3GY3A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy3A02
1HRTH 3RXCA 3TJOA 1FJSA 1YCPK 1T7CA 2IPHA 5F8ZA 5EXMA 4TY7A 1BRCE 2FWWA 2Z9GA 3M5MA 1SMFE 3M7TA 1Q2WA 3SU5A 3ZZ7A 1EUFA 1Q3XA 1TPSA 3LGUA 3M7UA 2CV3A 1H9HE 3MHWU 4A1VA 3K6ZA 1DS2E 1MUEB 1VITH 1G3CA 2FOBA 3I29A 3LPRA 4WWYA 1LKBA 3GY5A 3RU4D 2YNBA 3HGNA 1W12U 3W94A 1WAYB 3BTGE 2JETC 3SNEA 1TNHA 1KTSB 1P10A 1UTMA 4INLA 1C1NA 3R0FA 4AFZA 1A5IA 2OC8A 1WQSA 1E0FD 1PYTD 2QY0B 2ZECA 2ODPA 1P3EA 2A1DB 1GBCA 2G5NA 4X0WU 2CHAB 1C5QA 1ZLRA 1ZTLA 1ZZZA 1UTJA 2BLOA 1HJ8A 2OC1A 3TJVA 2W5EA 1P57B 2VIDA 3UWJH 2PKAA 4CHAC 5BRRE 5CMXH 4ABJA 1GMCF 2BQWB 3SNBA 2BHGA 2GKVE 5E0JA 2F9OA 2O8WA 1LVYA 1LVBA 1RXPA 2QXJA 1SQOA 3KIDU 1E34B 1T32A 5FXLA 1C5PA 2TPIZ 1S6HA 1CT2E 3ATMA 1TWXB 3E16B 1CHOF 3BTFE 1N6XA 4CR5A 2FO9A 3CS7A 3SUGA 3NZIA 3S9AA 5GIBA 3SW2B 2PLXA 3RXIA 5T6FA 3NXPA 3TNSA 2FLRH 2Y5HA 2SGFE 1QBVH 1F92A 3MU4A 5AFZH 1CQQA 4YOIA 4NIWA 2ANKH 3E3TA 4U01A 1GI5A 3PWCA 1FY3A 1S0RA 1MD8A 4OGYA 1GBDA 1W3CA 4YLUA 1TPOA 2J34A 1EASA 3C1KA 2BM2A 1O0DH 3M3SA 3TLOA 4ESTE 1BMAA 1GCTC 3EDXB 3GYLB 3M5LA 4R8TB 5DKMA 1O5DH 4RKJB 1IQHA 3RMNH 1OWDA 2P93A 4MPWA 3SN8A 1QL9A 1ELFA 4ZHLU 3M37A 1ID5H 5EGMA 1HLTH 4FU7A 1AWFH 2D1JA 3RM0H 4LK4A 1HYLA 1GBKA 1HV7A 1C1VH 1GHBG 1NFWA 7LPRA 2W3KA 2FOHA 2B8OH 4CBOA 5AHGH 1V2VT 5DJ7A 1EXFA 1SGCA 3UQVA 5FPSA 2XC4A 4JYVH 2AMQA 2V6NA 2EI7A 3ZV9A 2GP9B 1DSTA 1G2MA 1OYTH 2QAAA 1DLKB 2R2MB 3UR6A 3A87A 1LQDB 4U32A 2BZAA 3KNXA 2AGIX 3M5NA 4CBNA 4AGJA 1GL1A 4XBBA 1TONA 2J92A 1PQAA 1S84A 4OS2A 4TY6A 5DP3A 2HLCA 1DOJA 1G3DA 2Q6FA 1GPZA 3T62A 4K8YA 5L2YH 1NRPH 1BHXB 1C1PA 1LDTT 3PB1E 2QXIA 1BB0B 4NIYA 1L1JA 3A8CA 1GMHG 1TB6H 4MNYA 1G9IE 3BEUA 1D3PB 4X8UH 4U30A 2FS8A 1YLCA 1TPPA 2BX4A 4KTUA 1NROH 1C9TA 2PHBA 4NG9H 2BOKA 1WU1A 3R3GB 2KAIA 2ZPRA 1GMDG 3FAOA 1C4V2 4XE4A 7GCHF 4JK5A 1K1JA 1O3HA 1GJ9B 4AB9A 1OWEA 2A32A 8LPRA 1YKTA 2FTLE 5DGJA 3LT3A 3B8JA 3SQEE 4B2CA 3TIUA 4ZMAH 1DY9A 3MFJA 5EQRA 1A46H 3VB3A 3BG4B 4OS5A 5A8XA 3H5CB 1P3CA 1RS0A 2WPMS 2FX6A 1W8BH 1G3EA 2TGAA 2WINI 4NGAH 3TH3H 3SGQE 1N8OB 3SV6A 2OUAA 5FBIA 3MI4A 3RXDA 1O3DA 1YBWA 3MNXA 9ESTA 3GY8A 3FP7E 4WY3A 3GICB 3BTKE 2ZU4A 1LPZB 4M7GA 2OQUA 1C5XB 4NIVA 2Y82A 1ELAA 1OWJA 1O39A 1GL0E 1HJAC 1O3EA 1O2ZA 1TABE 1GVZA 1DLEA 2F9VA 2G4UA 1C2KA 4NA9H 4NWLA 1GBMA 1V2NT 2VWMA 1ZMJA 2AGGX 4WMEA 1O37A 2PTCE 3F9GA 1GJ5H 3E90B 4Y6DA 3EAJA 1MTVA 4BAHB 1YPLH 1CT4E 3ZVGA 4BAOB 1B7XB 3LH1A 3GDSA 2TIOA 1IQMA 1F0TA 1JOUB 4Z0KA 1O5GH 2TGTA 3HKIB 1UCYH 4JCNA 1QA7A 2FOAA 1VJAU 4WVPE 3QZRA 2GV7A 1ZPCA 2BDGA 2WPHS 3L33A 4JK6A 4H4FA 1NS3A 2UWPA 4CH8B 4D7FA 1HNEE 1TNKA 1Z8RA 1BHXF 1BTUA 3S9BA 2H5DA 3IG6B 4Q7YA 1UVSH 1L4DA 3NCLA 3QUMP 1C1WH 1EPTC 2A0QB 1NO9H 1C5UA 1TX7A 1BDAA 6GCHF 4OS4A 4NA7A 4AFQA 2ZHWH 2AYWA 1O33A 2XBYA 1C5VA 1G3BA 5J4QA 5JB8S 2ALPA 2WPJS 4CRFA 5JBCS 2OC7A 4I33A 1L0ZA 2ESTE 1O5FH 1VZQH 1O2JA 2CHAC 1MZAA 2WUCA 4YT7H 2ZGHA 3DT0H 3H7OA 2KAIB 3ESTA 4BTTB 3LGYA 1CO7E 3H7TA 1EATA 4BTIB 4DW2U 2A5KA 1FIWA 1SGQE 3K6YA 5DP9A 1FQ3A 4D9QA 1KXCA 2ZQ2A 1C5YB 2EI6A 3A84A 3EGKH 3N7OA 5E8EH 2A7HA 3OY5U 1IHTH 4X8TH 3QDZB 1J15A 2Y7XA 3PROA 1W7GH 4ISHH 1O2XA 5C20A 2NU1E 2J94A 1GHAG 1SOTA 5ETXA 1YGCH 2CF9H 1DSUA 5F6MA 1TALA 3QGJA 1SGNE 1XUGA 1W14U 1KIGH 2ZPSA 4O3TA 4ZROA 5L6NH 1WOFA 1QB6A 4X1NU 2SNVA 1XX9A 2ZHEH 2J4IA 2ZFPH 4WXVA 3A7ZA 3IWMA 3Q76A 1RTFB 2BD4A 2ULLA 2ZF0H 3ODFA 4AB8A 3F9HA 2BD5A 5G4BA 2ZCKP 2Y80A 2BY8X 3GY2A 1CBWC 2Z9LA 1MBQA 1C2MA 3D65E 1QBOA 4ABDA 4UFEH 4X2VA 1QJ1B 2IJOB 3AVZA 8KME2 4WMDA 2BQ7B 1A7SA 1O32A 1O2GH 2BQ6B 2BD7A 2GTBA 1PPZA 2AIQA 1D6WA 1RGQA 3RXSA 3U1IB 4X6OA 3SORA 1IQFA 4FVBA 4IGDA 4X1SU 2IN2A 2CJIA 1OPHB 2O9QA 3RXAA 1V3XA 4ZXYH 2SGQE 2ZA5A 2BX3A 3Q3YA 5FAHA 2GV6A 2GD4B 8GCHG 4NWKA 3RXOA 2QN5T 5DPAA 2FS9A 3UNQA 2XCFA 2ZKSA 1AU8A 4I32A 4B74A 2BDBA 2PR3A 3CS0A 4A1TA 6CHAC 1RIWB 1DX5M 3SGAE 1Z1IA 1VCQA 1QIXB 3KQCA 1GBJA 2P94A 2ALVA 1XKBC 2P3FH 1T4VH 5EW1H 2PKSB 2PSXA 3ELAH 5C5OA 4VGCB 3BG8A 1GDNA 1HAXB 4FUFA 3U1JB 3LGTA 5C3NA 3BEFB 2BZ6H 5EOKA 2VWOA 1RTLA 4DT7B 4X6NA 1IQKA 3P8NA 1NN6A 2BD8A 1GBFA 4DJZB 2STBE 2G81E 5EQSA 1BOQA 4YOGA 1UK4A 1YC0A 3KGPA 3RMMH 2PSYA 2A4RA 1J9CH 1HUTH 3GCTF 2GCHG 1HAOH 4D8NA 1NU7B 2Y81A 1YCPH 3ZZ8A 3U69H 1BRBE 3EA9A 3LONA 1NFUA 2VIOA 1O3AA 4INKA 2HALA 1ZHRA 2ZDLA 1KLIH 1P2KA 2EA3A 3O8RA 1P2JA 4RKOB 3DFLA 3K65B 1TX8A 3E8LA 3TVJB 1AE5A 2OXSA 1ZHMA 4O03A 2BLVA 4Z6AH 4B75A 1SGIB 1OS8A 4A6LA 2RG3A 3RUOA 3RXVA 1SC8U 1GJCB 1L4ZA 4D7GA 1MD7A 3AW1A 2SGPE 1O35A 1PPFE 2FYQA 3M7QA 1LPGB 3P8FA 2TRMA 4UFDH 4IMZA 1F7ZA 1E36B 3T28A 2XBXA 3FP6E 2O8TA 4MPVA 1V2JT 2BXTH 2SFAA 4WXIA 1AB9B 1GGDB 3ZVEA 1FUJA 2R9PA 2OC0A 2SNWA 2VB0A 3UR9A 4ABIA 4K8BA 1T31A 3A7WA 1A3BH 1HBTH 2FLBH 4DG4A 3RXKA 2B0FA 4GPGA 1G36A 1B5GH 2VJ1A 1ACBE 4X6PA 1CSOE 1ZR0A 1HPGA 1ORFA 3ZZBA 3I78A 5GCHF 1TRNA 2A2XH 1EAXA 2AMPA 5E2OA 1AIXH 2ZDNA 1TBRH 1IOEA 2CXVA 1VCWA 5FCKA 1QB1A 3BTHE 3GISB 3M61U 1SFIA 1GHWH 2HGTH 1OOKB 1QJ7B 5JBTA 5HM2A 4IS5A 1A3EH 2ZTXA 4GVUA 3M5OA 1GJ4H 4Q80A 3SZNA 2THFB 5JPMH 1Q31A 1EZQA 3D62A 2H9HA 2FODA 1KXBA 2VWLA 3MH7A 1XXDA 2H9TH 1L2EA 4K1EA 1GHXH 1HAGE 1YF4A 1P12E 1C2EA 4FUIA 1JIRA 1K1LA 1MQ5A 4I7YH 1O38A 4B76A 2AEIH 1M9UA 3O8BA 1IQNA 5HM9A 1AKSA 1OP8A 2AFQB 3GCHB 3F9FA 5FHTA 2V3HH 1EAIA 3TK5A 4E7NA 1BTXA 4X8SH 1JWTA 1A2CH 1LHCH 4CRBA 4X6MA 1SGTA 1G37A 1BITA 3PTNA 4UFGH 1QCPA 2BOHB 3A88A 1O2TA 3UFAA 2BDCA 4BAMB 4ZH8A 1SQTA 2AS9A 4YT6H 2Q1JA 1FZZA 1J14A 3P70B 1NC6A 2NWNA 1WUNH 1A1RA 1GHBF 1EZSC 1XKAC 1D6RA 1WTHD 1IQJA 1ZGIA 1OSSA 4CRCA 3PV4A 5EW2H 4FUBA 1T8OA 3GY7A 1IQEA 1OKXA 1ZMLA 2FTMA 1FN6A 2BTCE 3P8OA 1PQ5A 1LHDH 5FX5A 2VVCA 1A0LA 2ZU3A 1UTNA 4AZ2B 1VITG 4FU9A 1C1QA 3NWUA 5GDSH 1DWDH 3FP8E 1Z71A 3RM2H 2R3UA 1ANBA 4I8LA 4MDSA 3RC5A 3M35A 1J17T 2D8WA 1GVLA 2FOFA 1C4Y2 2XBWA 2F91A 3PO1B 1QRZA 2C8YB 1GBEA 1UTOA 2OTVA 2QXGA 3HPTB 4GCHG 1Y3YA 1GMHF 3E91A 4XBCA 5FX6A 2GZ7A 4AFSA 2F9NA 3DFJA 4KP0A 1SLVB 3SU1A 2A7JA 3OU0A 1VJ9U 2HVXA 2D26C 2SGEE 3KF2A 1FAXA 1IHSH 2W26A 3QZQA 1GMDF 2VVVA 1G30B 2B7DH 3A7VA 1SVPA 3LJOA 1EP5A 2UWLA 2QF3A 3E1XB 3QWCH 1QBNA 1O3BA 4O9VA 2TGDA 2W7UA 1EZXC 2V0BA 4ZHAA 1AFQB 4K60A 1C2DA 3T25A 3M3VA 3RXQA 4X1PU 1C5LH 1TMBH 1H8IH 1O3GA 4B71A 1RJXB 1G32B 2C8XB 1LHGH 4ISLA 3SI3H 1Z8JB 1HAHH 4B1TA 3MU5A 4KTCA 3GDVA 1XM1A 3RLWH 5EODA 1BMMH 1DFPA 4BAKB 3MU0A 1P9UA 3ATKA 1O2NA 1V2MT 4RSPA 1QRWA 2B9LA 1EJNA 1YPMH 3U98H 5CHAB 1TFXA 4O3UA 3HK3B 4VGCC 3UIRA 1AKSB 4MNVA 2BY5X 4ISOA 4Q7XA 1UTLM 2OBOA 1AD8H 1T8LA 5I46H 1OXGA 4UFFH 3T5FH 1DWEH 4DY7B 1C2IA 9LPRA 1DXPA 2ZFSA 2H9EH 2WPKS 4NZLA 3T27A 3BIUH 5E0HA 1YPHC 4UE7H 2ANYA 2K1QA 2BDAA 1O31A 4X1RU 3P17H 3ITIA 2Y5GA 2JH6D 1K21H 2G51A 1EZUC 4DVAU 1O2IA 5BPEA 5LPEA 2CGAA 3DHKH 5LH8A 1HAVA 3ZVFA 3ZZCA 1SQAA 1CGHA 1BTPA 4BOHA 4CRDA 1F5RA 1W13U 1P0SH 2I6QA 3URCA 1DXWA 1ZMNA 1RFNA 1ZRBA 1HAPH 1AGJA 4XSKU 4ABBA 2BVXH 1D4PB 1ELBA 2OLGA 2ASUB 5T6DA 4OS1A 1THPB 1AHTH 3SV9A 2F3CE 2WV5A 2OCVB 3BTQE 1TNJA 1O3CA 1SGFG 5GXPA 2FI3E 3SJOA 1TE0A 4F49A 1TBQH 4BXWA 4LZ4B 4R0IA 1MTUA 3PYHA 1ZPBA 1W2KH 2GCTC 1SGYE 1Z7KA 4X8VH 3T26A 1JXPA 1SFQB 1CA0C 5ESTE 3B23B 2A4QA 3TGIE 2QIQA 1ABIH 2ZEBA 1TLDA 2FOCA 1Z8GA 2HPQH 1BZXE 1AB9C 1BUIA 1GGDC 2ZHFH 3GY6A 4JZEH 3VGCC 2STAE 1Y3VA 3DUXH 2LNCA 3F9EA 1K28D 1P03A 4MVNA 1FI8A 4WH8A 2BD9A 1TRMA 1KTTB 1NT1A 2SGAA 1C1TA 1OWIA 4CH2B 3UWIA 4OS7A 3SV8A 1O3OA 1KDQB 1IQGA 4NSVA 1BTZA 1GG6B 1O3JA 3UREA 3WY8A 5EU8A 3A8BA 1SGEE 3F68H 1DUEA 3UNSA 2GMTB 1C1SA 2WUBA 1X7AC 3KL6A 5DP6A 1ZGVA 2O8LA 3BTWE 1YYY1 3U8OH 2LPRA 1KXAA 1GHAF 3P8GA 3S9CA 1KLTA 1W10U 3BN9A 1GI0A 2RDLA 4ISNA 1BTYA 2C8WB 1UMAH 2QGRA 5DP4A 3UY9A 2Q6DA 1C5NH 1C1UH 1BMLA 4B2BA 4AOQA 3IITA 1G2LA 4ZKRU 1TPAE 1BIOA 1LTOA 2XC5A 1NRNH 2PGQB 3UQOA 1HXEH 4LZ1H 1P8VC 2QA9E 1EX3A 2XBVA 2BMGB 3VB6A 1KYNA 2HNTF 1ANCA 1GVKB 2O8UA 3V7TA 4I8JA 3LOXA 1D3QB 4WMFA 1Z8IB 3SHAH 4MG3A 1MTNB 1HGTH 4SGBE 1O5CB 1GDUA 1C1RA 1LVOA 1QB9A 1JMOH 2Z9KA 1MTSA 5ESBA 1TOMH 2RCEA 3MU8A 1V2LT 5EQQA 1BJVA 4FUGA 3STJA 1C1MA 4YM9A 1P01A 1XVOA 3ATLA 2GGVB 4Y8ZA 1CT0E 3SUFA 3AW0A 1YP9A 3V3MA 1C1OA 1V2UT 8GCHF 1HAVB 3HKJB 3ODDA 1UTKA 4TPYA 5F03A 2FEQH 1ANEA 5EG4A 2XWAA 4JYTA 4K2YA 2VH6A 4JZFH 1A4WH 1O2UA 4H42U 4ABGA 2V35A 2J9NA 3HGPA 3PWBA 2FOMB 3VB7A 4K69A 3EA8A 1QL8A 1QY6A 3P92A 1QR3E 3SU0A 1A0JA 2ZDMA 3OTJE 2BDHA 3GOVB 3EA7A 1MQ6A 2G8TA 3MYWA 5LGOA 1D3DB 1BQYA 1OWKA 3FZDA 1NESE 2QC2A 2HOBA 3ZZAA 2QYIA 2FESH 1O3LA 1F2SE 2ZFTA 4A1XA 1MTWA 4CHAB 1LKAA 1ZSLA 3VPKA 2IOTA 3RC6A 1EKBB 2GCHF 1RRKA 2DE8A 1F5KU 2GT8A 1MCTA 3VXEH 2VIPA 5K0HA 4AGKA 7KMEH 4HTCH 1TAWA 1TMUH 2DUCA 2Z3CA 2FXRA 1CGIE 2GZ9A 1Y3WA 1AFQC 1MKWH 2ZP0H 3SNDA 1KSNA 5JBAS 4TPIZ 2ZGCA 1PQ7A 1O3IA 3FFGA 5H4IB 5PTPA 2DE9A 3LIWA 2XNIA 3KQDA 3TK9A 3NKKA 4TWYA 1L1GA 1P2MA 1XUKA 5A0AE 3MNBA 1XUJA 4MTBA 2UUJB 1AFEH 5GJ4B 1V2ST 5F8TA 3E0PB 1RD3B 1ELVA 3M36A 5ABWA 1BRUP 3ATIA 3A86A 4JZDH 1SGFA 2Y7ZA 5CHAC 4X2XA 1GI8B 2OD3B 1FPHH 1C5ZB 4WF8A 3ZVDA 1O5BB 1NU9A 1QL7A 3GCNA 2XC0A 2ZTYA 4NZQA 1QQUA 3RMOH 2ZO3H 4ZXXH 3BTDE 3OX7U 2PTNA 2ZZUH 1HXFH 2CF8H 1V2OT 1AWHB 1SSXA 1WYKA 2HNTC 2HNTE 3A85A 4NSYA 5A0CA 3LC5A 1SLXB 2BYAX 1WBGB 2ZU1A 3A7TA 4FUDA 3BTEE 1WV7H 1OX1A 1HAIH 1ARBA 1YM0A 3NUMA 2ODQA 2ZFRH 3RDZA 3JZ2B 1VR1H 1NY22 4ZHMU 4MPUA 2F83A 3BTTE 1DY8A 2UUKB 3MMGA 1ESBA 4Y71A 4X2YA 4NFFA 3GY3A 1ELCA 1E38B 1HAYB 1DPOA 2OP9A 4TYDA 2XW9A 2FX4A 4IN2A 1FY1A 1UTPA 3RXLA 2C8ZB 1MZDA 3U9AH 3C27B 2F9BH 1JRTA 3SNCA 1O2QA 1MKWK 4J1YA 2GDDA 2AH4X 4K3JA 3SU6A 4AN7A 2QV1A 1SPJA 1MU6B 1V2TT 3PMHB 5B6OA 5AVDA 4DIIH 1PYTC 2ZCHP 3BG4C 4XDEA 1ETSH 4FVDA 2BY7X 1GJDB 1GJ6A 1EAWA 4NCYA 3ZYDA 3ZV8A 3Q3XA 1THSH 3UOUA 4GLYA 3JZ1B 3F6UH 1N8OC 2Z94A 2ZG0H 3VB5A 3PMAB 2VGCB 1DANH 2XXLA 4JZIA 1O36A 5C1XA 2ZC9H 6LPRA 1P11E 1VGCB 3TH2H 1FV9A 1ZYOA 4FUEA 1GI3A 1A5HA 1Y8TA 2SGDE 4F4OC 3S0NA 2OBQA 4YOJA 2ZIQH 3SUDA 1Y3UA 1ELDE 1HJ9A 3RLYH 1T4UH 1P05A 4UD9H 2ODYB 4PROA 2GMTC 3ATWA 3MO9A 1GJ7B 3PLPA 1SGRE 1MMJN 1VITF 1EAUA 3FVFB 1IQIA 4KELA 1BBRE 1S0QA 5GWZA 5I25A 3VEQB 4K1SA 3BF6H 3UNRA 1XXFA 1ZTKA 1UVPA 1J16A 1BBRK 3OYPA 2A45B 2A2QH 2FIRH 3A7YA 1TQ7B 3RP2A 4ABHA 1GHYH 3PLBA 1SL3A 2XRCA 4GHQA 2HWLB 3B9FH 4GCHF 2BD3A 3QO6A 1O3MA 4O97A 5DO4H 4E7RG 1TNIA 1E35B 5E2PA 1GBTA 1O3FA 3BTME 1NFYA 1J8AA 1EJAA 5SGAE 3SU3A 1IQLA 1GCDA 2JH5D 5DG6A 2EI8A 4UONA 1K1IA 4Y7AA 2BY9X 4JYUH 2ZPQA 1TOCB 1MTNC 1QJ6B 4FUJA 8ESTE 4YLQH 2ZGBH 3RXPA 5K7RA 4A7IB 2J38A 2FI5E 1INCA 3NPSA 1ANDA 3GDUA 1HCGA 4DCDA 1W7XH 3GCTG 2G52A 1EP6A 1LO6A 5AF9H 3VFEA 4Y11E 2GDEH 4GUXA 3QLPH 1FDPA 3E6PH 4XBDA 1QGFA 2FM2A 1GBBA 2BDIA 1V2WT 1HIAA 1EOJA 1FY4A 4AG1A 3SJ9A 4NIXA 1O2VA 3O8CA 2R0LA 4ISIH 2WPIS 2BVRH 2AGEX 1O2WA 1EPTB 1TGNA 2ANMH 2VIQA 5IYTA 4Y0YE 1T8MA 5HGGA 1CGJE 5JDUB 3L6PA 1GI4A 1OYQA 3SI4H 3V0XA 7ESTE 3QTVH 4A5TS 4Y8XA 1PPGE 1V2PT 2P3TB 1LHFH 1P06A 2WYJA 4H6TA 3RC4A 1TIOA 1MKXK 1UVUH 2YOLA 2TBSA 4A92A 3MTYA 3P6ZB 4Y79A 1SG8B 3ZVAA 3SHCH 1BRAA 1XUIA 1DT2A 1OWHA 1QNJA 4IMQA 3T2NA 1KLJH 1XUFA 3U8TH 5JBBS 1XUHA 2VWNA 2F9PA 2NU3E 1H9LB 2AMDA 5GCHG 1B0FA 4IN1A 1V2RT 1UK3A 2R3YA 2J95A 3LGVA 1EOLA 1JBUH 2P8OB 3MH4A 1KDQA 2VIWA 3SJIA 1ELGA 4OS6A 1YPKH 2TGPZ 3GCOA 2UWOA 1O2SA 5C67A 1NPMA 5EXNA 2A5IA 3S7HB 1YPEH 3SO3A 1AI8H 1ETTH 4X1QU 3RXFA 4I8KA 1NFXA 1THRH 4B73A 1C5MD 1CBWB 4JZ1A 4K1TA 2GVFA 1FAKH 4Y8YA 1F0RA 1NM6A 2H1UA 2UUYA 2B5TB 2WV4A 4ZKOU 2R0KA 3LJJA 1IAUA 2EEKA 1TNLA 3RXHA 3T29A 3K2UA 2FI4E 1Y5AT 1ABJH 2ZI2H 1K9OE 1RIWC 4E05H 2R2WU 1TYNA 2VIVA 1AZZA 1SB1H 4NFEA 3MO3A 4CR9A 4YO9A 3RXRA 2PKSC 1GI6A 2AERH 1C5SA 5TCAA 3A89A 4MNXA 1FN8A 1N1LA 1NRQH 1TGTA 3FZZA 1BA8B 3A83A 2ZDKA 3ZYEA 5FPYA 1OP2A 3Q77A 2ZU5A 3MU1A 3ZZ5A 1B0EA 2ZDAH 1HIAB 1SGDE 1YPHE 2W7SA 1W0ZU 3TGKE 1FONA 4ZUHA 4D76A 3RXJA 4HZHA 4MNWA 5AFYH 1CE5A 1GMCG 6CHAB 4U2WA 3HK6B 3URDA 3A8AA 1O3KA 1CA8B 3A7XA 1MCVA 1QURH 1DWCH 1SBWA 3AASA 1NRRH 1C4U2 1AVGH 1PPCE 1SLUB 1ZJKA 2Z7FE 1P2IA 4AYVB 4THNH 1MAXA 3K9XB 3AAUA 1GHVH 1SLWB 1ZRKA 1P2OA 3GY4A 1CHOG 5A09A 1LCYA 2BVSH 4CREA 2VVUA 4XFQA 1S5SA 2D2DA 5T6GA 4FUHA 2A7CA 1AE8H 1O2YA 2QXHA 2G5VA 4ABAA 5TCCA 1UVTH 2VGCC 1UHBA 2PUQH 1PQ8A 1S83A 2GT7A 3QK1A 1W0YH 2PKAB 2AIPA 5HMAA 3KHVA 1VGCC 1O2PA 1SR5C 2ZTZA 5FBEA 1K22H 1C2LA 1P09A 4I8GA 5T3HA 3SBKA 4KTSA 2ZQ1A 5HXFA 1GJ8B 2NU4E 3KN2A 2OINA 1NZQH 2PWXA 1QA0A 2ZNKH 1PFXC 3TJUA 1K1OA 1Z6EA 3ZVBA 2P95A 1C2GA 5E0GA 3VB4A 5C2ZA 1AUJA 1PJPA 3SJ8A 3MNSA 2VU8E 2ZHQH 1TA6A 3UPEA 1KY9A 2ZGJA 4IBLH 4Q7ZA 3TPIZ 5JYIA 4TWWA 4BXSA 2CMYA 2C3SA 1UJ1A 1AO5A 4AG2A 1KXFA 2A5AA 3O8DA 4IC5A 2HPPH 3BV9B 3RXBA 2A31A 3MH6A 1SI5H 1XVMA 2FP7B 5DP8A 2Z9JA 2H2ZA 1TNGA 3TNTA 3A81A 4IW4E 3ZZ4A 2GX4A 3TH4H 1WTGH 3MO6A 3E0NB 4MQAA 3ZZ9A 1BJUA 2Y5FA 3HATH 4DIHH 3RXEA 1Y3XA 2JKHA 2ZFQH 5J4SA 2JH0D 1C5TA 4LXBH 1V2KT 3SV7A 1L1NA 3EE0B 3Q00A 1ZHPA 3CP7A 1UO6A 1ETRH 2EC9H 3RU4T 1PPBH 2P3UB 2G4TA 2HRVA 4E06H 1AUTC 2FOGA 2H6MA 2C4FH 3GCHC 1YPJH 2Q6GA 2ZGXH 1GJBB 4WJG2 1Z1JA 3UUZA 5HYOA 4FXGH 1CU1A 1CHGA 4UEHH 2P16A 3PMBB 4DGJA 2BLQA 1P04A 1UK2A 2ZU2A 2RA3A 5TJXA 2BXUH 1HDTH 4AX9H 2G55A 7GCHG 4AORA 3QGNB 2RA0A 1FMGA 1PPEE 2Z3DA 2V3OH 4MLFB 1Y5UT 4YESB 4CRGA 3D49H 3KCGH 1UTQA 4AFUA 1LHEH 1Y59T 3U8RH 2PV9B 1K2I1 1GBAA 1YPGH 4GHTA 5C1UA 1BTHH 4B2AA 1GWAA 1QHRB 1Y5BT 1O2MA 2C90B 3S69A 4ZAEA 4ABEA 4CRAA 2YNAA 3SU2A 1K1PA 1K1MA 1CVWH 3UTUH 4GAWA 3ZZDA 2OQ5A 4ASHA 1FIZA 3D23A 4Y7BA 2JETB 1ZPZA 3SGBE 3F1SB 1UHBB 4Y76A 1AQ7A 3PO1C 4H6SB 1GBLA 3MOCA 3SU4A 1WCZA 1WSSH 2Z3EA 1TBZH 1O3NA 2NU0E 1O2HA 1ESAA 4FU8A 1DICA 5C5NA 1T8NA 2Z6BD 1V6DA 1HFDA 1EB1H 2Y6TA 2ZCLP 5L2ZH 1AVXA 1O5AB 1HB0B 2PFEA 3KEEA 1O3PB 4INHA 3L3TA 3PLKA 1A5GH 1ELTA 3ZVCA 1O34A 3TJNA 1P2NA 1N6YA 1DE7H 1KXEA 3RMLH 2UUFB 4LOYH 3A82A 1AN1E 1Z6JH 1K1NA 2NU2E 3TU7H 2P8OC 1UCYE 1ZSJA 2ZFFH 2FPZA 2FMJA 3DA9B 4RN6A 1KXDA 1XMNB 1QQ4A 1LPKB 2BD2A 2F9UA 4MPXA 4Q2KA 1A0HB 1A61H 4DURA 3TITA 1UCYK 1FY8E 1FY5A 3QTOH 3PTBA 4Y0ZE 5EPNA 2W3IA 2FOEA 1GHZA 3SQHE 1PPHE 4YTAA 5IDKA 3I77A 1TGBA 1F0UA 5JB9S 1D3TB 1W11U 3KQEA 1HAZB 3P95A 2PGBB 3OSYA 1NTPA 1MAYA 1AY6H 1P02A 5A0BA 4ABFA 1P2QA 5EPYA 4HFPB 4K5ZA 2CN0H 2FZZA 1WQVH 4JMYA 2XCNA 3LGIA 6GCHG 1LMWB 1DM4B 1P9SA 3RXTA 1LVMA 3FANA 4HI3A 3LU9B 5F8XA 1TX6A 1GCTB 2BDYA 3VXFH 5A8ZA 1H8DH 2VH0A 3LC3A 3PM3A 3V13A 1TGCA 2C93B 3PMJA 4IC6A 3SUEA 2J2UA 4KKDA 3UOPA 4BNRA 2PUXB 1U6QA 3M3TA 1ZSKA 2GZ8A 3TK6A 2I6SA 1BMNH 1YCPM 1E37B 2ZWLH 1ELEE 4BANB 2ILNA 2A4GA 4GSOA 2O8MA 1AVWA 4DOQA 2P59A 5A2MH 1RTKA 3DD2H 1GBHA 4SGAE 1ZTJA 3W95A 1EB2A 1VCPA 2PW8H 1GI1A 1BBRH 1DVAH 1NRSH 2Z9IA 5LPFA 1C5RA 2VNTA 1O2OA 1DUAA 3Q3KA 3MWIU 2G00A 5A8YA 4XOJA 1QFKH 4BAQB 2XYAA 1F0SA 1TA2A 3BSQA 4D9RA 3LH3A 1UVOA 1SHYA 3RXUA 1BT7A 1D9IA 1EPTA 2WYGA 3RU4E 2ZHDA 1GI9B 3RXMA 1F5LA 4WH6A 5GPIB 1FXYA 3LKWA 2ANWA 3AAVA 4ZKSU 4FUCA 5C1YA 1SGPE 2FDAA 2QCYA 2M5TA 1GJAB 6ESTA 4UDWH 1BCUH 1FNIA 1MBMA 1S82A 4I31A 1H1BA 3ZZ6A 1MH0A 4YZUA 1GDQA 4ZKNU 3S7KB 1O2KA 1BTWA 1H4WA 5CE1A 3EYDA 1SOZA 1TGSZ 3A8DA 1S81A 3QN7A 1QRXA 3QX5H 3RXGA 4QT8C 3A80A 1EJMA 3BEIB 4Y10E 4BTUB 1TRYA 1O30A 3MH5A 1JRSA 1GG6C 2VINA 3NK8A 1O2RA 1O5EH 2ZDVH 1C5WB 5DK1A 4HGCA 3CENA 1FPCH 3G01A 1TQ0B 2GCTB 3SNAA 2BB4A 1O2LA 3SOSA 4X2WA 1S85A 2XTTB 1OP0A 3TGJE 1CA0B 4AYYB 3KQBA 3STIA 3SV2H 1C2JA 1GI2A 1ZOMA 1AMHA 1DDJA 1YLDA 2WPLS 3VGCB 1MU8B 2BY6X 2FYRA 5LPRA 1C2HA 1FLEE 3ENSB 3EQ0H 4OGXA 1MKXH 1C2FA 4NA8A 1ARCA 2BLWA 1HJAB 1S6FA 4J2YB 1SHHB 1LQEA 3LGWA 1EQ9A 1H9IE 2A4OA 2XWBI 5FPTA 5FCRA 3MNCA 1QTFA 1V2QT 3SJKA 5L30H 1GBIA 1AZ8A 1GI7B 1ZJDA 1JIMA 5EXLA 3V12A 1ESTA 1DITH 3BIVH 1TMTH 1DWBH 5DP5A 5DP7A 4KGAA 3LDXH 1C5OH 2QF0A 1C9PA 4I8HA 2H5CA 3ZZ3A 3GYMA 3OY6U
chains in the Genus database with same CATH superfamily
1HRTH 3RXCA 3TJOA 1FJSA 1YCPK 1T7CA 2IPHA 5F8ZA 5EXMA 4TY7A 1BRCE 2FWWA 2Z9GA 3M5MA 1SMFE 3M7TA 1Q2WA 3SU5A 3ZZ7A 1EUFA 1Q3XA 1TPSA 2WSSD 3LGUA 3M7UA 2CV3A 1H9HE 3MHWU 4A1VA 3K6ZA 1DS2E 1MUEB 1VITH 1G3CA 2FOBA 3I29A 3LPRA 2JIZD 4WWYA 1LKBA 3GY5A 3RU4D 2YNBA 3HGNA 1W12U 3W94A 1WAYB 3BTGE 2JETC 3SNEA 1TNHA 1KTSB 1P10A 1UTMA 2EQNA 1C1NA 4INLA 3R0FA 4AFZA 1A5IA 2OC8A 1WQSA 1E0FD 1PYTD 2QY0B 2ZECA 2ODPA 1P3EA 2A1DB 1GBCA 2G5NA 4X0WU 3F2FA 2CHAB 4Q4LA 1C5QA 1ZLRA 1ZTLA 1ZZZA 2QE7D 1UTJA 2BLOA 1HJ8A 2OC1A 5FL7D 3N99A 3TJVA 2W5EA 3U28C 1P57B 2VIDA 3UWJH 2PKAA 2KCOA 4CHAC 5BRRE 5CMXH 4ABJA 1GMCF 2BQWB 3SNBA 2BHGA 2GKVE 5E0JA 2JDID 2F9OA 5KGOA 2O8WA 1LVYA 1LVBA 1RXPA 2QXJA 1SQOA 3KIDU 1E34B 1T32A 4TT3D 5FXLA 1C5PA 2TPIZ 2IJD1 1S6HA 2WZQA 1CT2E 3ATMA 1TWXB 3E16B 2KR7A 1CHOF 3BTFE 1N6XA 4CR5A 2FO9A 3CS7A 3SUGA 2KCAA 3NZIA 3S9AA 5GIBA 3SW2B 2PLXA 3RXIA 5T6FA 3NXPA 3TNSA 2FLRH 2J98B 2Y5HA 2SGFE 1QBVH 1F92A 3MU4A 5AFZH 1CQQA 4YOIA 4NIWA 2ANKH 3E3TA 4U01A 1GI5A 3PWCA 1FY3A 1S0RA 1MD8A 4OGYA 1E79D 1GBDA 1W3CA 4YLUA 1TPOA 2J34A 1EASA 3C1KA 2BM2A 1O0DH 3M3SA 3TLOA 4ESTE 1BMAA 1GCTC 3EDXB 3GYLB 3M5LA 4R8TB 5DKMA 1O5DH 4RKJB 1IQHA 3RMNH 1OWDA 2P93A 4MPWA 3SN8A 1QL9A 1ELFA 4ZHLU 3M37A 1ID5H 5EGMA 1HLTH 4FU7A 1AWFH 2D1JA 3RM0H 4LK4A 1HYLA 1GBKA 1HV7A 1C1VH 1GHBG 1NFWA 7LPRA 2W3KA 2FOHA 2B8OH 4CBOA 5AHGH 1V2VT 5DJ7A 1EXFA 1SGCA 3UQVA 5FPSA 2XC4A 4JYVH 2AMQA 2V6NA 2EI7A 3ZV9A 2GP9B 1DSTA 1G2MA 1OYTH 2QAAA 1DLKB 2R2MB 3UR6A 3A87A 1LQDB 3N7EA 4U32A 2BZAA 3KNXA 2AGIX 3M5NA 4CBNA 4AGJA 1GL1A 3PV5A 4XBBA 1TONA 2J92A 3KQ5A 1PQAA 1S84A 4OS2A 4TY6A 5DP3A 2HLCA 4XD7D 1DOJA 1G3DA 2Q6FA 1GPZA 3T62A 4K8YA 5L2YH 1NRPH 1BHXB 1C1PA 1LDTT 3PB1E 2QXIA 1BB0B 4NIYA 1L1JA 3A8CA 1GMHG 1TB6H 4MNYA 1G9IE 3BEUA 1D3PB 5HKKD 4X8UH 4FETA 4U30A 2FS8A 1YLCA 1TPPA 2BX4A 4KTUA 1NROH 4FOUC 1C9TA 2PHBA 4NG9H 2BOKA 1WU1A 3R3GB 2KAIA 2ZPRA 1GMDG 3FAOA 1C4V2 4XE4A 7GCHF 4JK5A 1K1JA 1O3HA 1GJ9B 4AB9A 1OWEA 2A32A 3FN8A 8LPRA 1YKTA 2FTLE 5DGJA 3LT3A 3W1EA 3B8JA 3SQEE 4B2CA 3TIUA 4ZMAH 1DY9A 3MFJA 3N7DA 5EQRA 1WXRA 1A46H 3VB3A 3BG4B 4OS5A 5A8XA 3H5CB 1P3CA 1RS0A 2WPMS 2FX6A 1W8BH 1G3EA 2TGAA 2WINI 4NGAH 3TH3H 3SGQE 1N8OB 3SV6A 2OUAA 5FBIA 3MI4A 3RXDA 1O3DA 1YBWA 3MNXA 9ESTA 3GY8A 3FP7E 4WY3A 3GICB 3BTKE 2ZU4A 1LPZB 4M7GA 2OQUA 2V3MA 1C5XB 4NIVA 2Y82A 1ELAA 1OWJA 1O39A 1GL0E 1HJAC 1O3EA 1O2ZA 1TABE 1GVZA 1DLEA 2F9VA 2G4UA 1C2KA 4NA9H 4NWLA 5KEDA 1GBMA 1V2NT 2VWMA 1ZMJA 1SQRA 2AGGX 2YMSB 4WMEA 1O37A 2PTCE 3F9GA 1GJ5H 3E90B 4Y6DA 3EAJA 1MTVA 4BAHB 1YPLH 1CT4E 3ZVGA 4BAOB 1B7XB 3LH1A 2M2AA 3GDSA 2TIOA 1IQMA 1F0TA 1JOUB 4Z0KA 1O5GH 2TGTA 3HKIB 3FOAA 1UCYH 4JCNA 1QA7A 2FOAA 1VJAU 4WVPE 3QZRA 2GV7A 1ZPCA 2BDGA 2WPHS 3L33A 4JK6A 4H4FA 1NS3A 2UWPA 4CH8B 4D7FA 1HNEE 1TNKA 5CHBA 1Z8RA 1BHXF 1BTUA 3S9BA 2H5DA 3IG6B 4Q7YA 2KCPA 1UVSH 1L4DA 3NCLA 3QUMP 1C1WH 1EPTC 2A0QB 1NO9H 1C5UA 1TX7A 1BDAA 6GCHF 4OS4A 4NA7A 4AFQA 2ZHWH 2AYWA 2LELA 1O33A 2XBYA 1C5VA 1G3BA 5J4QA 5JB8S 2ALPA 2WPJS 4CRFA 5JBCS 2OC7A 4I33A 1L0ZA 2ESTE 1O5FH 1VZQH 1O2JA 2CHAC 1MZAA 3GS9A 2WUCA 4YT7H 2ZGHA 3DT0H 3H7OA 2KAIB 3ESTA 4BTTB 3LGYA 1CO7E 3H7TA 1EATA 4BTIB 4DW2U 2A5KA 1FIWA 1SGQE 3K6YA 5DP9A 1FQ3A 4D9QA 1KXCA 2KZ4A 1C5YB 2EI6A 2ZQ2A 3A84A 3EGKH 3N7OA 5E8EH 2A7HA 3OY5U 1IHTH 1KMHB 4X8TH 2KCYA 3QDZB 1J15A 2Y7XA 3PROA 4RT1A 1W7GH 4ISHH 1O2XA 5C20A 2NU1E 2J94A 1GHAG 1SOTA 5ETXA 1YGCH 2CF9H 1DSUA 5F6MA 1TALA 3QGJA 1SGNE 1XUGA 1W14U 1KIGH 2ZPSA 4O3TA 4ZROA 5L6NH 1WOFA 1QB6A 4X1NU 2SNVA 1XX9A 2ZHEH 2J4IA 2ZFPH 4WXVA 3A7ZA 3IWMA 3Q76A 1RTFB 2BD4A 2ULLA 2ZF0H 3ODFA 4AB8A 1H8HD 3F9HA 2BD5A 5G4BA 2ZCKP 2Y80A 2BY8X 3GY2A 1CBWC 2Z9LA 1MBQA 1C2MA 3D65E 1QBOA 4ABDA 4UFEH 4X2VA 1QJ1B 2IJOB 3AVZA 2KM0A 8KME2 4WMDA 2BQ7B 1A7SA 1O32A 1O2GH 2BQ6B 2BD7A 2GTBA 1PPZA 2AIQA 1D6WA 1RGQA 5C0UA 3RXSA 3U1IB 4X6OA 3SORA 1IQFA 4FVBA 4IGDA 4X1SU 2IN2A 2CJIA 1OPHB 2O9QA 3RXAA 1V3XA 3ZIAD 4ZXYH 2SGQE 4P02A 2ZA5A 2BX3A 3Q3YA 5FAHA 2GV6A 2GD4B 8GCHG 4NWKA 3RXOA 2QN5T 5DPAA 2FS9A 3NRLA 3UNQA 2XCFA 2ZKSA 1AU8A 4I32A 4B74A 2BDBA 1NBME 2PR3A 3CS0A 4A1TA 6CHAC 1RIWB 1DX5M 3SGAE 1Z1IA 1VCQA 1QIXB 3KQCA 1GBJA 2P94A 2ALVA 1XKBC 2P3FH 1T4VH 5EW1H 2PKSB 2PSXA 3ELAH 5C5OA 4VGCB 3BG8A 1GDNA 1HAXB 4FUFA 3U1JB 3LGTA 5C3NA 3BEFB 2BZ6H 5EOKA 2VWOA 1RTLA 4DT7B 4X6NA 1IQKA 3P8NA 1NN6A 2BD8A 1GBFA 4DJZB 2STBE 2G81E 5C17A 5EQSA 1BOQA 4YOGA 1UK4A 1YC0A 3KGPA 3RMMH 2PSYA 2A4RA 1J9CH 1HUTH 3GCTF 2GCHG 1HAOH 4D8NA 2OK5A 1NU7B 2Y81A 1YCPH 3ZZ8A 3U69H 1BRBE 3EA9A 3LONA 1NFUA 2VIOA 1O3AA 4INKA 2HALA 1ZHRA 1QZ8A 2ZDLA 1KLIH 2LP6A 1P2KA 2EA3A 3O8RA 1P2JA 4RKOB 3DFLA 3F0OA 3K65B 1TX8A 3E8LA 3TVJB 3F0PA 1AE5A 2OXSA 1ZHMA 4O03A 4DT4A 2BLVA 4Z6AH 4B75A 1SGIB 1OS8A 4A6LA 2RG3A 3RUOA 3RXVA 1SC8U 1GJCB 1L4ZA 4D7GA 1MD7A 3AW1A 2SGPE 1O35A 1PPFE 2FYQA 3M7QA 1LPGB 3P8FA 2TRMA 4UFDH 4IMZA 1F7ZA 1E36B 3T28A 2XBXA 3FP6E 2O8TA 4MPVA 1V2JT 2BXTH 2SFAA 4WXIA 1AB9B 1GGDB 3ZVEA 1FUJA 2R9PA 2OC0A 2SNWA 2VB0A 3UR9A 4ABIA 4K8BA 1T31A 2WHXA 3A7WA 1A3BH 1HBTH 2FLBH 4DG4A 3RXKA 2YMSC 2B0FA 4GPGA 1G36A 1B5GH 2VJ1A 1ACBE 4X6PA 1CSOE 1ZR0A 1HPGA 1ORFA 3ZZBA 3I78A 5GCHF 1TRNA 2A2XH 1EAXA 2AMPA 5E2OA 1AIXH 2ZDNA 1TBRH 1IOEA 2CXVA 1VCWA 5FCKA 1QB1A 3BTHE 3GISB 3M61U 1SFIA 1GHWH 2HGTH 1OOKB 1QJ7B 5JBTA 5HM2A 5CDFE 4IS5A 1A3EH 2ZTXA 3H09A 4GVUA 3M5OA 1GJ4H 4I86A 4Q80A 3SZNA 2THFB 5JPMH 1Q31A 1EZQA 3D62A 2H9HA 2FODA 1KXBA 2VWLA 3MH7A 1XXDA 2H9TH 1L2EA 4K1EA 1NBMD 1GHXH 1HAGE 1YF4A 1P12E 1C2EA 4FUIA 1JIRA 1K1LA 1MQ5A 4I7YH 1O38A 4B76A 2AEIH 1M9UA 3O8BA 1IQNA 5HM9A 1AKSA 1OP8A 2AFQB 3GCHB 3F9FA 5FHTA 2V3HH 1EAIA 3TK5A 4E7NA 1BTXA 4X8SH 1JWTA 1A2CH 1LHCH 4CRBA 4X6MA 1SGTA 1G37A 1BITA 3PTNA 4UFGH 1QCPA 2BOHB 3A88A 1O2TA 3UFAA 2BDCA 4BAMB 4ZH8A 1SQTA 2AS9A 4YT6H 2Q1JA 1FZZA 1J14A 3P70B 1NC6A 2NWNA 1WUNH 1A1RA 1GHBF 1EZSC 1XKAC 1D6RA 1WTHD 1IQJA 1ZGIA 1OSSA 4CRCA 3PV4A 5EW2H 4FUBA 1T8OA 3GY7A 1IQEA 1OKXA 1ZMLA 2FTMA 1FN6A 2BTCE 3P8OA 1PQ5A 1LHDH 5FX5A 2VVCA 1A0LA 2ZU3A 1UTNA 4AZ2B 1VITG 4FU9A 1C1QA 3NWUA 5GDSH 1DWDH 3FP8E 1Z71A 3RM2H 2R3UA 1ANBA 4I8LA 4MDSA 3RC5A 3M35A 1J17T 2D8WA 1GVLA 2FOFA 1C4Y2 2XBWA 2F91A 3PO1B 1QRZA 2C8YB 2QF4A 3MQKC 1GBEA 1UTOA 2OTVA 2QXGA 3HPTB 4GCHG 1Y3YA 1GMHF 3E91A 4XBCA 5FX6A 2GZ7A 4AFSA 2F9NA 3DFJA 4KP0A 1SLVB 3SU1A 2A7JA 3OU0A 1VJ9U 2HVXA 2D26C 2SGEE 3KF2A 1FAXA 1IHSH 2W26A 2GJGA 3QZQA 1GMDF 2VVVA 1G30B 2B7DH 3A7VA 1SVPA 3LJOA 1EP5A 2UWLA 2QF3A 3E1XB 3QWCH 1QBNA 1O3BA 4O9VA 2TGDA 2W7UA 1EZXC 2V0BA 4ZHAA 1AFQB 4K60A 1C2DA 3T25A 3M3VA 3RXQA 4X1PU 1C5LH 3VG8A 1TMBH 5EJ1A 1H8IH 1O3GA 4B71A 1RJXB 1G32B 2C8XB 4F55A 3OTPA 1LHGH 4ISLA 3SI3H 1Z8JB 1HAHH 4B1TA 3MU5A 4KTCA 3GDVA 1XM1A 3RLWH 5EODA 1BMMH 1DFPA 4BAKB 3MU0A 1P9UA 3ATKA 1O2NA 1V2MT 4RSPA 1QRWA 2B9LA 1EJNA 1YPMH 3U98H 5CHAB 1TFXA 4O3UA 3HK3B 1E1QD 4VGCC 3UIRA 1AKSB 4MNVA 2BY5X 4ISOA 4Q7XA 1UTLM 2OBOA 1AD8H 1T8LA 5I46H 1OXGA 4UFFH 3T5FH 1DWEH 4DY7B 1C2IA 9LPRA 1DXPA 2ZFSA 2H9EH 2J5UA 2WPKS 4NZLA 3T27A 3BIUH 5E0HA 1YPHC 4UE7H 2ANYA 2K1QA 2BDAA 1O31A 4X1RU 3P17H 3ITIA 2Y5GA 2JH6D 1K21H 2G51A 1EZUC 4DVAU 1O2IA 5BPEA 5LPEA 2WPDD 2CGAA 3DHKH 5LH8A 1HAVA 3ZVFA 4XRNA 3ZZCA 1SQAA 1CGHA 1BTPA 4BOHA 4CRDA 1F5RA 1W13U 1P0SH 1YLNA 2I6QA 3URCA 1DXWA 1ZMNA 1RFNA 1ZRBA 1HAPH 1AGJA 4XSKU 4ABBA 2BVXH 1D4PB 1ELBA 2OLGA 2ASUB 5T6DA 4OS1A 1THPB 1AHTH 3SV9A 2F3CE 2WV5A 2OCVB 3BTQE 3OEHD 1TNJA 1O3CA 1SGFG 5GXPA 2FI3E 3SJOA 1TE0A 4F49A 1TBQH 4BXWA 4LZ4B 4R0IA 1MTUA 3PYHA 1ZPBA 1W2KH 2GCTC 1SGYE 1Z7KA 4X8VH 3T26A 1JXPA 1SFQB 1CA0C 5ESTE 3B23B 2A4QA 3TGIE 2QIQA 1ABIH 2ZEBA 1TLDA 2FOCA 1Z8GA 2HPQH 1BZXE 1AB9C 1BUIA 1GGDC 2ZHFH 3GY6A 4JZEH 3VGCC 2STAE 1Y3VA 3DUXH 2LNCA 3F9EA 1K28D 1P03A 4MVNA 1FI8A 4WH8A 2BD9A 1TRMA 1KTTB 1NT1A 5HIYA 2SGAA 1C1TA 1OWIA 4CH2B 3UWIA 4OS7A 1FX0B 3SV8A 1O3OA 1KDQB 1IQGA 2L6OA 1BTZA 1GG6B 4NSVA 1O3JA 3UREA 3WY8A 5EU8A 3A8BA 1SGEE 3F68H 1DUEA 2K8IA 3UNSA 2GMTB 1C1SA 2WUBA 1X7AC 3KL6A 3CNRA 5DP6A 1ZGVA 2O8LA 3BTWE 1YYY1 3U8OH 2LPRA 1KXAA 1GHAF 3P8GA 3S9CA 1KLTA 1W10U 3BN9A 1GI0A 2RDLA 4ISNA 1BTYA 2C8WB 1UMAH 2QGRA 5DP4A 3UY9A 2Q6DA 5HIZA 1C5NH 1C1UH 1BMLA 4B2BA 4AOQA 3IITA 1G2LA 4ZKRU 1TPAE 3OEED 1BIOA 1LTOA 2XC5A 1NRNH 2PGQB 5EJLA 3UQOA 1HXEH 4LZ1H 1P8VC 2QA9E 1EX3A 2XBVA 2BMGB 3VB6A 1KYNA 2HNTF 1ANCA 1GVKB 2O8UA 3V7TA 4I8JA 3LOXA 1D3QB 4WMFA 1Z8IB 3SHAH 4MG3A 1MTNB 1HGTH 4SGBE 1O5CB 1GDUA 3OFND 1C1RA 1LVOA 1QB9A 1JMOH 2JJ2D 2Z9KA 1MTSA 5ESBA 1TOMH 5DN6D 2RCEA 3MU8A 1V2LT 5EQQA 1BJVA 4FUGA 3STJA 1C1MA 4YM9A 1P01A 1XVOA 3ATLA 2GGVB 4Y8ZA 1CT0E 3SUFA 3AW0A 1YP9A 3V3MA 1C1OA 1V2UT 8GCHF 1HAVB 3HKJB 3PRDA 3ODDA 1UTKA 4TPYA 5F03A 2FEQH 1ANEA 3FKSD 5EG4A 2XWAA 4Q63A 4JYTA 4K2YA 2VH6A 4JZFH 1A4WH 3OAAD 1O2UA 4H42U 4ABGA 2V35A 2J9NA 1BMFD 3HGPA 3PWBA 2FOMB 3VB7A 4K69A 3EA8A 1QL8A 1QY6A 3P92A 1QR3E 3SU0A 1A0JA 2ZDMA 3OTJE 2BDHA 3GOVB 3EA7A 1MQ6A 2JJ1D 2G8TA 3MYWA 5LGOA 1D3DB 1BQYA 1OWKA 3FZDA 1NESE 2QC2A 4RT0A 2HOBA 3ZZAA 2QYIA 2FESH 1O3LA 1F2SE 2KX4A 2ZFTA 1MTWA 4A1XA 4CHAB 1LKAA 1ZSLA 3VPKA 2IOTA 3RC6A 1EKBB 2GCHF 4B6FA 1RRKA 2DE8A 1F5KU 2GT8A 1MCTA 3VXEH 2VIPA 5K0HA 4AGKA 7KMEH 4HTCH 1TAWA 1TMUH 2DUCA 2Z3CA 2FXRA 1CGIE 2GZ9A 1Y3WA 1AFQC 1MKWH 2ZP0H 3SNDA 1KSNA 5JBAS 4TPIZ 2ZGCA 1PQ7A 1O3IA 3FFGA 5H4IB 5PTPA 2DE9A 3LIWA 2XNIA 3KQDA 3TK9A 3NKKA 4TWYA 1L1GA 1P2MA 1XUKA 5A0AE 4TSFD 3MNBA 1XUJA 4MTBA 2UUJB 1AFEH 5GJ4B 1V2ST 5F8TA 3E0PB 1RD3B 1ELVA 3M36A 5ABWA 1BRUP 3ATIA 3A86A 4JZDH 1SGFA 2Y7ZA 5CHAC 4X2XA 1GI8B 2OD3B 1FPHH 1C5ZB 4WF8A 3ZVDA 1O5BB 1NU9A 1QL7A 3GCNA 2XC0A 2ZTYA 4NZQA 1QQUA 3RMOH 2ZO3H 5F53A 4ZXXH 2W6JD 3BTDE 3OX7U 2PTNA 2ZZUH 1HXFH 2CF8H 1V2OT 1AWHB 1SSXA 1WYKA 2HNTC 2HNTE 3A85A 4NSYA 5A0CA 3LC5A 1SLXB 2BYAX 1WBGB 2ZU1A 3A7TA 4FUDA 3BTEE 1WV7H 1OX1A 1HAIH 1ARBA 1YM0A 3NUMA 2ODQA 2ZFRH 3RDZA 3JZ2B 1VR1H 1NY22 4ZHMU 4MPUA 2F83A 3BTTE 1DY8A 2UUKB 3MMGA 1ESBA 4Y71A 4X2YA 4NFFA 3GY3A 1ELCA 1E38B 1HAYB 1DPOA 4ASUD 2OP9A 4TYDA 2XW9A 2FX4A 4IN2A 1FY1A 1UTPA 3RXLA 2C8ZB 1MZDA 3PRBA 3U9AH 3C27B 2F9BH 1JRTA 3SNCA 1O2QA 1MKWK 4J1YA 2GDDA 2AH4X 4K3JA 3SU6A 4AN7A 2QV1A 1SPJA 1MU6B 1V2TT 3PMHB 5B6OA 5AVDA 4DIIH 1EFRD 1PYTC 4ACAA 2ZCHP 3BG4C 4XDEA 1ETSH 4FVDA 2BY7X 1GJDB 1GJ6A 1EAWA 4NCYA 3ZYDA 3ZV8A 4YXWD 3Q3XA 1THSH 3UOUA 4GLYA 3JZ1B 3F6UH 1N8OC 2Z94A 2L74A 2ZG0H 3VB5A 3PMAB 2VGCB 1DANH 2XXLA 4JZIA 1O36A 5C1XA 2ZC9H 6LPRA 1P11E 1VGCB 3TH2H 1FV9A 1ZYOA 4FUEA 1GI3A 1A5HA 1Y8TA 2SGDE 4F4OC 3S0NA 2OBQA 4YOJA 2ZIQH 3SUDA 2RFKC 1Y3UA 1ELDE 1HJ9A 3RLYH 1T4UH 1P05A 4UD9H 2ODYB 4PROA 2GMTC 3ATWA 3MO9A 1GJ7B 3PLPA 1SGRE 1MMJN 1VITF 1EAUA 3FVFB 1IQIA 4KELA 1BBRE 1S0QA 5GWZA 5I25A 3VEQB 4K1SA 3BF6H 3UNRA 1S6LA 1XXFA 1ZTKA 1UVPA 1J16A 1BBRK 3OYPA 2A45B 2A2QH 2FIRH 5EJZA 3A7YA 1TQ7B 3KYFA 3RP2A 1GHYH 4ABHA 3PLBA 1SL3A 2XRCA 4GHQA 1COWD 2HWLB 3B9FH 4GCHF 2BD3A 3QO6A 1O3MA 4O97A 5DO4H 4E7RG 1TNIA 1E35B 5E2PA 1GBTA 1O3FA 3BTME 1NFYA 1J8AA 1EJAA 5SGAE 3SU3A 1IQLA 1GCDA 2JH5D 5DG6A 2EI8A 4UONA 1K1IA 4Y7AA 2BY9X 4JYUH 2ZPQA 1TOCB 1MTNC 1QJ6B 4FUJA 8ESTE 1W0KD 4YLQH 2ZGBH 3RXPA 5K7RA 4A7IB 2J38A 2FI5E 1INCA 3NPSA 1ANDA 3GDUA 1HCGA 4DCDA 1W7XH 3GCTG 2G52A 1EP6A 1LO6A 5AF9H 3VFEA 4Y11E 2GDEH 4GUXA 3QLPH 1FDPA 3E6PH 4XBDA 1QGFA 2FM2A 4HG6A 1GBBA 2BDIA 1V2WT 1HIAA 1EOJA 1FY4A 4AG1A 3SJ9A 4NIXA 1O2VA 3O8CA 2R0LA 4ISIH 2WPIS 2BVRH 2AGEX 1O2WA 1EPTB 1TGNA 2ANMH 2VIQA 5IYTA 4Y0YE 1T8MA 5HGGA 1CGJE 5JDUB 3L6PA 1GI4A 1OYQA 3SI4H 3V0XA 7ESTE 3QTVH 4A5TS 4Y8XA 1PPGE 1V2PT 2P3TB 1LHFH 1P06A 3EE7A 2WYJA 4H6TA 3RC4A 1TIOA 1MKXK 1UVUH 2YOLA 2TBSA 3WW7A 3MTYA 3P6ZB 4Y79A 4A92A 4P00A 1SG8B 3ZVAA 3SHCH 1BRAA 1XUIA 1DT2A 1K0HA 1OWHA 1QNJA 4IMQA 3T2NA 1KLJH 1XUFA 3DCLA 3U8TH 5JBBS 1XUHA 2VWNA 2F9PA 3WWFA 1MABB 2NU3E 1H9LB 2AMDA 5GCHG 1B0FA 4IN1A 1V2RT 1UK3A 2R3YA 1WDIA 2J95A 3LGVA 1EOLA 1JBUH 2P8OB 3MH4A 1KDQA 2VIWA 3SZEA 2YMSD 3SJIA 1ELGA 4OS6A 1YPKH 2TGPZ 3GCOA 2UWOA 2K0QA 1O2SA 5C67A 1NPMA 5EXNA 2A5IA 3S7HB 1YPEH 4Z1MD 3SO3A 1AI8H 1ETTH 4X1QU 3RXFA 4I8KA 1NFXA 1THRH 4B73A 1C5MD 1CBWB 2XOKD 4JZ1A 4K1TA 2GVFA 1FAKH 4Y8YA 4OM9A 2HLDD 3OE7D 1F0RA 1NM6A 2H1UA 2UUYA 2B5TB 2WV4A 4ZKOU 2R0KA 1SKYE 3LJJA 1IAUA 2EEKA 1TNLA 3RXHA 3T29A 3K2UA 2FI4E 1Y5AT 1ABJH 2ZI2H 1K9OE 1RIWC 4E05H 2R2WU 1TYNA 2VIVA 1AZZA 1SB1H 4NFEA 2HVYB 3MO3A 4CR9A 4YO9A 3RXRA 4M9FA 2PKSC 1GI6A 2AERH 1C5SA 5TCAA 3A89A 4MNXA 1FN8A 3DSPA 1N1LA 1NRQH 1TGTA 3FZZA 1BA8B 3A83A 2ZDKA 3ZYEA 5FPYA 1OP2A 3Q77A 2ZU5A 3MU1A 3ZZ5A 1B0EA 2ZDAH 1HIAB 1SGDE 2CK3D 1YPHE 2EY4C 2W7SA 1W0ZU 3TGKE 1FONA 4ZUHA 4D76A 3RXJA 4HZHA 4MNWA 5AFYH 1CE5A 1GMCG 6CHAB 4U2WA 3HK6B 3URDA 3A8AA 1O3KA 1CA8B 3A7XA 1MCVA 1QURH 1DWCH 1SBWA 3AASA 1NRRH 1C4U2 1AVGH 1PPCE 1SLUB 4ZCNA 1ZJKA 2Z7FE 1P2IA 4AYVB 4THNH 1MAXA 3K9XB 3AAUA 1GHVH 1SLWB 4F48B 1ZRKA 1P2OA 3GY4A 1CHOG 5A09A 1LCYA 2BVSH 2F43B 4CREA 2VVUA 4XFQA 1S5SA 2D2DA 5T6GA 4FUHA 2A7CA 1AE8H 1O2YA 2QXHA 2G5VA 4ABAA 5TCCA 4ACBA 5T1VA 1UVTH 2VGCC 1UHBA 2PUQH 1PQ8A 1S83A 2GT7A 3QK1A 5DSFA 1W0YH 2PKAB 2KFWA 2AIPA 5HMAA 3KHVA 1VGCC 3PV2A 1O2PA 1SR5C 2ZTZA 5FBEA 1K22H 1C2LA 1P09A 4I8GA 1YY3A 5T3HA 3SBKA 4KTSA 2ZQ1A 5HXFA 1GJ8B 2NU4E 3KN2A 2OINA 1NZQH 2PWXA 1QA0A 2ZNKH 3AK5A 1PFXC 3TJUA 1K1OA 1Z6EA 3ZVBA 5IK2D 2P95A 1C2GA 5E0GA 3VB4A 5C2ZA 1AUJA 1PJPA 3SJ8A 3MNSA 2VU8E 2ZHQH 1TA6A 3UPEA 1KY9A 2ZGJA 4IBLH 4Q7ZA 3TPIZ 5JYIA 4TWWA 3F2HA 4BXSA 2CMYA 2C3SA 1UJ1A 1AO5A 4AG2A 1KXFA 2A5AA 3O8DA 4IC5A 2HPPH 3DSOA 3BV9B 3RXBA 2A31A 3MH6A 1SI5H 1XVMA 1UW7A 2FP7B 5DP8A 2Z9JA 3KYGA 2H2ZA 2WV9A 1TNGA 3TNTA 3A81A 4IW4E 3ZZ4A 2GX4A 3TH4H 1WTGH 3MO6A 3E0NB 4MQAA 3ZZ9A 1BJUA 5GNDA 2Y5FA 3HATH 4DIHH 4AC9A 3WWBA 3RXEA 1Y3XA 2JKHA 2ZFQH 5J4SA 2JH0D 1C5TA 1YWUA 4LXBH 1V2KT 3SV7A 1L1NA 3EE0B 3Q00A 1ZHPA 3CP7A 1UO6A 5C0TA 1ETRH 2EC9H 3RU4T 1PPBH 2P3UB 2G4TA 2HRVA 4E06H 1AUTC 2FOGA 2H6MA 2C4FH 3GCHC 1YPJH 2Q6GA 2ZGXH 1GJBB 4WJG2 1Z1JA 3UUZA 5HYOA 4FXGH 1CU1A 1CHGA 4UEHH 2P16A 3PMBB 4DGJA 2BLQA 1P04A 1UK2A 2ZU2A 2RA3A 5TJXA 2BXUH 1HDTH 4AX9H 2G55A 7GCHG 4AORA 3QGNB 2RA0A 1FMGA 1W0JD 1PPEE 2Z3DA 2V3OH 4MLFB 1Y5UT 4YESB 4CRGA 3D49H 3KCGH 1UTQA 4AFUA 1LHEH 1Y59T 3U8RH 2PV9B 1K2I1 1GBAA 1YPGH 2RDEA 4GHTA 5C1UA 1BTHH 4B2AA 1GWAA 1QHRB 1Y5BT 1O2MA 2C90B 3S69A 4ZAEA 4ABEA 4CRAA 2YNAA 3SU2A 1K1PA 1K1MA 4B6EA 1CVWH 3UTUH 4GAWA 3ZZDA 2OQ5A 4ASHA 1FIZA 2IPQX 3D23A 4Y7BA 2JETB 1ZPZA 3SGBE 2VBCA 3F1SB 1UHBB 4Y76A 1AQ7A 3PO1C 4H6SB 1GBLA 3MOCA 3SU4A 1WCZA 1WSSH 2Z3EA 1TBZH 1O3NA 2NU0E 1O2HA 1ESAA 4FU8A 1DICA 5C5NA 1T8NA 2Z6BD 1V6DA 1HFDA 1EB1H 2Y6TA 2ZCLP 5L2ZH 1AVXA 1O5AB 1HB0B 2PFEA 3KEEA 1H8ED 1O3PB 4INHA 3L3TA 3PLKA 1A5GH 1ELTA 3ZVCA 2W6ID 1O34A 3TJNA 1P2NA 1N6YA 1DE7H 1KXEA 3RMLH 2UUFB 4LOYH 2PP6A 3A82A 1AN1E 1Z6JH 1K1NA 2NU2E 3TU7H 2P8OC 1UCYE 1ZSJA 2ZFFH 2FPZA 2FMJA 3DA9B 4RN6A 1KXDA 1XMNB 1QQ4A 1LPKB 2BD2A 2F9UA 4MPXA 5EIYA 4Q2KA 1A0HB 1A61H 4DURA 3TITA 1UCYK 2XNDD 1FY8E 1FY5A 3QTOH 3PTBA 4Y0ZE 5EPNA 2W3IA 2FOEA 1GHZA 3SQHE 1PPHE 2F4LA 4YTAA 5IDKA 3I77A 1TGBA 1F0UA 5JB9S 1D3TB 1W11U 3KQEA 1HAZB 3P95A 2PGBB 3OSYA 1NTPA 1MAYA 1AY6H 1P02A 5A0BA 4ABFA 1P2QA 5EPYA 4HFPB 4K5ZA 2CN0H 2FZZA 1WQVH 4JMYA 2XCNA 3LGIA 6GCHG 1LMWB 1DM4B 1P9SA 3RXTA 1LVMA 3FANA 4HI3A 3LU9B 5F8XA 1TX6A 1GCTB 2BDYA 3F3BA 3VXFH 5A8ZA 1H8DH 2VH0A 3LC3A 3PM3A 3V13A 1TGCA 2C93B 3PMJA 4IC6A 3SUEA 2J2UA 2AHME 4KKDA 2QF5A 3UOPA 4BNRA 2PUXB 1U6QA 3M3TA 1ZSKA 2GZ8A 3TK6A 2I6SA 1BMNH 1YCPM 1E37B 2ZWLH 1ELEE 4BANB 2ILNA 5C94A 2A4GA 4GSOA 3SYJA 2O8MA 1AVWA 4DOQA 2P59A 5A2MH 1RTKA 3DD2H 1GBHA 4SGAE 1ZTJA 3W95A 1EB2A 1VCPA 2PW8H 1GI1A 1BBRH 1DVAH 1NRSH 2Z9IA 5LPFA 1C5RA 2VNTA 1O2OA 1DUAA 3Q3KA 3MWIU 2G00A 5A8YA 4XOJA 1QFKH 4BAQB 2XYAA 1F0SA 1TA2A 3BSQA 4D9RA 3LH3A 1UVOA 1SHYA 3RXUA 1BT7A 1D9IA 1EPTA 2WYGA 3RU4E 2ZHDA 1GI9B 3RXMA 1F5LA 4WH6A 5GPIB 1FXYA 3LKWA 2ANWA 3AAVA 4ZKSU 4FUCA 5C1YA 1OHHD 1SGPE 2FDAA 2QCYA 2M5TA 1GJAB 6ESTA 4UDWH 1BCUH 1FNIA 1MBMA 1S82A 4I31A 4RI0A 1H1BA 3ZZ6A 1MH0A 4YZUA 1GDQA 4ZKNU 3S7KB 1O2KA 1BTWA 3UAIC 1H4WA 5CE1A 3EYDA 1SOZA 1TGSZ 3A8DA 1S81A 3QN7A 1QRXA 3QX5H 3RXGA 2J97A 4QT8C 3A80A 1EJMA 3BEIB 4Y10E 4BTUB 1TRYA 1O30A 3MH5A 1JRSA 1GG6C 2VINA 3NK8A 1O2RA 1O5EH 2ZDVH 1C5WB 5DK1A 3DSGA 3CENA 4HGCA 1FPCH 3G01A 1TQ0B 2GCTB 3FO8D 2BB4A 3SNAA 1O2LA 3SOSA 4X2WA 1S85A 2XTTB 1OP0A 3TGJE 1CA0B 4AYYB 3KQBA 3STIA 3SV2H 1C2JA 1GI2A 1ZOMA 1AMHA 1DDJA 1YLDA 2WPLS 3VGCB 1MU8B 2BY6X 2FYRA 5LPRA 1C2HA 1FLEE 3ENSB 3EQ0H 4OGXA 1MKXH 1C2FA 4NA8A 2J98A 1ARCA 2BLWA 1HJAB 1S6FA 4J2YB 1SHHB 1LQEA 3LGWA 1EQ9A 1H9IE 2A4OA 2V7QD 2XWBI 5FPTA 5FCRA 3MNCA 1QTFA 1V2QT 3SJKA 3UB0A 5L30H 1GBIA 1VKYA 1AZ8A 1GI7B 1ZJDA 1JIMA 5B6LA 5EXLA 3V12A 1ESTA 1DITH 3BIVH 1TMTH 1DWBH 5KECA 5DP5A 5DP7A 4KGAA 3F2GA 1E1RD 3LDXH 1C5OH 2QF0A 1C9PA 4I8HA 2H5CA 3ZZ3A 3GYMA 3OY6U
chains in the Genus database with same CATH topology
1HRTH 3RXCA 3TJOA 1FJSA 1YCPK 1T7CA 2IPHA 5F8ZA 5EXMA 4TY7A 1BRCE 2FWWA 2Z9GA 3M5MA 1SMFE 3M7TA 1Q2WA 3SU5A 3ZZ7A 1EUFA 1Q3XA 1TPSA 3LGUA 3M7UA 2CV3A 1H9HE 3MHWU 4A1VA 3K6ZA 1DS2E 1MUEB 1VITH 1G3CA 2FOBA 3I29A 3LPRA 4WWYA 1LKBA 3GY5A 3RU4D 2YNBA 3HGNA 1W12U 3W94A 1WAYB 3BTGE 2JETC 3SNEA 1TNHA 1KTSB 1P10A 1UTMA 4INLA 1C1NA 3R0FA 4AFZA 1A5IA 2OC8A 1WQSA 1E0FD 1PYTD 2QY0B 2ZECA 2ODPA 1P3EA 2A1DB 1GBCA 2G5NA 4X0WU 2CHAB 1C5QA 1ZLRA 1ZTLA 1ZZZA 1UTJA 2BLOA 1HJ8A 2OC1A 3TJVA 2W5EA 1P57B 2VIDA 3UWJH 2PKAA 4CHAC 5BRRE 5CMXH 4ABJA 1GMCF 2BQWB 3SNBA 2BHGA 2GKVE 5E0JA 2F9OA 2O8WA 1LVYA 1LVBA 1RXPA 2QXJA 1SQOA 3KIDU 1E34B 1T32A 5FXLA 1C5PA 2TPIZ 1S6HA 1CT2E 3ATMA 1TWXB 3E16B 1CHOF 3BTFE 1N6XA 4CR5A 2FO9A 3CS7A 3SUGA 3NZIA 3S9AA 5GIBA 3SW2B 2PLXA 3RXIA 5T6FA 3NXPA 3TNSA 2FLRH 2Y5HA 2SGFE 1QBVH 1F92A 3MU4A 5AFZH 1CQQA 4YOIA 4NIWA 2ANKH 3E3TA 4U01A 1GI5A 3PWCA 1FY3A 1S0RA 1MD8A 4OGYA 1GBDA 1W3CA 4YLUA 1TPOA 2J34A 1EASA 3C1KA 2BM2A 1O0DH 3M3SA 3TLOA 4ESTE 1BMAA 1GCTC 3EDXB 3GYLB 3M5LA 4R8TB 5DKMA 1O5DH 4RKJB 1IQHA 3RMNH 1OWDA 2P93A 4MPWA 3SN8A 1QL9A 1ELFA 4ZHLU 3M37A 1ID5H 5EGMA 1HLTH 4FU7A 1AWFH 2D1JA 3RM0H 4LK4A 1HYLA 1GBKA 1HV7A 1C1VH 1GHBG 1NFWA 7LPRA 2W3KA 2FOHA 2B8OH 4CBOA 5AHGH 1V2VT 5DJ7A 1EXFA 1SGCA 3UQVA 5FPSA 2XC4A 4JYVH 2AMQA 2V6NA 2EI7A 3ZV9A 2GP9B 1DSTA 1G2MA 1OYTH 2QAAA 1DLKB 2R2MB 3UR6A 3A87A 1LQDB 4U32A 2BZAA 3KNXA 2AGIX 3M5NA 4CBNA 4AGJA 1GL1A 4XBBA 1TONA 2J92A 1PQAA 1S84A 4OS2A 4TY6A 5DP3A 2HLCA 1DOJA 1G3DA 2Q6FA 1GPZA 3T62A 4K8YA 5L2YH 1NRPH 1BHXB 1C1PA 1LDTT 3PB1E 2QXIA 1BB0B 4NIYA 1L1JA 3A8CA 1GMHG 1TB6H 4MNYA 1G9IE 3BEUA 1D3PB 4X8UH 4U30A 2FS8A 1YLCA 1TPPA 2BX4A 4KTUA 1NROH 1C9TA 2PHBA 4NG9H 2BOKA 1WU1A 3R3GB 2KAIA 2ZPRA 1GMDG 3FAOA 1C4V2 4XE4A 7GCHF 4JK5A 1K1JA 1O3HA 1GJ9B 4AB9A 1OWEA 2A32A 8LPRA 1YKTA 2FTLE 5DGJA 3LT3A 3B8JA 3SQEE 4B2CA 3TIUA 4ZMAH 1DY9A 3MFJA 5EQRA 1A46H 3VB3A 3BG4B 4OS5A 5A8XA 3H5CB 1P3CA 1RS0A 2WPMS 2FX6A 1W8BH 1G3EA 2TGAA 2WINI 4NGAH 3TH3H 3SGQE 1N8OB 3SV6A 2OUAA 5FBIA 3MI4A 3RXDA 1O3DA 1YBWA 3MNXA 9ESTA 3GY8A 3FP7E 4WY3A 3GICB 3BTKE 2ZU4A 1LPZB 4M7GA 2OQUA 1C5XB 4NIVA 2Y82A 1ELAA 1OWJA 1O39A 1GL0E 1HJAC 1O3EA 1O2ZA 1TABE 1GVZA 1DLEA 2F9VA 2G4UA 1C2KA 4NA9H 4NWLA 1GBMA 1V2NT 2VWMA 1ZMJA 2AGGX 4WMEA 1O37A 2PTCE 3F9GA 1GJ5H 3E90B 4Y6DA 3EAJA 1MTVA 4BAHB 1YPLH 1CT4E 3ZVGA 4BAOB 1B7XB 3LH1A 3GDSA 2TIOA 1IQMA 1F0TA 1JOUB 4Z0KA 1O5GH 2TGTA 3HKIB 1UCYH 4JCNA 1QA7A 2FOAA 1VJAU 4WVPE 3QZRA 2GV7A 1ZPCA 2BDGA 2WPHS 3L33A 4JK6A 4H4FA 1NS3A 2UWPA 4CH8B 4D7FA 1HNEE 1TNKA 1Z8RA 1BHXF 1BTUA 3S9BA 2H5DA 3IG6B 4Q7YA 1UVSH 1L4DA 3NCLA 3QUMP 1C1WH 1EPTC 2A0QB 1NO9H 1C5UA 1TX7A 1BDAA 6GCHF 4OS4A 4NA7A 4AFQA 2ZHWH 2AYWA 1O33A 2XBYA 1C5VA 1G3BA 5J4QA 5JB8S 2ALPA 2WPJS 4CRFA 5JBCS 2OC7A 4I33A 1L0ZA 2ESTE 1O5FH 1VZQH 1O2JA 2CHAC 1MZAA 2WUCA 4YT7H 2ZGHA 3DT0H 3H7OA 2KAIB 3ESTA 4BTTB 3LGYA 1CO7E 3H7TA 1EATA 4BTIB 4DW2U 2A5KA 1FIWA 1SGQE 3K6YA 5DP9A 1FQ3A 4D9QA 1KXCA 2ZQ2A 1C5YB 2EI6A 3A84A 3EGKH 3N7OA 5E8EH 2A7HA 3OY5U 1IHTH 4X8TH 3QDZB 1J15A 2Y7XA 3PROA 1W7GH 4ISHH 1O2XA 5C20A 2NU1E 2J94A 1GHAG 1SOTA 5ETXA 1YGCH 2CF9H 1DSUA 5F6MA 1TALA 3QGJA 1SGNE 1XUGA 1W14U 1KIGH 2ZPSA 4O3TA 4ZROA 5L6NH 1WOFA 1QB6A 4X1NU 2SNVA 1XX9A 2ZHEH 2J4IA 2ZFPH 4WXVA 3A7ZA 3IWMA 3Q76A 1RTFB 2BD4A 2ULLA 2ZF0H 3ODFA 4AB8A 3F9HA 2BD5A 5G4BA 2ZCKP 2Y80A 2BY8X 3GY2A 1CBWC 2Z9LA 1MBQA 1C2MA 3D65E 1QBOA 4ABDA 4UFEH 4X2VA 1QJ1B 2IJOB 3AVZA 8KME2 4WMDA 2BQ7B 1A7SA 1O32A 1O2GH 2BQ6B 2BD7A 2GTBA 1PPZA 2AIQA 1D6WA 1RGQA 3RXSA 3U1IB 4X6OA 3SORA 1IQFA 4FVBA 4IGDA 4X1SU 2IN2A 2CJIA 1OPHB 2O9QA 3RXAA 1V3XA 4ZXYH 2SGQE 2ZA5A 2BX3A 3Q3YA 5FAHA 2GV6A 2GD4B 8GCHG 4NWKA 3RXOA 2QN5T 5DPAA 2FS9A 3UNQA 2XCFA 2ZKSA 1AU8A 4I32A 4B74A 2BDBA 2PR3A 3CS0A 4A1TA 6CHAC 1RIWB 1DX5M 3SGAE 1Z1IA 1VCQA 1QIXB 3KQCA 1GBJA 2P94A 2ALVA 1XKBC 2P3FH 1T4VH 5EW1H 2PKSB 2PSXA 3ELAH 5C5OA 4VGCB 3BG8A 1GDNA 1HAXB 4FUFA 3U1JB 3LGTA 5C3NA 3BEFB 2BZ6H 5EOKA 2VWOA 1RTLA 4DT7B 4X6NA 1IQKA 3P8NA 1NN6A 2BD8A 1GBFA 4DJZB 2STBE 2G81E 5EQSA 1BOQA 4YOGA 1UK4A 1YC0A 3KGPA 3RMMH 2PSYA 2A4RA 1J9CH 1HUTH 3GCTF 2GCHG 1HAOH 4D8NA 1NU7B 2Y81A 1YCPH 3ZZ8A 3U69H 1BRBE 3EA9A 3LONA 1NFUA 2VIOA 1O3AA 4INKA 2HALA 1ZHRA 2ZDLA 1KLIH 1P2KA 2EA3A 3O8RA 1P2JA 4RKOB 3DFLA 3K65B 1TX8A 3E8LA 3TVJB 1AE5A 2OXSA 1ZHMA 4O03A 2BLVA 4Z6AH 4B75A 1SGIB 1OS8A 4A6LA 2RG3A 3RUOA 3RXVA 1SC8U 1GJCB 1L4ZA 4D7GA 1MD7A 3AW1A 2SGPE 1O35A 1PPFE 2FYQA 3M7QA 1LPGB 3P8FA 2TRMA 4UFDH 4IMZA 1F7ZA 1E36B 3T28A 2XBXA 3FP6E 2O8TA 4MPVA 1V2JT 2BXTH 2SFAA 4WXIA 1AB9B 1GGDB 3ZVEA 1FUJA 2R9PA 2OC0A 2SNWA 2VB0A 3UR9A 4ABIA 4K8BA 1T31A 3A7WA 1A3BH 1HBTH 2FLBH 4DG4A 3RXKA 2B0FA 4GPGA 1G36A 1B5GH 2VJ1A 1ACBE 4X6PA 1CSOE 1ZR0A 1HPGA 1ORFA 3ZZBA 3I78A 5GCHF 1TRNA 2A2XH 1EAXA 2AMPA 5E2OA 1AIXH 2ZDNA 1TBRH 1IOEA 2CXVA 1VCWA 5FCKA 1QB1A 3BTHE 3GISB 3M61U 1SFIA 1GHWH 2HGTH 1OOKB 1QJ7B 5JBTA 5HM2A 4IS5A 1A3EH 2ZTXA 4GVUA 3M5OA 1GJ4H 4Q80A 3SZNA 2THFB 5JPMH 1Q31A 1EZQA 3D62A 2H9HA 2FODA 1KXBA 2VWLA 3MH7A 1XXDA 2H9TH 1L2EA 4K1EA 1GHXH 1HAGE 1YF4A 1P12E 1C2EA 4FUIA 1JIRA 1K1LA 1MQ5A 4I7YH 1O38A 4B76A 2AEIH 1M9UA 3O8BA 1IQNA 5HM9A 1AKSA 1OP8A 2AFQB 3GCHB 3F9FA 5FHTA 2V3HH 1EAIA 3TK5A 4E7NA 1BTXA 4X8SH 1JWTA 1A2CH 1LHCH 4CRBA 4X6MA 1SGTA 1G37A 1BITA 3PTNA 4UFGH 1QCPA 2BOHB 3A88A 1O2TA 3UFAA 2BDCA 4BAMB 4ZH8A 1SQTA 2AS9A 4YT6H 2Q1JA 1FZZA 1J14A 3P70B 1NC6A 2NWNA 1WUNH 1A1RA 1GHBF 1EZSC 1XKAC 1D6RA 1WTHD 1IQJA 1ZGIA 1OSSA 4CRCA 3PV4A 5EW2H 4FUBA 1T8OA 3GY7A 1IQEA 1OKXA 1ZMLA 2FTMA 1FN6A 2BTCE 3P8OA 1PQ5A 1LHDH 5FX5A 2VVCA 1A0LA 2ZU3A 1UTNA 4AZ2B 1VITG 4FU9A 1C1QA 3NWUA 5GDSH 1DWDH 3FP8E 1Z71A 3RM2H 2R3UA 1ANBA 4I8LA 4MDSA 3RC5A 3M35A 1J17T 2D8WA 1GVLA 2FOFA 1C4Y2 2XBWA 2F91A 3PO1B 1QRZA 2C8YB 1GBEA 1UTOA 2OTVA 2QXGA 3HPTB 4GCHG 1Y3YA 1GMHF 3E91A 4XBCA 5FX6A 2GZ7A 4AFSA 2F9NA 3DFJA 4KP0A 1SLVB 3SU1A 2A7JA 3OU0A 1VJ9U 2HVXA 2D26C 2SGEE 3KF2A 1FAXA 1IHSH 2W26A 3QZQA 1GMDF 2VVVA 1G30B 2B7DH 3A7VA 1SVPA 3LJOA 1EP5A 2UWLA 2QF3A 3E1XB 3QWCH 1QBNA 1O3BA 4O9VA 2TGDA 2W7UA 1EZXC 2V0BA 4ZHAA 1AFQB 4K60A 1C2DA 3T25A 3M3VA 3RXQA 4X1PU 1C5LH 1TMBH 1H8IH 1O3GA 4B71A 1RJXB 1G32B 2C8XB 1LHGH 4ISLA 3SI3H 1Z8JB 1HAHH 4B1TA 3MU5A 4KTCA 3GDVA 1XM1A 3RLWH 5EODA 1BMMH 1DFPA 4BAKB 3MU0A 1P9UA 3ATKA 1O2NA 1V2MT 4RSPA 1QRWA 2B9LA 1EJNA 1YPMH 3U98H 5CHAB 1TFXA 4O3UA 3HK3B 4VGCC 3UIRA 1AKSB 4MNVA 2BY5X 4ISOA 4Q7XA 1UTLM 2OBOA 1AD8H 1T8LA 5I46H 1OXGA 4UFFH 3T5FH 1DWEH 4DY7B 1C2IA 9LPRA 1DXPA 2ZFSA 2H9EH 2WPKS 4NZLA 3T27A 3BIUH 5E0HA 1YPHC 4UE7H 2ANYA 2K1QA 2BDAA 1O31A 4X1RU 3P17H 3ITIA 2Y5GA 2JH6D 1K21H 2G51A 1EZUC 4DVAU 1O2IA 5BPEA 5LPEA 2CGAA 3DHKH 5LH8A 1HAVA 3ZVFA 3ZZCA 1SQAA 1CGHA 1BTPA 4BOHA 4CRDA 1F5RA 1W13U 1P0SH 2I6QA 3URCA 1DXWA 1ZMNA 1RFNA 1ZRBA 1HAPH 1AGJA 4XSKU 4ABBA 2BVXH 1D4PB 1ELBA 2OLGA 2ASUB 5T6DA 4OS1A 1THPB 1AHTH 3SV9A 2F3CE 2WV5A 2OCVB 3BTQE 1TNJA 1O3CA 1SGFG 5GXPA 2FI3E 3SJOA 1TE0A 4F49A 1TBQH 4BXWA 4LZ4B 4R0IA 1MTUA 3PYHA 1ZPBA 1W2KH 2GCTC 1SGYE 1Z7KA 4X8VH 3T26A 1JXPA 1SFQB 1CA0C 5ESTE 3B23B 2A4QA 3TGIE 2QIQA 1ABIH 2ZEBA 1TLDA 2FOCA 1Z8GA 2HPQH 1BZXE 1AB9C 1BUIA 1GGDC 2ZHFH 3GY6A 4JZEH 3VGCC 2STAE 1Y3VA 3DUXH 2LNCA 3F9EA 1K28D 1P03A 4MVNA 1FI8A 4WH8A 2BD9A 1TRMA 1KTTB 1NT1A 2SGAA 1C1TA 1OWIA 4CH2B 3UWIA 4OS7A 3SV8A 1O3OA 1KDQB 1IQGA 4NSVA 1BTZA 1GG6B 1O3JA 3UREA 3WY8A 5EU8A 3A8BA 1SGEE 3F68H 1DUEA 3UNSA 2GMTB 1C1SA 2WUBA 1X7AC 3KL6A 5DP6A 1ZGVA 2O8LA 3BTWE 1YYY1 3U8OH 2LPRA 1KXAA 1GHAF 3P8GA 3S9CA 1KLTA 1W10U 3BN9A 1GI0A 2RDLA 4ISNA 1BTYA 2C8WB 1UMAH 2QGRA 5DP4A 3UY9A 2Q6DA 1C5NH 1C1UH 1BMLA 4B2BA 4AOQA 3IITA 1G2LA 4ZKRU 1TPAE 1BIOA 1LTOA 2XC5A 1NRNH 2PGQB 3UQOA 1HXEH 4LZ1H 1P8VC 2QA9E 1EX3A 2XBVA 2BMGB 3VB6A 1KYNA 2HNTF 1ANCA 1GVKB 2O8UA 3V7TA 4I8JA 3LOXA 1D3QB 4WMFA 1Z8IB 3SHAH 4MG3A 1MTNB 1HGTH 4SGBE 1O5CB 1GDUA 1C1RA 1LVOA 1QB9A 1JMOH 2Z9KA 1MTSA 5ESBA 1TOMH 2RCEA 3MU8A 1V2LT 5EQQA 1BJVA 4FUGA 3STJA 1C1MA