3GY3A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy3A02
1LQEA 1TPAE 3TJNA 2HNTE 1TGTA 2ALVA 2FMJA 3PWCA 1C9PA 5T6FA 2VINA 1MH0A 2BDGA 2FZZA 2HALA 2Y80A 3V12A 1T8NA 4NG9H 4LK4A 4ABFA 1HUTH 1U6QA 2P8OC 1TALA 3FP6E 3P70B 4OS7A 2B0FA 3GY7A 1Y3XA 3SN8A 1AZZA 1FUJA 1BHXF 4MNXA 2NU1E 2A2XH 6GCHG 1SBWA 3TNSA 3PM3A 1GHAG 5ESTE 1AFQC 4I7YH 3EA7A 4B76A 2BLWA 1HPGA 3RMNH 1L1GA 2PKAA 2ALPA 3KGPA 3PTBA 3RLYH 2RDLA 4BAQB 3OSYA 3RC5A 1UCYK 2ANKH 1Q2WA 3VGCB 4ABBA 1J14A 2PGQB 4Z6AH 3K9XB 3LGIA 3BG4C 3A81A 1WTHD 2FI5E 2VIQA 1ESTA 3SU6A 3BTTE 1Z1JA 1UCYH 1C5NH 4B2AA 1UTJA 4BAOB 1MKWK 1TNKA 1CT0E 4Q80A 4YLUA 4JZEH 3LGTA 1TRYA 2VWNA 4GHTA 1IQIA 1EZUC 2C4FH 1TWXB 2SGAA 1C5UA 3TNTA 2OBOA 2BDAA 1PPCE 1GI5A 1MKWH 1O35A 6CHAB 4FU9A 5JBCS 3T62A 1OX1A 4MPWA 1GGDB 2C90B 4XFQA 2GZ8A 3S9CA 3MH5A 3SOSA 2VH0A 4INHA 2GV6A 5DO4H 1LKBA 3F9FA 1AO5A 3RMMH 2XBYA 5C1XA 2GX4A 7GCHG 1GBTA 1K1IA 2GCTC 1E34B 1P03A 4A5TS 3BEIB 3S9AA 1UVTH 1GHYH 4KELA 3KHVA 5IYTA 1DITH 1WYKA 1UVUH 3STJA 4ABJA 1QJ6B 1W3CA 1UTPA 2J34A 3ENSB 1MMJN 2AMQA 1YPJH 3Q3YA 5HM2A 2BXUH 1MD8A 5F8ZA 2FOFA 2ZGXH 1MTNC 1G3BA 1O2ZA 3BG4B 1BMNH 3SJOA 2F83A 2WUBA 3TITA 3RXUA 3P17H 1P8VC 1AUJA 1NRSH 5A8XA 3A7WA 3SV7A 1F92A 1SR5C 5FX6A 2XC5A 1ORFA 1GI7B 1DY9A 4TWWA 2A5IA 2BD8A 1OP2A 4X2VA 1O0DH 1SHYA 1IQLA 1F5RA 1EAUA 2ZFFH 2ZGHA 1LVYA 1O5CB 1A7SA 1HYLA 2H1UA 4H6TA 5LH8A 1ACBE 4IS5A 2A32A 3FZDA 1GJ5H 4BXSA 5B6OA 4JYTA 2ZIQH 5BPEA 3P8OA 1HAGE 1YPHE 2R2WU 1IHTH 1HCGA 2DUCA 2P3UB 1HXEH 4ZHLU 3TGJE 3A82A 1P2IA 3LJOA 3GOVB 9LPRA 1TAWA 3QWCH 4Y7BA 1GMHF 3GYMA 2Z9JA 1Y3YA 4K69A 1NFYA 1JIRA 3TH3H 1AFEH 3ZVCA 2F9VA 1ABIH 1BQYA 3QTOH 2CF8H 1E36B 1TLDA 3MO3A 1C2HA 4Y7AA 9ESTA 2OC0A 2AFQB 2TGAA 1HAPH 1SG8B 3VFEA 1MTNB 2GTBA 3BIUH 2CJIA 4Y0YE 1ZSLA 1CQQA 1TX8A 3Q77A 3SUEA 4ASHA 1YPKH 1L1NA 1NRNH 2GD4B 2VIWA 4NFFA 3P95A 3V7TA 3LONA 2EA3A 2P59A 1ZPZA 3SNAA 1A0LA 2G4TA 1BBRK 5FCRA 2FDAA 3A85A 2Z3EA 2TGPZ 1EB2A 3PMBB 2FOBA 1K1OA 2XRCA 1C2FA 1YBWA 3P8GA 1NRRH 1BBRH 1HJ9A 4LZ1H 2UUFB 3O8DA 1W11U 3RU4T 1QQUA 1UMAH 1WBGB 3SUFA 4YT7H 1SLXB 1GJ6A 1C5OH 5T6DA 1C2EA 2BYAX 2SGEE 3ODFA 1Y3VA 1SGYE 2ZTXA 1AVXA 1G3CA 5GCHF 1ETTH 2FM2A 4O03A 3ZZCA 3ZZ7A 2XTTB 2BDCA 1GCTB 1TRMA 1A2CH 2XBWA 1TPOA 1BRBE 1RIWC 1GBFA 2ZPRA 1WTGH 1O5EH 4Q7YA 1GI3A 2BB4A 2GCHG 3A86A 2VWMA 1HAVA 1NY22 3MI4A 4IC6A 2BDYA 1F0SA 2WV4A 1UHBA 5DJ7A 3MH6A 4NZQA 2ZHFH 4ZH8A 4YOJA 5F6MA 1GI4A 1T4VH 1SGTA 1CHOF 4YOIA 1C2KA 1J17T 1GVLA 2XBVA 3PWBA 3RXJA 3SU3A 3ZVEA 3BF6H 1SFQB 4NFEA 1AUTC 3ZZBA 2FTMA 4U32A 1TQ7B 3TH4H 4O97A 1NROH 4JZIA 3VB5A 4RKJB 2WV5A 1FLEE 3ZV9A 4U01A 2F9NA 1O3GA 5A0AE 2H6MA 4AX9H 1C2JA 1C1QA 2Z9LA 5DPAA 2BLQA 2W7UA 1SMFE 1O2YA 1YM0A 3EA9A 1GMHG 1FZZA 3A89A 3VEQB 4JZDH 3K65B 1C1UH 5AFZH 4MPVA 2PSYA 1AWFH 3T29A 2G5NA 1AIXH 3BTDE 2BQWB 2BY7X 4CR5A 1HAYB 1N8OC 1GBAA 2VVUA 4NIYA 3TK5A 1GHZA 4HI3A 8GCHG 3A8AA 3CENA 1BRAA 1DWEH 3HGNA 1FIWA 1O2XA 1K22H 4AYVB 2P93A 1L2EA 2ZTZA 1A3BH 1TB6H 1EPTA 1KXBA 2BY5X 1Z8RA 1S84A 1CA8B 2G52A 3RMLH 1P11E 1ZLRA 2O9QA 3LC5A 1MTWA 1TPPA 5C1YA 2EI7A 4Y10E 2D1JA 1VGCB 4B2BA 2Y6TA 3TJOA 3SJKA 1NPMA 1GJ9B 1HLTH 3A8DA 2XC4A 3QGJA 1EJNA 4NSVA 2FWWA 1YPEH 4JCNA 1NRPH 2OD3B 2Q1JA 4FUJA 1V2KT 1HBTH 3KEEA 3ZZ4A 1O2MA 4RSPA 3PLKA 1C5MD 1XUJA 1FDPA 5GCHG 4RN6A 4VGCB 1D9IA 1TGNA 2IPHA 1NESE 3SV9A 1C5ZB 3ZVBA 3V3MA 4Y79A 4H6SB 1GG6B 1DOJA 3ZVDA 2ZECA 2JH5D 2XXLA 5C5OA 1Z8IB 4JZFH 1P2OA 3PV4A 1CSOE 2EI6A 1Z1IA 1BTXA 3L33A 4FUIA 4OS1A 1MCTA 2FX4A 2XWAA 1S0QA 4DT7B 1UK2A 3V0XA 2ZI2H 2ILNA 1IOEA 4AFZA 4LOYH 1P09A 2FI3E 2JETB 3A87A 2Z3DA 1CHOG 2YNBA 1LTOA 1SQOA 2FOHA 2IN2A 2D26C 4GHQA 2R2MB 4AORA 4MVNA 1C1NA 1G2MA 1ZR0A 4X1RU 2FP7B 1Y5BT 2BMGB 2BD2A 5TJXA 4AG2A 2ZPSA 3GCTF 3DT0H 5DKMA 3UR9A 3ZVFA 1Y5AT 1G3EA 3LT3A 1AKSB 4UFEH 1SSXA 1YGCH 2ZU1A 4JYUH 1BUIA 2DE9A 4CR9A 3TGKE 4TWYA 1QB6A 4I8HA 2F9BH 4AFQA 3KL6A 1EJAA 1PPFE 1FMGA 3RDZA 2A1DB 1ANBA 5JBBS 1LCYA 1N6YA 2TPIZ 3M5NA 1GHVH 3MH7A 3QN7A 1K1NA 1P3CA 1YPLH 1GI1A 2ZCLP 2QC2A 4DG4A 1GJAB 4YOGA 2FIRH 4XBBA 3O8RA 3BTHE 3EAJA 5A8YA 4AFSA 3GY8A 2SGDE 1G3DA 4YLQH 4DJZB 1W0YH 1GDNA 1O31A 4F49A 1O39A 3K2UA 1GVKB 5T3HA 1ZZZA 3NWUA 5EQSA 4BAKB 1KLJH 2ZPQA 3IITA 1EXFA 3ZZ5A 1QL8A 3EQ0H 4Y76A 5EOKA 2VNTA 1O2IA 1PQ5A 1AU8A 3VB7A 1CBWC 3RXQA 1GHXH 1TX6A 5E8EH 2BY8X 1B7XB 1KYNA 1ELTA 1KXFA 2VGCC 3EA8A 3O8BA 4YT6H 2GVFA 5EPYA 1GDQA 1FPCH 1W14U 3ELAH 5DP3A 1HAXB 1SGCA 1TQ0B 1NTPA 4AB8A 1DICA 3RXTA 1C5QA 1JRSA 3I29A 3A7VA 4ABDA 3ATLA 4Q2KA 1XXDA 1E38B 1W10U 1ZYOA 2C8XB 2WPLS 2HLCA 1ZTKA 3Q3KA 1W0ZU 2ZDAH 2J94A 1DWDH 2FODA 1BT7A 4UEHH 4KTCA 1C1TA 1QA7A 2Z7FE 3U8RH 1O5BB 3TJUA 5FPYA 1FAKH 1P57B 3M3SA 3SUGA 4B75A 5EW1H 1GI0A 1Z6EA 4ZXYH 2A2QH 5JB9S 2FYRA 3FFGA 3VGCC 1AHTH 2F9PA 4X8UH 3UPEA 3RXHA 4ZMAH 3UY9A 2BLVA 1C5RA 1HIAB 3P6ZB 5DK1A 4XBCA 1K1MA 1C1MA 1C2MA 4MNWA 3HKJB 1O2WA 2G4UA 1H9LB 1QCPA 1UK3A 1SGNE 3MMGA 4WJG2 2Y82A 2GT7A 3S7HB 2ZDLA 1LO6A 2AIQA 2G55A 2PKSB 3A88A 5FBIA 1UCYE 4Y6DA 3LH1A 4MTBA 1GPZA 1AB9B 1BTZA 4WY3A 3PLBA 1V2VT 1MTSA 4AGKA 1VJAU 4LXBH 2VVCA 3EGKH 3E16B 3LJJA 5L30H 3M3TA 1GGDC 4ABGA 5H4IB 1BB0B 4INKA 2D2DA 2H5DA 5FAHA 3NCLA 3RXDA 1C4Y2 3H5CB 2HNTF 1XUGA 2XCNA 1HFDA 4JMYA 2TBSA 3P8NA 3TPIZ 3JZ1B 4WMEA 4INLA 4MNYA 5F8XA 2QIQA 2WPMS 1V2LT 3HKIB 2THFB 4R8TB 1KXEA 3I78A 3TVJB 3O8CA 4H42U 1TGBA 1V2QT 2PKAB 1OS8A 1D3QB 1NC6A 2A4GA 1AWHB 1LVMA 2BD3A 3AASA 1TA2A 3UIRA 4Z0KA 4K2YA 2HVXA 3BIVH 4D9QA 2R3UA 1S6HA 2O8TA 3MHWU 4OS6A 2V0BA 2QAAA 3F68H 3SJ8A 3DFLA 4NIWA 4KTSA 2W7SA 2PTCE 2A4OA 1WOFA 2GGVB 3RXRA 1MZDA 4WWYA 3E0NB 3VB3A 3RXAA 1O2NA 1OPHB 2HNTC 2FX6A 4E7RG 1IHSH 2UWPA 3ZVAA 1B0EA 1O2OA 1BTWA 6ESTA 1PPHE 4B2CA 1NFWA 1THSH 1VR1H 1SVPA 4ISNA 2UUYA 1TA6A 2BOKA 1BTUA 2ODYB 1MTUA 3F1SB 2PUQH 1AE5A 3E6PH 1OWKA 4RKOB 1O2UA 3PB1E 1BZXE 3W94A 1V3XA 2UWLA 1ZMNA 4B71A 5FPTA 5JBTA 1PPBH 4WMDA 1QBOA 5T6GA 3MU1A 1TMUH 1Y5UT 3SV8A 1ZPCA 1NU7B 1ZPBA 4FVBA 4BXWA 3LDXH 3GICB 3RXKA 5FCKA 1PPZA 2AIPA 1N1LA 1NO9H 5A0CA 1O2PA 5K0HA 1UVPA 5EXLA 1RTKA 2P3FH 4X6PA 1J16A 1O2TA 1AN1E 4ZXXH 2G81E 2ZWLH 3QZQA 4R0IA 4KGAA 2D8WA 1Y3WA 3SI4H 4AZ2B 2ZU3A 2C8YB 2I6SA 1YF4A 2K1QA 2PR3A 2VIVA 4K3JA 1O3OA 3URCA 1XVOA 7ESTE 2FTLE 1CVWH 1L4ZA 1ETSH 2HPPH 4MLFB 1TYNA 4E05H 3SGBE 1C5TA 2GMTB 2H9HA 1THPB 4ZKSU 4OS5A 2QCYA 1TX7A 1HB0B 1QA0A 3Q76A 1OWJA 1SGFG 1UVSH 3BTFE 1F7ZA 1SGEE 3QZRA 1GBMA 3ATWA 5LPEA 3BV9B 3D49H 1LQDB 3KF2A 1DLEA 1FY3A 4CRFA 4UFFH 5C1UA 1O3DA 2Q6FA 4CRDA 1MBMA 4B1TA 2AGGX 1P02A 3A80A 1NS3A 5J4SA 1V2JT 5GDSH 1BBRE 1OWHA 3ZVGA 2R0LA 1O2GH 1V2UT 1P9UA 1YCPM 1Q31A 4FVDA 3KQEA 1IQHA 2LPRA 4K1TA 4XDEA 1HGTH 1VZQH 3RU4E 4WF8A 1F0TA 3UR6A 3DA9B 3LC3A 1GCTC 4Y71A 3KIDU 1C5VA 1ELBA 3EYDA 4DVAU 2OINA 4CBOA 2Y7ZA 1XUIA 3Q3XA 2ZGJA 1P2MA 1HV7A 1OOKB 3LGYA 4B73A 4O3UA 1NFUA 4OGXA 2OP9A 1GBLA 2CV3A 1C2IA 2GZ7A 4ABAA 1O2SA 3MNXA 2TGDA 1KDQB 3QO6A 5CHAB 1HAIH 1CE5A 1DX5M 4HGCA 4PROA 2IJOB 1VITF 1ZGIA 5EGMA 4AG1A 4BAHB 2F9OA 2GDDA 1EOLA 1OP0A 4YM9A 1BCUH 1C2DA 2BVXH 3KQDA 3KNXA 3KQCA 1WQVH 5ETXA 1O5DH 1O33A 3LKWA 1EX3A 1PPGE 1XM1A 3U69H 1H9IE 2QXGA 2AMDA 2XWBI 4I32A 1O5GH 1DVAH 1YC0A 4ISIH 2V35A 4MPUA 2SNVA 4XSKU 1YPHC 1UTNA 1OKXA 1W7XH 2GT8A 3M7QA 4AOQA 3N7OA 1JMOH 4TY6A 1EJMA 3QTVH 4KTUA 3SW2B 1TFXA 1O3LA 1GVZA 4A92A 1LPGB 2FOEA 1PJPA 4FUCA 1MKXK 1ZMLA 2JKHA 3U1IB 1S82A 2J38A 3ZZ3A 3TK9A 1VCQA 3NUMA 3QX5H 3ATKA 4ISLA 1QRWA 5E0HA 4HFPB 4D7GA 5GPIB 3LU9B 5C2ZA 2FLRH 2VIOA 2LNCA 5SGAE 1GBCA 2W3KA 1MKXH 1BTPA 1V2MT 2NU0E 1ELDE 4MNVA 1J9CH 2SGFE 3IG6B 1UHBB 2ZGBH 3MNCA 2VU8E 4NIVA 3KN2A 1IQFA 2XW9A 3EE0B 1C5YB 1KY9A 1XUFA 4I31A 4MPXA 5A0BA 2OQ5A 3PMHB 1VGCC 4CH8B 2BLOA 1SGRE 6LPRA 1KXDA 3RMOH 3MOCA 4U2WA 2A5KA 2XYAA 3ITIA 2VIPA 2ANWA 2UUKB 3SO3A 2STAE 1XX9A 4CRAA 5HGGA 1GBHA 1DPOA 1GMDF 1GJ8B 2SNWA 5JBAS 1GBKA 1VITH 5EXMA 5EU8A 1A1RA 1IQGA 1L1JA 2HRVA 1A61H 1KLTA 2OC1A 1MD7A 2XBXA 1B5GH 3RXFA 4DCDA 1C4V2 1VCPA 2V3OH 3M35A 4X1SU 3E8LA 4ISOA 4O9VA 1TNGA 2VWLA 3RXIA 4VGCC 2ZDMA 5CMXH 1C1RA 2Z3CA 3B8JA 1K1PA 4UD9H 4IN2A 5GJ4B 1GG6C 5EPNA 4BNRA 4TYDA 3FP8E 3MWIU 1Z7KA 1O3FA 1P2KA 3ATIA 2GDEH 2P95A 1IAUA 2WPKS 3UTUH 1Z8JB 2ZGCA 5CE1A 4WH8A 2JETC 1XMNB 1EPTB 1PPEE 3TU7H 3DD2H 1A46H 1C1SA 1VITG 1HNEE 1Z8GA 1BTYA 3A84A 1QGFA 1NRQH 2WPJS 1TMBH 2BZAA 4GCHF 1GI2A 2BY6X 2ZFQH 1T31A 2ZZUH 4TPIZ 1FY5A 4SGAE 1O3BA 1SHHB 1TPSA 2VVVA 4UE7H 1NU9A 3F9HA 1DM4B 1KXAA 1HAZB 5JDUB 3UNRA 1ZMJA 2OC8A 1GI9B 3I77A 1AMHA 1FJSA 2XNIA 4TY7A 3SU0A 2VJ1A 4ABEA 4YO9A 4CRGA 3GY5A 3GISB 1MQ6A 1T4UH 1KSNA 2HWLB 4JZ1A 1SLWB 1SI5H 1EATA 1S6FA 2BVRH 5FXLA 4CRBA 1DSUA 3R3GB 1E37B 1P10A 2BD5A 2AH4X 3RUOA 1H4WA 3S7KB 2ZA5A 1O3MA 5BRRE 4Q7XA 1CO7E 2ZF0H 1C1PA 2AMPA 1T8LA 2EI8A 3UNQA 4ZROA 4CREA 2ODPA 1TONA 1HDTH 1BJVA 2ZHEH 1LHCH 3LH3A 1O5AB 2ZDKA 4ZHMU 3BEUA 5TCCA 4NWKA 1XVMA 2A7CA 3GY6A 3MU8A 1SLUB 4X1QU 5HM9A 1C9TA 1EB1H 5C5NA 1CGJE 1AVGH 4XE4A 2A7JA 1BMAA 2SGPE 1O3NA 2A31A 1DFPA 1HJ8A 2R0KA 3A7YA 2B5TB 3C27B 1C2LA 4MDSA 2QY0B 1CA0B 1O2HA 5LPFA 1KTSB 1O5FH 3ZZ8A 3RXSA 1VJ9U 4XBDA 2DE8A 2HPQH 1O32A 3NK8A 5AF9H 2HGTH 4WVPE 4QT8C 4DY7B 3FAOA 3PO1B 1GI8B 3RM2H 2EC9H 2A4RA 1OWIA 2O8LA 3BSQA 3PROA 2BZ6H 1CGHA 4YESB 3KCGH 1ESAA 1ID5H 1NT1A 1FPHH 2A0QB 4UFDH 3TH2H 2KAIA 2FOGA 3CS7A 5DP7A 4CHAC 1D6WA 4JK5A 5J4QA 1G32B 4ESTE 1DWBH 3NZIA 1LHGH 1QR3E 3M5OA 2STBE 1AVWA 3FP7E 3HK3B 1O2JA 1SLVB 1T7CA 1N6XA 1SGIB 4BTTB 5E0GA 1W2KH 1DSTA 1KLIH 1TNJA 1G2LA 1P0SH 1C1OA 1SGQE 3UWIA 3A7ZA 1AD8H 4GCHG 3L3TA 2PKSC 1QNJA 1O3JA 1L4DA 1AB9C 1W8BH 1YYY1 4HTCH 1WAYB 1BRUP 1GWAA 2ZO3H 1RD3B 4X2XA 4IC5A 1TNHA 1O2QA 1JBUH 1EZXC 1XUKA 2YNAA 3MO6A 4NWLA 2ZHDA 1TGCA 4FU8A 1A0HB 1MUEB 4UONA 2WPHS 1SFIA 1FN8A 1P12E 1O3HA 1MU8B 5C20A 2OUAA 3UNSA 3VB4A 1QB9A 1DDJA 3RXCA 2Y5GA 3P92A 2C93B 3A8CA 1GJ7B 5GWZA 3UWJH 4XOJA 4FUBA 1QB1A 2CMYA 2YOLA 2F3CE 1X7AC 2QF3A 2BD4A 2OXSA 1LPZB 1IQKA 3GCHB 2Z6BD 3U8TH 3UQVA 4CHAB 1SQTA 4U30A 3ZV8A 2ZKSA 1O38A 4SGBE 2BX3A 3RXPA 2PWXA 1TBQH 4DW2U 3KQBA 1GBDA 3S69A 3ATMA 2BVSH 4NA9H 3MNSA 2BDBA 1ZHRA 3PLPA 5L2YH 3LPRA 1RS0A 2ZHWH 3LIWA 4FUFA 3F6UH 3BEFB 3UFAA 1C4U2 1V2NT 1K1LA 3M3VA 1V2ST 3QUMP 2CGAA 1EASA 4CBNA 3GCTG 1G9IE 1D3DB 1FIZA 2XC0A 2HOBA 5DP6A 4AFUA 2BOHB 4I8LA 1EP6A 5HMAA 1H9HE 4FUHA 2FESH 1Z71A 3BTGE 1V2RT 3M37A 4X2YA 1OWEA 4DOQA 3SORA 1BA8B 1FNIA 1ZJDA 4F4OC 3SJIA 1LPKB 1TGSZ 1RTFB 2Q6DA 1O2LA 2BDIA 1MBQA 2J95A 4I8JA 4B74A 3W95A 1PYTD 3H7TA 1GCDA 1OSSA 1QY6A 3MH4A 3SGAE 3D62A 3BTWE 1A5GH 2R9PA 4I8GA 1MCVA 4X6MA 4Y8ZA 2QN5T 5L6NH 3OTJE 2QXIA 3V13A 4KKDA 2UWOA 1ZTLA 3RP2A 4AYYB 1Y8TA 1SGDE 3MO9A 4AN7A 3RXMA 1UVOA 2P16A 3GDUA 4IMQA 1QQ4A 4BOHA 2SGQE 2AERH 5A2MH 3DFJA 4GLYA 1CT2E 4IW4E 1EZSC 1MAXA 1RRKA 1GMCF 3C1KA 5EODA 3GYLB 2FOAA 2BD9A 4Y0ZE 1LMWB 1MZAA 5DG6A 5E2PA 4IMZA 2GMTC 2O8MA 1HAHH 4A1TA 5LGOA 1CT4E 1P2QA 2XCFA 2AS9A 3VXFH 1J8AA 1SB1H 1O34A 1C5SA 3T28A 1O3PB 1KIGH 1QJ7B 1YCPK 1INCA 5C3NA 1CU1A 2GKVE 3TIUA 1YKTA 1C1WH 2ASUB 4LZ4B 3E0PB 3RU4D 1Q3XA 8ESTE 1F5KU 1QL9A 5F03A 1EUFA 1GJBB 1LVBA 3GDVA 1V2WT 1YCPH 1ARCA 2ZDVH 4JK6A 5LPRA 3SBKA 4NA7A 3NKKA 3ZZDA 1RFNA 1ELAA 1EP5A 1DT2A 2UUJB 1ZHPA 4BTIB 3K6ZA 3M7TA 4H4FA 3ZZ6A 1UTOA 3P8FA 1E0FD 2FLBH 3MYWA 2J9NA 2J2UA 2PUXB 1AQ7A 1HJAC 5EW2H 2W3IA 2TGTA 2A5AA 2P8OB 3GCNA 1S5SA 2ZFRH 2A45B 1V2TT 5E0JA 4BAMB 2Z9GA 4HZHA 2RA0A 5AHGH 2ZHQH 2H9TH 2OCVB 2ZU4A 4DGJA 5CHAC 2H5CA 1XKAC 4K8YA 3RXVA 5HYOA 2WINI 1NM6A 2O8UA 1IQNA 3BTQE 3SGQE 4X2WA 3AW1A 1AFQB 2QA9E 4ABHA 3B9FH 3FZZA 1DXWA 1O3IA 1SPJA 4CRCA 3RLWH 4O3TA 1SL3A 1EQ9A 3T26A 5PTPA 2NWNA 1FI8A 3SU5A 3T25A 4K1EA 2ESTE 2NU2E 1DY8A 1GHBF 3NXPA 1SOZA 2G51A 3E1XB 1F0UA 7LPRA 4IBLH 4D76A 2GCHF 4ZUHA 4YZUA 1SGFA 3F9GA 3GCOA 4GPGA 1PYTC 1QFKH 1QRXA 3SHAH 3DUXH 2F9UA 1ELFA 1H8DH 3ESTA 4MQAA 3TJVA 1W13U 1P01A 4ZAEA 1ABJH 1UJ1A 2P94A 1O36A 3TK6A 2P3TB 1A0JA 1AGJA 1SC8U 2C8WB 1BHXB 1ZJKA 1E35B 2V3HH 1WQSA 2VB0A 1GMCG 3UUZA 2J4IA 4D9RA 5EQQA 3OY5U 2WYJA 5C67A 4ZHAA 1GBIA 1HJAB 1FY4A 1Y59T 3G01A 1BITA 3S0NA 1O3KA 2A7HA 1FAXA 2GCTB 1D6RA 1QURH 4K5ZA 1THRH 4NA8A 1SQAA 4K60A 2J92A 1UTKA 1TNLA 4OS2A 1ESBA 1T8MA 1D4PB 3SV6A 1TMTH 2WPIS 3AAUA 3LGWA 1ZRBA 4Y8YA 1P9SA 1B0FA 2CN0H 3BG8A 2BXTH 1C5LH 2ZCHP 2Z9IA 4GSOA 1O3EA 2VIDA 8GCHF 3ODDA 3A7TA 1BDAA 2A4QA 1NFXA 1RGQA 4J2YB 3GY4A 3R0FA 4K1SA 5L2ZH 3SUDA 1SGPE 1KDQA 2IOTA 3PYHA 5E2OA 3VPKA 3TGIE 1A4WH 3RXBA 1ZTJA 3D65E 3FVFB 3T27A 3SZNA 1HXFH 1XKBC 3RC4A 4FUEA 3U1JB 1LVOA 5I25A 1OWDA 3URDA 5JB8S 2ODQA 2QXHA 4GVUA 2Y5HA 3SU4A 1WU1A 1DXPA 5AFYH 3GDSA 3VXEH 1LHDH 3SQHE 1FN6A 4ABIA 1JXPA 1RXPA 2EEKA 1OXGA 1YP9A 2FO9A 2GV7A 3B23B 4I33A 1O3AA 1EPTC 1GJDB 4X8SH 2ANYA 1EOJA 3PMJA 1PQAA 1HAVB 4UDWH 1H1BA 1D3PB 1ZRKA 2ZQ1A 3PMAB 1PQ8A 2QXJA 1V2PT 2OQUA 3RXGA 2JH6D 3NPSA 2B9LA 2ZG0H 3UQOA 4AB9A 5DP8A 5EG4A 1IQMA 1P06A 4WMFA 1Y3UA 1GJCB 2ZU5A 4Q7ZA 3A7XA 1GHBG 1G36A 1ANDA 1AZ8A 2FOCA 3BTME 1TOCB 2BQ6B 2RG3A 1EZQA 1DLKB 3SQEE 1JIMA 5TCAA 5F8TA 3U8OH 1QTFA 3OU0A 5K7RA 1QJ1B 2PLXA 2Y7XA 3SJ9A 4NCYA 3QLPH 4GAWA 1ELGA 3RC6A 1BTHH 1GBEA 1O2KA 1V2OT 3TLOA 3M61U 1SOTA 1TOMH 1DE7H 2G5VA 5JYIA 5EXNA 1UTMA 1JRTA 3BTEE 3MNBA 1ANCA 4ZKOU 1S0RA 3M36A 3MFJA 1BMLA 4KP0A 5IDKA 3AVZA 4UFGH 3SNDA 1AI8H 2BY9X 3GY2A 1K21H 2H2ZA 3QK1A 4OS4A 4A6LA 1S81A 1XUHA 1WSSH 2G8TA 1K1JA 5FBEA 4ZKNU 5I46H 2ZEBA 1O37A 3A83A 3HGPA 1EAWA 1KXCA 5ABWA 1CGIE 3JZ2B 2ZTYA 1C5PA 1C5XB 1CA0C 3MU0A 4A7IB 4ZKRU 1NZQH 3QGNB 4WXIA 2PHBA 1VCWA 3MU4A 3HATH 3QDZB 2QV1A 1BMMH 5ESBA 2BX4A 2TIOA 5GIBA 1RIWB 3RM0H 3PO1C 4X1PU 5GXPA 2O8WA 2BDHA 4JYVH 1F5LA 2ZNKH 1W7GH 1O3CA 1F0RA 1MTVA 3LGVA 3CS0A 3SU1A 1ELCA 1ZSJA 2AGEX 1QBVH 2PV9B 2B7DH 3M7UA 2ZQ2A 4X6OA 2WYGA 1GJ4H 3LOXA 3UOUA 1EAXA 2TRMA 4IGDA 1G37A 2BHGA 1ARBA 3ZZ9A 1O2RA 1QRZA 2RA3A 4Y11E 2JH0D 4K8BA 1NN6A 1UO6A 3UREA 1CHGA 1S83A 2VWOA 5A8ZA 5FPSA 4M7GA 4FUGA 1BOQA 3LGUA 3M5LA 3SI3H 1ZOMA 1EKBB 1K28D 1MQ5A 1RTLA 1ANEA 2QF0A 1GBJA 4A1VA 1V6DA 1O2VA 1KTTB 2FPZA 2GZ9A 2BTCE 2NU3E 1C5WB 2ZFTA 4D8NA 1QL7A 1TIOA 3MTYA 4AGJA 3E90B 2GP9B 1P3EA 3ZZAA 2FOMB 2H9EH 1YLDA 1LHFH 2Y81A 3AW0A 4X0WU 1GMDG 3MU5A 1H8IH 3VB6A 2B8OH 2Z94A 1N8OB 2M5TA 4BANB 1FQ3A 1FY8E 1YPGH 2ZDNA 2Q6GA 3T2NA 1GDUA 2ZP0H 3GY3A 2PW8H 1GL1A 5DP5A 1GHWH 2OC7A 8LPRA 1QHRB 2R3YA 4FUDA 3ZYEA 4DIIH 1FY1A 8KME2 1LDTT 5AVDA 2ZFPH 4ISHH 4NSYA 1DANH 1HRTH 2AGIX 2G00A 3SNCA 3A8BA 1J15A 2CHAC 2KAIB 2FXRA 1IQEA 1F2SE 2ZC9H 2I6QA 1DS2E 3GCHC 1GBBA 2ZFSA 1YLCA 4Y8XA 2QYIA 3SNBA 1MAYA 2ULLA 4X6NA 4WH6A 1TRNA 4YTAA 1JOUB 3STIA 3SV2H 1TBRH 2W26A 1P05A 1AKSA 1YPMH 1ZSKA 1ELEE 1OP8A 5FHTA 3Q00A 5DP4A 3PTNA 1K9OE 1OYQA 3OX7U 5DP9A 1MU6B 1C1VH 1DUAA 4I8KA 2BM2A 1BIOA 3D23A 1QIXB 1A5HA 1IQJA 3EDXB 1P2JA 3H7OA 1P04A 3RXLA 1T8OA 3AAVA 2CF9H 1LHEH 6GCHF 2VH6A 2ZU2A 1P2NA 1XXFA 1GL0E 1WUNH 1GHAF 4NIXA 1C2GA 3DHKH 4TPYA 1A5IA 2AEIH 3RXOA 5HXFA 2NU4E 2FYQA 3L6PA 2PGBB 4THNH 1UTLM 3E91A 3OY6U 4BTUB 4NGAH 2PSXA 1L0ZA 1DUEA 2OLGA 1ZGVA 4E7NA 4X8VH 2WUCA 3F9EA 1AY6H 1QBNA 4MG3A 4E06H 2FI4E 3CP7A 3U9AH 3IWMA 3U98H 1O30A 3SNEA 2FS8A 3T5FH 1S85A 1UTQA 1OYTH 4WXVA 5JPMH 2FS9A 4NZLA 2AYWA 2CHAB 1Z6JH 3HK6B 4X1NU 4GUXA 3SU2A 1ZHMA 1PFXC 1FONA 5DGJA 3M5MA 1AE8H 2PTNA 4DIHH 3BTKE 2V6NA 2ANMH 1HAOH 4D7FA 4FXGH 1K2I1 1G30B 2Z9KA 5A09A 5G4BA 1BJUA 1RJXB 7GCHF 3OYPA 2RCEA 2PFEA 2Y5FA 3K6YA 2F91A 1ETRH 1M9UA 4A1XA 4DURA 4J1YA 4IN1A 4FU7A 1BRCE 1WV7H 1TABE 4CH2B 1ELVA 1EAIA 1FXYA 2C3SA 1HIAA 2OTVA 1D3TB 2QGRA 1JWTA 5EQRA 1W12U 3HPTB 1LKAA 2ZCKP 3BN9A 1T32A 1A3EH 2BQ7B 3FANA 7KMEH 3RXEA 2CXVA 3WY8A 1TBZH 2BD7A 3UOPA 1GI6A 3ZYDA 1TNIA 1CBWB 3S9BA 1UK4A 5FX5A 2W5EA 4X8TH 1TE0A 1PQ7A 2FEQH 2SFAA 2VGCB 4OGYA 3SHCH 6CHAC 1DWCH 3E3TA 2C8ZB 1FV9A 2OBQA 1WCZA
chains in the Genus database with same CATH superfamily
1LQEA 1TPAE 3TJNA 5CDFE 2HNTE 1TGTA 2ALVA 2EQNA 2FMJA 3PWCA 1C9PA 5T6FA 2VINA 1MH0A 2BDGA 2FZZA 2HALA 2Y80A 5F53A 3V12A 1T8NA 4NG9H 4LK4A 4ABFA 1HUTH 1U6QA 2P8OC 1TALA 3FP6E 3P70B 4OS7A 2B0FA 3GY7A 1S6LA 1Y3XA 3SN8A 1AZZA 1FUJA 1BHXF 4MNXA 2NU1E 2A2XH 6GCHG 1SBWA 3TNSA 3PM3A 1GHAG 5ESTE 1AFQC 4I7YH 3EA7A 4B76A 2BLWA 1HPGA 3RMNH 1L1GA 2PKAA 2ALPA 3KGPA 3PTBA 3F2FA 2RDLA 3RLYH 4BAQB 3OSYA 3RC5A 4F55A 1UCYK 2OK5A 2ANKH 1Q2WA 3VGCB 4ABBA 1J14A 2PGQB 4Z6AH 4Q4LA 3K9XB 3LGIA 3BG4C 3A81A 1WTHD 2FI5E 2VIQA 1ESTA 3SU6A 3BTTE 1Z1JA 1UCYH 1C5NH 4B2AA 1UTJA 4BAOB 2WSSD 1MKWK 1TNKA 1CT0E 4Q80A 4YLUA 2JIZD 4JZEH 3LGTA 1TRYA 2VWNA 4GHTA 1IQIA 1EZUC 2C4FH 1TWXB 2SGAA 1C5UA 3TNTA 2OBOA 2BDAA 1PPCE 1GI5A 1MKWH 1O35A 6CHAB 4FU9A 5JBCS 3T62A 1OX1A 4MPWA 1GGDB 2C90B 4XFQA 2GZ8A 4B6FA 3S9CA 3MH5A 3SOSA 2VH0A 4INHA 2GV6A 5DO4H 1LKBA 3F9FA 1AO5A 3RMMH 2XBYA 5C1XA 2GX4A 7GCHG 1GBTA 1K1IA 2GCTC 1E34B 1P03A 4A5TS 3BEIB 3S9AA 1UVTH 1GHYH 4KELA 3KHVA 5IYTA 1DITH 1WYKA 1UVUH 3STJA 4ABJA 1QJ6B 1W3CA 1UTPA 2J34A 3ENSB 1MMJN 2AMQA 1YPJH 3Q3YA 5HM2A 2BXUH 1MD8A 5F8ZA 2FOFA 2ZGXH 3FN8A 1MTNC 3N7DA 1G3BA 1O2ZA 3BG4B 1BMNH 3SJOA 2F83A 2WUBA 3TITA 3RXUA 3P17H 1P8VC 1AUJA 1NRSH 5A8XA 3A7WA 3SV7A 1F92A 1SR5C 5FX6A 2XC5A 1ORFA 1GI7B 1DY9A 4TWWA 2A5IA 2BD8A 1OP2A 4X2VA 1O0DH 1SHYA 1IQLA 1F5RA 1EAUA 2ZFFH 2ZGHA 1LVYA 1O5CB 1A7SA 1HYLA 2H1UA 2PP6A 4H6TA 5LH8A 5KGOA 1ACBE 4IS5A 2A32A 3FZDA 1GJ5H 4BXSA 5B6OA 4JYTA 2ZIQH 5BPEA 3P8OA 1HAGE 1YPHE 2R2WU 1IHTH 1HCGA 2DUCA 2P3UB 1HXEH 4ZHLU 3TGJE 3A82A 1P2IA 3LJOA 3GOVB 9LPRA 1TAWA 3QWCH 4Y7BA 1GMHF 3GYMA 2Z9JA 1Y3YA 4K69A 1NFYA 1JIRA 3TH3H 1AFEH 3ZVCA 2KCAA 2F9VA 1ABIH 1BQYA 3QTOH 2CF8H 1E36B 1TLDA 3KYFA 3MO3A 1C2HA 3DCLA 1WDIA 4Y7AA 9ESTA 2OC0A 2AFQB 2TGAA 1HAPH 1SG8B 3VFEA 1MTNB 2GTBA 3BIUH 2CJIA 4Y0YE 1ZSLA 1CQQA 1TX8A 3Q77A 3SUEA 4ASHA 1YPKH 1L1NA 1NRNH 2GD4B 2VIWA 3KQ5A 4NFFA 3P95A 3V7TA 3LONA 2EA3A 2P59A 1ZPZA 3SNAA 1A0LA 2G4TA 1BBRK 5FCRA 2FDAA 3A85A 2Z3EA 2TGPZ 1EB2A 3PMBB 2FOBA 1K1OA 2XRCA 1C2FA 1YBWA 3P8GA 1NRRH 1BBRH 1HJ9A 4LZ1H 2UUFB 3O8DA 1W11U 3RU4T 1QQUA 1UMAH 1WBGB 3SUFA 4TSFD 3EE7A 4YT7H 1SLXB 2YMSC 1GJ6A 1C5OH 5T6DA 1C2EA 2BYAX 2SGEE 3ODFA 4Z1MD 1Y3VA 1SGYE 2ZTXA 1AVXA 1G3CA 5GCHF 1ETTH 2FM2A 4O03A 3ZZCA 3ZZ7A 2XTTB 2BDCA 1GCTB 1TRMA 1A2CH 2XBWA 3DSGA 1TPOA 1BRBE 1RIWC 1GBFA 2ZPRA 1WTGH 1O5EH 4Q7YA 1GI3A 2BB4A 2GCHG 3A86A 2VWMA 1HAVA 1NY22 3MI4A 4IC6A 2BDYA 1F0SA 2WV4A 1UHBA 5DJ7A 3MH6A 4NZQA 2ZHFH 4ZH8A 4YOJA 5F6MA 1GI4A 1T4VH 1SGTA 1CHOF 4YOIA 1C2KA 1J17T 1GVLA 2XBVA 3PWBA 4OM9A 3RXJA 3SU3A 3ZVEA 3BF6H 1SFQB 4NFEA 1AUTC 3ZZBA 2FTMA 4I86A 4U32A 1TQ7B 3TH4H 4O97A 1NROH 4JZIA 3VB5A 4RKJB 1E1QD 2WV5A 1FLEE 3ZV9A 4U01A 2F9NA 1O3GA 5A0AE 2H6MA 4AX9H 1C2JA 1C1QA 2Z9LA 5DPAA 2BLQA 2W7UA 1SMFE 1O2YA 2W6JD 2J97A 1YM0A 3EA9A 1GMHG 1FZZA 3A89A 3VEQB 4JZDH 3K65B 1C1UH 4Q63A 4MPVA 5AFZH 2PSYA 1AWFH 3T29A 2G5NA 1AIXH 3BTDE 2BQWB 2BY7X 4CR5A 1HAYB 1N8OC 1GBAA 2VVUA 4NIYA 3TK5A 1GHZA 4HI3A 8GCHG 3A8AA 1H8ED 3CENA 1BRAA 1DWEH 1W0KD 3HGNA 1FIWA 1O2XA 1K22H 4AYVB 2P93A 4FOUC 1L2EA 2ZTZA 1A3BH 1TB6H 1EPTA 1KXBA 2BY5X 1Z8RA 1S84A 1CA8B 2G52A 3RMLH 1P11E 1ZLRA 2O9QA 3LC5A 1MTWA 1TPPA 5C1YA 2EI7A 4Y10E 2D1JA 1VGCB 4B2BA 2Y6TA 3TJOA 3SJKA 1NPMA 1GJ9B 1HLTH 3A8DA 2XC4A 3QGJA 1EJNA 4NSVA 2FWWA 1YPEH 4JCNA 1NRPH 2OD3B 2Q1JA 2CK3D 4AC9A 4FUJA 3FKSD 1V2KT 1HBTH 2KM0A 3KEEA 3ZZ4A 1O2MA 4RSPA 3PLKA 1C5MD 1XUJA 1FDPA 5GCHG 4RN6A 4VGCB 1D9IA 1TGNA 2IPHA 1NESE 3SV9A 1C5ZB 3ZVBA 3V3MA 4Y79A 4H6SB 1GG6B 1DOJA 3ZVDA 2ZECA 2JH5D 2XXLA 5C5OA 1Z8IB 4JZFH 1P2OA 3PV4A 1CSOE 2EI6A 1Z1IA 1BTXA 3L33A 4FUIA 4OS1A 1MCTA 2FX4A 2XWAA 1S0QA 5T1VA 4DT7B 1UK2A 3V0XA 2ZI2H 2ILNA 1IOEA 4AFZA 4LOYH 1P09A 2FI3E 3OFND 2JETB 3A87A 2Z3DA 1CHOG 2YNBA 5EJ1A 1LTOA 1SQOA 2FOHA 2IN2A 2D26C 2V3MA 4GHQA 2R2MB 4AORA 4MVNA 1C1NA 1G2MA 1ZR0A 4X1RU 2FP7B 1Y5BT 2BMGB 2BD2A 5TJXA 4AG2A 2ZPSA 3GCTF 3DT0H 5DKMA 3UR9A 3ZVFA 1Y5AT 1G3EA 3LT3A 1AKSB 4UFEH 1SSXA 1YGCH 2ZU1A 4JYUH 1BUIA 2DE9A 4CR9A 3TGKE 4TWYA 1QB6A 4I8HA 2F9BH 4AFQA 3KL6A 1EJAA 1PPFE 1FMGA 3RDZA 2A1DB 3PRBA 1ANBA 5JBBS 1LCYA 1N6YA 2TPIZ 3M5NA 1GHVH 3MH7A 3QN7A 1K1NA 1P3CA 1YPLH 1GI1A 2ZCLP 2QC2A 3F3BA 4DG4A 1GJAB 4YOGA 3AK5A 2FIRH 4XBBA 3O8RA 3BTHE 3EAJA 5A8YA 4AFSA 3GY8A 2J98B 2SGDE 1G3DA 4YLQH 4DJZB 1W0YH 1GDNA 1O31A 4F49A 1O39A 3K2UA 1GVKB 5T3HA 1ZZZA 3NWUA 5EQSA 4BAKB 1KLJH 2ZPQA 3IITA 1EXFA 3ZZ5A 1QL8A 3EQ0H 4Y76A 5EOKA 2VNTA 1O2IA 1PQ5A 1AU8A 3VB7A 1CBWC 3RXQA 1GHXH 1TX6A 5E8EH 2BY8X 1B7XB 1KYNA 1ELTA 1KXFA 2VGCC 3EA8A 3O8BA 4YT6H 2GVFA 5EPYA 1GDQA 1FPCH 1W14U 3ELAH 5DP3A 1HAXB 1SGCA 1TQ0B 2JJ1D 4ACAA 1NTPA 4AB8A 1DICA 3RXTA 1C5QA 1JRSA 3I29A 3A7VA 4ABDA 3ATLA 4Q2KA 1XXDA 2F4LA 1E38B 1W10U 1ZYOA 2C8XB 2WPLS 2HLCA 1ZTKA 3Q3KA 1W0ZU 2ZDAH 2J94A 1DWDH 2FODA 1BT7A 4UEHH 4KTCA 1C1TA 1QA7A 2Z7FE 3U8RH 1O5BB 3TJUA 5DSFA 5FPYA 1FAKH 1P57B 3M3SA 3SUGA 4B75A 5EW1H 1GI0A 4FETA 1Z6EA 4ZXYH 2A2QH 5JB9S 2FYRA 2K0QA 3FFGA 1QZ8A 3VGCC 1AHTH 2F9PA 4X8UH 3UPEA 3RXHA 4ZMAH 3UY9A 2BLVA 1C5RA 1HIAB 3P6ZB 4B6EA 5DK1A 4XBCA 1K1MA 1C1MA 1C2MA 4MNWA 3HKJB 1O2WA 2G4UA 1H9LB 1QCPA 1UK3A 1SGNE 3MMGA 4WJG2 5EJLA 2Y82A 2GT7A 3S7HB 2ZDLA 1LO6A 2AIQA 2G55A 2PKSB 3A88A 5FBIA 1UCYE 4Y6DA 3F2HA 3LH1A 4MTBA 3FO8D 1GPZA 1AB9B 1BTZA 4WY3A 3PLBA 1V2VT 1MTSA 4AGKA 1VJAU 4LXBH 2VVCA 3EGKH 3E16B 3LJJA 5L30H 3M3TA 1GGDC 4ABGA 5H4IB 1BB0B 4INKA 2D2DA 2H5DA 5FAHA 3NCLA 3RXDA 1C4Y2 3H5CB 2HNTF 1XUGA 2XCNA 1HFDA 4JMYA 2TBSA 3OE7D 3P8NA 3JZ1B 3OEHD 3TPIZ 5EJZA 4WMEA 4INLA 4MNYA 5F8XA 2QIQA 2WPMS 1V2LT 3HKIB 2THFB 4R8TB 1KXEA 3I78A 3TVJB 3O8CA 4H42U 1TGBA 1V2QT 2PKAB 1OS8A 1D3QB 1NC6A 2A4GA 1AWHB 1LVMA 2BD3A 3AASA 1TA2A 3UIRA 4Z0KA 4K2YA 2HVXA 3BIVH 4D9QA 2R3UA 1S6HA 2O8TA 3MHWU 4OS6A 2V0BA 2QAAA 3F68H 3SJ8A 3DFLA 4NIWA 4KTSA 2W7SA 2PTCE 2A4OA 1WOFA 2GGVB 2XOKD 3RXRA 1MZDA 4WWYA 3E0NB 3VB3A 3RXAA 1O2NA 1OPHB 2HNTC 2FX6A 4E7RG 1IHSH 2UWPA 3ZVAA 1B0EA 1O2OA 1BTWA 3UB0A 6ESTA 1PPHE 4B2CA 1NFWA 1THSH 1VR1H 1SVPA 4ISNA 2JJ2D 2UUYA 1TA6A 1KMHB 2BOKA 5C0UA 3H09A 1BTUA 2ODYB 1MTUA 3F1SB 3PRDA 2PUQH 1AE5A 3E6PH 1OWKA 4RKOB 1O2UA 3PB1E 1BZXE 3W94A 1V3XA 2UWLA 1ZMNA 4B71A 5FPTA 5JBTA 1PPBH 4WMDA 1QBOA 5T6GA 3MU1A 1TMUH 1Y5UT 3SV8A 1ZPCA 1NU7B 1ZPBA 4FVBA 4BXWA 3LDXH 1E1RD 3GICB 3RXKA 5FCKA 1PPZA 5C17A 3CNRA 2AIPA 1N1LA 1NO9H 5A0CA 1O2PA 5K0HA 1UVPA 5EXLA 1RTKA 2P3FH 4X6PA 1J16A 1O2TA 1AN1E 4ZXXH 2G81E 2ZWLH 3QZQA 4R0IA 4KGAA 2D8WA 1Y3WA 3SI4H 4AZ2B 2ZU3A 2C8YB 2I6SA 1YF4A 2K1QA 2PR3A 2VIVA 4K3JA 1O3OA 3URCA 1XVOA 7ESTE 2FTLE 1CVWH 1L4ZA 1ETSH 2HPPH 4MLFB 1TYNA 4E05H 5FL7D 3SGBE 1C5TA 2GMTB 2H9HA 1SKYE 1THPB 4ZKSU 4OS5A 1SQRA 2QCYA 2LELA 1TX7A 1HB0B 1QA0A 3Q76A 1OWJA 1SGFG 1UVSH 3BTFE 1F7ZA 1SGEE 3QZRA 1GBMA 3ATWA 5LPEA 3BV9B 3D49H 1LQDB 3F0OA 3KF2A 1DLEA 1FY3A 1OHHD 4CRFA 4UFFH 5C1UA 1O3DA 2Q6FA 4CRDA 1MBMA 4B1TA 2AGGX 1P02A 3A80A 2XNDD 1NS3A 5J4SA 1V2JT 3N7EA 5GDSH 1BBRE 1OWHA 2KCYA 3ZVGA 2R0LA 1O2GH 1V2UT 1P9UA 1YCPM 1Q31A 4FVDA 3KQEA 1IQHA 2LPRA 4K1TA 4XDEA 1HGTH 1VZQH 3RU4E 4WF8A 1F0TA 3UR6A 3DA9B 3LC3A 1GCTC 4Y71A 3KIDU 5HKKD 1C5VA 1ELBA 3EYDA 4DVAU 2OINA 4CBOA 2Y7ZA 1XUIA 3Q3XA 2ZGJA 1P2MA 1HV7A 1OOKB 3LGYA 3PV2A 4B73A 4O3UA 1NFUA 4YXWD 4OGXA 1GBLA 2CV3A 2GZ7A 1C2IA 2OP9A 4ABAA 1O2SA 3MNXA 2TGDA 1KDQB 3QO6A 5CHAB 1HAIH 1CE5A 1DX5M 4HGCA 4PROA 2IJOB 1VITF 1ZGIA 5EGMA 4AG1A 4BAHB 2KZ4A 2F9OA 2GDDA 1EOLA 1OP0A 4YM9A 1BCUH 1C2DA 2BVXH 5GNDA 3KQDA 3KNXA 3KQCA 1WQVH 5ETXA 1O5DH 1O33A 3LKWA 1EX3A 1PPGE 1XM1A 2KX4A 3U69H 1H9IE 2QXGA 2AMDA 2XWBI 4I32A 1O5GH 1DVAH 1YC0A 4ISIH 2V35A 4MPUA 2SNVA 4XSKU 1YPHC 3SYJA 1UTNA 1OKXA 1W7XH 2GT8A 3M7QA 4AOQA 3N7OA 1JMOH 4TY6A 1EJMA 3QTVH 4KTUA 2V7QD 3SW2B 1TFXA 1O3LA 1GVZA 4A92A 1LPGB 2FOEA 1PJPA 4XD7D 4FUCA 1MKXK 1ZMLA 2JKHA 3U1IB 1S82A 2J38A 3ZZ3A 3OAAD 1VCQA 3TK9A 3NUMA 3QX5H 3ATKA 4ISLA 1QRWA 5E0HA 4HFPB 4D7GA 5GPIB 3LU9B 5C2ZA 2FLRH 2VIOA 2LNCA 3KYGA 5SGAE 1GBCA 2W3KA 1MKXH 1BTPA 1V2MT 2NU0E 1ELDE 4MNVA 1J9CH 2SGFE 3IG6B 1UHBB 2ZGBH 3MNCA 2VU8E 4NIVA 3KN2A 5B6LA 1IQFA 2XW9A 3EE0B 1C5YB 1KY9A 1XUFA 4I31A 4MPXA 5A0BA 2OQ5A 3PMHB 1VGCC 4CH8B 2BLOA 1SGRE 6LPRA 1KXDA 3RMOH 3MOCA 4U2WA 2A5KA 2XYAA 3ITIA 2VIPA 2ANWA 2UUKB 3SO3A 2STAE 1XX9A 4CRAA 5HGGA 1GBHA 1DPOA 1GMDF 1GJ8B 2SNWA 5JBAS 1GBKA 1VITH 5EXMA 5EU8A 1A1RA 1IQGA 1L1JA 2HRVA 1A61H 1KLTA 2OC1A 1MD7A 2XBXA 2GJGA 1B5GH 3RXFA 4DCDA 1C4V2 1VCPA 2V3OH 3M35A 4X1SU 3E8LA 4ISOA 4O9VA 1TNGA 2VWLA 3RXIA 4VGCC 2ZDMA 3OEED 1C1RA 5CMXH 2Z3CA 3B8JA 1K1PA 4UD9H 4IN2A 5GJ4B 1GG6C 5EPNA 4BNRA 2L74A 1YY3A 4TYDA 1EFRD 3FP8E 3MWIU 1Z7KA 1O3FA 1P2KA 3ATIA 2GDEH 2P95A 1IAUA 2WPKS 3UTUH 1Z8JB 1BMFD 2ZGCA 5CE1A 4WH8A 2JETC 1XMNB 1EPTB 1PPEE 3TU7H 3DD2H 1A46H 1C1SA 1VITG 1HNEE 1Z8GA 1BTYA 3A84A 1QGFA 1NRQH 2WPJS 1TMBH 2BZAA 4GCHF 1GI2A 4F48B 2BY6X 2ZFQH 1T31A 2ZZUH 4TPIZ 1FY5A 4SGAE 1O3BA 1SHHB 1TPSA 2VVVA 4UE7H 1NU9A 3F9HA 1DM4B 1KXAA 4DT4A 1HAZB 5JDUB 3UNRA 1ZMJA 2OC8A 1GI9B 3I77A 1AMHA 1H8HD 1MABB 1FJSA 2XNIA 4TY7A 3SU0A 2VJ1A 4ABEA 4YO9A 4CRGA 3GY5A 3GISB 1MQ6A 5KEDA 1T4UH 1KSNA 2HWLB 4JZ1A 1SLWB 1SI5H 1EATA 1S6FA 2BVRH 5FXLA 4CRBA 4XRNA 1DSUA 3R3GB 1E37B 1P10A 2BD5A 2AH4X 3RUOA 1H4WA 3S7KB 3W1EA 2ZA5A 1O3MA 5BRRE 4Q7XA 1CO7E 2ZF0H 1C1PA 2AMPA 1T8LA 2EI8A 2WZQA 3UNQA 4ZROA 4CREA 2ODPA 1TONA 1HDTH 1BJVA 2ZHEH 1LHCH 3LH3A 1O5AB 2ZDKA 4ZHMU 3BEUA 5TCCA 4NWKA 1XVMA 2A7CA 3GY6A 3MU8A 1SLUB 4X1QU 5HM9A 1C9TA 1EB1H 5C5NA 1CGJE 1AVGH 4XE4A 2A7JA 1BMAA 2SGPE 1O3NA 2A31A 1DFPA 1HJ8A 3WWBA 2R0KA 3A7YA 2B5TB 3C27B 1C2LA 4MDSA 2QY0B 1CA0B 1O2HA 5LPFA 1KTSB 1O5FH 3ZZ8A 3RXSA 1VJ9U 4XBDA 2DE8A 2HPQH 1O32A 3NK8A 5AF9H 2HGTH 5EIYA 4WVPE 4QT8C 4DY7B 3FAOA 3PO1B 1GI8B 3RM2H 2EC9H 2A4RA 1OWIA 2L6OA 2O8LA 3BSQA 3PROA 2BZ6H 1CGHA 4YESB 3KCGH 1ESAA 1ID5H 1NT1A 1FPHH 2A0QB 4UFDH 3TH2H 2KAIA 2FOGA 3CS7A 5DP7A 4CHAC 1D6WA 1E79D 4JK5A 5J4QA 1G32B 4ESTE 1DWBH 3NZIA 1LHGH 1QR3E 3M5OA 2STBE 1AVWA 3FP7E 3HK3B 1O2JA 1SLVB 1T7CA 1N6XA 1SGIB 4BTTB 5E0GA 1W2KH 1DSTA 1KLIH 1TNJA 1G2LA 1P0SH 1C1OA 1SGQE 3UWIA 3A7ZA 1AD8H 4GCHG 3L3TA 2PKSC 1QNJA 4P00A 1O3JA 1L4DA 1AB9C 1W8BH 1YYY1 4HTCH 1WAYB 1BRUP 1GWAA 2ZO3H 1RD3B 4X2XA 3VG8A 4IC5A 1TNHA 1O2QA 3F0PA 1JBUH 2M2AA 1EZXC 2RDEA 1XUKA 2YNAA 3MO6A 4NWLA 2ZHDA 1TGCA 4FU8A 1A0HB 1MUEB 4UONA 2WPHS 1SFIA 1FN8A 1P12E 1O3HA 1MU8B 5C20A 2OUAA 3UNSA 2AHME 3VB4A 1QB9A 1DDJA 3RXCA 2Y5GA 3P92A 2C93B 3A8CA 1GJ7B 5GWZA 3OTPA 3F2GA 4XOJA 3UWJH 4FUBA 1QB1A 2CMYA 2YOLA 2F3CE 1X7AC 2QF3A 2BD4A 2OXSA 1LPZB 1IQKA 3GCHB 2Z6BD 3U8TH 3UQVA 4CHAB 1SQTA 4U30A 3ZV8A 2ZKSA 1O38A 4SGBE 2BX3A 3RXPA 1VKYA 4TT3D 2PWXA 1TBQH 4DW2U 3KQBA 1GBDA 3S69A 3ATMA 2BVSH 4NA9H 3MNSA 2BDBA 1ZHRA 3PLPA 5L2YH 2QF5A 3LPRA 4ZCNA 1RS0A 2ZHWH 3LIWA 4FUFA 3F6UH 3BEFB 3UFAA 1C4U2 1V2NT 1K1LA 3M3VA 1V2ST 3QUMP 4M9FA 2CGAA 5IK2D 1EASA 4CBNA 3GCTG 1G9IE 1D3DB 1FIZA 2XC0A 2HOBA 5DP6A 1NBME 4AFUA 2BOHB 4I8LA 1EP6A 5HMAA 1H9HE 4FUHA 2FESH 1Z71A 3BTGE 1V2RT 3M37A 4X2YA 1OWEA 4DOQA 3SORA 1BA8B 1FNIA 1ZJDA 4F4OC 3SJIA 1LPKB 1TGSZ 1RTFB 2Q6DA 1O2LA 2BDIA 1MBQA 2J95A 4I8JA 4B74A 3W95A 1PYTD 3H7TA 1GCDA 1OSSA 1QY6A 2K8IA 3MH4A 3SGAE 3D62A 3BTWE 1A5GH 2R9PA 4I8GA 2J5UA 1MCVA 4X6MA 4Y8ZA 2QN5T 5L6NH 3OTJE 2QXIA 3V13A 4KKDA 2UWOA 1ZTLA 3RP2A 4AYYB 1Y8TA 1SGDE 3MO9A 4AN7A 3RXMA 1UVOA 3PV5A 2P16A 3GDUA 4IMQA 1QQ4A 4BOHA 2SGQE 2AERH 5A2MH 3DFJA 4GLYA 1CT2E 4IW4E 1EZSC 1MAXA 1RRKA 1GMCF 3C1KA 5EODA 3GYLB 2FOAA 2BD9A 4Y0ZE 1LMWB 1MZAA 5DG6A 5E2PA 4IMZA 2GMTC 2O8MA 1HAHH 4A1TA 5LGOA 1CT4E 1P2QA 2XCFA 3MQKC 2AS9A 3VXFH 1J8AA 1SB1H 1O34A 1C5SA 3T28A 1O3PB 1KIGH 3FOAA 1QJ7B 1YCPK 1INCA 5C3NA 1CU1A 2GKVE 3TIUA 1YKTA 1C1WH 2ASUB 4LZ4B 3E0PB 3RU4D 4ACBA 1Q3XA 8ESTE 1F5KU 1QL9A 5F03A 2IPQX 1EUFA 1GJBB 1LVBA 3GDVA 1V2WT 1YCPH 1ARCA 2ZDVH 4JK6A 2HVYB 5LPRA 3SBKA 2QE7D 4NA7A 3NKKA 3ZZDA 1RFNA 1ELAA 1EP5A 1DT2A 2UUJB 1ZHPA 4BTIB 3K6ZA 3M7TA 4H4FA 3ZZ6A 1UTOA 3P8FA 1E0FD 2FLBH 3MYWA 2J9NA 2J2UA 2PUXB 1AQ7A 1HJAC 5EW2H 2W3IA 2TGTA 2YMSD 2A5AA 2P8OB 3GCNA 4RI0A 1S5SA 2ZFRH 2A45B 1V2TT 5E0JA 4BAMB 2Z9GA 4HZHA 2RA0A 5AHGH 2ZHQH 2H9TH 2OCVB 2ZU4A 4DGJA 5CHAC 2H5CA 1XKAC 4K8YA 3RXVA 5HYOA 2WINI 1NM6A 2O8UA 1IQNA 3BTQE 3SGQE 4X2WA 3AW1A 1AFQB 2QA9E 4ABHA 3B9FH 3FZZA 1DXWA 1O3IA 1SPJA 4CRCA 3RLWH 4O3TA 1SL3A 1EQ9A 3T26A 5PTPA 2NWNA 1FI8A 3SU5A 3T25A 3NRLA 4K1EA 2ESTE 2NU2E 1DY8A 1GHBF 3NXPA 1SOZA 2QF4A 2G51A 3E1XB 1F0UA 7LPRA 4IBLH 4D76A 2GCHF 2IJD1 2KCOA 4ZUHA 4YZUA 1SGFA 3F9GA 3GCOA 4GPGA 1PYTC 1QFKH 1QRXA 3SHAH 3DUXH 2KR7A 2F9UA 1ELFA 1H8DH 3ESTA 4MQAA 3TJVA 1W13U 1P01A 4ZAEA 1FX0B 1ABJH 1UJ1A 2P94A 1O36A 3TK6A 2P3TB 1A0JA 1AGJA 1SC8U 2C8WB 1BHXB 1ZJKA 1E35B 2V3HH 1WQSA 2VB0A 1GMCG 5CHBA 3UUZA 2J4IA 4D9RA 5EQQA 3OY5U 3UAIC 2WYJA 5C67A 4ZHAA 1GBIA 1HJAB 1FY4A 1Y59T 2F43B 3G01A 1BITA 3S0NA 1O3KA 2A7HA 1FAXA 2GCTB 1D6RA 1QURH 4K5ZA 1THRH 4NA8A 1SQAA 4K60A 2J92A 1UTKA 1TNLA 4OS2A 1ESBA 1T8MA 1D4PB 3SV6A 1TMTH 2WPIS 3AAUA 3LGWA 1ZRBA 4Y8YA 1P9SA 1B0FA 2CN0H 3BG8A 2BXTH 1C5LH 2ZCHP 2Z9IA 4GSOA 1O3EA 2VIDA 8GCHF 3ODDA 5KECA 3A7TA 1BDAA 2A4QA 1NFXA 1RGQA 4J2YB 3GY4A 3WWFA 3R0FA 4K1SA 5L2ZH 3SUDA 1SGPE 1KDQA 2IOTA 3PYHA 5E2OA 3VPKA 3TGIE 1A4WH 3RXBA 1ZTJA 3D65E 3FVFB 3T27A 3SZNA 1HXFH 1XKBC 3RC4A 4FUEA 3U1JB 1LVOA 5I25A 1OWDA 3URDA 5JB8S 2ODQA 2QXHA 4GVUA 2Y5HA 3SU4A 1WU1A 1DXPA 5AFYH 3GDSA 3VXEH 1LHDH 3SQHE 1FN6A 4ABIA 1WXRA 1JXPA 1RXPA 2EEKA 1OXGA 1YP9A 2FO9A 2GV7A 3B23B 4I33A 1O3AA 1EPTC 1GJDB 4X8SH 2ANYA 1EOJA 3PMJA 2WHXA 1PQAA 1YLNA 5DN6D 1HAVB 4UDWH 1H1BA 2EY4C 1D3PB 1ZRKA 2ZQ1A 3PMAB 1PQ8A 2QXJA 2RFKC 1V2PT 3WW7A 2OQUA 3RXGA 2JH6D 3NPSA 2B9LA 2ZG0H 3UQOA 4AB9A 5DP8A 5EG4A 5C94A 1IQMA 1P06A 4WMFA 1Y3UA 1GJCB 2ZU5A 5HIYA 4Q7ZA 5HIZA 3A7XA 1GHBG 1G36A 1ANDA 1AZ8A 2FOCA 3BTME 1TOCB 2BQ6B 2RG3A 1EZQA 1DLKB 3SQEE 1JIMA 5TCAA 5F8TA 3U8OH 1QTFA 3OU0A 5K7RA 1QJ1B 2PLXA 2Y7XA 3SJ9A 4NCYA 3QLPH 2JDID 4GAWA 1ELGA 3RC6A 1BTHH 1GBEA 1O2KA 1V2OT 3TLOA 3M61U 1SOTA 1TOMH 1DE7H 2G5VA 5JYIA 5EXNA 1UTMA 1JRTA 3BTEE 3MNBA 1ANCA 2WPDD 4ZKOU 1S0RA 3M36A 3MFJA 1BMLA 2WV9A 4KP0A 5IDKA 3AVZA 4UFGH 3SNDA 1AI8H 2BY9X 3GY2A 2HLDD 1K21H 2H2ZA 3QK1A 4OS4A 4A6LA 1S81A 1XUHA 3N99A 1WSSH 3GS9A 2G8TA 1K1JA 5FBEA 4ZKNU 5I46H 2W6ID 2ZEBA 1O37A 3DSPA 3A83A 3HGPA 1EAWA 1KXCA 5ABWA 1CGIE 3JZ2B 2YMSB 2ZTYA 1C5PA 1C5XB 1CA0C 3MU0A 4A7IB 4ZKRU 1NZQH 3QGNB 4WXIA 2PHBA 1VCWA 3MU4A 3HATH 3QDZB 2QV1A 1BMMH 5ESBA 3ZIAD 2BX4A 2TIOA 5GIBA 1RIWB 3RM0H 3PO1C 4X1PU 5GXPA 2O8WA 2BDHA 4JYVH 1F5LA 2ZNKH 1W7GH 1O3CA 1F0RA 1MTVA 3LGVA 3CS0A 3SU1A 1ELCA 1ZSJA 2AGEX 1QBVH 2PV9B 2B7DH 3M7UA 2ZQ2A 4X6OA 2KCPA 2WYGA 1GJ4H 3LOXA 3UOUA 1EAXA 2TRMA 4IGDA 1G37A 2BHGA 1ARBA 3ZZ9A 1O2RA 1QRZA 2RA3A 4Y11E 2JH0D 4K8BA 1NN6A 1UO6A 3UREA 1CHGA 1S83A 2VWOA 5A8ZA 5FPSA 4M7GA 4FUGA 4P02A 1BOQA 3LGUA 3M5LA 3SI3H 1ZOMA 1EKBB 1K28D 1MQ5A 1RTLA 1ANEA 2QF0A 1GBJA 4A1VA 1V6DA 1O2VA 1KTTB 2FPZA 2GZ9A 2BTCE 2NU3E 1C5WB 2ZFTA 4D8NA 1QL7A 1TIOA 3MTYA 3SZEA 4AGJA 3E90B 2GP9B 1P3EA 3ZZAA 2FOMB 2H9EH 1YLDA 1LHFH 2Y81A 3AW0A 4X0WU 1GMDG 3MU5A 1H8IH 3VB6A 2B8OH 4RT0A 2VBCA 2Z94A 1N8OB 2M5TA 4BANB 1FQ3A 1FY8E 1YPGH 2ZDNA 2Q6GA 3T2NA 1GDUA 2ZP0H 3GY3A 2PW8H 1GL1A 5DP5A 1GHWH 2OC7A 8LPRA 1QHRB 2R3YA 4FUDA 3ZYEA 4DIIH 1FY1A 8KME2 1LDTT 5AVDA 2ZFPH 4ISHH 4NSYA 1DANH 1HRTH 2AGIX 2G00A 3SNCA 3A8BA 1J15A 2CHAC 2KAIB 2FXRA 1IQEA 1F2SE 2ZC9H 2I6QA 1DS2E 3GCHC 1GBBA 2ZFSA 1YLCA 4Y8XA 2QYIA 3SNBA 1MAYA 2ULLA 4X6NA 4WH6A 1TRNA 4YTAA 1JOUB 3STIA 3SV2H 1TBRH 2W26A 1P05A 1AKSA 1YPMH 1ZSKA 1ELEE 1OP8A 5FHTA 2LP6A 3Q00A 5DP4A 3PTNA 1COWD 1K9OE 1OYQA 3OX7U 5DP9A 1NBMD 1MU6B 1C1VH 1DUAA 4I8KA 2BM2A 1BIOA 3D23A 1QIXB 1A5HA 1IQJA 3EDXB 1P2JA 5C0TA 3H7OA 1P04A 3RXLA 1T8OA 3AAVA 2CF9H 1LHEH 6GCHF 2VH6A 2ZU2A 1P2NA 1XXFA 1GL0E 1WUNH 1GHAF 4NIXA 1C2GA 2J98A 3DHKH 4TPYA 1A5IA 2AEIH 3RXOA 5HXFA 2NU4E 1UW7A 2FYQA 1YWUA 3L6PA 2PGBB 4RT1A 4THNH 1UTLM 3E91A 3OY6U 4BTUB 4NGAH 2PSXA 1L0ZA 1DUEA 2OLGA 1ZGVA 4E7NA 4X8VH 2WUCA 3F9EA 1AY6H 1QBNA 4MG3A 4E06H 2FI4E 3CP7A 3U9AH 3IWMA 3U98H 1O30A 4ASUD 3SNEA 2FS8A 3T5FH 1S85A 1UTQA 1OYTH 4WXVA 5JPMH 2FS9A 4NZLA 2AYWA 2CHAB 1Z6JH 3HK6B 4X1NU 4GUXA 3SU2A 1ZHMA 1PFXC 1FONA 5DGJA 3M5MA 1AE8H 2PTNA 4DIHH 3BTKE 2V6NA 2ANMH 1HAOH 4D7FA 4FXGH 1K2I1 1G30B 2Z9KA 5A09A 5G4BA 1BJUA 1RJXB 7GCHF 2KFWA 3OYPA 2RCEA 2PFEA 2Y5FA 3K6YA 2F91A 1ETRH 1M9UA 4A1XA 4DURA 4J1YA 1W0JD 4IN1A 4FU7A 1K0HA 1BRCE 1WV7H 1TABE 4CH2B 1ELVA 3U28C 1EAIA 1FXYA 2C3SA 1HIAA 2OTVA 1D3TB 3DSOA 2QGRA 1JWTA 5EQRA 1W12U 3HPTB 1LKAA 2ZCKP 3BN9A 1T32A 1A3EH 2BQ7B 3FANA 7KMEH 3RXEA 2CXVA 3WY8A 1TBZH 2BD7A 3UOPA 1GI6A 3ZYDA 4HG6A 1TNIA 1CBWB 3S9BA 1UK4A 5FX5A 2W5EA 4X8TH 1TE0A 1PQ7A 2FEQH 2SFAA 2VGCB 4OGYA 3SHCH 6CHAC 1DWCH 3E3TA 2C8ZB 1FV9A 2OBQA 1WCZA
chains in the Genus database with same CATH topology
1LQEA 1TPAE 3TJNA 2HNTE 1TGTA 2ALVA 2FMJA 3PWCA 1C9PA 5T6FA 2VINA 1MH0A 2BDGA 2FZZA 2HALA 2Y80A 3V12A 1T8NA 4NG9H 4LK4A 4ABFA 1HUTH 1U6QA 2P8OC 1TALA 3FP6E 3P70B 4OS7A 2B0FA 3GY7A 1Y3XA 3SN8A 1AZZA 1FUJA 1BHXF 4MNXA 2NU1E 2A2XH 6GCHG 1SBWA 3TNSA 3PM3A 1GHAG 5ESTE 1AFQC 4I7YH 3EA7A 4B76A 2BLWA 1HPGA 3RMNH 1L1GA 2PKAA 2ALPA 3KGPA 3PTBA 3RLYH 2RDLA 4BAQB 3OSYA 3RC5A 1UCYK 2ANKH 1Q2WA 3VGCB 4ABBA 1J14A 2PGQB 4Z6AH 3K9XB 3LGIA 3BG4C 3A81A 1WTHD 2FI5E 2VIQA 1ESTA 3SU6A 3BTTE 1Z1JA 1UCYH 1C5NH 4B2AA 1UTJA 4BAOB 1MKWK 1TNKA 1CT0E 4Q80A 4YLUA 4JZEH 3LGTA 1TRYA 2VWNA 4GHTA 1IQIA 1EZUC 2C4FH 1TWXB 2SGAA 1C5UA 3TNTA 2OBOA 2BDAA 1PPCE 1GI5A 1MKWH 1O35A 6CHAB 4FU9A 5JBCS 3T62A 1OX1A 4MPWA 1GGDB 2C90B 4XFQA 2GZ8A 3S9CA 3MH5A 3SOSA 2VH0A 4INHA 2GV6A 5DO4H 1LKBA 3F9FA 1AO5A 3RMMH 2XBYA 5C1XA 2GX4A 7GCHG 1GBTA 1K1IA 2GCTC 1E34B 1P03A 4A5TS 3BEIB 3S9AA 1UVTH 1GHYH 4KELA 3KHVA 5IYTA 1DITH 1WYKA 1UVUH 3STJA 4ABJA 1QJ6B 1W3CA 1UTPA 2J34A 3ENSB 1MMJN 2AMQA 1YPJH 3Q3YA 5HM2A 2BXUH 1MD8A 5F8ZA 2FOFA 2ZGXH 1MTNC 1G3BA 1O2ZA 3BG4B 1BMNH 3SJOA 2F83A 2WUBA 3TITA 3RXUA 3P17H 1P8VC 1AUJA 1NRSH 5A8XA 3A7WA 3SV7A 1F92A 1SR5C 5FX6A 2XC5A 1ORFA 1GI7B 1DY9A 4TWWA 2A5IA 2BD8A 1OP2A 4X2VA 1O0DH 1SHYA 1IQLA 1F5RA 1EAUA 2ZFFH 2ZGHA 1LVYA 1O5CB 1A7SA 1HYLA 2H1UA 4H6TA 5LH8A 1ACBE 4IS5A 2A32A 3FZDA 1GJ5H 4BXSA 5B6OA 4JYTA 2ZIQH 5BPEA 3P8OA 1HAGE 1YPHE 2R2WU 1IHTH 1HCGA 2DUCA 2P3UB 1HXEH 4ZHLU 3TGJE 3A82A 1P2IA 3LJOA 3GOVB 9LPRA 1TAWA 3QWCH 4Y7BA 1GMHF 3GYMA 2Z9JA 1Y3YA 4K69A 1NFYA 1JIRA 3TH3H 1AFEH 3ZVCA 2F9VA 1ABIH 1BQYA 3QTOH 2CF8H 1E36B 1TLDA 3MO3A 1C2HA 4Y7AA 9ESTA 2OC0A 2AFQB 2TGAA 1HAPH 1SG8B 3VFEA 1MTNB 2GTBA 3BIUH 2CJIA 4Y0YE 1ZSLA 1CQQA 1TX8A 3Q77A 3SUEA 4ASHA 1YPKH 1L1NA 1NRNH 2GD4B 2VIWA 4NFFA 3P95A 3V7TA 3LONA 2EA3A 2P59A 1ZPZA 3SNAA 1A0LA 2G4TA 1BBRK 5FCRA 2FDAA 3A85A 2Z3EA 2TGPZ 1EB2A 3PMBB 2FOBA 1K1OA 2XRCA 1C2FA 1YBWA 3P8GA 1NRRH 1BBRH 1HJ9A 4LZ1H 2UUFB 3O8DA 1W11U 3RU4T 1QQUA 1UMAH 1WBGB 3SUFA 4YT7H 1SLXB 1GJ6A 1C5OH 5T6DA 1C2EA 2BYAX 2SGEE 3ODFA 1Y3VA 1SGYE 2ZTXA 1AVXA 1G3CA 5GCHF 1ETTH 2FM2A 4O03A 3ZZCA 3ZZ7A 2XTTB 2BDCA 1GCTB 1TRMA 1A2CH 2XBWA 1TPOA 1BRBE 1RIWC 1GBFA 2ZPRA 1WTGH 1O5EH 4Q7YA 1GI3A 2BB4A 2GCHG 3A86A 2VWMA 1HAVA 1NY22 3MI4A 4IC6A 2BDYA 1F0SA 2WV4A 1UHBA 5DJ7A 3MH6A 4NZQA 2ZHFH 4ZH8A 4YOJA 5F6MA 1GI4A 1T4VH 1SGTA 1CHOF 4YOIA 1C2KA 1J17T 1GVLA 2XBVA 3PWBA 3RXJA 3SU3A 3ZVEA 3BF6H 1SFQB 4NFEA 1AUTC 3ZZBA 2FTMA 4U32A 1TQ7B 3TH4H 4O97A 1NROH 4JZIA 3VB5A 4RKJB 2WV5A 1FLEE 3ZV9A 4U01A 2F9NA 1O3GA 5A0AE 2H6MA 4AX9H 1C2JA 1C1QA 2Z9LA 5DPAA 2BLQA 2W7UA 1SMFE 1O2YA 1YM0A 3EA9A 1GMHG 1FZZA 3A89A 3VEQB 4JZDH 3K65B 1C1UH 5AFZH 4MPVA 2PSYA 1AWFH 3T29A 2G5NA 1AIXH 3BTDE 2BQWB 2BY7X 4CR5A 1HAYB 1N8OC 1GBAA 2VVUA 4NIYA 3TK5A 1GHZA 4HI3A 8GCHG 3A8AA 3CENA 1BRAA 1DWEH 3HGNA 1FIWA 1O2XA 1K22H 4AYVB 2P93A 1L2EA 2ZTZA 1A3BH 1TB6H 1EPTA 1KXBA 2BY5X 1Z8RA 1S84A 1CA8B 2G52A 3RMLH 1P11E 1ZLRA 2O9QA 3LC5A 1MTWA 1TPPA 5C1YA 2EI7A 4Y10E 2D1JA 1VGCB 4B2BA 2Y6TA 3TJOA 3SJKA 1NPMA 1GJ9B 1HLTH 3A8DA 2XC4A 3QGJA 1EJNA 4NSVA 2FWWA 1YPEH 4JCNA 1NRPH 2OD3B 2Q1JA 4FUJA 1V2KT 1HBTH 3KEEA 3ZZ4A 1O2MA 4RSPA 3PLKA 1C5MD 1XUJA 1FDPA 5GCHG 4RN6A 4VGCB 1D9IA 1TGNA 2IPHA 1NESE 3SV9A 1C5ZB 3ZVBA 3V3MA 4Y79A 4H6SB 1GG6B 1DOJA 3ZVDA 2ZECA 2JH5D 2XXLA 5C5OA 1Z8IB 4JZFH 1P2OA 3PV4A 1CSOE 2EI6A 1Z1IA 1BTXA 3L33A 4FUIA 4OS1A 1MCTA 2FX4A 2XWAA 1S0QA 4DT7B 1UK2A 3V0XA 2ZI2H 2ILNA 1IOEA 4AFZA 4LOYH 1P09A 2FI3E 2JETB 3A87A 2Z3DA 1CHOG 2YNBA 1LTOA 1SQOA 2FOHA 2IN2A 2D26C 4GHQA 2R2MB 4AORA 4MVNA 1C1NA 1G2MA 1ZR0A 4X1RU 2FP7B 1Y5BT 2BMGB 2BD2A 5TJXA 4AG2A 2ZPSA 3GCTF 3DT0H 5DKMA 3UR9A 3ZVFA 1Y5AT 1G3EA 3LT3A 1AKSB 4UFEH 1SSXA 1YGCH 2ZU1A 4JYUH 1BUIA 2DE9A 4CR9A 3TGKE 4TWYA 1QB6A 4I8HA 2F9BH 4AFQA 3KL6A 1EJAA 1PPFE 1FMGA 3RDZA 2A1DB 1ANBA 5JBBS 1LCYA 1N6YA 2TPIZ 3M5NA 1GHVH 3MH7A 3QN7A 1K1NA 1P3CA 1YPLH 1GI1A 2ZCLP 2QC2A 4DG4A 1GJAB 4YOGA 2FIRH 4XBBA 3O8RA 3BTHE 3EAJA 5A8YA 4AFSA 3GY8A 2SGDE 1G3DA 4YLQH 4DJZB 1W0YH 1GDNA 1O31A 4F49A 1O39A 3K2UA 1GVKB 5T3HA 1ZZZA 3NWUA 5EQSA 4BAKB 1KLJH 2ZPQA 3IITA 1EXFA 3ZZ5A 1QL8A 3EQ0H 4Y76A 5EOKA 2VNTA 1O2IA 1PQ5A 1AU8A 3VB7A 1CBWC 3RXQA 1GHXH 1TX6A 5E8EH 2BY8X 1B7XB 1KYNA 1ELTA 1KXFA 2VGCC 3EA8A 3O8BA 4YT6H 2GVFA 5EPYA 1GDQA 1FPCH 1W14U 3ELAH 5DP3A 1HAXB 1SGCA 1TQ0B 1NTPA 4AB8A 1DICA 3RXTA 1C5QA 1JRSA 3I29A 3A7VA 4ABDA 3ATLA 4Q2KA 1XXDA 1E38B 1W10U 1ZYOA 2C8XB 2WPLS 2HLCA 1ZTKA 3Q3KA 1W0ZU 2ZDAH 2J94A 1DWDH 2FODA 1BT7A 4UEHH 4KTCA 1C1TA 1QA7A 2Z7FE 3U8RH 1O5BB 3TJUA 5FPYA 1FAKH 1P57B 3M3SA 3SUGA 4B75A 5EW1H 1GI0A 1Z6EA 4ZXYH 2A2QH 5JB9S 2FYRA 3FFGA 3VGCC 1AHTH 2F9PA 4X8UH 3UPEA 3RXHA 4ZMAH 3UY9A 2BLVA 1C5RA 1HIAB 3P6ZB 5DK1A 4XBCA 1K1MA 1C1MA 1C2MA 4MNWA 3HKJB 1O2WA 2G4UA 1H9LB 1QCPA 1UK3A 1SGNE 3MMGA 4WJG2 2Y82A 2GT7A 3S7HB 2ZDLA 1LO6A 2AIQA 2G55A 2PKSB 3A88A 5FBIA 1UCYE 4Y6DA 3LH1A 4MTBA 1GPZA 1AB9B 1BTZA 4WY3A 3PLBA 1V2VT 1MTSA 4AGKA 1VJAU 4LXBH 2VVCA 3EGKH 3E16B 3LJJA 5L30H 3M3TA 1GGDC 4ABGA 5H4IB 1BB0B 4INKA 2D2DA 2H5DA 5FAHA 3NCLA 3RXDA 1C4Y2 3H5CB 2HNTF 1XUGA 2XCNA 1HFDA 4JMYA 2TBSA 3P8NA 3TPIZ 3JZ1B 4WMEA 4INLA 4MNYA 5F8XA 2QIQA 2WPMS 1V2LT 3HKIB 2THFB 4R8TB 1KXEA 3I78A 3TVJB 3O8CA 4H42U 1TGBA 1V2QT 2PKAB 1OS8A 1D3QB 1NC6A 2A4GA 1AWHB 1LVMA 2BD3A 3AASA 1TA2A 3UIRA 4Z0KA 4K2YA 2HVXA 3BIVH 4D9QA 2R3UA 1S6HA 2O8TA 3MHWU 4OS6A 2V0BA 2QAAA 3F68H 3SJ8A 3DFLA 4NIWA 4KTSA 2W7SA 2PTCE 2A4OA 1WOFA 2GGVB 3RXRA 1MZDA 4WWYA 3E0NB 3VB3A 3RXAA 1O2NA 1OPHB 2HNTC 2FX6A 4E7RG 1IHSH 2UWPA 3ZVAA 1B0EA 1O2OA 1BTWA 6ESTA 1PPHE 4B2CA 1NFWA 1THSH 1VR1H 1SVPA 4ISNA 2UUYA 1TA6A 2BOKA 1BTUA 2ODYB 1MTUA 3F1SB 2PUQH 1AE5A 3E6PH 1OWKA 4RKOB 1O2UA 3PB1E 1BZXE 3W94A 1V3XA 2UWLA 1ZMNA 4B71A 5FPTA 5JBTA 1PPBH 4WMDA 1QBOA 5T6GA 3MU1A 1TMUH 1Y5UT 3SV8A 1ZPCA 1NU7B 1ZPBA 4FVBA 4BXWA 3LDXH 3GICB 3RXKA 5FCKA 1PPZA 2AIPA 1N1LA 1NO9H 5A0CA 1O2PA 5K0HA 1UVPA 5EXLA 1RTKA 2P3FH 4X6PA 1J16A 1O2TA 1AN1E 4ZXXH 2G81E 2ZWLH 3QZQA 4R0IA 4KGAA 2D8WA 1Y3WA 3SI4H 4AZ2B 2ZU3A 2C8YB 2I6SA 1YF4A 2K1QA 2PR3A 2VIVA 4K3JA 1O3OA 3URCA 1XVOA 7ESTE 2FTLE 1CVWH 1L4ZA 1ETSH 2HPPH 4MLFB 1TYNA 4E05H 3SGBE 1C5TA 2GMTB 2H9HA 1THPB 4ZKSU 4OS5A 2QCYA 1TX7A 1HB0B 1QA0A 3Q76A 1OWJA 1SGFG 1UVSH 3BTFE 1F7ZA 1SGEE 3QZRA 1GBMA 3ATWA 5LPEA 3BV9B 3D49H 1LQDB 3KF2A 1DLEA 1FY3A 4CRFA 4UFFH 5C1UA 1O3DA 2Q6FA 4CRDA 1MBMA 4B1TA 2AGGX 1P02A 3A80A 1NS3A 5J4SA 1V2JT 5GDSH 1BBRE 1OWHA 3ZVGA 2R0LA 1O2GH 1V2UT 1P9UA 1YCPM 1Q31A 4FVDA 3KQEA 1IQHA 2LPRA 4K1TA 4XDEA 1HGTH 1VZQH 3RU4E 4WF8A 1F0TA 3UR6A 3DA9B 3LC3A 1GCTC 4Y71A 3KIDU 1C5VA 1ELBA 3EYDA 4DVAU 2OINA 4CBOA 2Y7ZA 1XUIA 3Q3XA 2ZGJA 1P2MA 1HV7A 1OOKB 3LGYA 4B73A 4O3UA 1NFUA 4OGXA 2OP9A 1GBLA 2CV3A 1C2IA 2GZ7A 4ABAA 1O2SA 3MNXA 2TGDA 1KDQB 3QO6A 5CHAB 1HAIH 1CE5A 1DX5M 4HGCA 4PROA 2IJOB 1VITF 1ZGIA 5EGMA 4AG1A 4BAHB 2F9OA 2GDDA 1EOLA 1OP0A 4YM9A 1BCUH 1C2DA 2BVXH 3KQDA 3KNXA 3KQCA 1WQVH 5ETXA 1O5DH 1O33A 3LKWA 1EX3A 1PPGE 1XM1A 3U69H 1H9IE 2QXGA 2AMDA 2XWBI 4I32A 1O5GH 1DVAH 1YC0A 4ISIH 2V35A 4MPUA 2SNVA 4XSKU 1YPHC 1UTNA 1OKXA 1W7XH 2GT8A 3M7QA 4AOQA 3N7OA 1JMOH 4TY6A 1EJMA 3QTVH 4KTUA 3SW2B 1TFXA 1O3LA 1GVZA 4A92A 1LPGB 2FOEA 1PJPA 4FUCA 1MKXK 1ZMLA 2JKHA 3U1IB 1S82A 2J38A 3ZZ3A 3TK9A 1VCQA 3NUMA 3QX5H 3ATKA 4ISLA 1QRWA 5E0HA 4HFPB 4D7GA 5GPIB 3LU9B 5C2ZA 2FLRH 2VIOA 2LNCA 5SGAE 1GBCA 2W3KA 1MKXH 1BTPA 1V2MT 2NU0E 1ELDE 4MNVA 1J9CH 2SGFE 3IG6B 1UHBB 2ZGBH 3MNCA 2VU8E 4NIVA 3KN2A 1IQFA 2XW9A 3EE0B 1C5YB 1KY9A 1XUFA 4I31A 4MPXA 5A0BA 2OQ5A 3PMHB 1VGCC 4CH8B 2BLOA 1SGRE 6LPRA 1KXDA 3RMOH 3MOCA 4U2WA 2A5KA 2XYAA 3ITIA 2VIPA 2ANWA 2UUKB 3SO3A 2STAE 1XX9A 4CRAA 5HGGA 1GBHA 1DPOA 1GMDF 1GJ8B 2SNWA 5JBAS 1GBKA 1VITH 5EXMA 5EU8A 1A1RA 1IQGA 1L1JA 2HRVA 1A61H 1KLTA 2OC1A 1MD7A 2XBXA 1B5GH 3RXFA 4DCDA 1C4V2 1VCPA 2V3OH 3M35A 4X1SU 3E8LA 4ISOA 4O9VA 1TNGA 2VWLA 3RXIA 4VGCC 2ZDMA 5CMXH 1C1RA 2Z3CA 3B8JA 1K1PA 4UD9H 4IN2A 5GJ4B 1G