ZV9A 3K9XB 1O2VA 2FOEA 4FU9A 1ZMLA 1O2GH 2ZTYA 1GI9B 1GMDF 4DVAU 1NT1A 4ZXYH 1O3DA 3L3TA 1UK4A 1BITA 1HAZB 3I77A 1BTHH 4WH8A 1C5RA 1F0UA 2GZ7A 1TX7A 1P11E 4JYTA 1A0LA 5EG4A 2Z9JA 1AUTC 1BOQA 2AGIX 4AX9H 2H6MA 3OY5U 2R3YA 1CE5A 1G37A 3GYLB 2XC4A 2RA3A 4JZIA 3QTOH 2BDCA 3QLPH 2STBE 1S82A 1IQGA 1EP6A 1GCTB 4X1QU 1CSOE 1OXGA 1WQSA 4RN6A 2BB4A 1GHAF 2QA9E 3ITIA 1F0SA 1VJ9U 3M5OA 1OWJA 5JBBS 1GI3A 3BG4C 4I8LA 4MPXA 3ZZ6A 2YNAA 2AFQB 1O2QA 4JZ1A 1Z8GA 2D26C 3RMLH 2ZA5A 1O2SA 1KSNA 4ASHA 1FONA 1SQOA 1UVTH 3DD2H 2G55A 1KLTA 1EAUA 5JBAS 1PYTC 2HNTE 2HVXA 4FUJA 3AW1A 5FBEA 2Y6TA 1BQYA 1H4WA 4AOQA 2SGDE 4ABDA 1LHEH 1BRCE 1O32A 1LQEA 2PR3A 1MTSA 1P0SH 1Y3WA 1QHRB 4UEHH 1DOJA 1OYQA 2XBWA 1PPZA 4X2VA 4WY3A 2RG3A 5FX5A 5BPEA 1B0EA 1UTPA 5T3HA 4X0WU 1LDTT 5GIBA 2G5VA 1UTNA 1XUIA 1ZRBA 4X2YA 1PQ7A 2GT7A 3KQCA 1H9HE 2O8MA 2P93A 3HATH 1CVWH 1SLWB 3ZV8A 1OX1A 1Y5UT 2SGEE 1GGDB 3HKJB 1GHXH 4UE7H 1PQAA 2ASUB 3FP6E 3U1IB 4B2BA 1HJ8A 2PHBA 4Q2KA 1PPCE 1DLKB 2A4GA 3A85A 4MNXA 1TNLA 4SGAE 3MU5A 1MKXH 3PYHA 3VGCB 2ZFTA 4NWLA 1NN6A 4YM9A 5FPSA 3IWMA 1EKBB 3IG6B 4AFUA 2PUQH 2HPPH 2P8OC 1KXCA 2H9HA 1YPJH 1ELEE 2VIVA 2Z6BD 5A2MH 3Q77A 2BD5A 1TA6A 2HNTF 3JZ1B 4H6SB 2FWWA 2WUBA 4VGCC 5A0AE 1VITF 1C1SA 2VB0A 1SLVB 3ZZ5A 4ESTE 1O3KA 1K1LA 5E0GA 1O3CA 3QWCH 3RM0H 1AMHA 1VGCB 3VEQB 4CRBA 1S84A 1S0QA 1J14A 1P9SA 1W2KH 4BXWA 1EXFA 2AMQA 5DO4H 1Z6EA 3FVFB 4YOGA 5EGMA 1K1PA 1ETSH 4D76A 1C5YB 3A86A 1GBJA 3KHVA 1BJVA 3GCHC 1DANH 1C5UA 1UJ1A 1QBVH 2QN5T 6ESTA 4JK5A 1EJNA 3BTTE 2ZG0H 4DW2U 1Z8IB 1BJUA 1Z1JA 1N1LA 1OPHB 5L6NH 2NU2E 1UVPA 1TGNA 4INLA 5HGGA 3M35A 3BTWE 3MYWA 1P8VC 4B2AA 2R3UA 2ZF0H 3GY7A 3SV6A 1AE8H 1AVWA 1TFXA 1GHBG 2FLRH 5FCKA 1CHOG 2P3UB 1YM0A 2B7DH 1ZRKA 3MH6A 3SNEA 1SGFG 1FIWA 3T5FH 5A0CA 1ESBA 3M5LA 2BVSH 1MTWA 4JZEH 3E8LA 1UTMA 2ZDMA 2GCTB 1C1OA 3SV7A 1YCPK 1P03A 1W13U 3VB4A 2OBOA 5L2YH 4YLQH 1FN8A 1EX3A 1C2HA 1TRNA 2A7CA 3SJKA 5AHGH 1CT4E 4UFGH 1O2ZA 1TPAE 4GLYA 1W14U 2YNBA 5LPFA 2CF8H 4X6OA 4BAHB 3F9EA 1KLJH 1EASA 4IN1A 1VCQA 1GBCA 4X1PU 4CRCA 5JBTA 4LK4A 1GI7B 5T6FA 3TGKE 2HOBA 3M7UA 1YC0A 4HGCA 2A0QB 1G2MA 3PMHB 1YPKH 2R2MB 3A84A 1PYTD 4R8TB 4FUCA 2WPKS 2H5DA 1GI5A 1V3XA 1HPGA 3ZVDA 1N6XA 5JBCS 1CHGA 1Y3YA 1SGIB 2G81E 4KELA 4MNYA 4X1RU 7GCHG 1T4VH 2ZFPH 1O3FA 1EB2A 2D2DA 1IQFA 1XX9A 1O5FH 2SFAA 1A3EH 3PTNA 4B73A 2CGAA 4ABAA 1RD3B 2GCHF 1G3BA 2QYIA 3CP7A 2CV3A 4K69A 4NZQA 1FMGA 4D9RA 2AYWA 5GCHF 4ABIA 4FUGA 2BY8X 4HI3A 1RJXB 2PTCE 4FVBA 2Z9KA 3MH5A 1D3QB 2QXHA 1VCPA 1T8NA 2VINA 2CJIA 2JKHA 3MU4A 2VU8E 4Y8ZA 4LZ1H 1G3DA 1ZTJA 1H9IE 2Q6FA 2ZFRH 3RXIA 1TRMA 3ZVCA 2UWOA 1YGCH 4BAMB 4F4OC 1G3EA 1HB0B 2FXRA 2ZGXH 2BZAA 1QURH 2ZHDA 1SGNE 2P16A 4ZAEA 1LMWB 3CS0A 3RXPA 1G3CA 1L4ZA 2W3IA 4I7YH 2GMTC 3UOPA 2A2XH 1BBRK 1GBLA 2XWAA 1L1GA 2BY6X 3KQEA 4D7FA 2V0BA 1EAIA 2QAAA 4CBNA 4ISOA 3SNAA 3E0NB 3ZZ4A 1NO9H 3ZZ3A 2FOBA 3CS7A 1SR5C 4YOJA 2P59A 2PKSB 3RUOA 2JH5D 3ATKA 3D65E 3O8RA 2J95A 2WYJA 1SGPE 2CXVA 1WUNH 1O2JA 2BLVA 3HGNA 1EOJA 1F92A 3FZZA 4FUFA 2BDIA 1V2MT 2CHAC 1O3IA 3M36A 5BRRE 1LHDH 2DE8A 1EJMA 2Z3EA 1WSSH 2OP9A 2WPJS 4K8YA 2AERH 1O5BB 1GBEA 1E38B 4OS5A 1OOKB 3LGWA 1P12E 2OD3B 1T31A 1TMBH 3A7VA 2FODA 4XBBA 4NZLA 3PO1B 3T28A 2GD4B 1AUJA 3KQDA 3SV9A 5HXFA 1BZXE 1TX6A 1WAYB 6GCHF 3D62A 1CT0E 2G5NA 5C1YA 5C5OA 1CA0C 1ANEA 3A81A 2ZFSA 1P2QA 1ELDE 2VIQA 5AFZH 1C1MA 3FAOA 3R3GB 1O2RA 1A4WH 4DG4A 1HXFH 3PROA 4YTAA 1TONA 1O3MA 3MHWU 2OC0A 5A8ZA 1B7XB 4JYUH 1ZMNA 1O2NA 3BTQE 3OU0A 3UWJH 3SGQE 1AU8A 1K1IA 1EAWA 3IITA 4TPIZ 2BVRH 4THNH 4ABEA 2QF3A 1DWBH 3BG8A 1FPHH 1FAKH 3AVZA 3PWCA 1JRSA 3RMOH 2EI6A 2HWLB 1NFYA 1C4Y2 2FOMB 3SUFA 1LKAA 1BB0B 2ZECA 2OUAA 2FTLE 4WXIA 2ZP0H 1VITH 2GCTC 2SGPE 1THRH 1TNIA 1DWEH 2PSXA 3RDZA 2BOKA 3ZZCA 3V3MA 4B2CA 3DUXH 2V35A 1QRWA 2F9UA 1ZMJA 3KIDU 1AQ7A 3EA8A 2G51A 5LH8A 1O2LA 1FUJA 1CGHA 2KAIA 3NPSA 3V13A 6CHAC 4UFDH 1MZDA 4ZMAH 1QL8A 3SI4H 1HAOH 4OGXA 1H8DH 2HALA 4DJZB 3GY2A 2C8YB 3K6ZA 4F49A 1G9IE 2OC8A 2VWMA 1IQMA 2XCFA 3TU7H 3LH3A 4Z6AH 1J9CH 2VH0A 2O8WA 5CMXH 5HYOA 2BD3A 5DP7A 1WV7H 5FHTA 3PO1C 4ISIH 2Y82A 1ZLRA 2Q6GA 2H5CA 2EA3A 3O8BA 1GCTC 1GBKA 4IMQA 3PMJA 3SO3A 1ETTH 1HAPH 1SLXB 4BTTB 2VVUA 3LGUA 1O3AA 4J2YB 1QB9A 4MPVA 4MTBA 4K60A 2GV6A 3B8JA 3SQEE 1BRUP 2WV5A 1KDQB 1RRKA 5GPIB 1S83A 1NPMA 4ZHLU 3ZVFA 5E2PA 3Q3KA 3A87A 3TH2H 4Z0KA 2BX3A 4ZH8A 1DSUA 3A7WA 1JBUH 1Z8JB 5EPNA 1P10A 4I32A 4U32A 4A5TS 3PLKA 1AE5A 2PV9B 5CHAC 5C67A 1GG6C 3UQVA 4X2XA 1A0JA 2XC0A 2F9OA 1LHCH 4AFZA 1O5EH 3PMAB 1SB1H 2ZPQA 5EQRA 2IPHA 2D1JA 3TJOA 2BLQA 2IN2A 3SNDA 1O3JA 1CO7E 1T8OA 3E6PH 1MTNB 4YT6H 1O33A 1PPBH 4B74A 1O3PB 2C93B 2QIQA 3LIWA 5FCRA 2QXJA 4MDSA 1KY9A 2CMYA 5B6OA 1YLDA 4E7RG 4AN7A 4UD9H 1IQKA 2WV4A 3LJJA 2FOAA 1JXPA 1AVGH 3LOXA 1OWHA 3EQ0H 2Y7ZA 2VIDA 2G4TA 1DX5M 1ZSLA 1BIOA 4IN2A 1EAXA 4X8TH 3RC5A 5DP6A 4K5ZA 1FAXA 3SU0A 1Y8TA 1O2MA 1MUEB 1O5GH 1X7AC 1YLCA 3JZ2B 3RXUA 1KYNA 1C9TA 1IAUA 1BA8B 1F0TA 3RMNH 1CBWC 1ZHPA 1RGQA 1C1NA 3A7ZA 4I8HA 3TJVA 4ABJA 2TGDA 1HYLA 2C8ZB 3BTEE 1OS8A 3OYPA 2FOGA 3GY6A 3ZZ8A 1EATA 1V2ST 2BDBA 1J8AA 4VGCB 1Q31A 1QIXB 4CBOA 1TIOA 2XBXA 2G00A 1OWIA 3SN8A 1C1VH 3NZIA 3O8CA 1J15A 2BDGA 5LPRA 3EA7A 4SGBE 5FBIA 1TYNA 1BCUH 1E37B 4X1NU 1AFEH 4WH6A 1KDQA 4I8KA 1C1PA 1LCYA 1MKWK 4WMEA 1NU9A 4TWWA 3TJNA 1QRZA 2Q1JA 1Z1IA 2PGQB 3PM3A 4XFQA 1GDNA 1P2KA 2F9NA 1RTKA 5EXLA 1W7GH 2ANMH 4K1SA 4AG1A 4K1EA 1A7SA 1SGFA 1V2VT 1Y3VA 2BQWB 4I31A 5DP4A 1SGCA 3RC4A 1GI8B 3BG4B 4IBLH 2H1UA 3N7OA 2A32A 5TCCA 1EJAA 4WJG2 5EW1H 1FZZA 4GSOA 1OP8A 4YT7H 1CQQA 3BEUA 1ELFA 2FI5E 1QQUA 1SQAA 1NESE 4QT8C 2FI4E 5EQQA 1NRQH 1TOCB 1NM6A 1ZHMA 4JZDH 5JDUB 2AGGX 4I8JA 2WPMS 4AB9A 2Y80A 5DK1A 8GCHF 3H5CB 1IQIA 1QJ7B 1TPPA 5F8XA 4JCNA 1XUKA 4K2YA 2FOFA 4A1TA 3UNQA 2P8OB 4ZKNU 4O3UA 2BM2A 1W8BH 1FY8E 4X2WA 1GHAG 3GY3A 1PPHE 1D3DB 1O3GA 3AASA 3F1SB 1JIRA 5G4BA 3HPTB 2TGAA 1O3EA 3QZQA 1GI1A 2JH0D 4KTCA 1A0HB 1O3OA 1YPGH 2W5EA 3KN2A 1DE7H 1Z7KA 2AMDA 2OCVB 3MTYA 2H2ZA 5DKMA 3S9BA 1DT2A 2BLWA 2GTBA 3QUMP 3L33A 2Y5FA 1O3BA 5L30H 3RXHA 1AHTH 1KTSB 3SGAE 2B0FA 1HJ9A 4Y76A 1GBDA 5CE1A 2VIOA 1GL1A 1NRSH 1O2PA 1AD8H 3GOVB 1U6QA 1LPGB 2ODYB 2STAE 1C2GA 2W26A 3KNXA 5EXMA 3KCGH 3M61U 4XE4A 1HAXB 1GPZA 1BBRE 1KXFA 1HAHH 3SJ9A 1TE0A 1TRYA 1Y59T 9LPRA 1V2PT 1GJ6A 3ZVEA 1C5XB 2BLOA 3NKKA 3AAVA 3F9HA 2GVFA 2NU3E 2AIQA 2TRMA 1EOLA 3U8RH 2I6QA 3S0NA 2HLCA 2H9TH 3T62A 5FPTA 3E91A 3VXFH 2IJOB 1D6WA 1GVKB 3H7OA 1LHGH 1N6YA 1DLEA 2ANYA 3QX5H 1C2LA 1TBZH 4IW4E 1L0ZA 1Y5AT 1WTGH 4A1VA 4CR9A 2ZZUH 2ZFFH 1MTNC 8ESTE 4RKJB 2VWOA 2EEKA 2ANKH 2WUCA 3TJUA 1YPHE 5TCAA 1GDUA 1YBWA 1W7XH 3LU9B 1LVMA 1FLEE 1XMNB 2UUFB 1O5AB 4UFFH 3MWIU 4KGAA 7ESTE 2K1QA 1EZXC 2R9PA 1SLUB 5E2OA 1GJCB 2ZDKA 3SNCA 4OS2A 1LVOA 1UMAH 2QC2A 1LPZB 3PV4A 1V2TT 4INHA 3UREA 5T6DA 2G52A 1GBBA 1BTZA 1VITG 1ZOMA 3ZZ9A 1GVLA 4WMDA 4KP0A 3RXLA 1QJ6B 2BDAA 4XSKU 3BSQA 2XTTB 2UWPA 1GJ8B 1D9IA 2GDDA 3T29A 1LHFH 2FMJA 1DXWA 2A5IA 1NRNH 5TJXA 1HJAC 3LGYA 1G2LA 7KMEH 3P8GA 1HDTH 3A80A 3LT3A 3QN7A 1A5GH 2TIOA 2FESH 4HTCH 1DWCH 3RU4D 1ELGA 1KIGH 1QTFA 2ZCKP 3ZVAA 2ODQA 3K2UA 3H7TA 1DVAH 4B76A 5C3NA 3A89A 4CRDA 1DUEA 3GYMA 4D9QA 4YOIA 4ZHMU 2G4UA 1ZTKA 2C4FH 2ULLA 1BTYA 1SGDE 3PWBA 1BMLA 3TNSA 5DP9A 1UTQA 1VZQH 4RKOB 2YOLA 1AB9B 4OS6A 1ABJH 4MQAA 3TPIZ 3M5MA 1YPLH 1NFUA 1P3CA 2PTNA 1ESAA 4A92A 1K22H 2Z3DA 4Y10E 3NK8A 1L1NA 1CHOF 3OTJE 2BY7X 3ZYEA 3RMMH 3S9CA 1ZTLA 2O8TA 2DUCA 1O39A 1L1JA 2ZO3H 2LPRA 3SUDA 4X8SH 1N8OC 4NA7A 1A46H 2AMPA 4K3JA 1SG8B 1MU8B 2HGTH 1ELCA 1TNJA 2OINA 4NIYA 1YKTA 3BTDE 4GHTA 1C5NH 1GL0E 1W10U 4ABGA 2W3KA 1C2JA 1NROH 1S5SA 1T8LA 2FS9A 3SOSA 1ZSJA 2F9VA 4CRAA 1SOZA 1A3BH 2TGPZ 2FTMA 1Y5BT 1D4PB 3MU1A 1CA8B 1C5LH 1MMJN 4AORA 1GI6A 2VVCA 3RU4T 1PQ8A 1S6FA 1TQ7B 3FZDA 4DY7B 5JB9S 3M7TA 1KTTB 4Y8YA 1JIMA 3RXSA 2ZPSA 1GMHG 2Y81A 1GBMA 3ZYDA 2C3SA 1GDQA 2QGRA 2ZEBA 3ATWA 4WVPE 1A1RA 1NU7B 3B9FH 4ISHH 3SI3H 3VB6A 1IHSH 1UK3A 3P92A 1BRBE 2WPHS 3MO9A 2UUKB 4K1TA 3MFJA 2GZ9A 1P2OA 3DT0H 2CHAB 2NWNA 3BEIB 3GCTG 3GDSA 5F8TA 3ESTA 3RLYH 4ZKOU 7GCHF 2XCNA 3BTHE 2F91A 2IOTA 4ISLA 1O30A 3RXEA 4CREA 4FU8A 3DFLA 2RCEA 1ZGIA 5LGOA 2ZGHA 1OYTH 1UCYE 2GCHG 1VJAU 4FVDA 1OWEA 2FPZA 4ABFA 1SGEE 3T27A 1GBAA 1ZSKA 3SU2A 1OWKA 3EGKH 3Q3XA 5GCHG 1TGTA 2FOHA 3A83A 2GGVB 1MTVA 1K1JA 3LKWA 1Z71A 5JYIA 1SGQE 1MKXK 2WPLS 4ABHA 1UTLM 1E35B 4BXSA 1F5LA 1IQHA 1YYY1 2M5TA 1V2WT 1GI4A 4GCHG 2ZDVH 1GI0A 2JH6D 5C5NA 1XM1A 1BMNH 1HAIH 1NFXA 2BZ6H 3LDXH 4TY6A 1D6RA 4FUDA 1TALA 2ZHFH 4ABBA 1K28D 3SQHE 1GWAA 2QY0B 1XKBC 3TGIE 3KEEA 3U8OH 3A7TA 1C5PA 3RXCA 3STJA 1C5MD 4Y7BA 3RP2A 3HKIB 1HAGE 4NFFA 3RXOA 3E16B 4LXBH 1DXPA 2A2QH 1V2LT 1O2IA 3KF2A 4Y7AA 2SGAA 1QA0A 1QBNA 2F83A 4E05H 1FDPA 1K1MA 1SQTA 1MH0A 3EAJA 3TNTA 2BD2A 2ZHQH 5F8ZA 1LVBA 1CGJE 1MZAA 2SGFE 1F0RA 3RXBA 1GMCG 3LPRA 1ANBA 1BDAA 1JWTA 5L2ZH 1IQEA 4E06H 1YPEH 1MQ6A 2PLXA 3PLBA 2R2WU 1O2YA 1SVPA 5SGAE 1WBGB 1AIXH 1WTHD 2WPIS 1F5RA 1MTUA 1SBWA 1TPSA 4BTUB 1CBWB 3OY6U 2A4RA 1INCA 2KAIB 2R0LA 3MNXA 1AZZA 2J9NA 1O38A 1JOUB 2G8TA 3SHCH 1MD8A 2VNTA 1T8MA 1MQ5A 4H4FA 3RXAA 2EI7A 4TY7A 3ELAH 3E0PB 3DHKH 6GCHG 5T6GA 1AFQB 4AGJA 3SU1A 1OWDA 2AEIH 4CHAC 1SC8U 1GG6B 5C20A 2FI3E 1ELTA 1RTLA 5EU8A 1NRRH 5DG6A 3ZVBA 6CHAB 2I6SA 3RU4E 3U98H 3A7XA 5F03A 2Q6DA 1QL9A 1PPGE 1UO6A 1V2UT 2QCYA 2PGBB 2ZGJA 2ANWA 2ZIQH 1AZ8A 4JK6A 2W7SA 1HIAA 3FFGA 2ZU2A 5K0HA 2Y7XA 4Y79A 4XBCA 4DIIH 4OS4A 4XOJA 1W0ZU 3CENA 4TPYA 3URCA 3ODFA 2OBQA 3F6UH 1DFPA 4BTIB 1K1NA 3VB5A 4Y0ZE 4NSYA 2PWXA 3UWIA 1M9UA 1Z8RA 3BEFB 4J1YA 5DP8A 5ETXA 1FY3A 3S69A 1NTPA 1GVZA 1RIWB 3D23A 3A82A 3FP7E 3SV2H 4Q80A 1AGJA 4IC6A 5EPYA 1QBOA 1C1UH 3ZZDA 4IMZA 1UK2A 1W3CA 2HRVA 4RSPA 3FP8E 1C2IA 4NGAH 2O8LA 4GUXA 2C8XB 3SGBE 2ZQ1A 1XXFA 4HFPB 1DY8A 1BBRH 1W0YH 1C2DA 1QA7A 2ZTZA 1P04A 1THPB 1LKBA 8LPRA 1ACBE 1TNHA 3BN9A 4ZKRU 1BMAA 3F68H 3FANA 3KL6A 1E0FD 1V2QT 3RLWH 5DPAA 1O2XA 1O2KA 1PPEE 3LC3A 2ZKSA 3OSYA 1V2OT 3BTFE 1DM4B 2XBYA 3D49H 3BTGE 2OC1A 3T2NA 3V0XA 3RXQA 1O35A 6LPRA 2Z94A 1GJ4H 3ENSB 4IC5A 1UVOA 4XBDA 2QV1A 1GMDG 2UWLA 3BV9B 2SNVA 2W7UA 3PB1E 3P95A 1EPTC 5HMAA 3A8CA 1ZZZA 4WWYA 1D3PB 2D8WA 4NA8A 5I25A 5ABWA 1MD7A 2FP7B 3MU0A 3HK3B 4JYVH 4Y6DA 8KME2 2ZTXA 2FX4A 3SBKA 1Y3XA 3STIA 4CHAB 1RTFB 4KTUA 4PROA 2TPIZ 2GKVE 5GDSH 1GJBB 1HLTH 3ATLA 1C5TA 3VXEH 2ALPA 2WYGA 2V3OH 2FZZA 4CH2B 1O37A 2VWLA 3QZRA 3ZZ7A 2PUXB 2B8OH 4MVNA 4OS7A 1F5KU 1P9UA 5E0JA 1KXBA 1O2TA 3M3SA 4IS5A 4FUIA 4NFEA 5DP5A 1ZJDA 4LOYH 2ILNA 4Q7ZA 5DJ7A 2GX4A 4ISNA 2P3FH 1QL7A 3BTME 1GBIA 1C5SA 3SV8A 3SU4A 3R0FA 3EE0B 2ZNKH 1QJ1B 3TLOA 1HAVB 4Y8XA 4BAOB 1J16A 1QR3E 3SU3A 2ZU5A 3TK5A 3URDA 4MLFB 2OC7A 1FN6A 2ZPRA 1P2NA 1TOMH 2J38A 2PFEA 2GMTB 1TLDA 1RS0A 1KLIH 1YCPH 3E90B 2ESTE 1O5CB 3GY5A 2ZC9H 3RXDA 5DGJA 1MAXA 4YESB 2A7HA 1T32A 1C1RA 2F9PA 1AI8H 1MAYA 1P06A 3LJOA 1O3HA 1P2MA 5HM2A 2BD4A 1B5GH 5FXLA 1QRXA 3TK6A 1EB1H 3TH3H 3SU6A 1DUAA 1F7ZA 1FY5A 2ZWLH 3A8DA 5GXPA 1YF4A 3UTUH 1TBQH 2Z9LA 2CF9H 4MG3A 4UFEH 2ZGCA 4E7NA 3LGTA 4FUEA 3UY9A 3T25A 1VR1H 3DA9B 2A5AA 2RA0A 4NSVA 2ZI2H 1HRTH 4I8GA 1TMTH 2JETB 3LC5A 4NIXA 1YPMH 2BVXH 2BYAX 1XKAC 5JPMH 4D7GA 1JMOH 1A5HA 4KTSA 1NY22 1A2CH 1V2RT 2B5TB 2BDHA 3LH1A 2GT8A 3Q00A 1CA0B 1C5ZB 8GCHG 1ELVA 2AH4X 4WXVA 2ZCHP 3AW0A 1EZQA 2A31A 1SL3A 3M37A 2A1DB 2QXIA 1PFXC 2ALVA 3A88A 3RXKA 3HK6B 1GJDB 4CR5A 3SNBA 4OGYA 4U2WA 5LPEA 1SGTA 2C8WB 3OX7U 1BRAA 2J92A 2BXUH 1HIAB 3EA9A 5IDKA 2BD7A 3GDUA 4B75A 3EYDA 4GHQA 3WY8A 3RXRA 1ARCA 1LO6A 3ATIA 4M7GA 2R0KA 1TBRH 1UTOA 1GBHA 5AVDA 3Q3YA 2NU1E 2THFB 4Q7YA 3SUEA 1AWHB 3UOUA 1ARBA 3VGCC 2ZU1A 2OXSA 2PW8H 3E1XB 4WF8A 2FIRH 3MNSA 1V2KT 4DCDA 5C2ZA 3E3TA 5GJ4B 1TQ0B 2F9BH 3P6ZB 2UUJB 2XRCA 2Y5HA 3L6PA 1GBFA 1XVMA 1TPOA 5ESBA 1GHBF 2SGQE 3GISB 2JETC 5F6MA 3K6YA 4JZFH 3SZNA 2GZ8A 1O3NA 1H9LB 2BMGB 4WMFA 3SHAH 4R0IA 4XDEA 1HGTH 3S7KB 1LQDB 3UPEA 2NU0E 1UHBA 2A5KA 3VPKA 3S7HB 2VGCC 2J94A 1GJ9B 1K2I1 4H6TA 3C1KA 1C2EA 1HCGA 1C1WH 1S0RA 1ZR0A 5AFYH 4DT7B 4GVUA 2ZU4A 1HNEE 5I46H 3GCOA 1O3LA 2FS8A 3QTVH 2ZDAH 4ZROA 5E8EH 5A8YA 1UTKA 1IQNA 1C5QA 1FI8A 1O5DH 1P57B 1Y3UA 1Z6JH 3AAUA 3SORA 3MH4A 3VB3A 3I29A 4FUHA 1E34B 1XUGA 3A8BA 1P02A 1VGCC 5A0BA 3UNSA 3RM2H 3NWUA 4O97A 1QB1A 1FNIA 4I33A 4DOQA 2A7JA 5GWZA 3MO3A 3LONA 3SW2B 1SPJA 5EW2H 1XUJA 2XC5A 5J4QA 5C1UA 2ZHWH 1NZQH 1FPCH 1YP9A 2XBVA 1UTJA 2P95A 1D3TB 1O2HA 1QQ4A 2A4QA 3EDXB 4NCYA 4GAWA 2ZU3A 4A6LA 1DICA 4X1SU 4Y71A 1TX8A 1MBQA 2A45B 1FY4A 2WINI 3KQBA 3PMBB 1TAWA 1BHXB 1SMFE 4FUBA 5H4IB 2ZDNA 1MKWH 1HAYB 2Z3CA 1DPOA 1SGRE 5A09A 2XYAA 4U01A 3TGJE 1EPTA 2EI8A 1ZYOA 1GI2A 1ZPBA 5J4SA 1C1TA 1GJAB 3RXMA 1DY9A 3SUGA 2FDAA 3QGJA 5EQSA 1EUFA 5DP3A 2Z9GA 1HAVA 5EXNA 3P8OA 4AG2A 2F3CE 2BD9A 4NIWA 3UQOA 1RFNA 1G32B 1NRPH 2DE9A 4ZKSU 4B1TA 1EQ9A 5AF9H 3RXTA 4YO9A 2BY5X 1PJPA
chains in the Genus database with same CATH superfamily
2A4OA 2QF5A 2PKSC 1AKSB 2PKAA 1GJ5H 4X6MA 2LNCA 4NA9H 2VIWA 1WYKA 4BANB 2K8IA 1V2NT 1KXAA 1TWXB 3PLPA 3ZVGA 1OKXA 1BTPA 1ZPZA 1UHBB 1AFQC 3RXVA 3MI4A 3MNBA 1HV7A 2VIPA 3KGPA 4TYDA 2CK3D 4K8BA 5PTPA 1DWDH 1UVUH 1ID5H 2FYQA 4BAQB 5EOKA 4X8VH 1W11U 2ZQ2A 1WCZA 4X6PA 4ZUHA 2HPQH 1LTOA 3ZIAD 3UR9A 1AB9C 4X6NA 1CT2E 1HFDA 1S6HA 4B71A 2FEQH 1P09A 1B0FA 1T7CA 1EZSC 2TBSA 1IOEA 1W12U 2BHGA 3W94A 2VVVA 2BQ7B 1WOFA 2ZDLA 1NC6A 3MOCA 3HGPA 1P2IA 3NCLA 1FY1A 5KGOA 1ZPCA 3G01A 1GMHF 1ZJKA 4H42U 1TABE 3I78A 4NG9H 1P3EA 1JRTA 2C90B 3FN8A 3BTKE 3SJ8A 1UVSH 1NS3A 1XVOA 4IGDA 1EP5A 1SSXA 2FM2A 1GJ7B 1ELAA 5ESTE 1OSSA 1SOTA 1GHYH 1BT7A 1PPFE 4AC9A 1TGCA 3GCTF 1ZGVA 1YCPM 2ZCLP 3M3VA 2HNTC 1C1QA 3U1JB 1QNJA 1RXPA 1BMMH 2P94A 3DFJA 4B6FA 2FLBH 3RXJA 2V3HH 4AYYB 3QGNB 3GCNA 3NXPA 5EODA 1CGIE 3FKSD 4X8UH 1DSTA 3MU8A 3UIRA 2BY9X 1BTXA 3MH7A 4DURA 7LPRA 1AWFH 2XXLA 1SGYE 2V7QD 4D8NA 2GDEH 1TNGA 2FYRA 4AYVB 2BX4A 4MNVA 4Y11E 2AIPA 5HIZA 1MBMA 9ESTA 5KEDA 1VCWA 3S9AA 1CU1A 1UCYK 5A8XA 2OQ5A 1WQVH 3UR6A 1FXYA 2AGEX 3UUZA 2FO9A 1SHYA 1TNKA 4GCHF 3UNRA 2P3TB 4O03A 3ZZBA 2O8UA 2CN0H 2BTCE 2AS9A 2FX6A 4MNWA 3LGVA 2VGCB 3VFEA 4BAKB 3GY4A 2J2UA 2RDEA 1O31A 3BF6H 1ELBA 1F2SE 1OP2A 4OS1A 3GICB 1O34A 4AGKA 1MCTA 1XUHA 2Y5GA 1K1OA 2OLGA 2RDLA 3CNRA 1IQLA 1Q2WA 1IQJA 1DS2E 3PTBA 3RC6A 1ESTA 4TWYA 2BQ6B 1DDJA 1LPKB 4DIHH 3F9FA 4DGJA 3SJIA 1QFKH 3ZZAA 2KFWA 3MMGA 5HM9A 2GP9B 1HUTH 1E36B 3TVJB 5KECA 1V6DA 3K65B 1K21H 1IHTH 2XWBI 3F0PA 3TITA 3C27B 1TGBA 3B23B 1GMCF 4JMYA 1TA2A 4BNRA 1BHXF 1KXEA 4O3TA 2BDYA 3SU5A 1THSH 4FOUC 1V2JT 1HBTH 3TIUA 1C2MA 3RXFA 3SJOA 1L2EA 4UONA 1PQ5A 3Q76A 3MQKC 1SFIA 2QXGA 1H1BA 2H9EH 1G36A 1O2OA 3U8TH 4P00A 3VB7A 5EIYA 1UCYH 4CRGA 1ABIH 1Q3XA 4YLUA 1A61H 4A7IB 1TB6H 1O36A 1EZUC 1QB6A 1YPHC 2OTVA 3GY8A 4AZ2B 4BOHA 1BUIA 4FXGH 3TH4H 1FJSA 4HZHA 4Q7XA 4ZHAA 5B6LA 1GBTA 4AFQA 5CDFE 2PSYA 3P17H 3RXGA 1TMUH 4UDWH 1AY6H 1SHHB 2EC9H 4INKA 4Z1MD 1NFWA 1GHZA 1S81A 2BD8A 3V12A 5JB8S 1SI5H 1H8IH 1BTUA 1O0DH 2FOCA 4YZUA 1C5VA 2O9QA 3BIUH 1P01A 1C4V2 2ODPA 3TK9A 1XXDA 1G30B 1AO5A 4MPWA 5C1XA 5K7RA 2XW9A 1MCVA 1HJAB 4NWKA 3P8FA 4CH8B 1ANCA 1DITH 1C9PA 4KKDA 5IYTA 5E0HA 4LZ4B 3MNCA 1GCDA 2J4IA 1ANDA 1J17T 2Z7FE 3UFAA 2OQUA 1TGSZ 1XUFA 3F9GA 3M5NA 1FV9A 2GV7A 4AB8A 1AKSA 1QY6A 1K9OE 2BXTH 2NU4E 3M7QA 3ODDA 1GHWH 3M3TA 1MU6B 4O9VA 1C5WB 1S85A 1C5OH 3WWBA 1QCPA 3QDZB 2ZGBH 2VH6A 2QF0A 3U28C 4FU7A 4CRFA 4AFSA 1C2KA 1GHVH 2UUYA 2ZFQH 3DSPA 3O8DA 4A1XA 3U9AH 1T4UH 3GCHB 5FX6A 3BIVH 2J34A 2XNIA 1EPTB 4MPUA 3P70B 1ZHRA 1KXDA 3MO6A 3U69H 1C4U2 2F43B 4GPGA 2B9LA 3QO6A 3OAAD 1L4DA 1C2FA 3ATMA 5FPYA 3LGIA 1N8OB 3FOAA 1GGDC 3A8AA 2BOHB 4U30A 3GDVA 1P2JA 2ZHEH 4NIVA 1BTWA 2PKAB 5CHAB 1FIZA 3P8NA 1AN1E 2VWNA 2SNWA 1RIWC 1ETRH 1FQ3A 1P05A 3V7TA 3W95A 2F4LA 1OP0A 1WU1A 4ZXXH 1AVXA 2TGTA 2Z9IA 1HXEH 4Y0YE 3T26A 1O2WA 1A5IA 1QGFA 2V6NA 5FAHA 3QK1A 2VJ1A 3NUMA 3A7YA 1O2UA 1LVYA 1SFQB 1ORFA 3ZV9A 3K9XB 1O2VA 2FOEA 4FU9A 1ZMLA 1O2GH 2ZTYA 1GI9B 1GMDF 4DVAU 1NT1A 4ZXYH 1O3DA 3L3TA 1UK4A 1BITA 1HAZB 3I77A 1BTHH 4WH8A 1C5RA 1F0UA 2GZ7A 1TX7A 1P11E 4JYTA 1A0LA 5EG4A 2Z9JA 1AUTC 1BOQA 2AGIX 4AX9H 2H6MA 3OY5U 2R3YA 1CE5A 1G37A 1OHHD 3GYLB 2XC4A 2RA3A 4JZIA 3QTOH 2BDCA 3QLPH 2STBE 1S82A 1IQGA 1EP6A 1GCTB 4X1QU 1CSOE 1OXGA 1WQSA 4RN6A 2BB4A 1GHAF 2QA9E 3ITIA 1F0SA 1VJ9U 3M5OA 1OWJA 4FETA 5JBBS 1GI3A 3BG4C 4I8LA 4MPXA 3ZZ6A 2YNAA 2AFQB 1O2QA 4JZ1A 1Z8GA 3UAIC 2D26C 3RMLH 2ZA5A 1O2SA 1KSNA 4ASHA 1FONA 1SQOA 1UVTH 3DD2H 2G55A 1KLTA 1EAUA 5JBAS 1PYTC 4RT0A 2HNTE 2HVXA 4FUJA 3AW1A 5FBEA 2Y6TA 1BQYA 1H4WA 4AOQA 5F53A 2SGDE 4ABDA 1LHEH 1BRCE 1O32A 1LQEA 2PR3A 1MTSA 1P0SH 1Y3WA 2J98B 1QHRB 4UEHH 1DOJA 1OYQA 2XBWA 2WPDD 1PPZA 4X2VA 4WY3A 2RG3A 5FX5A 5BPEA 1B0EA 1UTPA 5T3HA 4X0WU 1LDTT 5GIBA 2G5VA 1UTNA 1XUIA 1ZRBA 4X2YA 1PQ7A 2GT7A 3KQCA 1H9HE 2O8MA 2P93A 3HATH 1CVWH 1SLWB 3ZV8A 1OX1A 1Y5UT 2SGEE 1GGDB 3HKJB 1GHXH 4UE7H 1PQAA 2ASUB 3FP6E 3U1IB 4B2BA 1HJ8A 2PHBA 4Q2KA 1PPCE 3F2GA 2JIZD 1DLKB 1YLNA 3VG8A 2A4GA 3A85A 4MNXA 1TNLA 5CHBA 4SGAE 4ACBA 3MU5A 1MKXH 3PYHA 3VGCB 2ZFTA 4NWLA 1NN6A 4YM9A 5FPSA 3IWMA 1EKBB 3IG6B 4AFUA 2PUQH 2HPPH 5EJ1A 2P8OC 1KXCA 2H9HA 1YPJH 1ELEE 2VIVA 2Z6BD 5A2MH 3Q77A 2BD5A 1TA6A 2HNTF 3JZ1B 4H6SB 2FWWA 2WUBA 4VGCC 5HIYA 5A0AE 1VITF 1C1SA 2VB0A 1SLVB 3ZZ5A 4ESTE 1O3KA 1K1LA 2WV9A 5E0GA 1O3CA 3QWCH 3RM0H 1AMHA 1VGCB 3VEQB 4CRBA 1S84A 1S0QA 1J14A 1P9SA 1W2KH 4BXWA 1EXFA 2AMQA 5DO4H 1Z6EA 3FVFB 4XRNA 4YOGA 5EGMA 2AHME 1K1PA 1ETSH 4D76A 1C5YB 3A86A 1GBJA 3KHVA 1BJVA 3GCHC 3KYGA 1DANH 1C5UA 1UJ1A 1QBVH 2KCAA 2QN5T 6ESTA 4JK5A 1EJNA 2IPQX 3BTTE 2PP6A 2ZG0H 4DW2U 1Z8IB 1BJUA 1Z1JA 1N1LA 1OPHB 5L6NH 1W0KD 2NU2E 1UVPA 1TGNA 4INLA 5HGGA 3M35A 3BTWE 3MYWA 4F55A 1P8VC 4B2AA 2R3UA 2ZF0H 3GY7A 3SV6A 1AE8H 1YY3A 1AVWA 1TFXA 1GHBG 2FLRH 2YMSC 5FCKA 1CHOG 2P3UB 1YM0A 2B7DH 1ZRKA 3MH6A 3SNEA 1SGFG 1FIWA 3T5FH 5A0CA 1ESBA 3M5LA 2BVSH 1MTWA 4JZEH 3E8LA 1UTMA 2ZDMA 2GCTB 1C1OA 3SV7A 1YCPK 1P03A 1W13U 3VB4A 2OBOA 5L2YH 4YLQH 1FN8A 1EX3A 1C2HA 1TRNA 2A7CA 1WXRA 3SJKA 5AHGH 1CT4E 4UFGH 1O2ZA 1TPAE 4GLYA 1W14U 2YNBA 5LPFA 2CF8H 4X6OA 4BAHB 3F9EA 1KLJH 1EASA 2W6JD 4IN1A 1VCQA 1GBCA 4X1PU 4CRCA 5JBTA 4LK4A 1GI7B 5T6FA 3TGKE 2HOBA 5DN6D 3M7UA 1YC0A 4HGCA 2A0QB 1G2MA 3PMHB 1YPKH 2R2MB 3A84A 1PYTD 4R8TB 4FUCA 2WPKS 2H5DA 1GI5A 1V3XA 1HPGA 3ZVDA 1N6XA 5JBCS 1CHGA 1Y3YA 1SGIB 2G81E 3F0OA 4KELA 4MNYA 4X1RU 7GCHG 1T4VH 2ZFPH 1O3FA 1EB2A 2XOKD 2D2DA 2KX4A 1IQFA 1XX9A 1O5FH 2SFAA 1A3EH 2WSSD 3PTNA 4B73A 1BMFD 2CGAA 4ABAA 1RD3B 2GCHF 1G3BA 2QYIA 3CP7A 2CV3A 4K69A 4NZQA 1FMGA 3WW7A 4D9RA 2AYWA 5GCHF 4ABIA 4FUGA 2BY8X 4HI3A 1RJXB 2PTCE 4FVBA 2Z9KA 3MH5A 1D3QB 2QXHA 1VCPA 1T8NA 2VINA 2CJIA 2JKHA 1SQRA 2VU8E 3MU4A 4Y8ZA 5C0TA 1G3DA 4LZ1H 1ZTJA 1H9IE 2Q6FA 2ZFRH 3RXIA 1TRMA 3ZVCA 2UWOA 1YGCH 4BAMB 4F4OC 1G3EA 1HB0B 4RT1A 2FXRA 2ZGXH 2BZAA 3PRBA 1QURH 2ZHDA 1SGNE 2P16A 4ZAEA 1LMWB 3CS0A 3RXPA 1G3CA 1L4ZA 2W3IA 4I7YH 2GMTC 3UOPA 2A2XH 1BBRK 1GBLA 3F2HA 2XWAA 1L1GA 2BY6X 3KQEA 4D7FA 2V0BA 1EAIA 2QAAA 4CBNA 4ISOA 3SNAA 1NBME 3E0NB 3ZZ4A 1NO9H 3ZZ3A 2FOBA 3CS7A 1SR5C 4YOJA 2P59A 2PKSB 3RUOA 2JH5D 1E1RD 3ATKA 3D65E 3O8RA 2J95A 2WYJA 1SGPE 2CXVA 1WUNH 1O2JA 2BLVA 3HGNA 1EOJA 1F92A 3FZZA 4FUFA 2BDIA 1V2MT 2CHAC 1O3IA 3M36A 5BRRE 1LHDH 2DE8A 1EJMA 3NRLA 2Z3EA 1WSSH 2OP9A 2WPJS 5DSFA 4K8YA 2AERH 3DSGA 1O5BB 1GBEA 1E38B 4OS5A 1OOKB 3LGWA 1P12E 2OD3B 1T31A 1TMBH 3A7VA 2FODA 4XBBA 4NZLA 3PO1B 3T28A 2GD4B 1AUJA 3KQDA 3SV9A 5HXFA 1BZXE 1TX6A 1WAYB 1UW7A 6GCHF 3D62A 1CT0E 1FX0B 2G5NA 5C1YA 5C5OA 1CA0C 1ANEA 3A81A 2ZFSA 1P2QA 1ELDE 2VIQA 5AFZH 1C1MA 3FAOA 3R3GB 1O2RA 1A4WH 5HKKD 4DG4A 1HXFH 3PROA 4YTAA 1TONA 1O3MA 3MHWU 2OC0A 5A8ZA 1B7XB 4JYUH 1ZMNA 1O2NA 3BTQE 3OU0A 3UWJH 3SGQE 1AU8A 1K1IA 1EAWA 3IITA 4TPIZ 2BVRH 4THNH 4ABEA 2QF3A 1DWBH 3BG8A 1FPHH 1FAKH 3AVZA 2YMSB 3PWCA 1JRSA 3RMOH 2EI6A 4Q63A 2HWLB 1NFYA 1C4Y2 2FOMB 4P02A 3SUFA 1LKAA 1BB0B 2ZECA 2OUAA 2FTLE 4WXIA 3RU4D 2ZP0H 1VITH 2GCTC 2SGPE 2PSXA 1THRH 1TNIA 1DWEH 2GJGA 3RDZA 2BOKA 3ZZCA 3V3MA 4B2CA 3DUXH 2V35A 1QRWA 2F9UA 1ZMJA 3OTPA 3KIDU 1AQ7A 3EA8A 2G51A 5LH8A 1O2LA 1FUJA 1CGHA 2KAIA 2WHXA 3NPSA 3V13A 5EJZA 6CHAC 4UFDH 1MZDA 4ZMAH 1QL8A 3SI4H 1HAOH 4OGXA 1H8DH 2HALA 4DJZB 3GY2A 2C8YB 3K6ZA 4F49A 1G9IE 2OC8A 2VWMA 1IQMA 2XCFA 3TU7H 3LH3A 4Z6AH 1J9CH 2VH0A 2O8WA 5CMXH 5HYOA 2BD3A 5DP7A 1WV7H 5FHTA 3PO1C 4ISIH 2Y82A 1ZLRA 2Q6GA 2H5CA 2EA3A 3O8BA 1GCTC 1GBKA 3DCLA 3PMJA 4IMQA 1ETTH 3SO3A 1HAPH 1SLXB 4BTTB 2VVUA 3LGUA 1O3AA 4J2YB 1QB9A 4MPVA 4MTBA 4K60A 2GV6A 3B8JA 4ASUD 3SQEE 1BRUP 2WV5A 1KDQB 1RRKA 5GPIB 1S83A 1NPMA 4ZHLU 3ZVFA 5E2PA 3Q3KA 3A87A 3TH2H 4Z0KA 2BX3A 4ZH8A 1DSUA 3A7WA 1JBUH 1Z8JB 5EPNA 1P10A 4I32A 4U32A 4A5TS 3PLKA 1AE5A 2PV9B 5C94A 5CHAC 3WWFA 5C67A 2L74A 1GG6C 3UQVA 4X2XA 1A0JA 2XC0A 2F9OA 1LHCH 4AFZA 1O5EH 3PMAB 1SB1H 2ZPQA 5EQRA 2IPHA 2D1JA 3TJOA 2BLQA 2IN2A 3DSOA 3VB6A 3SNDA 1O3JA 1CO7E 1T8OA 3E6PH 1MTNB 3PV5A 4YT6H 1O33A 1PPBH 4B74A 1O3PB 2C93B 2QIQA 3LIWA 5FCRA 2QXJA 4MDSA 1H8HD 1KY9A 2CMYA 5B6OA 1YLDA 4E7RG 4AN7A 4UD9H 1IQKA 2WV4A 3LJJA 2IJD1 2FOAA 1JXPA 1AVGH 3F2FA 3LOXA 4DT4A 1OWHA 3EQ0H 2Y7ZA 2VIDA 2G4TA 1DX5M 1ZSLA 2QE7D 1BIOA 4IN2A 1EAXA 4X8TH 3RC5A 5DP6A 4K5ZA 1FAXA 3SU0A 1Y8TA 1O2MA 1MUEB 1O5GH 1X7AC 1YLCA 3JZ2B 3RXUA 1KYNA 1C9TA 1IAUA 1BA8B 1F0TA 3RMNH 1CBWC 1ZHPA 1RGQA 1C1NA 3A7ZA 4I8HA 3TJVA 4ABJA 2TGDA 3EE7A 1HYLA 2C8ZB 3BTEE 5T1VA 1OS8A 3OYPA 2FOGA 3GY6A 3ZZ8A 1EATA 1V2ST 2BDBA 1J8AA 4VGCB 1Q31A 1QIXB 4CBOA 1TIOA 2XBXA 2G00A 1OWIA 3SN8A 1C1VH 2EY4C 3NZIA 3O8CA 1J15A 2BDGA 5LPRA 1E1QD 3EA7A 4SGBE 5FBIA 1TYNA 1BCUH 1E37B 4X1NU 1AFEH 2KR7A 4WH6A 1KDQA 4I8KA 2WZQA 1C1PA 1LCYA 1MKWK 4WMEA 1NU9A 4TWWA 3TJNA 1QRZA 2Q1JA 1Z1IA 2PGQB 4M9FA 3PM3A 4XFQA 1GDNA 4ZCNA 1P2KA 2F9NA 1RTKA 2XNDD 5EXLA 1W7GH 2ANMH 4K1SA 4AG1A 4K1EA 1A7SA 1SGFA 1V2VT 1Y3VA 2BQWB 4I31A 5DP4A 1SGCA 3RC4A 1GI8B 3BG4B 4IBLH 2H1UA 3N7OA 2A32A 5TCCA 1EJAA 4WJG2 5EW1H 1FZZA 4GSOA 1OP8A 4YT7H 1CQQA 3BEUA 1ELFA 2FI5E 1QQUA 1SQAA 1NESE 4QT8C 2J98A 2FI4E 5EQQA 1NRQH 1TOCB 1NM6A 1ZHMA 4JZDH 5JDUB 2AGGX 4I8JA 2WPMS 4AB9A 2Y80A 4I86A 5DK1A 8GCHF 3H5CB 1IQIA 1QJ7B 1TPPA 5F8XA 4JCNA 1XUKA 4K2YA 2FOFA 4A1TA 3UNQA 1H8ED 2P8OB 4ZKNU 4O3UA 2BM2A 1W8BH 1FY8E 4X2WA 1GHAG 3GY3A 1PPHE 1D3DB 1O3GA 2KM0A 3AASA 3F1SB 1JIRA 5G4BA 2KCOA 3HPTB 2TGAA 1O3EA 3QZQA 1GI1A 2JH0D 4KTCA 1A0HB 1O3OA 1YPGH 2W5EA 3KN2A 1DE7H 1Z7KA 2AMDA 2OCVB 3MTYA 2H2ZA 5DKMA 3S9BA 1DT2A 2BLWA 2GTBA 3QUMP 3L33A 4Q4LA 2Y5FA 1O3BA 2HVYB 5L30H 1W0JD 3RXHA 1AHTH 1KTSB 3SGAE 2B0FA 1HJ9A 4Y76A 1GBDA 5CE1A 2VIOA 1GL1A 1NRSH 1O2PA 1AD8H 3GOVB 1U6QA 1LPGB 2ODYB 2STAE 1C2GA 2W26A 3KNXA 5EXMA 3KCGH 3M61U 4XE4A 1HAXB 1GPZA 1BBRE 1KXFA 1HAHH 5GNDA 3SJ9A 1TE0A 1TRYA 1Y59T 9LPRA 1V2PT 1GJ6A 3ZVEA 1C5XB 2BLOA 3NKKA 3AAVA 3F9HA 2GVFA 2NU3E 2AIQA 2TRMA 1EOLA 3U8RH 2I6QA 3S0NA 2HLCA 2H9TH 3T62A 5FPTA 3E91A 1KMHB 2IJOB 1D6WA 1GVKB 3H7OA 3VXFH 1LHGH 1N6YA 1DLEA 2ANYA 3QX5H 1C2LA 1TBZH 4IW4E 1L0ZA 1Y5AT 1WTGH 4A1VA 4CR9A 2ZZUH 2ZFFH 1MTNC 8ESTE 4RKJB 2VWOA 4ACAA 2EEKA 2ANKH 2WUCA 3TJUA 1YPHE 5TCAA 1GDUA 1YBWA 1W7XH 3LU9B 4YXWD 1LVMA 1FLEE 1XMNB 1YWUA 2UUFB 1O5AB 4UFFH 3MWIU 4KGAA 7ESTE 2K1QA 2K0QA 1EZXC 2R9PA 1SLUB 5E2OA 1GJCB 2ZDKA 3SNCA 4OS2A 1LVOA 1UMAH 2QC2A 1LPZB 3PV4A 1V2TT 4INHA 3UREA 5T6DA 2G52A 1GBBA 1BTZA 1VITG 1ZOMA 3ZZ9A 1GVLA 4WMDA 4KP0A 3RXLA 1QJ6B 2BDAA 4XSKU 3BSQA 2XTTB 2UWPA 1D9IA 1GJ8B 2GDDA 3T29A 1LHFH 2FMJA 2HLDD 1DXWA 5IK2D 2A5IA 1NRNH 5TJXA 1HJAC 2JDID 3LGYA 1G2LA 7KMEH 3P8GA 1HDTH 3A80A 3LT3A 3QN7A 2TIOA 1A5GH 2FESH 2JJ1D 1DWCH 4HTCH 1ELGA 1KIGH 1QTFA 2ZCKP 3ZVAA 2ODQA 3K2UA 3H7TA 1DVAH 4B76A 5C3NA 3A89A 4CRDA 1DUEA 3GYMA 4D9QA 4YOIA 4ZHMU 2G4UA 1ZTKA 3FO8D 2C4FH 2ULLA 1BTYA 1SGDE 3PWBA 3SYJA 1BMLA 3TNSA 5DP9A 1UTQA 1VZQH 4RKOB 2YOLA 1AB9B 4OS6A 1ABJH 4MQAA 3TPIZ 3M5MA 1YPLH 3N99A 1NFUA 1P3CA 2PTNA 1ESAA 4A92A 1K22H 2Z3DA 4Y10E 3NK8A 1L1NA 1CHOF 3OTJE 2BY7X 3ZYEA 3RMMH 3S9CA 1ZTLA 2O8TA 2DUCA 1O39A 4TSFD 1L1JA 2ZO3H 2LPRA 3SUDA 4X8SH 1N8OC 4NA7A 1A46H 2LELA 2AMPA 4K3JA 1SG8B 1MU8B 2HGTH 1ELCA 4B6EA 1TNJA 2OINA 4NIYA 1YKTA 3BTDE 4GHTA 1C5NH 1GL0E 1W10U 4ABGA 2W3KA 1C2JA 1NROH 1S5SA 1T8LA 2FS9A 3SOSA 1ZSJA 2F9VA 4CRAA 1SOZA 1A3BH 2TGPZ 2FTMA 1Y5BT 1D4PB 3MU1A 1CA8B 1C5LH 1MMJN 4AORA 1GI6A 2VVCA 3RU4T 1PQ8A 1S6FA 1TQ7B 3FZDA 4DY7B 5JB9S 3M7TA 1KTTB 4Y8YA 1JIMA 3RXSA 2ZPSA 1GMHG 2Y81A 1GBMA 3ZYDA 2C3SA 1GDQA 2QF4A 2QGRA 2ZEBA 3ATWA 1A1RA 1NU7B 3B9FH 4ISHH 4WVPE 3SI3H 1IHSH 1UK3A 3P92A 1BRBE 2WPHS 3MO9A 2UUKB 4K1TA 3MFJA 2GZ9A 1P2OA 3DT0H 2CHAB 2NWNA 3BEIB 3GCTG 3GDSA 5F8TA 3ESTA 3RLYH 4ZKOU 7GCHF 2L6OA 2XCNA 3BTHE 4XD7D 3N7EA 2F91A 2IOTA 4ISLA 1O30A 3RXEA 4CREA 4FU8A 3DFLA 2RCEA 1ZGIA 5LGOA 2ZGHA 1OYTH 1UCYE 2GCHG 1VJAU 4FVDA 1OWEA 2FPZA 4ABFA 1SGEE 3T27A 1GBAA 1ZSKA 3SU2A 1OWKA 3EGKH 3Q3XA 1K0HA 5GCHG 1TGTA 2FOHA 3A83A 2GGVB 1MTVA 1K1JA 5C17A 3LKWA 1Z71A 5JYIA 1SGQE 1MKXK 2WPLS 4ABHA 1UTLM 1E35B 4BXSA 1F5LA 1IQHA 1YYY1 2J5UA 1V2WT 2M5TA 1GI4A 4GCHG 2ZDVH 1GI0A 2JH6D 5C5NA 1XM1A 1BMNH 1HAIH 1NFXA 2BZ6H 3LDXH 4TY6A 1D6RA 4FUDA 1TALA 2ZHFH 4ABBA 1K28D 3SQHE 1GWAA 2QY0B 1XKBC 3TGIE 3KEEA 3U8OH 3A7TA 1C5PA 3RXCA 3STJA 1C5MD 4Y7BA 3RP2A 3HKIB 1HAGE 4NFFA 3RXOA 3E16B 4LXBH 1DXPA 2A2QH 1V2LT 1O2IA 3KF2A 4Y7AA 2SGAA 1QA0A 1QBNA 2F83A 4E05H 1FDPA 1K1MA 1SQTA 1MH0A 3EAJA 3TNTA 2BD2A 2ZHQH 5F8ZA 1LVBA 1CGJE 1MZAA 2SGFE 1F0RA 3RXBA 1GMCG 3LPRA 1ANBA 1BDAA 1JWTA 2V3MA 5L2ZH 1IQEA 4E06H 1YPEH 1MQ6A 2PLXA 3PLBA 2R2WU 1EFRD 1O2YA 1SVPA 5SGAE 1WBGB 3H09A 1AIXH 1WTHD 2WPIS 1F5RA 1MTUA 1SBWA 1TPSA 4BTUB 1CBWB 3OY6U 2A4RA 1INCA 2KAIB 2R0LA 3MNXA 1AZZA 2J9NA 1O38A 1JOUB 2G8TA 2W6ID 3SHCH 1MD8A 2VNTA 1NBMD 1T8MA 1MQ5A 4H4FA 3RXAA 2EI7A 4TY7A 3ELAH 3E0PB 3DHKH 6GCHG 5T6GA 1AFQB 4AGJA 3SU1A 4RI0A 4OM9A 1OWDA 2AEIH 4CHAC 1SC8U 1GG6B 5C20A 2FI3E 1ELTA 1RTLA 5EU8A 1NRRH 5DG6A 3ZVBA 6CHAB 2I6SA 3RU4E 3U98H 3A7XA 5F03A 2Q6DA 1QL9A 1PPGE 1UO6A 1V2UT 2QCYA 2PGBB 2ZGJA 3AK5A 2ANWA 2ZIQH 1AZ8A 4JK6A 2W7SA 1HIAA 3FFGA 2ZU2A 5K0HA 2Y7XA 4Y79A 2J97A 4XBCA 4DIIH 4OS4A 4XOJA 3KYFA 1W0ZU 3CENA 4TPYA 3URCA 3ODFA 2OBQA 3F6UH 1DFPA 4BTIB 1K1NA 2KCYA 3VB5A 4Y0ZE 4NSYA 2PWXA 3UWIA 1M9UA 1Z8RA 3BEFB 4J1YA 5DP8A 5ETXA 1FY3A 3S69A 1NTPA 1GVZA 1RIWB 3D23A 3A82A 3FP7E 3SV2H 4Q80A 1AGJA 4IC6A 5EPYA 1QBOA 1C1UH 3ZZDA 4IMZA 1UK2A 1W3CA 2HRVA 4RSPA 3FP8E 1C2IA 4NGAH 2EQNA 2O8LA 2VBCA 2C8XB 4GUXA 3SGBE 2ZQ1A 3OE7D 1XXFA 4HFPB 1DY8A 1BBRH 1W0YH 1C2DA 1QA7A 2ZTZA 1P04A 1THPB 1LKBA 8LPRA 1ACBE 1TNHA 3BN9A 4ZKRU 1BMAA 3F68H 3FANA 3KL6A 1E0FD 1V2QT 1SKYE 3RLWH 5DPAA 1O2XA 1O2KA 1PPEE 3LC3A 2ZKSA 3OSYA 1V2OT 3BTFE 1DM4B 2XBYA 3D49H 3BTGE 2OC1A 3T2NA 3V0XA 3RXQA 1O35A 6LPRA 2Z94A 1GJ4H 3ENSB 4IC5A 1UVOA 4XBDA 2QV1A 1GMDG 2UWLA 3BV9B 2SNVA 2W7UA 3PB1E 3P95A 1EPTC 5HMAA 3A8CA 1ZZZA 5FL7D 4WWYA 1D3PB 2D8WA 4NA8A 5I25A 5ABWA 1MD7A 2FP7B 3MU0A 3HK3B 4JYVH 4Y6DA 8KME2 2ZTXA 2JJ2D 2FX4A 1WDIA 3SBKA 1Y3XA 3STIA 4CHAB 1RTFB 4KTUA 4PROA 2TPIZ 2GKVE 5GDSH 1GJBB 1HLTH 3ATLA 1C5TA 3VXEH 2ALPA 2WYGA 2V3OH 2FZZA 4CH2B 1O37A 2VWLA 3QZRA 3ZZ7A 2PUXB 2B8OH 4MVNA 4OS7A 1F5KU 1P9UA 5E0JA 1KXBA 1O2TA 3M3SA 4IS5A 4FUIA 4NFEA 5DP5A 1ZJDA 4LOYH 2ILNA 4Q7ZA 5DJ7A 1VKYA 2GX4A 4ISNA 2P3FH 1QL7A 3BTME 1GBIA 1C5SA 3SV8A 1QZ8A 3OEHD 3SU4A 2OK5A 3R0FA 3EE0B 2ZNKH 1QJ1B 3TLOA 1HAVB 4Y8XA 4BAOB 1J16A 1QR3E 3SU3A 2ZU5A 3TK5A 3URDA 4MLFB 2OC7A 1FN6A 2ZPRA 1P2NA 4F48B 1TOMH 2J38A 2PFEA 2GMTB 1TLDA 1RS0A 1KLIH 1YCPH 3E90B 2ESTE 1O5CB 3GY5A 2ZC9H 3RXDA 5DGJA 1MAXA 4YESB 2A7HA 1T32A 1C1RA 2F9PA 1AI8H 1MAYA 1P06A 3LJOA 1O3HA 1P2MA 5HM2A 2BD4A 1B5GH 5FXLA 1QRXA 3TK6A 1EB1H 3TH3H 3SU6A 1DUAA 1F7ZA 1FY5A 2ZWLH 3A8DA 5GXPA 1YF4A 3UTUH 1TBQH 2Z9LA 2CF9H 4MG3A 4UFEH 2ZGCA 4E7NA 3PRDA 3LGTA 4FUEA 3UY9A 3T25A 1VR1H 3DA9B 2A5AA 2RA0A 4HG6A 4NSVA 2ZI2H 1HRTH 4I8GA 1TMTH 2JETB 3LC5A 4NIXA 1YPMH 2BVXH 2BYAX 3W1EA 1XKAC 5JPMH 4D7GA 1JMOH 1A5HA 4KTSA 1NY22 1A2CH 1V2RT 3UB0A 2B5TB 2BDHA 3LH1A 2GT8A 3Q00A 1CA0B 3KQ5A 1C5ZB 8GCHG 1ELVA 2AH4X 4WXVA 2ZCHP 3AW0A 1EZQA 2A31A 4TT3D 1SL3A 3M37A 2A1DB 2QXIA 1PFXC 2ALVA 3A88A 3RXKA 3HK6B 1GJDB 4CR5A 3SNBA 4OGYA 4U2WA 5LPEA 1SGTA 2C8WB 3OX7U 1BRAA 2J92A 2BXUH 1HIAB 1E79D 3EA9A 5IDKA 2BD7A 3GDUA 4B75A 3EYDA 4GHQA 3WY8A 3RXRA 1ARCA 1LO6A 3ATIA 4M7GA 2R0KA 1TBRH 1UTOA 1GBHA 5AVDA 3Q3YA 2NU1E 2THFB 4Q7YA 3SUEA 1AWHB 3UOUA 1ARBA 3VGCC 2ZU1A 2OXSA 2PW8H 3E1XB 4WF8A 2FIRH 3MNSA 1V2KT 4DCDA 5C2ZA 3OEED 3F3BA 3E3TA 5GJ4B 1TQ0B 2F9BH 3P6ZB 2UUJB 2XRCA 2Y5HA 3L6PA 1GBFA 1XVMA 1TPOA 3SZEA 5ESBA 2LP6A 1GHBF 2SGQE 3GISB 2JETC 5F6MA 3K6YA 4JZFH 3SZNA 2GZ8A 1O3NA 1H9LB 2BMGB 4WMFA 3SHAH 4R0IA 4XDEA 1HGTH 2YMSD 3S7KB 1LQDB 3UPEA 2NU0E 1UHBA 2A5KA 3VPKA 2KZ4A 3S7HB 2VGCC 2J94A 5C0UA 1GJ9B 1K2I1 4H6TA 3C1KA 1C2EA 1HCGA 1C1WH 1S0RA 1ZR0A 5AFYH 4DT7B 4GVUA 2ZU4A 1HNEE 5I46H 3GCOA 1O3LA 2FS8A 3QTVH 2ZDAH 4ZROA 5E8EH 3PV2A 5A8YA 1UTKA 1IQNA 1C5QA 1FI8A 1O5DH 1P57B 2RFKC 1Y3UA 1Z6JH 3AAUA 1MABB 3SORA 3MH4A 3VB3A 3I29A 4FUHA 1E34B 1XUGA 3A8BA 1P02A 1VGCC 5A0BA 3UNSA 3RM2H 3NWUA 4O97A 1QB1A 1FNIA 4I33A 1S6LA 4DOQA 2A7JA 5GWZA 3MO3A 3LONA 3SW2B 1SPJA 5EW2H 1XUJA 2XC5A 5J4QA 5C1UA 2ZHWH 1NZQH 1FPCH 1YP9A 2XBVA 1UTJA 2P95A 1D3TB 1O2HA 1QQ4A 2A4QA 3EDXB 3N7DA 3GS9A 2ZU3A 4GAWA 4NCYA 1DICA 4A6LA 4X1SU 4Y71A 1TX8A 1MBQA 2M2AA 2A45B 1FY4A 2WINI 3KQBA 3PMBB 1TAWA 2KCPA 1BHXB 1SMFE 4FUBA 5H4IB 5EJLA 2ZDNA 1MKWH 1HAYB 2Z3CA 1DPOA 1SGRE 5A09A 2XYAA 4U01A 3TGJE 1EPTA 2EI8A 1ZYOA 1GI2A 1ZPBA 5J4SA 1C1TA 1GJAB 3RXMA 1DY9A 3SUGA 2FDAA 3QGJA 5EQSA 1EUFA 5DP3A 2Z9GA 1HAVA 5EXNA 3P8OA 4AG2A 2F3CE 2BD9A 4NIWA 3UQOA 2DE9A 1G32B 1COWD 1NRPH 1RFNA 4ZKSU 1EQ9A 3OFND 3RXTA 4B1TA 5AF9H 4YO9A 2BY5X 1PJPA
chains in the Genus database with same CATH topology
2A4OA 2PKSC 1AKSB 2PKAA 1GJ5H 4X6MA 2LNCA 4NA9H 2VIWA 1WYKA 4BANB 1V2NT 1KXAA 1TWXB 3PLPA 3ZVGA 1OKXA 1BTPA 1ZPZA 1UHBB 1AFQC 3RXVA 3MI4A 3MNBA 1HV7A 2VIPA 3KGPA 4TYDA 4K8BA 5PTPA 1DWDH 1UVUH 1ID5H 2FYQA 4BAQB 5EOKA 4X8VH 1W11U 2ZQ2A 1WCZA 4X6PA 4ZUHA 2HPQH 1LTOA 3UR9A 1AB9C 4X6NA 1CT2E 1HFDA 1S6HA 4B71A 2FEQH 1P09A 1B0FA 1T7CA 1EZSC 2TBSA 1IOEA 1W12U 2BHGA 3W94A 2VVVA 2BQ7B 1WOFA 2ZDLA 1NC6A 3MOCA 3HGPA 1P2IA 3NCLA 1FY1A 1ZPCA 3G01A 1GMHF 1ZJKA 4H42U 1TABE 3I78A 4NG9H 1P3EA 1JRTA 2C90B 3BTKE 3SJ8A 1UVSH 1NS3A 1XVOA 4IGDA 1EP5A 1SSXA 2FM2A 1GJ7B 1ELAA 5ESTE 1OSSA 1SOTA 1GHYH 1BT7A 1PPFE 1TGCA 3GCTF 1ZGVA 1YCPM 2ZCLP 3M3VA 2HNTC 1C1QA 3U1JB 1QNJA 1RXPA 1BMMH 2P94A 3DFJA 2FLBH 3RXJA 2V3HH 4AYYB 3QGNB 3GCNA 3NXPA 5EODA 1CGIE 4X8UH 1DSTA 3MU8A 3UIRA 2BY9X 1BTXA 3MH7A 4DURA 7LPRA 1AWFH 2XXLA 1SGYE 4D8NA 2GDEH 1TNGA 2FYRA 4AYVB 2BX4A 4MNVA 4Y11E 2AIPA 1MBMA 9ESTA 1VCWA 3S9AA 1CU1A 1UCYK 5A8XA 2OQ5A 1WQVH 3UR6A 1FXYA 2AGEX 3UUZA 2FO9A 1SHYA 1TNKA 4GCHF 3UNRA 2P3TB 4O03A 3ZZBA 2O8UA 2CN0H 2BTCE 2AS9A 2FX6A 4MNWA 3LGVA 2VGCB 3VFEA 4BAKB 3GY4A 2J2UA 1O31A 3BF6H 1ELBA 1F2SE 1OP2A 4OS1A 3GICB 1O34A 4AGKA 1MCTA 1XUHA 2Y5GA 1K1OA 2OLGA 2RDLA 1IQLA 1Q2WA 1IQJA 1DS2E 3PTBA 3RC6A 1ESTA 4TWYA 2BQ6B 1DDJA 1LPKB 4DIHH 3F9FA 4DGJA 3SJIA 1QFKH 3ZZAA 3MMGA 5HM9A 2GP9B 1HUTH 1E36B 3TVJB 1V6DA 3K65B 1K21H 1IHTH 2XWBI 3TITA 3C27B 1TGBA 3B23B 1GMCF 4JMYA 1TA2A 4BNRA 1BHXF 1KXEA 4O3TA 2BDYA 3SU5A 1THSH 1V2JT 1HBTH 3TIUA 1C2MA 3RXFA 3SJOA 1L2EA 4UONA 1PQ5A 3Q76A 1SFIA 2QXGA 1H1BA 2H9EH 1G36A 1O2OA 3U8TH 3VB7A 1UCYH 4CRGA 1ABIH 1Q3XA 4YLUA 1A61H 4A7IB 1TB6H 1O36A 1EZUC 1QB6A 1YPHC 2OTVA 3GY8A 4AZ2B 4BOHA 1BUIA 4FXGH 3TH4H 1FJSA 4HZHA 4Q7XA 4ZHAA 1GBTA 4AFQA 2PSYA 3P17H 3RXGA 1TMUH 4UDWH 1AY6H 1SHHB 2EC9H 4INKA 1NFWA 1GHZA 1S81A 2BD8A 3V12A 5JB8S 1SI5H 1H8IH 1BTUA 1O0DH 2FOCA 4YZUA 1C5VA 2O9QA 3BIUH 1P01A 1C4V2 2ODPA 3TK9A 1XXDA 1G30B 1AO5A 4MPWA 5C1XA 5K7RA 2XW9A 1MCVA 1HJAB 4NWKA 3P8FA 4CH8B 1ANCA 1DITH 1C9PA 4KKDA 5IYTA 5E0HA 4LZ4B 3MNCA 1GCDA 2J4IA 1ANDA 1J17T 2Z7FE 3UFAA 2OQUA 1TGSZ 1XUFA 3F9GA 3M5NA 1FV9A 2GV7A 4AB8A 1AKSA 1QY6A 1K9OE 2BXTH 2NU4E 3M7QA 3ODDA 1GHWH 3M3TA 1MU6B 4O9VA 1C5WB 1S85A 1C5OH 1QCPA 3QDZB 2ZGBH 2VH6A 2QF0A 4FU7A 4CRFA 4AFSA 1C2KA 1GHVH 2UUYA 2ZFQH 3O8DA 4A1XA 3U9AH 1T4UH 3GCHB 5FX6A 3BIVH 2J34A 2XNIA 1EPTB 4MPUA 3P70B 1ZHRA 1KXDA 3MO6A 3U69H 1C4U2 4GPGA 2B9LA 3QO6A 1L4DA 1C2FA 3ATMA 5FPYA 3LGIA 1N8OB 1GGDC 3A8AA 2BOHB 4U30A 3GDVA 1P2JA 2ZHEH 4NIVA 1BTWA 2PKAB 5CHAB 1FIZA 3P8NA 1AN1E 2VWNA 2SNWA 1RIWC 1ETRH 1FQ3A 1P05A 3V7TA 3W95A 1OP0A 1WU1A 4ZXXH 1AVXA 2TGTA 2Z9IA 1HXEH 4Y0YE 3T26A 1O2WA 1A5IA 1QGFA 2V6NA 5FAHA 3QK1A 2VJ1A 3NUMA 3A7YA 1O2UA 1LVYA 1SFQB 1ORFA 3ZV9A 3K9XB 1O2VA 2FOEA 4FU9A 1ZMLA 1O2GH 2ZTYA 1GI9B 1GMDF 4DVAU 1NT1A 4ZXYH 1O3DA 3L3TA 1UK4A 1BITA 1HAZB 3I77A 1BTHH 4WH8A 1C5RA 1F0UA 2GZ7A 1TX7A 1P11E 4JYTA 1A0LA 5EG4A 2Z9JA 1AUTC 1BOQA 2AGIX 4AX9H 2H6MA 3OY5U 2R3YA 1CE5A 1G37A 3GYLB 2XC4A 2RA3A 4JZIA 3QTOH 2BDCA 3QLPH 2STBE 1S82A 1IQGA 1EP6A 1GCTB 4X1QU 1CSOE 1OXGA 1WQSA 4RN6A 2BB4A 1GHAF 2QA9E 3ITIA 1F0SA 1VJ9U 3M5OA 1OWJA 5JBBS 1GI3A 3BG4C 4I8LA 4MPXA 3ZZ6A 2YNAA 2AFQB 1O2QA 4JZ1A 1Z8GA 2D26C 3RMLH 2ZA5A 1O2SA 1KSNA 4ASHA 1FONA 1SQOA 1UVTH 3DD2H 2G55A 1KLTA 1EAUA 5JBAS 1PYTC 2HNTE 2HVXA 4FUJA 3AW1A 5FBEA 2Y6TA 1BQYA 1H4WA 4AOQA 2SGDE 4ABDA 1LHEH 1BRCE 1O32A 1LQEA 2PR3A 1MTSA 1P0SH 1Y3WA 1QHRB 4UEHH 1DOJA 1OYQA 2XBWA 1PPZA 4X2VA 4WY3A 2RG3A 5FX5A 5BPEA 1B0EA 1UTPA 5T3HA 4X0WU 1LDTT 5GIBA 2G5VA 1UTNA 1XUIA 1ZRBA 4X2YA 1PQ7A 2GT7A 3KQCA 1H9HE 2O8MA 2P93A 3HATH 1CVWH 1SLWB 3ZV8A 1OX1A 1Y5UT 2SGEE 1GGDB 3HKJB 1GHXH 4UE7H 1PQAA 2ASUB 3FP6E 3U1IB 4B2BA 1HJ8A 2PHBA 4Q2KA 1PPCE 1DLKB 2A4GA 3A85A 4MNXA 1TNLA 4SGAE 3MU5A 1MKXH 3PYHA 3VGCB 2ZFTA 4NWLA 1NN6A 4YM9A 5FPSA 3IWMA 1EKBB 3IG6B 4AFUA 2PUQH 2HPPH 2P8OC 1KXCA 2H9HA 1YPJH 1ELEE 2VIVA 2Z6BD 5A2MH 3Q77A 2BD5A 1TA6A 2HNTF 3JZ1B 4H6SB 2FWWA 2WUBA 4VGCC 5A0AE 1VITF 1C1SA 2VB0A 1SLVB 3ZZ5A 4ESTE 1O3KA 1K1LA 5E0GA 1O3CA 3QWCH 3RM0H 1AMHA 1VGCB 3VEQB 4CRBA 1S84A 1S0QA 1J14A 1P9SA 1W2KH 4BXWA 1EXFA 2AMQA 5DO4H 1Z6EA 3FVFB 4YOGA 5EGMA 1K1PA 1ETSH 4D76A 1C5YB 3A86A 1GBJA 3KHVA 1BJVA 3GCHC 1DANH 1C5UA 1UJ1A 1QBVH 2QN5T 6ESTA 4JK5A 1EJNA 3BTTE 2ZG0H 4DW2U 1Z8IB 1BJUA 1Z1JA 1N1LA 1OPHB 5L6NH 2NU2E 1UVPA 1TGNA 4INLA 5HGGA 3M35A 3BTWE 3MYWA 1P8VC 4B2AA 2R3UA 2ZF0H 3GY7A 3SV6A 1AE8H 1AVWA 1TFXA 1GHBG 2FLRH 5FCKA 1CHOG 2P3UB 1YM0A 2B7DH 1ZRKA 3MH6A 3SNEA 1SGFG 1FIWA 3T5FH 5A0CA 1ESBA 3M5LA 2BVSH 1MTWA 4JZEH 3E8LA 1UTMA 2ZDMA 2GCTB 1C1OA 3SV7A 1YCPK 1P03A 1W13U 3VB4A 2OBOA 5L2YH 4YLQH 1FN8A 1EX3A 1C2HA 1TRNA 2A7CA 3SJKA 5AHGH 1CT4E 4UFGH 1O2ZA 1TPAE 4GLYA 1W14U 2YNBA 5LPFA 2CF8H 4X6OA 4BAHB 3F9EA 1KLJH 1EASA 4IN1A 1VCQA 1GBCA 4X1PU 4CRCA 5JBTA 4LK4A 1GI7B 5T6FA 3TGKE 2HOBA 3M7UA 1YC0A 4HGCA 2A0QB 1G2MA 3PMHB 1YPKH 2R2MB 3A84A 1PYTD 4R8TB 4FUCA 2WPKS 2H5DA 1GI5A 1V3XA 1HPGA 3ZVDA 1N6XA 5JBCS 1CHGA 1Y3YA 1SGIB 2G81E 4KELA 4MNYA 4X1RU 7GCHG 1T4VH 2ZFPH 1O3FA 1EB2A 2D2DA 1IQFA 1XX9A 1O5FH 2SFAA 1A3EH 3PTNA 4B73A 2CGAA 4ABAA 1RD3B 2GCHF 1G3BA 2QYIA 3CP7A 2CV3A 4K69A 4NZQA 1FMGA 4D9RA 2AYWA 5GCHF 4ABIA 4FUGA 2BY8X 4HI3A 1RJXB 2PTCE 4FVBA 2Z9KA 3MH5A 1D3QB 2QXHA 1VCPA 1T8NA 2VINA 2CJIA 2JKHA 3MU4A 2VU8E 4Y8ZA 4LZ1H 1G3DA 1ZTJA 1H9IE 2Q6FA 2ZFRH 3RXIA 1TRMA 3ZVCA 2UWOA 1YGCH 4BAMB 4F4OC 1G3EA 1HB0B 2FXRA 2ZGXH 2BZAA 1QURH 2ZHDA 1SGNE 2P16A 4ZAEA 1LMWB 3CS0A 3RXPA 1G3CA 1L4ZA 2W3IA 4I7YH 2GMTC 3UOPA 2A2XH 1BBRK 1GBLA 2XWAA 1L1GA 2BY6X 3KQEA 4D7FA 2V0BA 1EAIA 2QAAA 4CBNA 4ISOA 3SNAA 3E0NB 3ZZ4A 1NO9H 3ZZ3A 2FOBA 3CS7A 1SR5C 4YOJA 2P59A 2PKSB 3RUOA 2JH5D 3ATKA 3D65E 3O8RA 2J95A 2WYJA 1SGPE 2CXVA 1WUNH 1O2JA 2BLVA 3HGNA 1EOJA 1F92A 3FZZA 4FUFA 2BDIA 1V2MT 2CHAC 1O3IA 3M36A 5BRRE 1LHDH 2DE8A 1EJMA 2Z3EA 1WSSH 2OP9A 2WPJS 4K8YA 2AERH 1O5BB 1GBEA 1E38B 4OS5A 1OOKB 3LGWA 1P12E 2OD3B 1T31A 1TMBH 3A7VA 2FODA 4XBBA 4NZLA 3PO1B 3T28A 2GD4B 1AUJA 3KQDA 3SV9A 5HXFA 1BZXE 1TX6A 1WAYB 6GCHF 3D62A 1CT0E 2G5NA 5C1YA 5C5OA 1CA0C 1ANEA 3A81A 2ZFSA 1P2QA 1ELDE 2VIQA 5AFZH 1C1MA 3FAOA 3R3GB 1O2RA 1A4WH 4DG4A 1HXFH 3PROA 4YTAA 1TONA 1O3MA 3MHWU 2OC0A 5A8ZA 1B7XB 4JYUH 1ZMNA 1O2NA 3BTQE 3OU0A 3UWJH 3SGQE 1AU8A 1K1IA 1EAWA 3IITA 4TPIZ 2BVRH 4THNH 4ABEA 2QF3A 1DWBH 3BG8A 1FPHH 1FAKH 3AVZA 3PWCA 1JRSA 3RMOH 2EI6A 2HWLB 1NFYA 1C4Y2 2FOMB 3SUFA 1LKAA 1BB0B 2ZECA 2OUAA 2FTLE 4WXIA 2ZP0H 1VITH 2GCTC 2SGPE 1THRH 1TNIA 1DWEH 2PSXA 3RDZA 2BOKA 3ZZCA 3V3MA 4B2CA 3DUXH 2V35A 1QRWA 2F9UA 1ZMJA 3KIDU 1AQ7A 3EA8A 2G51A 5LH8A 1O2LA 1FUJA 1CGHA 2KAIA 3NPSA 3V13A 6CHAC 4UFDH 1MZDA 4ZMAH 1QL8A 3SI4H 1HAOH 4OGXA 1H8DH 2HALA 4DJZB 3GY2A 2C8YB 3K6ZA 4F49A 1G9IE 2OC8A 2VWMA 1IQMA 2XCFA 3TU7H 3LH3A 4Z6AH 1J9CH 2VH0A 2O8WA 5CMXH 5HYOA 2BD3A 5DP7A 1WV7H 5FHTA 3PO1C 4ISIH 2Y82A 1ZLRA 2Q6GA 2H5CA 2EA3A 3O8BA 1GCTC 1GBKA 4IMQA 3PMJA 3SO3A 1ETTH 1HAPH 1SLXB 4BTTB 2VVUA 3LGUA 1O3AA 4J2YB 1QB9A 4MPVA 4MTBA 4K60A 2GV6A 3B8JA 3SQEE 1BRUP 2WV5A 1KDQB 1RRKA 5GPIB 1S83A 1NPMA 4ZHLU 3ZVFA 5E2PA 3Q3KA 3A87A 3TH2H 4Z0KA 2BX3A 4ZH8A 1DSUA 3A7WA 1JBUH 1Z8JB 5EPNA 1P10A 4I32A 4U32A 4A5TS 3PLKA 1AE5A 2PV9B 5CHAC 5C67A 1GG6C 3UQVA 4X2XA 1A0JA 2XC0A 2F9OA 1LHCH 4AFZA 1O5EH 3PMAB 1SB1H 2ZPQA 5EQRA 2IPHA 2D1JA 3TJOA 2BLQA 2IN2A 3SNDA 1O3JA 1CO7E 1T8OA 3E6PH 1MTNB 4YT6H 1O33A 1PPBH 4B74A 1O3PB 2C93B 2QIQA 3LIWA 5FCRA 2QXJA 4MDSA 1KY9A 2CMYA 5B6OA 1YLDA 4E7RG 4AN7A 4UD9H 1IQKA 2WV4A 3LJJA 2FOAA 1JXPA 1AVGH 3LOXA 1OWHA 3EQ0H 2Y7ZA 2VIDA 2G4TA 1DX5M 1ZSLA 1BIOA 4IN2A 1EAXA 4X8TH 3RC5A 5DP6A 4K5ZA 1FAXA 3SU0A 1Y8TA 1O2MA 1MUEB 1O5GH 1X7AC 1YLCA 3JZ2B 3RXUA 1KYNA 1C9TA 1IAUA 1BA8B 1F0TA 3RMNH 1CBWC 1ZHPA 1RGQA 1C1NA 3A7ZA 4I8HA 3TJVA 4ABJA 2TGDA 1HYLA 2C8ZB 3BTEE 1OS8A 3OYPA 2FOGA 3GY6A 3ZZ8A 1EATA 1V2ST 2BDBA 1J8AA 4VGCB 1Q31A 1QIXB 4CBOA 1TIOA 2XBXA 2G00A 1OWIA 3SN8A 1C1VH 3NZIA 3O8CA 1J15A 2BDGA 5LPRA 3EA7A