3GY3A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
molecule tags Hydrolase
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy3A02
3P6ZB 1AFQB 1DUAA 1TQ0B 1LQEA 1UHBA 2HNTE 5DP5A 4AOQA 5K7RA 3BIVH 5JBAS 2BTCE 1W11U 1C2DA 1A5HA 4JYUH 2F9NA 1UO6A 2OC7A 1GGDB 1W0ZU 3L6PA 4FUFA 2P3TB 2H2ZA 2AYWA 4OS7A 1E0FD 1DWEH 3V3MA 2JH5D 2GDDA 2HGTH 4NA9H 5A0CA 2CN0H 4R8TB 1IQKA 2BD3A 3A8CA 1O5BB 1P05A 4ESTE 2XCFA 1SHYA 2FOEA 2XCNA 4MDSA 1GL1A 2AGEX 3M7UA 1TNHA 1S0QA 1ZZZA 1KTTB 1T4VH 1XUGA 1S81A 4TPYA 3EA8A 1DSTA 3SU5A 2C90B 4O9VA 5EW1H 2QAAA 4MNYA 2LPRA 2ASUB 1O2YA 3LC5A 3STIA 1ETTH 2P8OB 4AFSA 4CH2B 3RXIA 2A4QA 3VB4A 2ZU2A 3SGQE 4YLQH 1XM1A 1ELGA 1GG6C 2G4UA 1C2EA 1NZQH 1KXBA 2NU4E 5A8XA 4OS5A 3KQDA 2DE9A 2FOCA 2FS9A 5E0GA 4IC6A 3S69A 1AUTC 1FUJA 2P95A 4A1TA 6GCHF 4Y8YA 5EW2H 3UFAA 3F1SB 4J1YA 3RXQA 2RG3A 3AAVA 5E2OA 1T7CA 5E8EH 5JB8S 4I8GA 1UVSH 1JWTA 1CU1A 1IQLA 4TWYA 2J95A 1BHXF 1ZTJA 1Z8RA 4WJG2 2D8WA 1K9OE 3T5FH 4ISIH 3V0XA 3SJ9A 5AFYH 2ZPQA 5AHGH 3PWCA 5JBTA 4GCHG 5CMXH 5I46H 3T29A 5A0BA 1DOJA 1ZLRA 3BF6H 3MH6A 1O3OA 2V3OH 3ZVFA 3SU2A 4LZ1H 4FUBA 2VIPA 2ZGCA 1W7GH 1DANH 4YTAA 5F03A 2J9NA 1DWDH 4K8BA 1O2KA 2BXTH 1ZSKA 4AB8A 2C8YB 5JB9S 3H7OA 3U8RH 1FPHH 1MZAA 1O2OA 2WPHS 1TPPA 4NSVA 3TVJB 1ELBA 4RKOB 1GJBB 4UE7H 4AB9A 3NZIA 2H5DA 3A84A 1ANBA 3M5OA 2A5IA 1CA0C 1GVLA 1B0EA 1QTFA 2D1JA 2B7DH 2Z7FE 3EE0B 4ABBA 3SV2H 1EX3A 2WPKS 1BCUH 2ZHWH 1HJAB 1LVOA 3HATH 1C2JA 3K9XB 3L33A 1JXPA 1OSSA 3UNSA 2BY7X 1MTNC 2ZQ2A 1P2KA 3KF2A 2Z9JA 1KXEA 1DX5M 1MUEB 4JZEH 2PGBB 4HI3A 5E2PA 4A1XA 1EAUA 2VWNA 3A89A 4YOGA 3CENA 2A1DB 4Y6DA 1OWHA 1MTWA 2EC9H 2ZFQH 5DKMA 3VFEA 1RXPA 2FTLE 2SNWA 3HPTB 2ZCKP 2R0LA 1O5AB 2ZU3A 1GHAF 3GY2A 2ANWA 1V2UT 1NTPA 1PPFE 2B9LA 3BG4C 4CRDA 2ZHEH 1CT2E 4AYYB 1K21H 1PPZA 4ZH8A 4ZHAA 4JYTA 1TLDA 2BX4A 1C5QA 3LOXA 4JZDH 1MU6B 2TIOA 1GMCF 3BG8A 1SGQE 5DG6A 2P8OC 3AAUA 2ZDAH 1SOTA 3BTWE 5C5OA 3RLYH 1UTLM 1P2NA 1SGYE 2ZDMA 3PM3A 5FHTA 3LGWA 5JYIA 3UOPA 2AH4X 4CHAC 1H8DH 4I33A 2AS9A 2PW8H 1G2LA 4AFZA 1SGTA 1KLJH 3RXOA 1N1LA 4YM9A 3A7VA 3M37A 3E90B 1IOEA 1TRMA 6CHAC 1M9UA 1P02A 4UFGH 3S9AA 4PROA 1EQ9A 2P3UB 1T8NA 4ISNA 4SGBE 1LKBA 1CGJE 3PMAB 2NU0E 3SGBE 2UWOA 3A7WA 4CREA 2W7SA 1ZJKA 1W8BH 1ARCA 9ESTA 1MTSA 1HAVB 1OYQA 1AGJA 3ZZ9A 3A82A 1YCPK 4FUGA 3RXMA 4B76A 3PV4A 1MQ6A 5AFZH 3EYDA 4KTUA 5JBBS 4KP0A 2GZ8A 4FUEA 1UK4A 4X6NA 2QA9E 2NU1E 1A7SA 2R0KA 1DSUA 4YT6H 1QQUA 1GJDB 1BUIA 5A8ZA 2ALPA 3RXAA 2BB4A 1K2I1 1YPMH 4A7IB 2TPIZ 2CHAB 1O2QA 3BTEE 7LPRA 2SGEE 2PR3A 2WYJA 3SBKA 3TGKE 4AZ2B 2C93B 4U2WA 1FY5A 1TPAE 1A2CH 1O2PA 1P57B 2F9UA 1PJPA 4JZ1A 3VB7A 1SGFG 4X1SU 4B2BA 1AD8H 5IDKA 3ZZCA 1C2GA 4H42U 8GCHF 2VIDA 4JK5A 1BA8B 1P8VC 3SO3A 2UUKB 1SQAA 4ABAA 4DVAU 4IMZA 5A8YA 1T8MA 1XUKA 3E91A 2H6MA 4AG1A 1YC0A 2SFAA 1DWBH 1O2UA 1O3HA 2ZZUH 3SNBA 3T28A 3E1XB 4B73A 1WV7H 1D3QB 1SGCA 3ZZ4A 3TGJE 1C5WB 2WPIS 1Z1IA 1WUNH 1QJ1B 2XBYA 2SGQE 1OWJA 3SUGA 1EJMA 1IQIA 2Z9GA 1WBGB 2UWLA 1TOMH 3BTKE 4ABGA 1C5TA 2XXLA 4FVDA 1V2KT 3AW0A 3RXGA 1GG6B 1IQMA 4CH8B 1TPSA 1H9LB 1RIWB 1NS3A 4I8KA 3HK3B 1AI8H 1C5VA 1MZDA 2PUQH 1TQ7B 1O37A 1T8OA 1S6HA 3URCA 5GXPA 1TGCA 3RXPA 3NUMA 4NCYA 4FUHA 4B1TA 1NC6A 4B75A 3RXFA 4BAKB 1C5XB 4GHTA 5DP7A 3HK6B 1GMCG 3P8NA 3NXPA 1EPTA 3O8RA 1C5YB 1YGCH 2P94A 4ZXYH 2V35A 1LHEH 1XXDA 1O2NA 4QT8C 1VJ9U 1YPLH 1WTHD 3OYPA 1XKAC 5LPFA 1AVWA 3QUMP 4WF8A 1UVOA 4LK4A 3D23A 1O3JA 2OLGA 1JRSA 1LHCH 1SLWB 3QO6A 4INKA 1HBTH 1HAPH 5FCKA 3D65E 1CGHA 1SMFE 1C1WH 3A7TA 2GZ9A 1YBWA 3PMHB 7KMEH 3ZYDA 4A6LA 1VGCB 3CS7A 1MAYA 2Z94A 1AWHB 1J17T 2BDIA 2Z3EA 4OGXA 2BLWA 3C27B 4JK6A 2BD9A 1F2SE 1U6QA 3VGCB 1P9UA 1QA0A 4MVNA 1EZXC 1W3CA 2RDLA 1T4UH 1ELEE 2IJOB 3GOVB 1O2TA 3BV9B 3RXEA 1H1BA 2ZHQH 4NA7A 4I8JA 3L3TA 1A3BH 1O33A 1TBRH 4LOYH 4B2AA 2BDCA 1HAOH 3SNAA 2R3UA 1Z7KA 1HRTH 1V2RT 1F0SA 1P2QA 5HM9A 1ZPZA 3GDSA 2XRCA 3A7XA 1TGTA 1G2MA 1QQ4A 2ZPRA 4K69A 2IN2A 1C5SA 5DGJA 5EODA 1BQYA 2ZQ1A 1HCGA 4WWYA 4BTIB 2Y5FA 1EZUC 1JBUH 3ZZ6A 4INLA 3SJKA 2FZZA 4FVBA 3GDUA 3U9AH 4CBNA 1MKXK 4K60A 4BNRA 3U8TH 4GLYA 3RC6A 3PLBA 4JMYA 3RU4T 1WCZA 3WY8A 2SNVA 5J4QA 1VCWA 1J8AA 1EB1H 1O2JA 4KKDA 4D7FA 4Q7YA 2XC4A 2QXJA 3RXJA 3ZZ7A 3SUEA 3UUZA 5AF9H 4O3UA 3RLWH 4BTTB 1MKXH 3GCTF 2ZPSA 4Y8XA 1GBBA 2BY9X 1E34B 1AE5A 1RFNA 2J38A 1TBZH 1HFDA 3T2NA 5HXFA 3UWJH 1J15A 1F0TA 1RD3B 1UK2A 3M61U 5JPMH 2W7UA 2RA0A 3FP8E 2BOKA 4A92A 1RIWC 1ESAA 4XBBA 1C1SA 1TBQH 1SI5H 3PROA 4UD9H 1HJ9A 1XUFA 3KHVA 1A61H 4AORA 1C2KA 2B8OH 3EQ0H 3E3TA 2CJIA 1NT1A 1S82A 2O8UA 4GAWA 8ESTE 1KXFA 3QX5H 1DT2A 2FM2A 2PV9B 5LPRA 4LZ4B 5B6OA 2BYAX 1AB9C 3B9FH 3MH5A 3RXUA 4DG4A 4WXVA 1DICA 4HTCH 1FONA 1WQSA 2Z9IA 3SI3H 4RKJB 3ODFA 5TCAA 3CP7A 3LGYA 1GVKB 2GV6A 2ZDVH 3S9CA 2QXGA 3TIUA 3UTUH 2ZWLH 2XYAA 1FY4A 3AVZA 2G81E 1C5LH 2GCTB 3I78A 3SV7A 4X1NU 2W5EA 1DWCH 3RM0H 3ZZ3A 1TWXB 3LC3A 1MTVA 1EUFA 2HWLB 4JYVH 5C1YA 1MD7A 3LGUA 1F92A 3OY6U 2BDYA 4ZKNU 1GHYH 2G55A 4CRCA 2CXVA 2VH0A 4YO9A 5FX6A 1TNIA 1BZXE 1CO7E 1P11E 4IC5A 1GI5A 2H9TH 1SPJA 1KY9A 3GCOA 2YOLA 5GIBA 1HYLA 3TH4H 1QB6A 4M7GA 3GY6A 2BM2A 3PLKA 1CHGA 1HLTH 2XWBI 1QRXA 5F8ZA 3BEFB 2AMPA 3TJVA 1QY6A 2BDAA 3E8LA 3W95A 1S5SA 2ZHFH 2JH6D 2C8XB 4I8LA 2V3HH 2FP7B 3PWBA 3RC4A 2FESH 1H8IH 5FPTA 4GUXA 4WH8A 1A4WH 3FVFB 3N7OA 3OTJE 3Q3XA 5CHAC 1TYNA 3OY5U 1CVWH 2OCVB 2A2XH 2ZECA 3SZNA 1G3DA 2XBXA 5DP8A 5A2MH 3UY9A 2Z3DA 5PTPA 4BAHB 1W10U 1GI2A 3SU4A 2BVSH 7GCHF 1HXFH 4Q80A 2Z9KA 1YPGH 2HOBA 1NFYA 3PMJA 1FAKH 1H9HE 1O2LA 2P3FH 4I31A 4FU9A 4U32A 5DJ7A 1NFUA 1CSOE 5T6GA 4TY6A 1EJNA 5C1UA 1D6WA 3GYLB 2VB0A 2G52A 1F5LA 4K2YA 1AWFH 4OS2A 1UTMA 5CE1A 3MO9A 4Y11E 1SLXB 3U98H 3ZVBA 1A5GH 2JH0D 4X8UH 1YCPH 4O97A 4A1VA 1FN8A 2K1QA 1O35A 2GT7A 6ESTA 1ID5H 4XFQA 1V2JT 1K1JA 1MU8B 1C1VH 2CMYA 4X1RU 4YZUA 4MPVA 3GICB 2AGGX 1V2QT 1K1LA 3MNSA 1SFQB 1ZOMA 4K1SA 4X6MA 1C5OH 1D3PB 3TU7H 3EAJA 2ZFTA 1S0RA 5T6DA 3UR6A 4NWKA 4Q7ZA 1HUTH 1BIOA 2VU8E 2BY6X 1CA8B 1UCYK 4H6SB 4AGJA 1GDNA 3LONA 2PSXA 5F6MA 4IN2A 3M5LA 2ZFFH 4NFEA 1UCYE 1TNJA 2CF8H 2BZAA 2WPMS 2PTNA 4WXIA 3VPKA 1ZTKA 2QIQA 4X2WA 1C5UA 3Q3KA 4CRFA 3QZQA 2AFQB 2UUJB 1KTSB 1DY9A 1P2JA 2Z9LA 1G32B 1F5KU 2TGAA 1DFPA 4CRGA 3Q76A 2C8ZB 3KQBA 4RSPA 1L1NA 4X2XA 1OPHB 2H5CA 3FP6E 4ZXXH 1SGRE 2B5TB 1TFXA 3SV8A 4XBCA 3PO1B 2GCHG 1O2MA 2EA3A 2JETB 2G8TA 1QB9A 1GWAA 2ZGXH 1UTOA 1D3TB 2BDGA 2JETC 4B71A 2CF9H 2FMJA 1QRZA 1A3EH 1YLCA 1ZSJA 2AIQA 4Y0YE 2BLVA 1OWIA 1TALA 1A0HB 4MPWA 1S83A 5EQSA 3SJ8A 3A85A 3PMBB 3FP7E 4THNH 1ABJH 1IQGA 1C2IA 1O5CB 1W0YH 1ZPBA 1PQ5A 1QBVH 1G3CA 3QDZB 4AGKA 3CS0A 2Y5HA 2BY5X 2J34A 1OS8A 2I6QA 5ESBA 1KXAA 1P2IA 5F8XA 2BDHA 1O2VA 1TNKA 3P95A 2FYRA 3HKJB 1YPHE 4OS1A 3LGIA 1AKSA 1GI4A 1YPKH 2BDBA 3TLOA 1BJVA 3PYHA 2OBQA 1BTWA 5EQRA 2UUYA 1ZRKA 1AVGH 5L30H 1HJAC 1VGCC 2ZTZA 1V6DA 3RXTA 2BD7A 1BRAA 4NZLA 1BB0B 3TJOA 3K6ZA 3ODDA 1Y5BT 4D8NA 1CT0E 4NIVA 4DOQA 4K5ZA 1V2VT 1GVZA 2A31A 1G9IE 1BTXA 1DY8A 1MD8A 2STAE 1RTLA 1C1OA 1ZMLA 1GI7B 4BAQB 4K1EA 2KAIA 3NCLA 1K1MA 1O3EA 3BTHE 2PTCE 3KCGH 1DXWA 4MPUA 2VWMA 1OP0A 4Z0KA 1V2PT 1C1NA 4ABEA 3MNXA 1E35B 2A2QH 3ELAH 2ZO3H 2ODQA 1GHXH 1BTZA 4X2VA 1SGPE 1KYNA 3F9FA 1GCTB 3P17H 3ZZBA 3LJJA 1GHBF 3LU9B 2LNCA 1QBNA 3GCTG 1ZPCA 2ZFRH 1UTQA 2STBE 1H9IE 2NU2E 1LMWB 2VNTA 5ETXA 4F4OC 1B7XB 1K1PA 1XUJA 3D62A 4MPXA 1BT7A 2C4FH 4KTCA 1SLVB 2AMDA 3ZVCA 2VIVA 4AFQA 1HXEH 1O31A 3GY8A 1EP6A 1XMNB 1GBAA 3K2UA 1GI0A 2GX4A 2FODA 2J92A 1OWEA 2ZCLP 1N8OC 3PO1C 5J4SA 2IOTA 1C1MA 4Y8ZA 1NRPH 3TK6A 1GBMA 1MQ5A 5SGAE 3KIDU 3SJOA 2HPPH 4H4FA 5A0AE 2F9OA 1Z8GA 4B2CA 4X0WU 1BOQA 4I7YH 1L4DA 4YOJA 1LPKB 1HGTH 2OQ5A 1THPB 1KDQB 4IW4E 3SUFA 1FXYA 1RGQA 1DUEA 2TBSA 3LIWA 4IN1A 1ZTLA 1OP8A 3KQCA 1Z71A 1EP5A 4DIIH 2QYIA 3MTYA 3SV9A 1QR3E 1KSNA 3A86A 1FI8A 1UJ1A 1O2WA 3BTME 5FBIA 6CHAB 1TA2A 2W3KA 1YP9A 2F91A 2ODYB 3ZZAA 1P2OA 4CHAB 4FUJA 2FEQH 1Z8IB 2WPLS 1EKBB 3MU0A 3TH3H 2TGTA 2ZNKH 2BXUH 3LGVA 1C2LA 1TA6A 4NIWA 3TITA 3O8BA 1DE7H 3RDZA 1QBOA 1NFWA 1QJ6B 2FO9A 3UR9A 1CQQA 4I32A 3ZVEA 3SHCH 1AKSB 4FU7A 4LXBH 3BEIB 1MAXA 1C5ZB 1C4V2 1C9TA 1GI9B 5EG4A 1O2SA 5ABWA 4D9RA 2FX4A 4DURA 1OYTH 4X8TH 2F9PA 1GJ6A 3K6YA 2PKAB 4AX9H 3ESTA 5G4BA 3NK8A 1JOUB 1Q2WA 3RXBA 4ABHA 2UWPA 3MU1A 2GGVB 2Y82A 1LKAA 2QV1A 1NRRH 3ENSB 1HIAA 4U01A 3P8GA 2GCTC 1CBWB 2ANKH 1NRNH 1V3XA 3QN7A 4NA8A 1OXGA 1P06A 4NSYA 1BITA 1QJ7B 4BXSA 2ILNA 1MTUA 2OTVA 1BBRK 1ZR0A 2ZCHP 2BX3A 1MTNB 1GPZA 1N6YA 1V2NT 1S6FA 4Y10E 5EQQA 4Q7XA 2VIOA 4IBLH 3KQEA 4RN6A 3VB5A 2DUCA 1WOFA 1GL0E 1ZYOA 3PTNA 2F83A 1FY3A 2NWNA 1P9SA 1ANCA 5DPAA 1XVMA 3RXRA 1Y5UT 1ORFA 1TONA 1Z8JB 2PSYA 1P3CA 3D49H 1BBRH 2FOHA 3MU5A 2A45B 1ZRBA 3DD2H 2QCYA 1SGEE 4GHQA 5F8TA 2VVCA 4X8VH 2SGFE 1G30B 2QC2A 1CGIE 3UNRA 1T31A 1VITG 3EA7A 1BTHH 2VWOA 2A5KA 1EJAA 1DITH 4TY7A 1PQAA 1FJSA 2TRMA 1BDAA 3GCNA 7GCHG 2ULLA 1HV7A 2VIQA 2BLQA 1WAYB 1HAXB 1P09A 3RXSA 1RS0A 2FXRA 1AY6H 2XBWA 4U30A 1TAWA 4XOJA 3ATWA 5A09A 5L2YH 1B5GH 1SL3A 1XUHA 1FIWA 4E7RG 3AASA 2WV5A 4GSOA 3FANA 1UTKA 1CT4E 1DXPA 2VVVA 2A0QB 3SN8A 1O2GH 3U8OH 1EZQA 3EGKH 5EPYA 2A5AA 5GJ4B 4Y79A 1J14A 1SFIA 1ZGVA 3VXFH 2BQ6B 2C8WB 1AFQC 1W2KH 2A7JA 1SGNE 1W12U 4NZQA 4D9QA 1Z6JH 1GMDG 1NU7B 1CA0B 1VCPA 2GCHF 3MU4A 3V7TA 4FUIA 4Y71A 1ELFA 3KGPA 2BD4A 1TRNA 2EI6A 1LHFH 4ZHLU 1O2XA 1PYTD 2PWXA 1NN6A 1LVMA 3MO3A 5DO4H 3OX7U 1C5RA 3M5MA 3LPRA 4AFUA 5T6FA 1AMHA 3BTGE 1GCDA 1GBTA 4R0IA 1Z1JA 2OBOA 3GY3A 1ELTA 3UIRA 4ZMAH 1EB2A 4Y76A 1TMBH 4WVPE 2Q6GA 1SR5C 3ATKA 3M7TA 1DDJA 1DS2E 4UONA 3RXDA 5FAHA 4ZROA 2XTTB 1O3PB 1UTJA 2VIWA 4ABJA 1O3KA 5EU8A 2BZ6H 2AERH 2OP9A 1UCYH 4HGCA 2FI4E 2M5TA 1OOKB 1RTKA 2HLCA 4K3JA 3HGPA 1D6RA 1P03A 3Q77A 1PPBH 3NWUA 5BPEA 2A4GA 1AQ7A 2W26A 1TGBA 3U1JB 2PUXB 3FFGA 1ZSLA 3ZZDA 4WMEA 2OINA 3MH4A 1EASA 5AVDA 3V13A 3A80A 3RMLH 3RXLA 1QA7A 1L0ZA 2ZGJA 2D26C 2Y5GA 3IG6B 3RXVA 3FAOA 2W3IA 1ELCA 3M3VA 2O8LA 3MNBA 3S7HB 1TRYA 4UFEH 3SI4H 3DFLA 2J2UA 1PPEE 4IMQA 1O3GA 4X6OA 1GMHG 5K0HA 1BBRE 1O5EH 1XKBC 1EOLA 3A88A 2ZFSA 1O38A 1ZHPA 2BVRH 1SB1H 4DIHH 1OX1A 1W13U 2BD5A 1GBIA 2WV4A 1A1RA 4UEHH 1TIOA 4BANB 1P04A 5DP6A 1GDQA 3SNEA 2PFEA 2ZGBH 5HYOA 1WTGH 1THRH 2SGAA 1XVOA 1IHTH 4A5TS 2O8TA 3GY7A 1AZ8A 3BTDE 3V12A 3SU3A 4WMFA 5EGMA 1GJ5H 1FQ3A 1TNGA 3LT3A 1C1UH 3GY5A 4FUCA 1Y3UA 2Y7XA 1EAIA 1CE5A 4XBDA 2H1UA 3LKWA 3RMNH 1V2LT 3F6UH 5E0HA 1O3BA 1Z6EA 1OKXA 5FPYA 1FV9A 3SOSA 3IITA 1EPTB 2O9QA 1GBKA 1FNIA 1TE0A 1V2ST 2HRVA 2R2WU 3A7YA 3O8CA 3PTBA 2ZU5A 2SGPE 2HNTC 1QURH 3T62A 1ZHRA 1ARBA 1HDTH 1LHGH 1V2OT 1V2WT 4HZHA 1G37A 2XBVA 1ESTA 1PQ7A 3RC5A 3A81A 1ETRH 1GI6A 2FS8A 8GCHG 1RTFB 1C2MA 3PB1E 4I8HA 1O3LA 2XC0A 1TOCB 1Y59T 4GPGA 4K1TA 1NU9A 1AHTH 2BY8X 2Q6FA 3RM2H 1AVXA 2HALA 3UQVA 3Q00A 4MLFB 1TPOA 3T26A 5LH8A 1HIAB 1Y3YA 2V0BA 3STJA 2EI8A 1SBWA 1YYY1 2J4IA 2FX6A 3QGNB 1GJ8B 3TGIE 2OXSA 1LHDH 3SQEE 1WSSH 5L2ZH 5DP3A 1DPOA 5FX5A 1NY22 4DJZB 4YESB 3ZZ5A 1FLEE 1O5DH 1LVBA 5T3HA 4HFPB 1AFEH 1CHOG 2FOBA 1YPJH 2XC5A 1HPGA 1DLEA 1DVAH 1P0SH 2IPHA 2WUCA 1YLDA 1Y8TA 4WH6A 1C1RA 1KDQA 2AMQA 1O3AA 1P12E 3Q3YA 2F3CE 1BJUA 4MG3A 4X1QU 1EXFA 1NM6A 2FWWA 4BOHA 2Q1JA 1T32A 1GJ4H 1L2EA 4GVUA 3LH1A 2PHBA 2FIRH 3QK1A 3TPIZ 4ISLA 1P3EA 2A32A 3P8FA 3HGNA 2KAIB 1VR1H 5JBCS 2FOGA 3BG4B 1B0FA 1EAWA 1G3BA 1Y3XA 1JIRA 3SU6A 3GCHB 1Y3WA 4YLUA 1O5GH 1O3FA 2FPZA 2ANMH 2QXHA 1G36A 4CRBA 1GBDA 5TJXA 2Z3CA 1G3EA 4E05H 5TCCA 1N6XA 1PQ8A 3ATMA 4ABDA 1SHHB 2GV7A 3SGAE 1BMLA 1SG8B 3GDVA 2ZTXA 3T27A 1C9PA 2BLOA 4UFFH 3SJIA 1AN1E 3SNCA 2BMGB 3TJNA 1UK3A 1GHVH 8LPRA 1KIGH 2C3SA 2G5NA 1GCTC 3S7KB 1C2FA 2QN5T 1SC8U 2I6SA 2BOHB 2G51A 1Q3XA 4NWLA 5GCHG 3MMGA 5GDSH 3ZVGA 3FZDA 2P59A 3B23B 5DK1A 4ZKOU 1RRKA 1VCQA 4XE4A 2ZDKA 4ASHA 4ISOA 2PKSB 3UNQA 2R3YA 5LPEA 3SHAH 1VITF 4MTBA 2QF3A 3QLPH 1GI1A 1QFKH 2YNBA 5EXMA 1O3CA 1P2MA 4NIYA 1C2HA 1A0LA 1KLIH 2CV3A 1GJCB 1QB1A 5HMAA 1E36B 2FI5E 1K1IA 3W94A 1VZQH 1P10A 3TNSA 1RJXB 1BTUA 1LCYA 1SVPA 3RXHA 4Y7AA 5C20A 4H6TA 1MMJN 1ESBA 3MU8A 4MNWA 2QY0B 3ZZ8A 1LTOA 3DHKH 3KEEA 3I29A 4X6PA 2Y6TA 2XW9A 1F7ZA 3DT0H 3QGJA 5C3NA 4O3TA 5FXLA 5JDUB 4INHA 3DFJA 5GCHF 4ABIA 3HKIB 1IQNA 4BAMB 2XWAA 1YPEH 3TK9A 1ANEA 2OC8A 2TGDA 2VGCB 1Q31A 3MOCA 2VH6A 4CR5A 1SGDE 1GMDF 1ACBE 1GHBG 3S9BA 5GWZA 4NFFA 4KGAA 3I77A 1OWKA 3KNXA 2UUFB 2A4OA 5GPIB 1C4U2 1SQOA 1LO6A 1O0DH 1ELDE 1P01A 1E38B 4JCNA 2FOAA 1ETSH 1SQTA 1KLTA 1UTPA 3MFJA 1ELVA 1HAYB 3M3SA 4KELA 1A46H 1J9CH 1JIMA 3ZV9A 4CBOA 1IQFA 3T25A 1O2IA 4YT7H 5DP4A 3M36A 3M3TA 4AYVB 5FPSA 5E0JA 4FU8A 4IS5A 2ZEBA 1NPMA 4MNVA 4XDEA 1WU1A 4D76A 1NROH 2J94A 4F49A 3SQHE 3SUDA 3TNTA 1GHWH 1MBMA 2G5VA 4UDWH 3MH7A 2QGRA 1GBJA 2EI7A 4ZKRU 3SORA 4OS6A 3RXCA 2YNAA 1O34A 3F9GA 1SGIB 3NKKA 1C5PA 3RUOA 1D4PB 1ANDA 5C67A 2ESTE 4MNXA 3VEQB 2ZG0H 1Y5AT 5CHAB 2H9HA 3ATIA 3SW2B 1O2RA 2Y81A 3F9EA 3A87A 3MNCA 1UTNA 2PGQB 4Y0ZE 4IGDA 2TGPZ 2O8MA 2ODPA 1BTYA 3UOUA 2GTBA 3A8DA 1BHXB 2ZDNA 3PLPA 1EOJA 3UWIA 3A8AA 3RMMH 2R9PA 3TK5A 1E37B 1IQEA 2VINA 3KN2A 4ABFA 1GBEA 2F9VA 1HNEE 2CGAA 1NESE 1FDPA 1HAVA 5I25A 1K22H 2ZDLA 4GCHF 4ZUHA 1C4Y2 2OD3B 2P93A 2PKAA 2GKVE 4ISHH 5IYTA 4FUDA 3RP2A 1FAXA 4WMDA 1IQHA 2PKSC 3C1KA 4MQAA 1BMNH 1V2TT 3M35A 1LVYA 2BD8A 4X2YA 1MCTA 2BD2A 2OUAA 1J16A 4NIXA 1FN6A 5EOKA 3OU0A 2D2DA 2HPQH 1C1PA 3RU4D 1D9IA 2Z6BD 1TX7A 2B0FA 1V2MT 4DY7B 1O36A 1KXDA 3ZVAA 3ZVDA 4BAOB 6GCHG 2BVXH 1GMHF 3UREA 4UFDH 3SU1A 1QL9A 4E06H 1S85A 2VGCC 4JZIA 2AIPA 4Y7BA 5DP9A 1ZMNA 1TABE 2PLXA 4Z6AH 4VGCC 1X7AC 1CBWC 1QIXB 3F68H 4B74A 4SGAE 1TGSZ 3VB6A 1BRCE 4VGCB 1GGDC 3BEUA 3SNDA 1FY8E 3U1IB 2AEIH 1HAGE 1A5IA 2VJ1A 2OC1A 3SV6A 9LPRA 4AN7A 3JZ1B 1QNJA 1XUIA 1AO5A 2P16A 2ANYA 3NPSA 3UPEA 2NU3E 4ZKSU 1QL7A 2HVXA 2THFB 1FZZA 1MKWK 2GMTC 2RA3A 3ZYEA 2FOMB 1BTPA 1L4ZA 1GDUA 2FLRH 1SSXA 3GISB 1XX9A 2WPJS 3BTQE 1FMGA 1O3MA 3MI4A 2EEKA 3BTTE 1MBQA 4FXGH 2G4TA 1O3DA 1LQDB 4K8YA 2ZU4A 1K1OA 1NRSH 1IAUA 1SOZA 3B8JA 1MKWH 3RMOH 2AGIX 1H4WA 1FIZA 2SGDE 1IHSH 1C5NH 3BIUH 7ESTE 4JZFH 3KL6A 3BN9A 3E0PB 5EXNA 4OS4A 2FYQA 1DM4B 1O32A 1ABIH 1Y3VA 2A7CA 3GYMA 1JMOH 2OQUA 1OP2A 3F9HA 1C1QA 2WUBA 3E16B 3BSQA 4CR9A 3EDXB 2QXIA 3MHWU 1QL8A 3P92A 3UQOA 1EAXA 1QHRB 3O8DA 1UVUH 4TWWA 1KXCA 1HB0B 4CRAA 1ZJDA 1AE8H 1GHAG 3AW1A 1VITH 3E0NB 1F0UA 3QTOH 1TX8A 3MWIU 5HGGA 1GI3A 3DA9B 1LPGB 4DCDA 1W7XH 1GHZA 4J2YB 2ZFPH 1LDTT 3VGCC 3JZ2B 4DGJA 1HAZB 1TMUH 2GMTB 3GCHC 2HNTF 1QRWA 2OC0A 4DT7B 3K65B 1HAHH 1O2HA 1GJ7B 3P70B 2ZI2H 1AUJA 1AB9B 2GDEH 3H5CB 2V6NA 1EPTC 1TMTH 1ZHMA 3ITIA 3LH3A 2GT8A 1O2ZA 1UVTH 3H7TA 1TB6H 2F9BH 2Y80A 1K28D 4NG9H 1GI8B 1L1JA 3QZRA 5FBEA 4ZAEA 2Y7ZA 1HJ8A 3QTVH 1AZZA 3ZV8A 2ZF0H 1PPCE 2FOFA 4OGYA 1QCPA 5H4IB 2FI3E 2ZIQH 3M7QA 4NGAH 1ELAA 3RU4E 3RXKA 2ZKSA 1W14U 5ESTE 1TGNA 1O3IA 1SLUB 2VVUA 5FCRA 1L1GA 1PFXC 1YCPM 3LJOA 1JRTA 3A83A 1HAIH 2RCEA 4WY3A 2ZHDA 5C1XA 1PPHE 1C5MD 2CHAC 1YF4A 1UVPA 3M5NA 4DW2U 3A8BA 4TYDA 1BRBE 4ZHMU 1FPCH 5EPNA 2H9EH 1BRUP 4Q2KA 1O5FH 1UHBB 1NO9H 2WYGA 1K1NA 1F5RA 2QF0A 3MO6A 3MYWA 3VXEH 2JKHA 1O30A 1YKTA 2G00A 4D7GA 2BQWB 2ZA5A 1SGFA 1C1TA 2O8WA 1NFXA 4YOIA 5EXLA 1F0RA 3EA9A 1O39A 3A7ZA 1EATA 2ZC9H 2WINI 2ZTYA 1GBFA 1S84A 1N8OB 1GJ9B 1FY1A 1MH0A 2ALVA 2VWLA 2Q6DA 1ZMJA 3LDXH 4BTUB 1BMAA 3FZZA 3R3GB 4TPIZ 1QGFA 3DUXH 3ATLA 2FTMA 1AU8A 4AG2A 6LPRA 1XXFA 1PYTC 1TX6A 2GD4B 1LPZB 1ZGIA 1AIXH 1YPHC 1NRQH 1GBCA 1O3NA 2GVFA 3URDA 5C5NA 1DLKB 1YM0A 3BTFE 4O03A 1EZSC 3IWMA 4X8SH 1WQVH 3P8OA 1D3DB 1GBLA 3TH2H 1OWDA 1IQJA 4X1PU 1PPGE 3SU0A 3VB3A 1BMMH 4BXWA 3OSYA 2ZGHA 1TNLA 2FDAA 5C2ZA 5LGOA 2GZ7A 1INCA 8KME2 3GY4A 3S0NA 2XNIA 2BQ7B 2R2MB 5HM2A 3U69H 3QWCH 3E6PH 4E7NA 5L6NH 4XSKU 3LGTA 2ZU1A 2FLBH 1GBHA 2A4RA 1A0JA 1VJAU 1WYKA 1THSH 2BHGA 2ZP0H 2A7HA 1GJAB 2GP9B 5BRRE 1CHOF 1UMAH 4KTSA 1T8LA 3G01A 1MCVA 3TJUA 3R0FA 2DE8A
chains in the Genus database with same CATH superfamily
3P6ZB 1AFQB 1DUAA 1TQ0B 1LQEA 1UHBA 2HNTE 3F2HA 5DP5A 4AOQA 5K7RA 3BIVH 5JBAS 2BTCE 1W11U 1C2DA 1A5HA 4JYUH 2F9NA 1UO6A 2OC7A 1GGDB 1W0ZU 3L6PA 4FUFA 2P3TB 2H2ZA 2AYWA 4OS7A 1E0FD 1DWEH 3V3MA 2JH5D 2GDDA 2HGTH 4NA9H 5A0CA 2CN0H 4R8TB 1IQKA 2BD3A 3A8CA 1O5BB 1P05A 4ESTE 2XCFA 1SHYA 2FOEA 2XCNA 4MDSA 1GL1A 2AGEX 2QF4A 2VBCA 3M7UA 1TNHA 1S0QA 1ZZZA 1NBMD 1KTTB 1T4VH 1XUGA 1S81A 4TPYA 3EA8A 1DSTA 3SU5A 2C90B 4O9VA 5EW1H 2J97A 2QAAA 4MNYA 2LPRA 2ASUB 1O2YA 3LC5A 3STIA 1ETTH 2P8OB 4AFSA 4CH2B 3RXIA 2A4QA 3VB4A 2ZU2A 3SGQE 4YLQH 1XM1A 1ELGA 1GG6C 4ASUD 2G4UA 1C2EA 1NZQH 1KXBA 2NU4E 5A8XA 4OS5A 3KQDA 2DE9A 2FOCA 2FS9A 5E0GA 4IC6A 3S69A 1AUTC 1FUJA 2P95A 2M2AA 4A1TA 1VKYA 6GCHF 4Y8YA 5EW2H 3UFAA 3F1SB 2JIZD 4J1YA 3RXQA 2RG3A 3AAVA 5E2OA 1T7CA 5E8EH 5JB8S 4I8GA 1UVSH 1JWTA 1CU1A 1IQLA 4TWYA 2J95A 1BHXF 1ZTJA 1Z8RA 3DSOA 4WJG2 2D8WA 1K9OE 3T5FH 4ISIH 3V0XA 3SJ9A 5AFYH 2ZPQA 5AHGH 3PWCA 5JBTA 1YWUA 4GCHG 5CMXH 5I46H 3T29A 2WSSD 2L74A 5A0BA 1DOJA 1ZLRA 3BF6H 3MH6A 1O3OA 3MQKC 2V3OH 3ZVFA 4OM9A 3SU2A 4LZ1H 4FUBA 2VIPA 2ZGCA 5C94A 1W7GH 1DANH 4YTAA 5F03A 2PP6A 2J9NA 1DWDH 4K8BA 3EE7A 1O2KA 2BXTH 1OHHD 1ZSKA 4AB8A 2C8YB 5JB9S 3H7OA 3U8RH 1FPHH 1MZAA 1O2OA 2WPHS 1TPPA 4NSVA 3TVJB 1ELBA 4RKOB 1GJBB 4UE7H 4AB9A 3NZIA 2H5DA 3A84A 1ANBA 3M5OA 2A5IA 1CA0C 1GVLA 1B0EA 1QTFA 2D1JA 2B7DH 2Z7FE 3EE0B 4ABBA 3SV2H 1EX3A 2WPKS 1BCUH 2ZHWH 1E1QD 1HJAB 1LVOA 3HATH 1C2JA 3K9XB 3L33A 1JXPA 1OSSA 3UNSA 2BY7X 1MTNC 3F3BA 4FOUC 2ZQ2A 1P2KA 3KF2A 2Z9JA 1KXEA 1DX5M 1MUEB 4JZEH 2PGBB 4HI3A 5E2PA 4A1XA 1EAUA 2VWNA 3A89A 3W1EA 4YOGA 3CENA 2A1DB 2WPDD 4Y6DA 1OWHA 1MTWA 2EC9H 2ZFQH 5DKMA 3VFEA 1RXPA 2FTLE 2SNWA 3HPTB 2ZCKP 2R0LA 1O5AB 2ZU3A 1GHAF 3GY2A 2ANWA 1V2UT 1NTPA 1PPFE 2B9LA 3BG4C 4CRDA 2ZHEH 1CT2E 4AYYB 1K21H 1PPZA 4ZH8A 4ZHAA 4JYTA 1TLDA 2BX4A 3OEED 1C5QA 3LOXA 4JZDH 1MU6B 2TIOA 1GMCF 3BG8A 1SGQE 5DG6A 2P8OC 3AAUA 2ZDAH 1SOTA 3BTWE 2K8IA 5C5OA 3RLYH 1UTLM 2K0QA 1P2NA 1SGYE 2ZDMA 3PM3A 5FHTA 3LGWA 5JYIA 3UOPA 2AH4X 4CHAC 1H8DH 4I33A 4B6EA 2AS9A 2YMSB 2PW8H 1G2LA 4AFZA 1SGTA 1KLJH 3RXOA 1N1LA 4YM9A 3A7VA 3M37A 3E90B 1IOEA 1TRMA 6CHAC 1M9UA 1P02A 1MABB 4UFGH 3S9AA 4PROA 1EQ9A 5EJ1A 2P3UB 1T8NA 4ISNA 4SGBE 1LKBA 1CGJE 3PMAB 2NU0E 3SGBE 2UWOA 3A7WA 4CREA 2W7SA 1ZJKA 1W8BH 1ARCA 9ESTA 1MTSA 1HAVB 1OYQA 1AGJA 3ZZ9A 3A82A 1YCPK 5FL7D 2V3MA 4FUGA 3RXMA 4B76A 3PV4A 1MQ6A 5AFZH 3EYDA 4KTUA 5JBBS 4KP0A 2GZ8A 4FUEA 1UK4A 4X6NA 2QA9E 2NU1E 1A7SA 2R0KA 1DSUA 4YT6H 1QQUA 1GJDB 1BUIA 5A8ZA 2ALPA 3RXAA 2BB4A 1K2I1 1YPMH 4A7IB 2TPIZ 2CHAB 2KM0A 5T1VA 1O2QA 3BTEE 7LPRA 2SGEE 2PR3A 2WYJA 3SBKA 3TGKE 4AZ2B 2C93B 4U2WA 1FY5A 1TPAE 1A2CH 1O2PA 1P57B 2F9UA 1PJPA 4JZ1A 3VB7A 1SGFG 4X1SU 2YMSC 4B2BA 1AD8H 5IDKA 3ZZCA 1C2GA 4H42U 8GCHF 2W6JD 2VIDA 4JK5A 1BA8B 1P8VC 3SO3A 2UUKB 1SQAA 4ABAA 4DVAU 4IMZA 5A8YA 1T8MA 1XUKA 3E91A 3F0OA 2H6MA 4AG1A 1YC0A 2SFAA 1DWBH 1O2UA 1O3HA 2ZZUH 3SNBA 3T28A 3E1XB 4B73A 1WV7H 1D3QB 1SGCA 3ZZ4A 3TGJE 1C5WB 2WPIS 1Z1IA 1WUNH 1QJ1B 2W6ID 2XBYA 2SGQE 1OWJA 1H8HD 3SUGA 1EJMA 1IQIA 2Z9GA 1WBGB 2UWLA 1TOMH 3BTKE 4ABGA 1C5TA 2XXLA 4FVDA 1V2KT 3AW0A 3RXGA 1GG6B 2WHXA 1IQMA 4CH8B 1TPSA 1H9LB 1RIWB 1NS3A 4I8KA 2JDID 3HK3B 1AI8H 1C5VA 1MZDA 2PUQH 1TQ7B 1O37A 1T8OA 1S6HA 3URCA 5GXPA 1TGCA 3RXPA 3NUMA 4NCYA 4FUHA 4B1TA 1NC6A 4B75A 3RXFA 4BAKB 1C5XB 4GHTA 5DP7A 4M9FA 3HK6B 1GMCG 3P8NA 3NXPA 1EPTA 3O8RA 1C5YB 1YGCH 2P94A 4ZXYH 5CHBA 2V35A 1LHEH 1E1RD 1XXDA 1O2NA 2WZQA 4QT8C 1VJ9U 1YPLH 1WTHD 3OYPA 1XKAC 5LPFA 1AVWA 3QUMP 4WF8A 5C17A 1UVOA 4LK4A 3D23A 1O3JA 2OLGA 1JRSA 1LHCH 1SLWB 3QO6A 4INKA 1HBTH 1HAPH 5FCKA 3D65E 1CGHA 1SMFE 1C1WH 3A7TA 2GZ9A 1YBWA 3PMHB 7KMEH 3ZYDA 4A6LA 3WW7A 1VGCB 3CS7A 1MAYA 3GS9A 2Z94A 2JJ1D 1AWHB 1J17T 2BDIA 2Z3EA 4OGXA 2BLWA 3C27B 4JK6A 2BD9A 1F2SE 1U6QA 3VGCB 1P9UA 1QA0A 4ACAA 3FOAA 4MVNA 1EZXC 1W3CA 2RDLA 1T4UH 1ELEE 2IJOB 3GOVB 1O2TA 3BV9B 3RXEA 1H1BA 2ZHQH 4NA7A 4I8JA 3L3TA 1A3BH 1O33A 1TBRH 4LOYH 1QZ8A 4B2AA 2BDCA 1HAOH 3SNAA 2R3UA 1Z7KA 1HRTH 1V2RT 1F0SA 1P2QA 5HM9A 1ZPZA 3GDSA 2XRCA 3A7XA 1TGTA 1G2MA 1QQ4A 2ZPRA 4K69A 2IN2A 1C5SA 5DGJA 5EODA 1BQYA 2OK5A 2ZQ1A 1HCGA 4WWYA 4BTIB 2Y5FA 1EZUC 1JBUH 3ZZ6A 4INLA 3OTPA 3SJKA 2FZZA 4FVBA 3GDUA 3U9AH 4AC9A 4CBNA 1MKXK 4K60A 4BNRA 3U8TH 2YMSD 4GLYA 3RC6A 3PLBA 4JMYA 3RU4T 1WCZA 3WY8A 2SNVA 5J4QA 1VCWA 1J8AA 1EB1H 1O2JA 4KKDA 4D7FA 4Q7YA 2XC4A 2QXJA 3RXJA 3ZZ7A 3SUEA 3UUZA 5AF9H 4O3UA 3RLWH 4BTTB 1MKXH 3GCTF 2ZPSA 4Y8XA 5KECA 1GBBA 2BY9X 1E34B 1AE5A 1RFNA 2J38A 1E79D 1TBZH 1HFDA 3T2NA 5HXFA 3UWJH 1J15A 1F0TA 1RD3B 1UK2A 3M61U 5JPMH 2W7UA 2RA0A 3FP8E 2BOKA 4A92A 1RIWC 1ESAA 4XBBA 1C1SA 1TBQH 1SI5H 3PROA 4UD9H 2QE7D 1HJ9A 1XUFA 3KHVA 1A61H 4AORA 1C2KA 2B8OH 3EQ0H 3E3TA 2CJIA 1NT1A 1S82A 2O8UA 4GAWA 8ESTE 1KXFA 3QX5H 1DT2A 2FM2A 2PV9B 5LPRA 4LZ4B 5B6OA 2BYAX 1AB9C 3B9FH 3MH5A 4P00A 3RXUA 4DG4A 4WXVA 1DICA 4HTCH 1FONA 1WQSA 2Z9IA 3SI3H 4RKJB 3ODFA 5TCAA 3CP7A 3LGYA 1GVKB 2GV6A 2ZDVH 3S9CA 2QXGA 3TIUA 3UTUH 2ZWLH 2XYAA 1FY4A 3AVZA 2G81E 1C5LH 5CDFE 2GCTB 3I78A 3SV7A 3N7DA 4X1NU 2W5EA 1DWCH 3RM0H 3ZZ3A 1TWXB 3LC3A 1MTVA 1EUFA 2HWLB 4JYVH 5C1YA 1MD7A 3LGUA 1F92A 3OY6U 2BDYA 4ZKNU 1GHYH 2G55A 4CRCA 2CXVA 2VH0A 4YO9A 5FX6A 1TNIA 1BZXE 1CO7E 1P11E 4IC5A 1GI5A 2H9TH 1SPJA 1KY9A 3GCOA 2YOLA 5GIBA 1HYLA 5EJZA 3TH4H 1QB6A 4M7GA 3GY6A 2BM2A 3PLKA 1CHGA 1HLTH 2XWBI 1QRXA 5F8ZA 3BEFB 2AMPA 3TJVA 1QY6A 2BDAA 3E8LA 3W95A 1S5SA 2ZHFH 2JH6D 2C8XB 4I8LA 2V3HH 2FP7B 3PWBA 3RC4A 2FESH 1H8IH 5FPTA 4GUXA 4WH8A 1A4WH 3FVFB 3N7OA 3DSGA 3OTJE 3Q3XA 5CHAC 3KYGA 1TYNA 4Q63A 3OY5U 1CVWH 2OCVB 4Q4LA 2A2XH 2ZECA 3SZNA 1G3DA 2XBXA 5DP8A 5A2MH 3UY9A 5EJLA 2Z3DA 5PTPA 4BAHB 1W10U 1GI2A 3SU4A 2BVSH 3N7EA 7GCHF 1HXFH 4Q80A 2IJD1 1YPGH 2Z9KA 2HOBA 1NFYA 3PMJA 1FAKH 1H9HE 1O2LA 2P3FH 4I31A 4FU9A 4U32A 5DJ7A 1NFUA 1CSOE 5T6GA 4TY6A 1EJNA 5C1UA 1D6WA 2RDEA 2VB0A 2G52A 3GYLB 3FN8A 1F5LA 4K2YA 1AWFH 2JJ2D 4OS2A 1UTMA 5CE1A 3MO9A 4XRNA 3U28C 4Y11E 1SLXB 3U98H 3ZVBA 1A5GH 2JH0D 4X8UH 1YCPH 4O97A 4A1VA 1FN8A 2K1QA 1O35A 2GT7A 6ESTA 5C0TA 1ID5H 4XFQA 1V2JT 1K1JA 1MU8B 1C1VH 2CMYA 4X1RU 4YZUA 4MPVA 3GICB 2AGGX 1V2QT 1K1LA 3MNSA 1SFQB 1ZOMA 4K1SA 4X6MA 1C5OH 1D3PB 3TU7H 3EAJA 2ZFTA 1S0RA 5T6DA 3UR6A 4NWKA 4Q7ZA 1HUTH 1BIOA 2VU8E 2BY6X 1CA8B 1UCYK 4H6SB 4AGJA 1GDNA 3LONA 2PSXA 5F6MA 4IN2A 3M5LA 2ZFFH 2RFKC 4NFEA 1UCYE 1TNJA 2CF8H 2BZAA 2WPMS 2PTNA 4WXIA 3VPKA 1ZTKA 2QIQA 4X2WA 1C5UA 5B6LA 3Q3KA 3OE7D 4CRFA 3QZQA 2AFQB 2UUJB 1KTSB 1DY9A 1P2JA 2Z9LA 1G32B 1F5KU 2TGAA 1DFPA 4CRGA 3Q76A 2C8ZB 3KQBA 4RSPA 1L1NA 4X2XA 1OPHB 2H5CA 3FP6E 4ZXXH 1SGRE 5GNDA 2B5TB 1TFXA 1H8ED 2KZ4A 4XBCA 3PO1B 3SV8A 2GCHG 1O2MA 4RT1A 2EA3A 2JETB 2G8TA 1QB9A 1GWAA 2ZGXH 1UTOA 1D3TB 4B6FA 2BDGA 2JETC 4B71A 2CF9H 2FMJA 1QRZA 1A3EH 1YLCA 1ZSJA 2AIQA 4Y0YE 2BLVA 1OWIA 1TALA 1A0HB 4MPWA 1S83A 5EQSA 3SJ8A 3A85A 3PMBB 3FP7E 4THNH 1ABJH 1IQGA 1C2IA 2J98B 1O5CB 1W0YH 1ZPBA 1PQ5A 1QBVH 1G3CA 3QDZB 4AGKA 3CS0A 2Y5HA 2BY5X 2J34A 1OS8A 2I6QA 5ESBA 1KXAA 1P2IA 5F8XA 4F48B 2BDHA 1O2VA 1TNKA 3P95A 2FYRA 3HKJB 1YPHE 4OS1A 3LGIA 1AKSA 1GI4A 1YPKH 2BDBA 3TLOA 1BJVA 3PYHA 2OBQA 1BTWA 5EQRA 2UUYA 1ZRKA 1AVGH 5L30H 1HJAC 1VGCC 2ZTZA 1V6DA 3RXTA 2BD7A 1BRAA 4NZLA 1BB0B 3TJOA 3K6ZA 3ODDA 1Y5BT 4D8NA 1CT0E 4NIVA 4DOQA 4K5ZA 1V2VT 1GVZA 2A31A 1G9IE 1BTXA 1DY8A 1MD8A 2STAE 1RTLA 1C1OA 1ZMLA 1GI7B 4BAQB 4K1EA 2KAIA 3NCLA 1K1MA 1O3EA 3BTHE 2PTCE 3KCGH 1DXWA 4MPUA 2VWMA 1OP0A 4Z0KA 1V2PT 1C1NA 4ABEA 3MNXA 1E35B 2A2QH 3ELAH 2ZO3H 2ODQA 1GHXH 1BTZA 4X2VA 1SGPE 1KYNA 3F9FA 1GCTB 3P17H 3ZZBA 3LJJA 1GHBF 3LU9B 2LNCA 1QBNA 3GCTG 1ZPCA 2ZFRH 1UTQA 2STBE 1H9IE 2NU2E 1LMWB 2VNTA 5ETXA 4F4OC 1B7XB 1K1PA 1XUJA 3D62A 4MPXA 4FETA 1BT7A 2C4FH 4KTCA 1SLVB 2AMDA 3ZVCA 2VIVA 4AFQA 1HXEH 1O31A 3AK5A 3GY8A 1EP6A 1XMNB 1GBAA 3K2UA 1GI0A 2GX4A 2FODA 2J92A 1OWEA 2KCOA 2ZCLP 1N8OC 3PO1C 4I86A 5J4SA 2IOTA 1C1MA 2GJGA 4Y8ZA 1NRPH 3TK6A 1GBMA 1MQ5A 5SGAE 3SZEA 3KIDU 3SJOA 2HPPH 4H4FA 5A0AE 2F9OA 1Z8GA 4B2CA 4X0WU 1BOQA 4I7YH 1L4DA 4YOJA 1LPKB 1HGTH 2OQ5A 1THPB 1KDQB 4IW4E 3SUFA 1FXYA 1RGQA 1DUEA 2TBSA 3LIWA 4IN1A 1ZTLA 1OP8A 3KQCA 1Z71A 4HG6A 5IK2D 1EP5A 4DIIH 2QYIA 3MTYA 3SV9A 3ZIAD 1QR3E 1KSNA 3A86A 2WV9A 1FI8A 1UJ1A 1O2WA 3BTME 5FBIA 6CHAB 1TA2A 2KCAA 2KCYA 2W3KA 1YP9A 2F91A 2ODYB 3ZZAA 1P2OA 4CHAB 4FUJA 2FEQH 1Z8IB 2WPLS 1EKBB 3MU0A 3TH3H 2TGTA 2ZNKH 2BXUH 3LGVA 1C2LA 1TA6A 4NIWA 3TITA 3O8BA 1DE7H 3RDZA 1QBOA 1NFWA 1QJ6B 2FO9A 3UR9A 1CQQA 4I32A 3ZVEA 3SHCH 1AKSB 4FU7A 4LXBH 3BEIB 1MAXA 1C5ZB 1C4V2 1C9TA 1GI9B 5EG4A 1O2SA 5ABWA 4D9RA 2FX4A 4DURA 1OYTH 4X8TH 2F9PA 1GJ6A 3K6YA 2PKAB 4AX9H 3ESTA 5G4BA 3NK8A 1JOUB 1Q2WA 3RXBA 4ABHA 2UWPA 3MU1A 2GGVB 2Y82A 1LKAA 2QV1A 1NRRH 3ENSB 1HIAA 4U01A 3P8GA 2GCTC 1CBWB 2ANKH 1NRNH 1V3XA 3PRDA 3QN7A 4NA8A 1OXGA 1P06A 4NSYA 1BITA 1QJ7B 4BXSA 2ILNA 1MTUA 1YY3A 1BBRK 1ZR0A 2OTVA 2ZCHP 2BX3A 1MTNB 1GPZA 1N6YA 1V2NT 1S6FA 4Y10E 5EQQA 5HIYA 4Q7XA 2VIOA 4IBLH 3KQEA 4RN6A 3VB5A 2DUCA 1WOFA 1GL0E 1ZYOA 3PTNA 2F83A 1FY3A 2NWNA 1P9SA 1ANCA 5DPAA 1XVMA 3RXRA 4YXWD 1Y5UT 1ORFA 1TONA 1Z8JB 2PSYA 1P3CA 3D49H 1BBRH 2FOHA 3MU5A 2A45B 1ZRBA 3DD2H 2QCYA 1SGEE 4GHQA 5F8TA 2VVCA 4X8VH 2SGFE 1K0HA 1G30B 2QC2A 1CGIE 3UNRA 1T31A 1VITG 3EA7A 2KX4A 1BTHH 2VWOA 2A5KA 1EJAA 1DITH 4TY7A 1PQAA 2IPQX 1FJSA 2TRMA 1BDAA 3GCNA 7GCHG 2ULLA 1HV7A 2VIQA 2BLQA 1WAYB 1HAXB 1P09A 3RXSA 1RS0A 2FXRA 1AY6H 2XBWA 4U30A 1TAWA 4XOJA 3ATWA 5A09A 5L2YH 1B5GH 1SL3A 1XUHA 1FIWA 4E7RG 2KR7A 3AASA 2WV5A 4GSOA 3FANA 1UTKA 1CT4E 1DXPA 2VVVA 2A0QB 3SN8A 1O2GH 3U8OH 1EZQA 3EGKH 5EPYA 2A5AA 5GJ4B 4Y79A 1J14A 1SFIA 1ZGVA 3VXFH 2BQ6B 3UB0A 2C8WB 1AFQC 1W2KH 2A7JA 1SGNE 1W12U 4NZQA 4D9QA 1KMHB 1Z6JH 1GMDG 1NU7B 1CA0B 1VCPA 2GCHF 3MU4A 3V7TA 4FUIA 4Y71A 1ELFA 3KGPA 2BD4A 1TRNA 4F55A 2EI6A 1LHFH 4ZHLU 1O2XA 1PYTD 2PWXA 1NN6A 1LVMA 3MO3A 5DO4H 3OX7U 1C5RA 3M5MA 3LPRA 4AFUA 5T6FA 1YLNA 1AMHA 3BTGE 2XOKD 1GCDA 1GBTA 4R0IA 1Z1JA 2OBOA 3GY3A 1ELTA 3PRBA 3UIRA 4ZMAH 1EB2A 3UAIC 4Y76A 1TMBH 4WVPE 2Q6GA 1SR5C 3ATKA 3M7TA 1DDJA 1DS2E 5HKKD 4UONA 3RXDA 5FAHA 4ZROA 2XTTB 1O3PB 1UTJA 2VIWA 4ABJA 1O3KA 5EU8A 2BZ6H 2AERH 2OP9A 1UCYH 4HGCA 2FI4E 2M5TA 1OOKB 1RTKA 2HLCA 4K3JA 3HGPA 1D6RA 1P03A 3Q77A 1PPBH 2XNDD 3NWUA 5BPEA 2A4GA 1AQ7A 5DSFA 2W26A 1TGBA 3U1JB 2PUXB 3FFGA 1ZSLA 3ZZDA 4WMEA 2OINA 3MH4A 1EASA 5AVDA 3H09A 3V13A 3A80A 3RMLH 3RXLA 1QA7A 1L0ZA 2ZGJA 2D26C 2Y5GA 3IG6B 3RXVA 3FAOA 2W3IA 1ELCA 3M3VA 2O8LA 3MNBA 3S7HB 1TRYA 2EY4C 4UFEH 3DFLA 3SI4H 2J2UA 1PPEE 4IMQA 1O3GA 4X6OA 1GMHG 5K0HA 1BBRE 1O5EH 1XKBC 1EOLA 3A88A 2ZFSA 1O38A 1ZHPA 2BVRH 1SB1H 4DIHH 1OX1A 1W13U 2BD5A 1GBIA 5F53A 2WV4A 1A1RA 4UEHH 1TIOA 4BANB 1P04A 3FKSD 1GDQA 5DP6A 3SNEA 2PFEA 2ZGBH 5HYOA 1WTGH 1THRH 2SGAA 1XVOA 1IHTH 4A5TS 2O8TA 3GY7A 1AZ8A 3BTDE 3V12A 3SU3A 4WMFA 5EGMA 1GJ5H 1FQ3A 1TNGA 3LT3A 1C1UH 3GY5A 4FUCA 1Y3UA 2Y7XA 1EAIA 1CE5A 4XBDA 2H1UA 3LKWA 3RMNH 1V2LT 2KFWA 3F6UH 4ACBA 5E0HA 1O3BA 1Z6EA 1OKXA 5FPYA 1FV9A 3SOSA 3IITA 1EPTB 2O9QA 1GBKA 1FNIA 1TE0A 1V2ST 2HRVA 2R2WU 3A7YA 3O8CA 3PTBA 2ZU5A 4P02A 2SGPE 2HNTC 1QURH 3T62A 1ZHRA 1ARBA 1HDTH 3NRLA 1LHGH 1V2OT 1V2WT 4HZHA 1G37A 2XBVA 1ESTA 1PQ7A 3RC5A 3A81A 1ETRH 1GI6A 2FS8A 8GCHG 1RTFB 1C2MA 3PB1E 4I8HA 1O3LA 2XC0A 1TOCB 1Y59T 4GPGA 4K1TA 1NU9A 1AHTH 2BY8X 2Q6FA 3OAAD 3RM2H 1AVXA 2HALA 3UQVA 3Q00A 4MLFB 1TPOA 3T26A 5LH8A 1HIAB 1Y3YA 2V0BA 3STJA 3OFND 2EI8A 1SBWA 1YYY1 2J4IA 2FX6A 3QGNB 1GJ8B 3TGIE 2OXSA 1LHDH 3SQEE 1WSSH 5L2ZH 5DP3A 1DPOA 5FX5A 1NY22 4DJZB 4YESB 3ZZ5A 1FLEE 1O5DH 1LVBA 5T3HA 1BMFD 4HFPB 1AFEH 1CHOG 2FOBA 3KYFA 1YPJH 2XC5A 1HPGA 1DLEA 1DVAH 1P0SH 2IPHA 1YLDA 2WUCA 1Y8TA 5KGOA 4WH6A 1C1RA 1KDQA 2AMQA 1O3AA 1P12E 3Q3YA 2F3CE 1BJUA 4MG3A 4X1QU 1EXFA 1NM6A 2FWWA 4BOHA 5HIZA 2Q1JA 1T32A 1GJ4H 1L2EA 4GVUA 3LH1A 2PHBA 2FIRH 3QK1A 3TPIZ 4ISLA 1P3EA 1WXRA 2A32A 3P8FA 3HGNA 2KAIB 1VR1H 5JBCS 2FOGA 3BG4B 1B0FA 4TSFD 1EAWA 1G3BA 1Y3XA 1JIRA 3SU6A 3GCHB 1Y3WA 4YLUA 1O5GH 1O3FA 2FPZA 2ANMH 2QXHA 1G36A 4CRBA 1GBDA 5TJXA 2Z3CA 1G3EA 4Z1MD 4E05H 5TCCA 1N6XA 1PQ8A 3ATMA 4ABDA 1SHHB 2GV7A 3SGAE 1BMLA 1SG8B 3GDVA 2ZTXA 3T27A 1C9PA 2BLOA 3PV2A 4UFFH 3SJIA 1AN1E 3SNCA 2BMGB 3TJNA 1UK3A 1GHVH 8LPRA 1KIGH 2C3SA 2G5NA 1GCTC 3S7KB 1C2FA 2QN5T 1SC8U 2I6SA 2BOHB 2G51A 1Q3XA 4NWLA 5GCHG 3MMGA 5GDSH 3ZVGA 3FZDA 2P59A 3B23B 5DK1A 4ZKOU 1RRKA 1VCQA 4XE4A 2ZDKA 4ASHA 4ISOA 2PKSB 3UNQA 2R3YA 5LPEA 3SHAH 1VITF 4MTBA 2QF3A 3QLPH 1GI1A 2EQNA 1QFKH 1NBME 2YNBA 1O3CA 1P2MA 4NIYA 5EXMA 1C2HA 1A0LA 1KLIH 2CV3A 1GJCB 1QB1A 5HMAA 1SQRA 1E36B 2FI5E 1K1IA 3W94A 5DN6D 1VZQH 1P10A 3TNSA 1RJXB 1BTUA 1LCYA 1SVPA 3RXHA 4Y7AA 5C20A 4H6TA 1MMJN 3FO8D 1ESBA 3MU8A 4MNWA 2QY0B 3ZZ8A 1LTOA 3DHKH 3KEEA 3I29A 4X6PA 2Y6TA 2XW9A 1F7ZA 3DT0H 3QGJA 5C3NA 4O3TA 5FXLA 5JDUB 4INHA 3DFJA 5GCHF 4ABIA 3HKIB 1IQNA 4BAMB 2XWAA 1YPEH 3TK9A 1ANEA 4DT4A 2OC8A 2TGDA 2VGCB 1Q31A 3MOCA 2VH6A 4CR5A 1SGDE 1GMDF 1ACBE 1GHBG 3S9BA 5GWZA 4NFFA 4KGAA 3I77A 1OWKA 3KNXA 2UUFB 2A4OA 5GPIB 1UW7A 1C4U2 1SQOA 1LO6A 1O0DH 1ELDE 1P01A 3F2FA 1E38B 4JCNA 2FOAA 1ETSH 1SQTA 1KLTA 1UTPA 3MFJA 1ELVA 1HAYB 3M3SA 4KELA 1A46H 1J9CH 1JIMA 3ZV9A 4CBOA 1IQFA 3T25A 2F43B 1O2IA 4YT7H 1COWD 5DP4A 3M36A 3M3TA 4AYVB 5FPSA 5E0JA 3KQ5A 4FU8A 4IS5A 2ZEBA 1NPMA 4MNVA 4XDEA 1WU1A 4D76A 1NROH 2J94A 4F49A 3SQHE 3SUDA 3TNTA 3CNRA 1GHWH 1MBMA 2G5VA 4UDWH 3MH7A 2QGRA 1GBJA 2EI7A 4ZKRU 3SORA 4OS6A 3RXCA 2YNAA 1O34A 3F9GA 1SGIB 3NKKA 1C5PA 3RUOA 1D4PB 1ANDA 5C67A 1WDIA 3F2GA 3N99A 2ESTE 4MNXA 3VEQB 2ZG0H 1Y5AT 5CHAB 2H9HA 3ATIA 3SW2B 1O2RA 3VG8A 2Y81A 3F9EA 3A87A 3MNCA 1UTNA 2PGQB 4ZCNA 4Y0ZE 4IGDA 2TGPZ 2O8MA 2ODPA 1BTYA 3UOUA 2GTBA 3A8DA 1BHXB 2ZDNA 3PLPA 1EOJA 3UWIA 3A8AA 3RMMH 2R9PA 3TK5A 1E37B 1IQEA 2VINA 3KN2A 4ABFA 4RI0A 1GBEA 2F9VA 1HNEE 2CGAA 1NESE 1FDPA 1HAVA 5I25A 1K22H 2ZDLA 4GCHF 4ZUHA 1C4Y2 2OD3B 2P93A 2PKAA 2GKVE 4ISHH 5IYTA 4FUDA 3RP2A 1FAXA 4WMDA 1IQHA 2PKSC 3C1KA 4MQAA 2LP6A 1BMNH 1V2TT 3M35A 3OEHD 1LVYA 2BD8A 4X2YA 1MCTA 2BD2A 2OUAA 1J16A 4NIXA 1FN6A 5EOKA 3OU0A 2D2DA 3WWBA 2HPQH 1C1PA 3RU4D 1D9IA 2Z6BD 1TX7A 2B0FA 1V2MT 4DY7B 1O36A 1KXDA 3ZVAA 3ZVDA 2V7QD 4BAOB 6GCHG 2BVXH 1GMHF 3UREA 4UFDH 3SU1A 1QL9A 4E06H 2J98A 1S85A 2VGCC 4JZIA 2AIPA 2AHME 4Y7BA 5DP9A 1ZMNA 1TABE 2PLXA 4Z6AH 4VGCC 1X7AC 1CBWC 1QIXB 3F68H 4B74A 4SGAE 1S6LA 1TGSZ 3VB6A 1EFRD 2J5UA 3PV5A 1BRCE 4VGCB 1GGDC 3BEUA 3SNDA 1FY8E 3U1IB 2AEIH 1HAGE 1A5IA 2VJ1A 2OC1A 3SV6A 9LPRA 4AN7A 3JZ1B 1QNJA 2QF5A 1XUIA 1AO5A 2P16A 2ANYA 3NPSA 3UPEA 2NU3E 4ZKSU 1QL7A 2HVXA 2THFB 1FZZA 1MKWK 2GMTC 2RA3A 3ZYEA 2FOMB 1BTPA 1L4ZA 1GDUA 2FLRH 1SSXA 3GISB 1XX9A 2WPJS 3BTQE 1FMGA 2HLDD 1O3MA 3MI4A 2EEKA 3BTTE 1MBQA 2CK3D 4FXGH 2G4TA 1O3DA 1LQDB 4K8YA 2ZU4A 1K1OA 1NRSH 1IAUA 1SOZA 3B8JA 1MKWH 3RMOH 2AGIX 1H4WA 1FIZA 2SGDE 1IHSH 1C5NH 3BIUH 7ESTE 4JZFH 3KL6A 3BN9A 3E0PB 5EXNA 4OS4A 2FYQA 1DM4B 1O32A 1ABIH 1Y3VA 2A7CA 3GYMA 1JMOH 2OQUA 1OP2A 3F9HA 1C1QA 2WUBA 3E16B 3BSQA 1W0JD 4CR9A 3EDXB 2QXIA 1SKYE 2LELA 1QL8A 3MHWU 3P92A 3UQOA 1EAXA 1QHRB 3O8DA 1UVUH 4TWWA 1KXCA 1HB0B 4CRAA 1ZJDA 1AE8H 1GHAG 3AW1A 1VITH 3E0NB 1F0UA 3QTOH 1TX8A 3MWIU 5HGGA 1GI3A 3DA9B 1LPGB 4DCDA 1W7XH 1GHZA 4J2YB 2ZFPH 1LDTT 3VGCC 3WWFA 3JZ2B 4DGJA 1HAZB 1TMUH 2GMTB 3GCHC 2HNTF 1QRWA 2OC0A 4DT7B 3K65B 1HAHH 1O2HA 1GJ7B 3P70B 2ZI2H 1AUJA 1AB9B 3DSPA 2GDEH 3H5CB 2V6NA 1EPTC 1TMTH 1ZHMA 3ITIA 3LH3A 2GT8A 1O2ZA 1UVTH 3H7TA 1TB6H 2HVYB 2F9BH 2Y80A 1K28D 4NG9H 1FX0B 1GI8B 1L1JA 3QZRA 5FBEA 4ZAEA 2Y7ZA 1HJ8A 3QTVH 1AZZA 3ZV8A 2ZF0H 1PPCE 2FOFA 4OGYA 1QCPA 5H4IB 2FI3E 2ZIQH 3M7QA 4NGAH 1ELAA 3RU4E 3RXKA 2ZKSA 1W14U 5ESTE 1TGNA 1O3IA 1SLUB 2VVUA 5FCRA 1L1GA 1PFXC 1YCPM 3LJOA 1JRTA 5EIYA 3A83A 1HAIH 2RCEA 4WY3A 2ZHDA 5C1XA 1PPHE 1C5MD 2CHAC 1YF4A 1UVPA 3M5NA 4DW2U 3A8BA 4TYDA 3F0PA 1BRBE 4ZHMU 1FPCH 5EPNA 2H9EH 1BRUP 4Q2KA 1O5FH 5C0UA 1UHBB 1NO9H 1K1NA 1F5RA 2WYGA 2QF0A 3MO6A 3MYWA 4RT0A 3DCLA 3VXEH 5KEDA 2JKHA 1O30A 1YKTA 2G00A 4XD7D 4D7GA 2BQWB 4TT3D 2ZA5A 1SGFA 1C1TA 2O8WA 1NFXA 4YOIA 5EXLA 1F0RA 3EA9A 1O39A 3A7ZA 1EATA 1W0KD 2ZC9H 2WINI 2ZTYA 1GBFA 3SYJA 1S84A 1N8OB 1GJ9B 1FY1A 1MH0A 2ALVA 2VWLA 2Q6DA 1ZMJA 3LDXH 4BTUB 1BMAA 3FZZA 3R3GB 4TPIZ 1QGFA 3DUXH 3ATLA 2FTMA 1AU8A 4AG2A 6LPRA 1XXFA 1PYTC 1TX6A 2GD4B 1LPZB 1ZGIA 1AIXH 1YPHC 2F4LA 1NRQH 1GBCA 1O3NA 2GVFA 3URDA 5C5NA 1DLKB 1YM0A 3BTFE 4O03A 1EZSC 3IWMA 4X8SH 1WQVH 3P8OA 1D3DB 1GBLA 2L6OA 3TH2H 1OWDA 1IQJA 4X1PU 1PPGE 3SU0A 3VB3A 1BMMH 4BXWA 3OSYA 2ZGHA 1TNLA 2FDAA 5C2ZA 5LGOA 2GZ7A 1INCA 8KME2 3GY4A 3S0NA 2XNIA 2BQ7B 2R2MB 5HM2A 3U69H 3QWCH 3E6PH 4E7NA 5L6NH 4XSKU 3LGTA 2ZU1A 2KCPA 2FLBH 1GBHA 2A4RA 1A0JA 1VJAU 1WYKA 1THSH 2BHGA 2ZP0H 2A7HA 1GJAB 2GP9B 5BRRE 1CHOF 1UMAH 4KTSA 1T8LA 3G01A 1MCVA 3TJUA 3R0FA 2DE8A
chains in the Genus database with same CATH topology
3P6ZB 1AFQB 1DUAA 1TQ0B 1LQEA 1UHBA 2HNTE 5DP5A 4AOQA 5K7RA 3BIVH 5JBAS 2BTCE 1W11U 1C2DA 1A5HA 4JYUH 2F9NA 1UO6A 2OC7A 1GGDB 1W0ZU 3L6PA 4FUFA 2P3TB 2H2ZA 2AYWA 4OS7A 1E0FD 1DWEH 3V3MA 2JH5D 2GDDA 2HGTH 4NA9H 5A0CA 2CN0H 4R8TB 1IQKA 2BD3A 3A8CA 1O5BB 1P05A 4ESTE 2XCFA 1SHYA 2FOEA 2XCNA 4MDSA 1GL1A 2AGEX 3M7UA 1TNHA 1S0QA 1ZZZA 1KTTB 1T4VH 1XUGA 1S81A 4TPYA 3EA8A 1DSTA 3SU5A 2C90B 4O9VA 5EW1H 2QAAA 4MNYA 2LPRA 2ASUB 1O2YA 3LC5A 3STIA 1ETTH 2P8OB 4AFSA 4CH2B 3RXIA 2A4QA 3VB4A 2ZU2A 3SGQE 4YLQH 1XM1A 1ELGA 1GG6C 2G4UA 1C2EA 1NZQH 1KXBA 2NU4E 5A8XA 4OS5A 3KQDA 2DE9A 2FOCA 2FS9A 5E0GA 4IC6A 3S69A 1AUTC 1FUJA 2P95A 4A1TA 6GCHF 4Y8YA 5EW2H 3UFAA 3F1SB 4J1YA 3RXQA 2RG3A 3AAVA 5E2OA 1T7CA 5E8EH 5JB8S 4I8GA 1UVSH 1JWTA 1CU1A 1IQLA 4TWYA 2J95A 1BHXF 1ZTJA 1Z8RA 4WJG2 2D8WA 1K9OE 3T5FH 4ISIH 3V0XA 3SJ9A 5AFYH 2ZPQA 5AHGH 3PWCA 5JBTA 4GCHG 5CMXH 5I46H 3T29A 5A0BA 1DOJA 1ZLRA 3BF6H 3MH6A 1O3OA 2V3OH 3ZVFA 3SU2A 4LZ1H 4FUBA 2VIPA 2ZGCA 1W7GH 1DANH 4YTAA 5F03A 2J9NA 1DWDH 4K8BA 1O2KA 2BXTH 1ZSKA 4AB8A 2C8YB 5JB9S 3H7OA 3U8RH 1FPHH 1MZAA 1O2OA 2WPHS 1TPPA 4NSVA 3TVJB 1ELBA 4RKOB 1GJBB 4UE7H 4AB9A 3NZIA 2H5DA 3A84A 1ANBA 3M5OA 2A5IA 1CA0C 1GVLA 1B0EA 1QTFA 2D1JA 2B7DH 2Z7FE 3EE0B 4ABBA 3SV2H 1EX3A 2WPKS 1BCUH 2ZHWH 1HJAB 1LVOA 3HATH 1C2JA 3K9XB 3L33A 1JXPA 1OSSA 3UNSA 2BY7X 1MTNC 2ZQ2A 1P2KA 3KF2A 2Z9JA 1KXEA 1DX5M 1MUEB 4JZEH 2PGBB 4HI3A 5E2PA 4A1XA 1EAUA 2VWNA 3A89A 4YOGA 3CENA 2A1DB 4Y6DA 1OWHA 1MTWA 2EC9H 2ZFQH 5DKMA 3VFEA 1RXPA 2FTLE 2SNWA 3HPTB 2ZCKP 2R0LA 1O5AB 2ZU3A 1GHAF 3GY2A 2ANWA 1V2UT 1NTPA 1PPFE 2B9LA 3BG4C 4CRDA 2ZHEH 1CT2E 4AYYB 1K21H 1PPZA 4ZH8A 4ZHAA 4JYTA 1TLDA 2BX4A 1C5QA 3LOXA 4JZDH 1MU6B 2TIOA 1GMCF 3BG8A 1SGQE 5DG6A 2P8OC 3AAUA 2ZDAH 1SOTA 3BTWE 5C5OA 3RLYH 1UTLM 1P2NA 1SGYE 2ZDMA 3PM3A 5FHTA 3LGWA 5JYIA 3UOPA 2AH4X 4CHAC 1H8DH 4I33A 2AS9A 2PW8H 1G2LA 4AFZA 1SGTA 1KLJH 3RXOA 1N1LA 4YM9A 3A7VA 3M37A 3E90B 1IOEA 1TRMA 6CHAC 1M9UA 1P02A 4UFGH 3S9AA 4PROA 1EQ9A 2P3UB 1T8NA 4ISNA 4SGBE 1LKBA 1CGJE 3PMAB 2NU0E 3SGBE 2UWOA 3A7WA 4CREA 2W7SA 1ZJKA 1W8BH 1ARCA 9ESTA 1MTSA 1HAVB 1OYQA 1AGJA 3ZZ9A 3A82A 1YCPK 4FUGA 3RXMA 4B76A 3PV4A 1MQ6A 5AFZH 3EYDA 4KTUA 5JBBS 4KP0A 2GZ8A 4FUEA 1UK4A 4X6NA 2QA9E 2NU1E 1A7SA 2R0KA 1DSUA 4YT6H 1QQUA 1GJDB 1BUIA 5A8ZA 2ALPA 3RXAA 2BB4A 1K2I1 1YPMH 4A7IB 2TPIZ 2CHAB 1O2QA 3BTEE 7LPRA 2SGEE 2PR3A 2WYJA 3SBKA 3TGKE 4AZ2B 2C93B 4U2WA 1FY5A 1TPAE 1A2CH 1O2PA 1P57B 2F9UA 1PJPA 4JZ1A 3VB7A 1SGFG 4X1SU 4B2BA 1AD8H 5IDKA 3ZZCA 1C2GA 4H42U 8GCHF 2VIDA 4JK5A 1BA8B 1P8VC 3SO3A 2UUKB 1SQAA 4ABAA 4DVAU 4IMZA 5A8YA 1T8MA 1XUKA 3E91A 2H6MA 4AG1A 1YC0A 2SFAA 1DWBH 1O2UA 1O3HA 2ZZUH 3SNBA 3T28A 3E1XB 4B73A 1WV7H 1D3QB 1SGCA 3ZZ4A 3TGJE 1C5WB 2WPIS 1Z1IA 1WUNH 1QJ1B 2XBYA 2SGQE 1OWJA 3SUGA 1EJMA 1IQIA 2Z9GA 1WBGB 2UWLA 1TOMH 3BTKE 4ABGA 1C5TA 2XXLA 4FVDA 1V2KT 3AW0A 3RXGA 1GG6B 1IQMA 4CH8B 1TPSA 1H9LB 1RIWB 1NS3A 4I8KA 3HK3B 1AI8H 1C5VA 1MZDA 2PUQH 1TQ7B 1O37A 1T8OA 1S6HA 3URCA 5GXPA 1TGCA 3RXPA 3NUMA 4NCYA 4FUHA 4B1TA 1NC6A 4B75A 3RXFA 4BAKB 1C5XB 4GHTA 5DP7A 3HK6B 1GMCG 3P8NA 3NXPA 1EPTA 3O8RA 1C5YB 1YGCH 2P94A 4ZXYH 2V35A 1LHEH 1XXDA 1O2NA 4QT8C 1VJ9U 1YPLH 1WTHD 3OYPA 1XKAC 5LPFA 1AVWA 3QUMP 4WF8A 1UVOA 4LK4A 3D23A 1O3JA 2OLGA 1JRSA 1LHCH 1SLWB 3QO6A 4INKA 1HBTH 1HAPH 5FCKA 3D65E 1CGHA 1SMFE 1C1WH 3A7TA 2GZ9A 1YBWA 3PMHB 7KMEH 3ZYDA 4A6LA 1VGCB 3CS7A 1MAYA 2Z94A 1AWHB 1J17T 2BDIA 2Z3EA 4OGXA 2BLWA 3C27B 4JK6A 2BD9A 1F2SE 1U6QA 3VGCB 1P9UA 1QA0A 4MVNA 1EZXC 1W3CA 2RDLA 1T4UH 1ELEE 2IJOB 3GOVB 1O2TA 3BV9B 3RXEA 1H1BA 2ZHQH 4NA7A 4I8JA 3L3TA 1A3BH 1O33A 1TBRH 4LOYH 4B2AA 2BDCA 1HAOH 3SNAA 2R3UA 1Z7KA 1HRTH 1V2RT 1F0SA 1P2QA 5HM9A 1ZPZA 3GDSA 2XRCA 3A7XA 1TGTA 1G2MA 1QQ4A 2ZPRA 4K69A 2IN2A 1C5SA 5DGJA 5EODA 1BQYA 2ZQ1A 1HCGA 4WWYA 4BTIB 2Y5FA 1EZUC 1JBUH 3ZZ6A 4INLA 3SJKA 2FZZA 4FVBA 3GDUA 3U9AH 4CBNA 1MKXK 4K60A 4BNRA 3U8TH 4GLYA 3RC6A 3PLBA 4JMYA 3RU4T 1WCZA 3WY8A 2SNVA 5J4QA 1VCWA 1J8AA 1EB1H 1O2JA 4KKDA 4D7FA 4Q7YA 2XC4A 2QXJA 3RXJA 3ZZ7A 3SUEA 3UUZA 5AF9H 4O3UA 3RLWH 4BTTB 1MKXH 3GCTF 2ZPSA 4Y8XA 1GBBA 2BY9X 1E34B 1AE5A 1RFNA 2J38A 1TBZH 1HFDA 3T2NA 5HXFA 3UWJH 1J15A 1F0TA 1RD3B 1UK2A 3M61U 5JPMH 2W7UA 2RA0A 3FP8E 2BOKA 4A92A 1RIWC 1ESAA 4XBBA 1C1SA 1TBQH 1SI5H 3PROA 4UD9H 1HJ9A 1XUFA 3KHVA 1A61H 4AORA 1C2KA 2B8OH 3EQ0H 3E3TA 2CJIA 1NT1A 1S82A 2O8UA 4GAWA 8ESTE 1KXFA 3QX5H 1DT2A 2FM2A 2PV9B 5LPRA 4LZ4B 5B6OA 2BYAX 1AB9C 3B9FH 3MH5A 3RXUA 4DG4A 4WXVA 1DICA 4HTCH 1FONA 1WQSA 2Z9IA 3SI3H 4RKJB 3ODFA 5TCAA 3CP7A 3LGYA 1GVKB 2GV6A 2ZDVH 3S9CA 2QXGA 3TIUA 3UTUH 2ZWLH 2XYAA 1FY4A 3AVZA 2G81E 1C5LH 2GCTB 3I78A 3SV7A 4X1NU 2W5EA 1DWCH 3RM0H 3ZZ3A 1TWXB 3LC3A 1MTVA 1EUFA 2HWLB 4JYVH 5C1YA 1MD7A 3LGUA 1F92A 3OY6U 2BDYA 4ZKNU 1GHYH 2G55A 4CRCA 2CXVA 2VH0A 4YO9A 5FX6A 1TNIA 1BZXE 1CO7E 1P11E 4IC5A 1GI5A 2H9TH 1SPJA 1KY9A 3GCOA 2YOLA 5GIBA 1HYLA 3TH4H 1QB6A 4M7GA 3GY6A 2BM2A 3PLKA 1CHGA 1HLTH 2XWBI 1QRXA 5F8ZA 3BEFB 2AMPA 3TJVA 1QY6A 2BDAA 3E8LA 3W95A 1S5SA 2ZHFH 2JH6D 2C8XB 4I8LA 2V3HH 2FP7B 3PWBA 3RC4A 2FESH 1H8IH 5FPTA 4GUXA 4WH8A 1A4WH 3FVFB 3N7OA 3OTJE 3Q3XA 5CHAC 1TYNA 3OY5U 1CVWH 2OCVB 2A2XH 2ZECA 3SZNA 1G3DA 2XBXA 5DP8A 5A2MH 3UY9A 2Z3DA 5PTPA 4BAHB 1W10U 1GI2A 3SU4A 2BVSH 7GCHF 1HXFH 4Q80A 2Z9KA 1YPGH 2HOBA 1NFYA 3PMJA 1FAKH 1H9HE 1O2LA 2P3FH 4I31A 4FU9A 4U32A 5DJ7A 1NFUA 1CSOE 5T6GA 4TY6A 1EJNA 5C1UA 1D6WA 3GYLB 2VB0A 2G52A 1F5LA 4K2YA 1AWFH 4OS2A 1UTMA 5CE1A 3MO9A 4Y11E 1SLXB 3U98H 3ZVBA 1A5GH 2JH0D 4X8UH 1YCPH 4O97A 4A1VA 1FN8A 2K1QA 1O35A 2GT7A 6ESTA 1ID5H 4XFQA 1V2JT 1K1JA 1MU8B 1C1VH 2CMYA 4X1RU 4YZUA 4MPVA 3GICB 2AGGX 1V2QT 1K1LA 3MNSA 1SFQB 1ZOMA 4K1SA 4X6MA 1C5OH 1D3PB 3TU7H 3EAJA 2ZFTA 1S0RA 5T6DA 3UR6A 4NWKA 4Q7ZA 1HUTH 1BIOA 2VU8E 2BY6X 1CA8B 1UCYK 4H6SB 4AGJA 1GDNA 3LONA 2PSXA 5F6MA 4IN2A 3M5LA 2ZFFH 4NFEA 1UCYE 1TNJA 2CF8H 2BZAA 2WPMS 2PTNA 4WXIA 3VPKA 1ZTKA 2QIQA 4X2WA 1C5UA 3Q3KA 4CRFA 3QZQA 2AFQB 2UUJB 1KTSB 1DY9A 1P2JA 2Z9LA 1G32B 1F5KU 2TGAA 1DFPA 4CRGA 3Q76A 2C8ZB 3KQBA 4RSPA 1L1NA 4X2XA 1OPHB 2H5CA 3FP6E 4ZXXH 1SGRE 2B5TB 1TFXA 3SV8A 4XBCA 3PO1B 2GCHG 1O2MA 2EA3A 2JETB 2G8TA 1QB9A 1GWAA 2ZGXH 1UTOA 1D3TB 2BDGA 2JETC 4B71A 2CF9H 2FMJA 1QRZA 1A3EH 1YLCA 1ZSJA 2AIQA 4Y0YE 2BLVA 1OWIA 1TALA 1A0HB 4MPWA 1S83A 5EQSA 3SJ8A 3A85A 3PMBB 3FP7E 4THNH 1ABJH 1IQGA 1C2IA 1O5CB 1W0YH 1ZPBA 1PQ5A 1QBVH 1G3CA 3QDZB 4AGKA 3CS0A 2Y5HA 2BY5X 2J34A 1OS8A 2I6QA 5ESBA 1KXAA 1P2IA 5F8XA 2BDHA 1O2VA 1TNKA 3P95A 2FYRA 3HKJB 1YPHE 4OS1A 3LGIA 1AKSA 1GI4A 1YPKH 2BDBA 3TLOA 1BJVA 3PYHA 2OBQA 1BTWA 5EQRA 2UUYA 1ZRKA 1AVGH 5L30H 1HJAC 1VGCC 2ZTZA 1V6DA 3RXTA 2BD7A 1BRAA 4NZLA 1BB0B 3TJOA 3K6ZA 3ODDA 1Y5BT 4D8NA 1CT0E 4NIVA 4DOQA 4K5ZA 1V2VT 1GVZA 2A31A 1G9IE 1BTXA 1DY8A 1MD8A 2STAE 1RTLA 1C1OA 1ZMLA 1GI7B 4BAQB 4K1EA 2KAIA 3NCLA 1K1MA 1O3EA 3BTHE 2PTCE 3KCGH 1DXWA 4MPUA 2VWMA 1OP0A 4Z0KA 1V2PT 1C1NA 4ABEA 3MNXA 1E35B 2A2QH 3ELAH 2ZO3H 2ODQA 1GHXH 1BTZA 4X2VA 1SGPE 1KYNA 3F9FA 1GCTB 3P17H 3ZZBA 3LJJA 1GHBF 3LU9B 2LNCA 1QBNA 3GCTG 1ZPCA 2ZFRH 1UTQA 2STBE 1H9IE 2NU2E 1LMWB 2VNTA 5ETXA 4F4OC 1B7XB 1K1PA 1XUJA 3D62A 4MPXA 1BT7A 2C4FH 4KTCA 1SLVB 2AMDA 3ZVCA 2VIVA 4AFQA 1HXEH 1O31A 3GY8A 1EP6A 1XMNB 1GBAA 3K2UA 1GI0A 2GX4A 2FODA 2J92A 1OWEA 2ZCLP 1N8OC 3PO1C 5J4SA 2IOTA 1C1MA 4Y8ZA 1NRPH 3TK6A 1GBMA 1MQ5A 5SGAE 3KIDU 3SJOA 2HPPH 4H4FA 5A0AE 2F9OA 1Z8GA 4B2CA 4X0WU 1BOQA 4I7YH 1L4DA 4YOJA 1LPKB 1HGTH 2OQ5A 1THPB 1KDQB 4IW4E 3SUFA 1FXYA 1RGQA 1DUEA 2TBSA 3LIWA 4IN1A 1ZTLA 1OP8A 3KQCA 1Z71A 1EP5A 4DIIH 2QYIA 3MTYA 3SV9A 1QR3E 1KSNA 3A86A 1FI8A 1UJ1A 1O2WA 3BTME 5FBIA 6CHAB 1TA2A 2W3KA 1YP9A 2F91A 2ODYB 3ZZAA 1P2OA 4CHAB 4FUJA 2FEQH 1Z8IB 2WPLS 1EKBB 3MU0A 3TH3H 2TGTA 2ZNKH 2BXUH 3LGVA 1C2LA 1TA6A 4NIWA 3TITA 3O8BA 1DE7H 3RDZA 1QBOA 1NFWA 1QJ6B 2FO9A 3UR9A 1CQQA 4I32A 3ZVEA 3SHCH 1AKSB 4FU7A 4LXBH 3BEIB 1MAXA 1C5ZB 1C4V2 1C9TA 1GI9B 5EG4A 1O2SA 5ABWA 4D9RA 2FX4A 4DURA