3GY7A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 55
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy7A02
2Z9IA 2ANMH 2RDLA 4PROA 3K2UA 3SV9A 5LPEA 4A1XA 3FVFB 1TGCA 1AN1E 1HIAB 2ODPA 3V7TA 1P3CA 1S0QA 7ESTE 1ZMLA 2AMQA 1ZJKA 4YO9A 1NFUA 1BTYA 2BY8X 3O8BA 3EA7A 3RXAA 3ZZCA 1AHTH 2CF8H 3MO6A 1TWXB 1P2QA 4WH6A 3PWBA 1ELTA 4E06H 3M7QA 4DG4A 3BTKE 2FO9A 2NU4E 2VWLA 3W95A 1P05A 3EA9A 2O8UA 1XM1A 3LH3A 1RIWB 4U30A 3U98H 4KTSA 1NFWA 2VIOA 2H9TH 4OS1A 3PMHB 4BTUB 1G3DA 4Z6AH 1OSSA 2WUBA 1A7SA 6GCHF 3SNCA 2OC7A 2AMPA 4ABEA 1V2TT 2ZQ1A 2XWAA 1T8MA 1VCPA 2A31A 2BDGA 3TK9A 2R0KA 1ZPBA 2ANYA 1SB1H 1AFEH 1EZSC 2XYAA 2XBWA 2TGAA 3SUGA 3ZYDA 5TCAA 3UWJH 3RU4D 2WYJA 3DFLA 4U32A 1X7AC 2R3YA 2SGEE 3UNRA 1T4UH 1V2PT 1C9TA 1GMDF 5A0CA 4MQAA 3MO3A 2JETC 2KAIB 1Y3VA 3PYHA 1FDPA 3EDXB 2W3IA 2BD4A 3SJKA 1GBKA 1DFPA 1EZUC 1BT7A 1J15A 1P2IA 4DJZB 1KXDA 4I33A 4YOGA 2IJOB 4XE4A 2FEQH 1O5EH 4RN6A 5L6NH 4CRFA 1OOKB 1GJAB 4MTBA 1GPZA 1PPZA 1KXEA 1TNJA 2CHAB 1V2QT 2V35A 4IN2A 3UOPA 3DA9B 4DVAU 4RSPA 1ZOMA 1VGCB 2FS8A 2THFB 1W0ZU 2ZGHA 4D9QA 1HAZB 1TRNA 5GCHG 4D7GA 3P8NA 5IYTA 3LONA 1DANH 2WPJS 1ETTH 1SGEE 3C1KA 1UHBB 1QRWA 1THSH 2BXTH 5LGOA 1GI1A 1CA0C 7GCHF 1EPTC 3SU4A 1FJSA 5FBIA 4O03A 3TIUA 3L33A 4MDSA 1BZXE 3Q76A 4K60A 4HFPB 1YPMH 2AERH 5C1UA 2FMJA 2VU8E 3T25A 4X6PA 2WPLS 4HTCH 4WMEA 5E0GA 1DT2A 1FV9A 5TJXA 4ZXXH 4B2CA 5GCHF 1QL7A 3A84A 1QNJA 1LMWB 3QLPH 3STIA 5F03A 1V2UT 2ZTYA 2ZP0H 1TNGA 4VGCC 1LHFH 1EX3A 1P3EA 2SGAA 3UNQA 2P16A 5E0HA 1TNHA 1TONA 1J14A 1QBNA 4Y7BA 1P9UA 2AGIX 4U01A 3NZIA 3LGIA 1TQ7B 3AW0A 4ABDA 4FUFA 1EUFA 2HNTC 3A8CA 1Q2WA 4BAHB 1WAYB 9ESTA 1ACBE 1IQFA 1NU9A 2FTLE 1O2JA 2ZWLH 3RC6A 5DP9A 2BTCE 5EXMA 1GL0E 4INLA 1LHCH 4UFGH 4ZHAA 3M5MA 2Z7FE 4IC6A 2ZDNA 2BHGA 3QN7A 1QURH 5EG4A 4Y8YA 2P59A 2K1QA 1PFXC 1TLDA 1IQNA 1LHGH 1P2KA 1QB9A 3SU6A 5DO4H 1MU8B 1MBMA 1A46H 3V12A 1B0FA 1HAXB 3RMLH 2Y6TA 2BLQA 1HJ9A 4K2YA 2G8TA 3PLKA 2NU0E 1FY4A 4JCNA 3MWIU 3A88A 1HGTH 3DUXH 1C1WH 2G81E 1W12U 3TITA 2ZHWH 1DPOA 2AIQA 1HJ8A 1RIWC 1CT2E 4WH8A 2ZU5A 2ZIQH 1QL8A 3I29A 1UVUH 3PM3A 1Z8IB 1CU1A 3GISB 3ODDA 4ABFA 2PLXA 1YGCH 5J4SA 2VJ1A 2FPZA 1FNIA 1GHYH 1VCQA 4LOYH 2VNTA 2GDDA 1GI6A 2JH0D 1ZRKA 1T4VH 1O3CA 3HK6B 4NSVA 1Y3YA 4GCHG 1YF4A 7KMEH 1O2WA 1QIXB 3LKWA 4MPVA 1T7CA 4B2AA 1BHXF 4D8NA 2J9NA 3ZV8A 1O2IA 1D3DB 1VJ9U 4GAWA 1HAOH 3SW2B 3F9GA 1OKXA 4Y76A 4I7YH 2H5CA 4O97A 1RJXB 4WVPE 1Z6EA 4CREA 4Y10E 4FUDA 1ESBA 4JZEH 1DVAH 2B9LA 3EAJA 2ULLA 4UONA 1NU7B 3U9AH 1RTFB 1XXDA 2UWOA 5DKMA 5I25A 3PTBA 1WOFA 2VIDA 1P0SH 1UK3A 2CHAC 2OQUA 1O5AB 1SSXA 2FI5E 3U1JB 1DUAA 3S9AA 3T62A 1AZ8A 4ZKNU 2HNTE 1RRKA 1GI3A 3LGUA 2PSYA 2ZI2H 1DOJA 5E2OA 2XCNA 2OINA 4DGJA 1YLDA 4HI3A 4OS2A 1IQJA 8ESTE 4Y0YE 1UTQA 3GDSA 2BY5X 1HXEH 1UVPA 1CA0B 3ZZ5A 4FUCA 1GCTC 4CRGA 2Z9GA 1G3EA 1T8LA 4MPWA 1SR5C 4R0IA 4UD9H 2EI7A 1DWBH 2BYAX 1MU6B 1C5QA 2XRCA 5E8EH 3OY6U 1DWCH 1CHOF 3OU0A 2D26C 3LC3A 2ODQA 1C5LH 3ZVAA 3JZ2B 1HFDA 1SG8B 5L30H 2IN2A 2OBOA 1C5RA 3KIDU 4E7NA 2ZPQA 2ZU4A 3WY8A 1YPEH 1HCGA 2BD7A 2IPHA 4ABBA 3PLBA 1OS8A 1P03A 1C2LA 2Q1JA 1PPFE 1DY9A 1GGDC 1SFQB 1SGYE 1O3AA 1EAXA 3QDZB 5GWZA 2FOFA 4UFEH 5A8ZA 3A7ZA 2Z9KA 2G52A 2XWBI 2PSXA 1AFQB 2BDHA 3D65E 4O9VA 2EC9H 1F0RA 4KELA 1GVLA 2ZTXA 1NRRH 1GJ7B 3HATH 5IDKA 1Q3XA 1C5VA 1LQDB 2QXGA 2A4RA 3RLYH 5FXLA 2M5TA 3TH4H 2GV6A 1TA6A 1N8OB 5JPMH 3RLWH 2JETB 4BAQB 1P9SA 4TPIZ 3AAUA 4Y11E 3KQDA 4M7GA 1KXFA 5EW1H 2FOHA 4FVDA 2P8OB 2VWNA 2H9HA 4BTTB 1G3BA 1O35A 3ZYEA 3KN2A 1TPOA 3E16B 2CJIA 3TGJE 1N1LA 2AS9A 2G5NA 1J16A 1OWKA 1NRNH 3EYDA 3ZZ4A 1BRCE 3V0XA 3U69H 1HJAC 1YP9A 1EAUA 3P92A 3MNSA 5FPTA 1W3CA 1WTHD 1EKBB 1O2NA 4NZQA 1ABIH 3SV2H 4IGDA 1HXFH 1CBWC 3PMBB 3RXRA 3SJ9A 1GDNA 4YTAA 3GY5A 4I8HA 4FU8A 4R8TB 1ETSH 1GBFA 4NA7A 3TNTA 4Y8XA 4NSYA 1SQAA 3DHKH 3E0NB 3TU7H 3MU8A 3D62A 1TMUH 3SV8A 2ZU1A 1K1NA 3PV4A 3GY3A 1O2HA 3PTNA 5CHAC 2A4QA 1BIOA 2P3UB 1YPHC 4RKJB 1FUJA 3ZVBA 8KME2 1MD8A 1GWAA 2F83A 2XNIA 1BMAA 4YLQH 2HGTH 1Y5AT 1LPZB 2GVFA 2D2DA 1GJDB 2P3TB 2OXSA 4XDEA 4E7RG 5C3NA 3ENSB 3KQBA 3FAOA 1TOMH 1G36A 2BX4A 3ZVGA 3E0PB 1C4V2 1VITG 1XVMA 1V2VT 2CF9H 5JBCS 1SLXB 3PMAB 2WYGA 3T26A 3MU0A 2G4TA 1EP5A 4IW4E 1SI5H 3N7OA 1YCPM 4BAMB 2W7UA 3STJA 2W5EA 3FP8E 4ABHA 1FY1A 1YLCA 3O8CA 3RXGA 5FX5A 4CBNA 1O3NA 3GDVA 1C2IA 1GHBG 1JXPA 3A8BA 3TVJB 4DURA 1PQ5A 3URCA 4NGAH 1ELAA 1WV7H 4GLYA 1GBHA 1EJMA 2FYRA 2GDEH 4OS4A 1KTSB 1L4DA 1OWIA 3LJOA 4X8UH 1YPGH 1NROH 3UR9A 4D76A 3SNAA 1O31A 2AIPA 2VINA 2NU2E 1HAGE 1SGDE 4B73A 1P8VC 2Z6BD 4WJG2 3T29A 1FPHH 2PFEA 3KQCA 1HIAA 1GCTB 3AVZA 1C1MA 2R0LA 3MTYA 3RM2H 2Z9LA 2QN5T 2D1JA 3D49H 1O3PB 2BD9A 3GCTF 3QO6A 1QJ1B 3GOVB 1O3DA 1RTLA 3GY4A 5C2ZA 1P2NA 4NWLA 3I78A 3RXTA 3HKJB 1HLTH 5L2ZH 1XX9A 1K1OA 5EODA 1HAIH 1QB6A 5C5OA 4GUXA 4NIYA 2C8ZB 2GMTB 4WXIA 2BOHB 4ZUHA 2WV5A 1HB0B 1AE5A 1DXWA 3SU3A 2BY6X 3ODFA 2BD8A 1V2OT 2H1UA 5GJ4B 2HNTF 3LU9B 3Q3KA 1K22H 1DX5M 1V2KT 2OC0A 4X1QU 1WTGH 1TYNA 3SJ8A 1O34A 4X1PU 3RMNH 4CH2B 1EATA 3SUFA 1QRXA 1GMDG 3VB5A 3VB7A 4D7FA 1PJPA 1BBRK 3R0FA 3TLOA 5BPEA 1ZTJA 2BZ6H 1C5WB 1O2YA 1V3XA 5DP8A 2GCHG 2Z3EA 4BXWA 4MVNA 1KDQA 3S69A 1HYLA 1ZMNA 3P8GA 4RKOB 1FXYA 1LTOA 1O2OA 2QF0A 3FZDA 1AB9B 1F7ZA 2SGPE 2ZPRA 2Y81A 1HV7A 3RXJA 3GYMA 1ID5H 2ZDAH 3QUMP 1C4Y2 2ZGBH 1NTPA 2BDAA 1UK2A 4B71A 5ABWA 3BIVH 5AFZH 1O2PA 1AIXH 5CMXH 2C8XB 1K21H 4X6NA 1Z71A 5EQRA 1TMBH 2WUCA 2XBYA 2OP9A 1FQ3A 1KSNA 3ATMA 1GI4A 2Y5HA 1T31A 2GZ7A 1GBMA 1D9IA 3LJJA 5JBTA 2ZHFH 1NS3A 1D3PB 2G55A 2Y80A 1FI8A 1UTPA 2BQ6B 1SGIB 1T8NA 2XBVA 3M36A 1AB9C 1BBRH 2EA3A 3A81A 2GX4A 2VH6A 1O2XA 5F6MA 3SGAE 1GHVH 4NWKA 1GJ4H 1THRH 4KKDA 1SOZA 2ZHEH 2BB4A 2QCYA 3BV9B 2AMDA 1CBWB 1MTUA 2ESTE 4ZKRU 3QZRA 5JDUB 3MU1A 1E35B 3PMJA 2ILNA 2F9OA 1XUKA 2GCTB 1SGFA 1GJ5H 3GCNA 2J95A 5C1YA 2BM2A 1YPLH 2C8YB 1GHXH 3A7VA 1OP0A 3RM0H 2PUQH 1C5PA 4ISNA 3B23B 1BB0B 2ANKH 2HLCA 2CV3A 3NKKA 3PO1C 1GBBA 2FWWA 3B8JA 4AG2A 6GCHG 3MMGA 1QBOA 4YESB 1BHXB 1F0TA 2ZQ2A 3BTDE 4FUJA 4JYTA 2Y82A 3VB3A 3SNEA 2XC0A 3F9EA 2EI6A 1Y8TA 4ZKOU 1ZTKA 5EOKA 3MH7A 2Y7XA 1UVTH 3IG6B 1TRMA 1NFYA 2BX3A 2AFQB 1SBWA 1G30B 2RG3A 2RA3A 2ZFPH 4TWWA 1GHAG 2OTVA 3OX7U 4ZMAH 3SUEA 4AOQA 5C20A 1J9CH 1UVOA 5A8XA 1RS0A 1F0UA 2B8OH 3RC4A 5FX6A 1MCTA 1PPBH 3U1IB 2HRVA 1Q31A 4GHTA 1OP8A 5K7RA 4DY7B 2GT7A 2Z3CA 1CT4E 1O2LA 2C90B 3BTME 4ZHMU 3VB4A 1BRBE 5EQQA 1TMTH 2ZF0H 3QZQA 1JIRA 3A8DA 1C5XB 3TGIE 4MPUA 1Y3XA 2ZDVH 4HZHA 1BDAA 1IQLA 1EJNA 1MTNC 5F8TA 1SPJA 1Z8JB 4AFSA 1M9UA 3RXOA 3SBKA 1ZRBA 3S9BA 1PPEE 2P8OC 2QY0B 1VR1H 2BVRH 1OWDA 3QGJA 5E2PA 3SHAH 5JB8S 2PWXA 3ZZAA 4AGJA 2BD2A 4AORA 3MNBA 3VGCB 2NU1E 1MZDA 1UTJA 1LVYA 1LPKB 1O5BB 1OP2A 5PTPA 1S82A 3SU1A 2SNVA 1NFXA 2AH4X 1D3QB 1OYQA 3GICB 4NZLA 3VFEA 1U6QA 1C1UH 1A0HB 4AX9H 2F9PA 1G2LA 2WINI 2GMTC 1S81A 4DCDA 1ANBA 3MFJA 4LZ1H 2GZ9A 1ZSLA 1QJ7B 1AWFH 2ZTZA 4ABJA 3Q00A 1H4WA 1NM6A 3LT3A 1EP6A 1HAHH 2QXJA 4OGYA 2FXRA 1P11E 2W26A 4X8SH 5EPNA 2V6NA 2BVXH 3KGPA 3UIRA 4AG1A 1BTUA 3SU5A 1FY8E 3UR6A 4X1SU 2QV1A 3A8AA 2BQ7B 3LPRA 1KXAA 3GY2A 2P95A 2ALVA 5HGGA 1NPMA 1ARCA 1AD8H 3CS7A 1ZTLA 2QC2A 1ZSJA 2O9QA 4K8BA 1W8BH 2D8WA 3MHWU 1TQ0B 1VCWA 1Z7KA 1TBQH 8GCHG 1JRTA 3C27B 4F49A 1BRAA 2DE8A 2C4FH 1OX1A 1P02A 1GJ9B 1C1SA 2VVUA 4AFZA 4MNWA 1EASA 3ATIA 4VGCB 1GI7B 2PGBB 3M7UA 4WWYA 1C2FA 4X8VH 1F5KU 4F4OC 3TPIZ 1W13U 3S7KB 1BITA 2BMGB 1ZGVA 2B7DH 4GSOA 2O8LA 4X2WA 2G5VA 1KXCA 3RXDA 3RXVA 1HAYB 3R3GB 3HGPA 2A7HA 1A5GH 1O3BA 1V2LT 1GBTA 1JBUH 1F92A 3BF6H 1EAIA 5FBEA 3M5LA 4J1YA 2A5AA 1EPTA 4INKA 1GHAF 4GPGA 3SV7A 1Z8RA 7GCHG 3A80A 1S5SA 2PKAA 3VB6A 3M37A 1O33A 1VITH 5FPSA 3PROA 1GI9B 1RXPA 1BOQA 1CO7E 1QA7A 4NCYA 1V2WT 1K1PA 2AGGX 2ZO3H 3UTUH 1ELEE 5C5NA 2O8MA 2O8TA 3L3TA 4LK4A 1NT1A 1C2EA 3L6PA 1L1GA 3P95A 1IQGA 5CE1A 1N8OC 1ETRH 4X2XA 2BXUH 4OS5A 4XBDA 3T5FH 1AY6H 2FX4A 3SQEE 3LGTA 4ISLA 1L1NA 2JKHA 1C2KA 1SGCA 3E8LA 2NU3E 2I6SA 3U8OH 3D23A 3MU4A 5EXLA 3RXEA 3MH5A 5HM2A 5HXFA 1Z1JA 1GHBF 1WYKA 3RP2A 1EZXC 1GG6B 1P2JA 1MMJN 5T6FA 1GDQA 1KLJH 3RXKA 3ZZ3A 2CN0H 3EE0B 1FY3A 3GY7A 5FPYA 3LIWA 3SUDA 4X2VA 3BTFE 3ZZ9A 2CGAA 2Y7ZA 1XVOA 4UEHH 1CGJE 3RXSA 9LPRA 3NUMA 1ZJDA 1ZSKA 2ZZUH 1AQ7A 3RXBA 5EW2H 4YM9A 3ZZBA 4KTUA 4D9RA 3BN9A 1Z1IA 3PWCA 1W7XH 2ZGXH 1GHZA 4CBOA 3SU0A 1GI0A 1ELBA 3U8TH 1S6HA 4Q80A 2Q6FA 4LZ4B 4Y8ZA 3M35A 4TPYA 1DE7H 4AN7A 1C1OA 1DSTA 4Q2KA 2HWLB 1GI2A 3MYWA 4B74A 3QK1A 2EI8A 3NPSA 4ZHLU 2FM2A 1VJAU 1FN8A 3MNCA 5FCRA 3MNXA 3A86A 2AYWA 1INCA 1O2RA 5A0AE 1UTMA 1O3EA 4X2YA 5A8YA 2FTMA 3LGYA 3FP6E 1GBCA 4CRBA 1P01A 3ZZDA 1GL1A 4XOJA 4IBLH 2FI3E 5DP6A 3RUOA 1AUTC 1TIOA 1DICA 1YPHE 1QR3E 1MUEB 5AVDA 3M5OA 1DY8A 1IQEA 2ZDKA 1SGTA 3CS0A 4K1TA 3CP7A 1FIZA 2GKVE 1C5SA 1DM4B 1O2KA 2A2XH 1FAXA 2V0BA 1UTOA 1C5OH 1GBJA 2FOAA 1UTLM 5T6GA 4MPXA 3Q3XA 4MLFB 1F0SA 4OS6A 1IOEA 2AGEX 5C1XA 1GJCB 1WCZA 2ZGCA 1BMNH 1O2SA 2BDBA 4K1EA 1UMAH 1J17T 3GCTG 2Q6GA 3S9CA 1ESTA 2UUYA 1BUIA 5DP3A 5TCCA 1KDQB 4LXBH 3ZZ6A 1GMCF 1H8DH 1HPGA 1F5RA 2ZFRH 1O3HA 4BTIB 3LH1A 3O8DA 2BOKA 1GBEA 4CR5A 3QWCH 1AVWA 1GGDB 4O3TA 3RU4E 1C1QA 4IMZA 1KXBA 2OC1A 1QHRB 3RXPA 1VZQH 3H7TA 2ZHQH 1S6FA 3FFGA 1NRSH 1GCDA 4JK5A 1C2JA 1HAVA 1EAWA 5JYIA 1A0JA 2BDCA 1ZMJA 4WF8A 4FU9A 3UUZA 1AZZA 3SZNA 1LHDH 2A5IA 1GI8B 2VH0A 1TB6H 1VITF 3TK6A 1K9OE 3ELAH 2A32A 5F8XA 3K9XB 1GVZA 1JIMA 1K1JA 3SGQE 3F9HA 1S83A 2GGVB 1EOLA 1H1BA 3K65B 3ZV9A 1SL3A 3ATWA 4YT6H 1C1TA 5L2YH 4FUIA 1CHGA 4OGXA 1XXFA 1ELDE 1G3CA 1TPAE 4DW2U 1T32A 3SJOA 2CXVA 4Y71A 2A7CA 5AF9H 1W11U 2OCVB 1V2JT 2V3HH 1BQYA 4YT7H 2TGDA 1O3GA 1XMNB 5EGMA 4AZ2B 2C3SA 1OXGA 1LDTT 1JWTA 2PUXB 1AGJA 1WSSH 1BA8B 1MTSA 3EQ0H 7LPRA 5A0BA 3KQEA 2GV7A 3FANA 2ZCKP 3P70B 3ATKA 1C5ZB 2ZGJA 2FDAA 2XBXA 1GBDA 2VGCB 1FLEE 1LQEA 3TJVA 3F9FA 1SLWB 2J34A 1GJ6A 1MKXH 3OTJE 5DP4A 2R2MB 2H5DA 2TIOA 1IQMA 3F6UH 4JK6A 1K1MA 2A0QB 2BY9X 2FX6A 4ISHH 4K69A 3KL6A 1FN6A 2VIQA 4INHA 1PYTD 2ZNKH 1VGCC 3AW1A 2KAIA 4CHAC 4JZDH 3M61U 3ATLA 4NIXA 2ZPSA 3SV6A 4ASHA 1MKWK 1DITH 2BD3A 2FZZA 1MCVA 1Y5UT 2ZFSA 1TPSA 2PKSB 4MNVA 3S0NA 1NESE 2A5KA 2OD3B 2C8WB 3JZ1B 3GDUA 3K6YA 1MTVA 2XXLA 1A3BH 4UDWH 1SVPA 2FIRH 1QGFA 1ZHMA 6CHAC 4WY3A 3RXMA 1OWHA 2TBSA 2VIPA 4YOIA 1SGPE 2XC5A 1F5LA 1C2DA 1WBGB 2A7JA 2VWOA 1A0LA 2TGPZ 2XC4A 3RXUA 4CRDA 2FOCA 3LOXA 2UUFB 4MNYA 6ESTA 2J38A 1GVKB 2ZHDA 1EB1H 5F8ZA 4DIIH 2STAE 1L0ZA 3BTTE 6CHAB 1O3JA 1S84A 4A6LA 4IS5A 1LVBA 1MBQA 1UJ1A 1T8OA 1ZZZA 8GCHF 1PYTC 3VPKA 1O5CB 1YC0A 2ASUB 1EXFA 4QT8C 2O8WA 2VVCA 3TNSA 2PV9B 3GCHB 1SOTA 2A2QH 1ORFA 4Q7YA 2HPPH 1KYNA 5DP7A 2ZECA 3A83A 8LPRA 2BDIA 1QL9A 4FUGA 1A5HA 1MD7A 1TGNA 2P93A 3RXQA 2B5TB 4AB8A 1Z6JH 2YNBA 2ZCLP 2GD4B 3FZZA 1SHYA 2PTCE 3KEEA 1S85A 1FAKH 1TABE 2WPHS 1W14U 2FP7B 4CRAA 2G51A 2BLOA 1B7XB 4NA9H 5DJ7A 1MTNB 2SFAA 4B75A 2PTNA 4U2WA 1K28D 1TNKA 1AVXA 1UHBA 6LPRA 1O3MA 3QX5H 4B2BA 1N6YA 3M3VA 4AYVB 1LKAA 4TYDA 1W10U 1GMCG 4H6SB 3U8RH 1XUHA 1IHSH 2FESH 3SU2A 1B0EA 2Y5GA 1IHTH 4GHQA 1SMFE 1PQ7A 1H9HE 2TPIZ 5LPRA 1EQ9A 2HPQH 1MAYA 3BTQE 3K6ZA 3MH4A 2QGRA 1PPCE 1GJ8B 2OLGA 1ZPZA 3RXIA 5DPAA 1ELCA 3VEQB 1EJAA 1SFIA 1NZQH 1H9LB 1PQAA 3UOUA 3IWMA 5EXNA 2OQ5A 4I8GA 1O37A 4FUHA 4KGAA 4DOQA 1ELVA 3UQOA 2FYQA 5HMAA 2R2WU 1F2SE 1GMHF 3IITA 3TJNA 1C2HA 3PO1B 1CQQA 2BDYA 5B6OA 1O3LA 5GPIB 3SN8A 5EU8A 1O2VA 4ABAA 1G2MA 3AAVA 3KF2A 3TH2H 1A4WH 2ZCHP 1TRYA 4TY6A 2GTBA 1OPHB 2OBQA 1P04A 2ZFTA 4UFDH 3CENA 1SLVB 1P09A 4ZROA 2ODYB 3SJIA 5JBAS 2G00A 1TFXA 3ZZ8A 1QBVH 4ZH8A 1C4U2 1DLEA 1MQ6A 2QXHA 1XUJA 2BQWB 5JB9S 3F1SB 5EQSA 2ANWA 3DT0H 3LGVA 4NFFA 5LPFA 3BG4B 3UWIA 1G32B 2PW8H 1YYY1 2VVVA 1K1LA 3BTGE 2LNCA 3BSQA 4ISOA 1NN6A 1JRSA 2UWPA 1FIWA 3E3TA 2A1DB 3RXFA 4TWYA 2C93B 5G4BA 4AFQA 1ANEA 1O30A 3GCOA 1AVGH 1E34B 5A2MH 2AEIH 1TGTA 2XTTB 3LGWA 1GI5A 1YM0A 3M3TA 3SNDA 2QAAA 2EEKA 4CR9A 3E6PH 1WU1A 2FOMB 1V2NT 1KTTB 3BG4C 3QTVH 5FCKA 2BLVA 1AI8H 1QB1A 4BAKB 1DSUA 1C2MA 1CHOG 1FMGA 2H2ZA 1LVMA 4Z0KA 1XKBC 1KLIH 1MTWA 3GY6A 1K1IA 1UCYE 1W7GH 1S0RA 1KY9A 3OSYA 5BRRE 3T2NA 2A4GA 3OYPA 1TA2A 1SGFG 4ABGA 1TNLA 2ALPA 3NXPA 1O38A 3NK8A 4K3JA 2GZ8A 3UREA 1IQIA 1ZR0A 2H9EH 2BD5A 3SORA 3F68H 3ZVEA 4BAOB 1A61H 1P06A 1TBZH 3V3MA 5SGAE 3W94A 4IN1A 2CMYA 1O3FA 1G37A 4FUEA 1ZPCA 1O36A 1E0FD 1L2EA 1V2MT 2FOGA 4WMFA 4I31A 3ZVDA 1TOCB 1LPGB 3E90B 4JZFH 2YNAA 4X6MA 3MI4A 1TX8A 4K5ZA 3BTWE 1E36B 3ZZ7A 5AHGH 1GHWH 2PGQB 5AFYH 2ZFFH 1GMHG 1ZHPA 1CA8B 1O2GH 4XFQA 2ZG0H 1SGQE 2FOBA 4J2YB 3UQVA 2FOEA 1ZHRA 5DP5A 2HOBA 1WQSA 1RFNA 4WXVA 4ZXYH 1E38B 1GBLA 2RCEA 5DK1A 2LPRA 1G9IE 1HNEE 3VGCC 1XUFA 3TJOA 1MKXK 4OS7A 4ZKSU 1RD3B 2SGFE 2VIVA 1TX6A 1UTNA 1ELGA 1XUGA 2FI4E 4ZAEA 1BMLA 1SC8U 3URDA 1NRQH 3ZVFA 2ZFQH 1YCPH 2BY7X 3OY5U 3TK5A 1ANDA 4A1TA 2GCTC 3SI3H 1TALA 4A92A 2WV4A 1IQKA 1C1VH 1O39A 4CH8B 2F9NA 3MU5A 1QFKH 4Q7XA 1UCYH 3QTOH 4X6OA 1EPTB 1HUTH 3RXLA 4THNH 3SQHE 1SQTA 2G4UA 2HVXA 1QRZA 1YBWA 2H6MA 3UPEA 1TGBA 2OC8A 2Q6DA 1BTHH 3P6ZB 1LCYA 2J2UA 1LVOA 1AO5A 1HAPH 1XUIA 3P17H 1TAWA 1YPJH 2QF3A 1QA0A 2P3FH 4IMQA 4WMDA 2R9PA 1DLKB 3A89A 3B9FH 1KIGH 2XW9A 1AKSB 3S7HB 2SNWA 3ZVCA 1P2OA 3A7TA 1ARBA 1NC6A 5J4QA 1C1NA 1TNIA 1V2ST 3BEIB 3RXCA 3BTHE 1C5NH 1FPCH 1OYTH 4SGAE 4H6TA 1WUNH 3G01A 1GBAA 1LHEH 4I8KA 2Z3DA 1P57B 2R3UA 3PB1E 4Q7ZA 2VIWA 2HALA 4TY7A 1Y3WA 3KNXA 1HDTH 4KTCA 1O2TA 4UFFH 1OWJA 5GIBA 5GXPA 1O3OA 2UUJB 3BIUH 1A3EH 1O3KA 3RC5A 4JYUH 4AYYB 1SGRE 1O32A 4JZIA 2JH6D 4ISIH 1YPKH 1L1JA 1FONA 1SHHB 3RMMH 2BZAA 2ZDLA 2PR3A 4MNXA 3SI4H 1D6WA 1W0YH 1Z8GA 3LDXH 2WPKS 4X1RU 4A1VA 3A7WA 4YZUA 2I6QA 2F3CE 3KCGH 3EGKH 1H9IE 1CGIE 4A5TS 2ZU3A 1UTKA 1EOJA 1THPB 1Y3UA 1CGHA 1P10A 2BVSH 1O2UA 1QTFA 3HK3B 5FHTA 3QGNB 2J4IA 2JH5D 3H7OA 4ESTE 1DUEA 2NWNA 2B0FA 1O2QA 1O5DH 5EPYA 5LH8A 4FVBA 4DIHH 3O8RA 3UNSA 3KHVA 3NWUA 5T6DA 4XSKU 4BXSA 3T28A 2J94A 1A2CH 1BTPA 3UY9A 1LKBA 4FUBA 5E0JA 1NY22 1PPGE 3A7YA 1O2MA 2RA0A 4NG9H 1DXPA 3A85A 1BJUA 2VWMA 1YCPK 3HKIB 3MO9A 5FAHA 4YLUA 1FY5A 4KP0A 3M3SA 3VXEH 3Q3YA 1BRUP 2UUKB 1FZZA 1SGNE 1D4PB 5T3HA 1JMOH 4JMYA 4CRCA 1AUJA 5CHAB 3I77A 4Y79A 1DWDH 1O5GH 4O3UA 3VXFH 2P94A 5GDSH 5C67A 4B1TA 1YKTA 1L4ZA 1C9PA 1O2ZA 4H42U 1HJAB 4E05H 1BTZA 2Z94A 4ABIA 3UFAA 1QCPA 4Y7AA 1D3TB 2TRMA 2BLWA 2ZKSA 3P8OA 4CHAB 1HRTH 3ITIA 2ZC9H 1CE5A 1UO6A 2QA9E 3RMOH 1P2MA 4IC5A 5ESBA 3SO3A 5HYOA 2ZU2A 2FS9A 1A5IA 2FLRH 2Z9JA 3PLPA 4I8JA 2OUAA 2PKAB 4B76A 1N6XA 1BTXA 2QIQA 2YOLA 3A82A 5ESTE 3TGKE 3NCLA 1TX7A 2ZEBA 4AFUA 1BBRE 1E37B 1QJ6B 3MOCA 5ETXA 3SGBE 3GY8A 1DS2E 5DG6A 1PQ8A 1RGQA 1BJVA 1ZGIA 1ANCA 1PPHE 1C5YB 1BCUH 1EZQA 1TGSZ 2DUCA 1ESAA 2GCHF 1BMMH 1TPPA 1D6RA 3V13A 2WPIS 3GYLB 1ZYOA 3A87A 1Y5BT 3AASA 1EB2A 1O3IA 4AGKA 5A09A 1GDUA 4SGBE 1P12E 4Y0ZE 4I32A 2SGDE 4GVUA 1SQOA 1QQ4A 4BOHA 1XKAC 1MZAA 3ESTA 1AFQC 3Q77A 1J8AA 2J92A 2GP9B 1CSOE 4JZ1A 2ZA5A 1KLTA 1O5FH 1UK4A 1SLUB 1C1PA 1DDJA 1Y59T 3A7XA 3GCHC 1GG6C 4XBCA 1C5MD 1GJBB 2F91A 3M5NA 4GCHF 1C5TA 1JOUB 4DT7B 4XBBA 1IAUA 4X1NU 2SGQE 3EA8A 4NA8A 1NO9H 1B5GH 1QQUA 4X0WU 2Y5FA 2QYIA 4BANB 3E1XB 1BTWA 1C5UA 4K8YA 2FLBH 1ZLRA 2TGTA 3HGNA 1A1RA 3LC5A 3TJUA 1ELFA 1AKSA 1MQ5A 2UWLA 3RDZA 4NFEA 2QXIA 3SHCH 1C2GA 2VGCC 1C1RA 3DFJA 3FP7E 1ABJH 3DD2H 1TBRH 4X8TH 1HBTH 3BEUA 1RTKA 4UE7H 1MAXA 1UCYK 4NIVA 1V2RT 3HPTB 2W7SA 1MH0A 1UVSH 2V3OH 5I46H 2IOTA 3TH3H 1AWHB 5HM9A 5H4IB 1LO6A 3BEFB 4MG3A 2DE9A 2PKSC 1K2I1 1V6DA 1O0DH 1AU8A 3SOSA 2STBE 2WPMS 3MH6A 4K1SA 3RU4T 3T27A 2VB0A 2F9VA 3BG8A 1GBIA 4AB9A 4FU7A 1AE8H 2PHBA 1MKWH 3P8FA 3M7TA 2GT8A 4Y6DA 4HGCA 2XCFA 4NIWA 1NRPH 2W3KA 5K0HA 1AMHA 1CT0E 2F9UA 4YOJA 1IQHA 4JYVH 1H8IH 1CVWH 2A4OA 5JBBS 4A7IB 4BNRA 5DGJA 2F9BH 3BTEE 3SNBA 1DWEH 3H5CB 2A45B 4FXGH 4I8LA 1WQVH 2FODA 1W2KH 2ZDMA 3E91A 1OWEA 4H4FA 3RXHA 1QY6A 1HAVB 1TE0A
chains in the Genus database with same CATH superfamily
2Z9IA 2ANMH 2L6OA 2RDLA 4PROA 3K2UA 3SV9A 5LPEA 4A1XA 3FVFB 1TGCA 1AN1E 1HIAB 2ODPA 3V7TA 1P3CA 3F0OA 1S0QA 7ESTE 1ZMLA 2AMQA 1ZJKA 4YO9A 1NFUA 1BTYA 2KCAA 2BY8X 3O8BA 5T1VA 3EA7A 3RXAA 3ZZCA 1AHTH 2CF8H 3MO6A 1TWXB 1P2QA 4WH6A 3PWBA 1ELTA 3DSPA 4E06H 3M7QA 4DG4A 3BTKE 1VKYA 2FO9A 2NU4E 2VWLA 3W95A 1P05A 1H8ED 3EA9A 2O8UA 1XM1A 3LH3A 1RIWB 4U30A 3U98H 4KTSA 1NFWA 2VIOA 2H9TH 4OS1A 3PMHB 4BTUB 1G3DA 4Z6AH 1OSSA 4M9FA 2WUBA 1A7SA 6GCHF 3SNCA 2OC7A 2AMPA 4ABEA 1V2TT 2ZQ1A 2XWAA 1T8MA 1VCPA 2A31A 2BDGA 2L74A 3TK9A 2R0KA 1ZPBA 2ANYA 1SB1H 1AFEH 1EZSC 2XYAA 2XBWA 2KZ4A 2TGAA 3MQKC 3SUGA 3ZYDA 5TCAA 3UWJH 3RU4D 2WYJA 3DFLA 4U32A 1X7AC 2R3YA 2SGEE 3UNRA 1T4UH 1V2PT 1C9TA 1GMDF 5EJLA 5A0CA 4MQAA 4Z1MD 3MO3A 2JETC 2KAIB 1Y3VA 3PYHA 1FDPA 3EDXB 2W3IA 2BD4A 3SJKA 1GBKA 1DFPA 1EZUC 1BT7A 1J15A 1P2IA 4DJZB 5EIYA 1KXDA 4I33A 4YOGA 2IJOB 4XE4A 2FEQH 1O5EH 4RN6A 5L6NH 4CRFA 1OOKB 1GJAB 3UB0A 4MTBA 1GPZA 1PPZA 1KXEA 1TNJA 2CHAB 1V2QT 2V35A 4IN2A 3UOPA 3DA9B 4DVAU 4RSPA 1ZOMA 1VGCB 2FS8A 2THFB 1W0ZU 2ZGHA 4D9QA 1HAZB 1TRNA 5GCHG 4D7GA 3P8NA 5IYTA 3LONA 1DANH 2WPJS 1ETTH 1SGEE 3C1KA 1UHBB 1QRWA 1THSH 4I86A 2BXTH 5LGOA 1GI1A 1CA0C 7GCHF 1EPTC 3SU4A 3SZEA 1FJSA 5FBIA 4O03A 3TIUA 3L33A 4MDSA 1BZXE 3Q76A 4K60A 4HFPB 1YPMH 2AERH 5C1UA 2FMJA 2AHME 2VU8E 3T25A 4X6PA 2WPLS 4HTCH 4WMEA 5E0GA 1DT2A 1FV9A 5TJXA 4ZXXH 4B2CA 5GCHF 1QL7A 3A84A 1QNJA 1LMWB 1COWD 3QLPH 3STIA 5F03A 1V2UT 3FKSD 2ZTYA 2ZP0H 1TNGA 4VGCC 1LHFH 1EX3A 1P3EA 2SGAA 3UNQA 2P16A 5E0HA 1TNHA 1TONA 1J14A 1QBNA 4Y7BA 1P9UA 2AGIX 4U01A 3NZIA 3LGIA 1TQ7B 2JJ1D 3AW0A 4ABDA 4FUFA 1EUFA 2HNTC 3A8CA 1Q2WA 4BAHB 1WAYB 9ESTA 1ACBE 5EJ1A 1IQFA 1NU9A 2FTLE 1O2JA 2ZWLH 3RC6A 5DP9A 2BTCE 5EXMA 1GL0E 4INLA 1LHCH 4UFGH 4ZHAA 3M5MA 2Z7FE 4IC6A 2ZDNA 2BHGA 3QN7A 1QURH 1W0KD 5EG4A 5KGOA 4Y8YA 2P59A 2K1QA 2GJGA 1PFXC 1TLDA 1IQNA 1LHGH 1P2KA 1QB9A 3SU6A 5DO4H 1MU8B 1MBMA 1A46H 3V12A 1B0FA 1HAXB 3RMLH 2Y6TA 2BLQA 1HJ9A 4K2YA 2G8TA 3PLKA 2NU0E 1FY4A 4JCNA 3MWIU 3A88A 1HGTH 3DUXH 1C1WH 2G81E 1W12U 3TITA 2ZHWH 1DPOA 2AIQA 1HJ8A 1RIWC 1CT2E 4WH8A 2JDID 2ZU5A 2ZIQH 1QL8A 3I29A 1UVUH 3PM3A 1Z8IB 1CU1A 3GISB 3ODDA 4ABFA 2PLXA 1YGCH 5J4SA 2VJ1A 1OHHD 2FPZA 1FNIA 1GHYH 1VCQA 2KCOA 4LOYH 2VNTA 2GDDA 1GI6A 2JH0D 1ZRKA 1T4VH 1O3CA 3HK6B 4NSVA 1Y3YA 4GCHG 1YF4A 7KMEH 1O2WA 1QIXB 3LKWA 4MPVA 1T7CA 4B2AA 1BHXF 4D8NA 2J9NA 3ZV8A 1O2IA 1D3DB 1VJ9U 4GAWA 1HAOH 3SW2B 3F9GA 1OKXA 4Y76A 4I7YH 5C94A 2H5CA 5HIZA 4O97A 1RJXB 4WVPE 1Z6EA 4CREA 4Y10E 4FUDA 1ESBA 4JZEH 1DVAH 2B9LA 3EAJA 2ULLA 4UONA 1NU7B 3U9AH 1RTFB 1XXDA 2UWOA 5DKMA 5I25A 3PTBA 1WOFA 2VIDA 1P0SH 1UK3A 2CHAC 2OQUA 1O5AB 1SSXA 2FI5E 3U1JB 1DUAA 3S9AA 3T62A 1AZ8A 4ZKNU 2HNTE 1RRKA 1GI3A 3LGUA 2PSYA 2ZI2H 1DOJA 5E2OA 2XCNA 2OINA 3U28C 4DGJA 1YLDA 4HI3A 4OS2A 1IQJA 8ESTE 3F0PA 4Y0YE 1UTQA 3GDSA 2BY5X 1HXEH 1UVPA 1CA0B 3ZZ5A 4FUCA 3DCLA 1GCTC 4CRGA 2Z9GA 1G3EA 1T8LA 4MPWA 1SR5C 4R0IA 4UD9H 2EI7A 1DWBH 2BYAX 1MU6B 1C5QA 2XRCA 5E8EH 3OY6U 1DWCH 1CHOF 3OU0A 2D26C 3LC3A 2ODQA 1C5LH 3ZVAA 3JZ2B 1HFDA 1SG8B 5L30H 2IN2A 2OBOA 1C5RA 3KIDU 4E7NA 2ZPQA 2ZU4A 3WY8A 1YPEH 1HCGA 2BD7A 2IPHA 4ABBA 3PLBA 1OS8A 1P03A 1C2LA 2Q1JA 1PPFE 1DY9A 1GGDC 1SFQB 1SGYE 1O3AA 1EAXA 3QDZB 4TT3D 5GWZA 2FOFA 4UFEH 5A8ZA 3FN8A 3A7ZA 2XOKD 2Z9KA 2G52A 2XWBI 2PSXA 1AFQB 2BDHA 3D65E 4O9VA 2QF4A 2EC9H 1F0RA 4KELA 1GVLA 2ZTXA 1NRRH 1GJ7B 3HATH 5IDKA 1Q3XA 1C5VA 1LQDB 2QXGA 2A4RA 3RLYH 5FXLA 2M5TA 3TH4H 2GV6A 1TA6A 3F2FA 3F3BA 2IJD1 1NBMD 1N8OB 2KFWA 1SKYE 5JPMH 3RLWH 2JETB 4BAQB 1P9SA 4TPIZ 3WW7A 4TSFD 3AAUA 4Y11E 3KQDA 4M7GA 1KXFA 5EW1H 2FOHA 5IK2D 4FVDA 2P8OB 2VWNA 2H9HA 4BTTB 2LELA 1G3BA 1O35A 3ZYEA 3KN2A 1TPOA 3N99A 3E16B 2CJIA 3TGJE 1N1LA 2AS9A 2G5NA 1J16A 1OWKA 1NRNH 3EYDA 3ZZ4A 5B6LA 1BRCE 3V0XA 3U69H 1HJAC 1YP9A 1EAUA 3P92A 3MNSA 5FPTA 1W3CA 1WTHD 1EKBB 1O2NA 4NZQA 1ABIH 3SV2H 4IGDA 1HXFH 1CBWC 3PMBB 3RXRA 2F4LA 3SJ9A 1GDNA 4YTAA 3GY5A 4I8HA 4RT1A 4FU8A 4R8TB 1ETSH 1GBFA 4NA7A 3TNTA 4Y8XA 4NSYA 1SQAA 3DHKH 3E0NB 3TU7H 3MU8A 3D62A 5HIYA 1TMUH 3SV8A 2ZU1A 1K1NA 3PV4A 3GY3A 1O2HA 3PTNA 5CHAC 4B6FA 2A4QA 2V7QD 1BIOA 2P3UB 1YPHC 4RKJB 1FUJA 3ZVBA 8KME2 1MD8A 1GWAA 2F83A 3FO8D 2XNIA 1BMAA 4YLQH 2HGTH 1Y5AT 1LPZB 2GVFA 2D2DA 1GJDB 2P3TB 2OXSA 4XDEA 4E7RG 5C3NA 3ENSB 3KQBA 3FAOA 4XD7D 1TOMH 1G36A 2BX4A 3ZVGA 3E0PB 1C4V2 1VITG 1XVMA 1V2VT 2CF9H 5JBCS 1SLXB 3PMAB 2WYGA 3T26A 3MU0A 2G4TA 1EP5A 4IW4E 1SI5H 3N7OA 1YCPM 4BAMB 2W7UA 3STJA 2W5EA 3FP8E 4ABHA 1FY1A 1YLCA 3O8CA 3RXGA 5FX5A 4CBNA 1O3NA 3GDVA 1C2IA 1GHBG 1JXPA 3A8BA 3TVJB 4DURA 1PQ5A 3URCA 4NGAH 1ELAA 1WV7H 4GLYA 1GBHA 1EJMA 2FYRA 2GDEH 4OS4A 5FL7D 1KTSB 1L4DA 1OWIA 3LJOA 4X8UH 1YPGH 1NROH 3UR9A 4D76A 3SNAA 1O31A 2AIPA 2VINA 2NU2E 3W1EA 1HAGE 1SGDE 4B73A 1P8VC 2Z6BD 4WJG2 3T29A 1FPHH 2PFEA 3KQCA 1HIAA 1GCTB 3AVZA 1C1MA 2R0LA 3MTYA 3RM2H 2Z9LA 2QN5T 2D1JA 3D49H 1O3PB 2BD9A 3GCTF 3QO6A 1QJ1B 3GOVB 1O3DA 1RTLA 3GY4A 5C2ZA 1P2NA 4NWLA 3I78A 3RXTA 3HKJB 1HLTH 5L2ZH 1XX9A 1K1OA 5EODA 1HAIH 1QB6A 5C5OA 4GUXA 4F48B 4NIYA 2C8ZB 2GMTB 4WXIA 2BOHB 4ZUHA 2WV5A 1HB0B 1AE5A 1DXWA 3SU3A 2BY6X 3ODFA 2BD8A 1V2OT 2H1UA 5GJ4B 3WWBA 2HNTF 2EY4C 3LU9B 3Q3KA 1K22H 1DX5M 1V2KT 2OC0A 4X1QU 1WTGH 1TYNA 3SJ8A 1O34A 4X1PU 3RMNH 4CH2B 1EATA 3SUFA 1QRXA 1GMDG 3VB5A 3VB7A 4D7FA 1PJPA 1BBRK 3R0FA 3TLOA 5BPEA 1ZTJA 2BZ6H 1C5WB 1O2YA 1V3XA 2KR7A 5DP8A 2GCHG 2Z3EA 4BXWA 4MVNA 1KDQA 3S69A 2M2AA 1HYLA 1ZMNA 3P8GA 4FOUC 4RKOB 1FXYA 1LTOA 1O2OA 1H8HD 2QF0A 3FZDA 1AB9B 1F7ZA 2SGPE 2ZPRA 2Y81A 1HV7A 3RXJA 3GYMA 1ID5H 2ZDAH 3QUMP 1C4Y2 2ZGBH 1NTPA 2BDAA 1UK2A 4B71A 5ABWA 3BIVH 5AFZH 1O2PA 1AIXH 5CMXH 2C8XB 1K21H 4X6NA 1Z71A 5EQRA 1TMBH 2WUCA 2XBYA 2OP9A 1FQ3A 1KSNA 3ATMA 1GI4A 2Y5HA 1T31A 2GZ7A 1GBMA 1D9IA 3LJJA 5JBTA 2ZHFH 1NS3A 1D3PB 2G55A 2Y80A 1FI8A 1UTPA 2BQ6B 1SGIB 1T8NA 2XBVA 3M36A 1AB9C 1BBRH 2EA3A 3A81A 2GX4A 2VH6A 1O2XA 5F6MA 3SGAE 1GHVH 4NWKA 1GJ4H 1THRH 4KKDA 1SOZA 2ZHEH 2BB4A 2QCYA 3BV9B 2AMDA 1CBWB 1MTUA 2ESTE 4ZKRU 3QZRA 5JDUB 3MU1A 1E35B 1YLNA 3PMJA 2ILNA 2F9OA 1XUKA 2GCTB 1SGFA 1GJ5H 3GCNA 2J95A 5C1YA 2BM2A 1YPLH 2C8YB 1GHXH 3A7VA 1OP0A 3RM0H 2PUQH 1C5PA 4ISNA 3B23B 1BB0B 2ANKH 2HLCA 2CV3A 3NKKA 3PO1C 4P00A 1GBBA 2FWWA 3B8JA 4AG2A 6GCHG 3MMGA 1QBOA 4DT4A 4YESB 1BHXB 1F0TA 2ZQ2A 3BTDE 2QE7D 4FUJA 4JYTA 2Y82A 3VB3A 3SNEA 2XC0A 3F9EA 2EI6A 1Y8TA 4ZKOU 1ZTKA 5EOKA 3MH7A 2Y7XA 1UVTH 3IG6B 1TRMA 1NFYA 2BX3A 2AFQB 1SBWA 1G30B 2RG3A 2RA3A 2ZFPH 4TWWA 1GHAG 2OTVA 3OX7U 4ZMAH 3SUEA 4AOQA 5C20A 1J9CH 1UVOA 2PP6A 5A8XA 1RS0A 1F0UA 2B8OH 3RC4A 5FX6A 1MCTA 1PPBH 3U1IB 2HRVA 1Q31A 4GHTA 1NBME 1OP8A 4DY7B 2GT7A 2Z3CA 1CT4E 1O2LA 5K7RA 2C90B 3BTME 2WZQA 5DSFA 4ZHMU 3VB4A 1BRBE 5EQQA 1TMTH 2V3MA 2ZF0H 3QZQA 1JIRA 3A8DA 1C5XB 3TGIE 4MPUA 3GS9A 1Y3XA 2ZDVH 4HZHA 1BDAA 1IQLA 2RFKC 1EJNA 1MTNC 5F8TA 1SPJA 1Z8JB 4AFSA 1M9UA 3RXOA 3SBKA 1ZRBA 4HG6A 3S9BA 1PPEE 2P8OC 2QY0B 1VR1H 2BVRH 1OWDA 3QGJA 5E2PA 3SHAH 5JB8S 2PWXA 3ZZAA 4AGJA 4Q4LA 2BD2A 4AORA 3MNBA 3VGCB 2NU1E 1MZDA 1UTJA 2W6JD 1LVYA 1LPKB 1O5BB 1OP2A 5PTPA 1S82A 3SU1A 2SNVA 1NFXA 2AH4X 1D3QB 1OYQA 3GICB 4NZLA 3VFEA 1U6QA 1C1UH 1A0HB 4AX9H 2F9PA 1G2LA 2WINI 2GMTC 1S81A 4DCDA 1ANBA 3MFJA 4LZ1H 2GZ9A 1ZSLA 1QJ7B 1AWFH 2ZTZA 4ABJA 3Q00A 1H4WA 1NM6A 3LT3A 1EP6A 1HAHH 2QXJA 4OGYA 2FXRA 1P11E 2W26A 4X8SH 5EPNA 2V6NA 2BVXH 3KGPA 3UIRA 4AG1A 1BTUA 3SU5A 4YXWD 1FY8E 3UR6A 4X1SU 2QV1A 3A8AA 2BQ7B 3LPRA 1KXAA 3GY2A 2OK5A 2P95A 2YMSB 1WXRA 2ALVA 5HGGA 1NPMA 1ARCA 1AD8H 3CS7A 1ZTLA 2QC2A 1ZSJA 2O9QA 4K8BA 2J5UA 1W8BH 2J98B 2D8WA 3MHWU 1TQ0B 1VCWA 1Z7KA 1TBQH 8GCHG 1JRTA 3C27B 4F49A 1BRAA 2DE8A 2C4FH 1OX1A 1P02A 1GJ9B 1C1SA 2VVUA 4AFZA 2KCPA 1EASA 4MNWA 3ATIA 4VGCB 1GI7B 2PGBB 3M7UA 4WWYA 3ZIAD 1C2FA 4X8VH 1F5KU 3N7DA 4F4OC 3TPIZ 1W13U 3S7KB 1BITA 3KYGA 2BMGB 1ZGVA 2B7DH 4GSOA 2O8LA 4X2WA 2G5VA 2WV9A 1KXCA 3RXDA 3RXVA 1HAYB 2CK3D 3R3GB 3OTPA 3HGPA 4ACBA 2A7HA 1A5GH 1O3BA 1V2LT 1GBTA 1JBUH 3F2GA 1F92A 3BF6H 1EAIA 5FBEA 3M5LA 4J1YA 2A5AA 1EPTA 4INKA 1GHAF 2QF5A 4GPGA 3SV7A 1Z8RA 7GCHG 3A80A 1QZ8A 1S5SA 2PKAA 3VB6A 3M37A 1O33A 1VITH 5FPSA 3PROA 1GI9B 1RXPA 1BOQA 1CO7E 1QA7A 2WPDD 1V2WT 4NCYA 1K1PA 2AGGX 2ZO3H 3UTUH 1ELEE 5C5NA 2O8MA 2O8TA 3L3TA 4LK4A 1NT1A 1C2EA 3L6PA 1L1GA 3P95A 1IQGA 5CE1A 1N8OC 1ETRH 4X2XA 2BXUH 4OS5A 4XBDA 3T5FH 1AY6H 2FX4A 3SQEE 3LGTA 1YWUA 4ISLA 1L1NA 2JKHA 1C2KA 1SGCA 3E8LA 4F55A 2NU3E 2I6SA 3U8OH 3D23A 3MU4A 5EXLA 3RXEA 3MH5A 5HM2A 5HXFA 1Z1JA 4OM9A 1GHBF 1WYKA 3RP2A 1EZXC 1GG6B 1P2JA 1MMJN 5T6FA 1GDQA 1KLJH 3RXKA 3ZZ3A 2CN0H 3EE0B 1FY3A 4XRNA 3GY7A 5FPYA 3LIWA 3SUDA 4X2VA 3BTFE 3ZZ9A 2CGAA 2Y7ZA 1XVOA 4UEHH 1CGJE 3RXSA 9LPRA 3NUMA 1ZJDA 1ZSKA 2ZZUH 1AQ7A 3RXBA 5EW2H 4YM9A 3OE7D 3ZZBA 2W6ID 4KTUA 4D9RA 3BN9A 1Z1IA 3PWCA 1W7XH 2ZGXH 1GHZA 4CBOA 3SU0A 1GI0A 1ELBA 3U8TH 1S6HA 4Q80A 2Q6FA 4LZ4B 4Y8ZA 3M35A 4TPYA 1DE7H 4AN7A 3UAIC 1C1OA 1DSTA 4Q2KA 2HWLB 1GI2A 3MYWA 4B74A 3QK1A 2EI8A 2VBCA 3NPSA 2FM2A 1VJAU 1FN8A 4ZHLU 2K0QA 3MNCA 5FCRA 3MNXA 3A86A 2AYWA 1INCA 1O2RA 5A0AE 1UTMA 1O3EA 4X2YA 5A8YA 2FTMA 3LGYA 3FP6E 1GBCA 4CRBA 1P01A 3ZZDA 1GL1A 4XOJA 4IBLH 2FI3E 5DP6A 3RUOA 1AUTC 1TIOA 1DICA 1YPHE 1QR3E 1MUEB 5AVDA 3M5OA 1DY8A 1IQEA 2ZDKA 3OAAD 1SGTA 2YMSD 3CS0A 4K1TA 3CP7A 2XNDD 1FIZA 2GKVE 1C5SA 1DM4B 1O2KA 2A2XH 1FAXA 2V0BA 1UTOA 1C5OH 1GBJA 2FOAA 3F2HA 1UTLM 5T6GA 4MPXA 3Q3XA 4MLFB 1F0SA 4OS6A 1IOEA 2AGEX 5C1XA 1GJCB 1WCZA 5CHBA 2ZGCA 1BMNH 1O2SA 2BDBA 4K1EA 1UMAH 1J17T 3GCTG 2Q6GA 3S9CA 1ESTA 2UUYA 1BUIA 5DP3A 2WSSD 5TCCA 1KDQB 4LXBH 3ZZ6A 1GMCF 1H8DH 1HPGA 1F5RA 2ZFRH 1O3HA 4BTIB 3LH1A 3O8DA 2BOKA 2LP6A 1GBEA 4CR5A 3QWCH 1AVWA 1GGDB 4O3TA 3RU4E 1C1QA 4IMZA 1KXBA 2OC1A 1QHRB 3RXPA 1VZQH 3H7TA 2ZHQH 1S6FA 3FFGA 1NRSH 1GCDA 4JK5A 1C2JA 1HAVA 2WHXA 1EAWA 3SYJA 5JYIA 1A0JA 2BDCA 1ZMJA 4WF8A 4FU9A 3UUZA 3PV2A 1AZZA 3SZNA 1LHDH 2A5IA 1GI8B 2VH0A 1MABB 1TB6H 1VITF 3TK6A 1K9OE 2JIZD 3ELAH 2A32A 5F8XA 3K9XB 1GVZA 1JIMA 1K1JA 3SGQE 3F9HA 1S83A 2GGVB 1EOLA 1H1BA 3K65B 3ZV9A 1SL3A 3ATWA 4YT6H 1C1TA 5L2YH 4FUIA 1CHGA 4OGXA 1XXFA 1ELDE 1G3CA 1TPAE 4DW2U 1T32A 3SJOA 2CXVA 4Y71A 2A7CA 5AF9H 1W11U 2OCVB 1V2JT 2V3HH 1BQYA 4YT7H 2TGDA 1O3GA 1XMNB 5EGMA 4AZ2B 2C3SA 1OXGA 1LDTT 1JWTA 2PUXB 1AGJA 1WSSH 1BA8B 1MTSA 3EQ0H 7LPRA 5A0BA 3KQEA 2GV7A 3FANA 2ZCKP 3P70B 3ATKA 1C5ZB 2ZGJA 2FDAA 3OFND 2XBXA 1GBDA 2VGCB 1FLEE 1LQEA 3TJVA 3F9FA 1SLWB 2J34A 1GJ6A 1MKXH 3OTJE 5DP4A 2R2MB 2H5DA 2TIOA 1IQMA 3F6UH 4JK6A 1K1MA 2A0QB 2BY9X 2FX6A 4ISHH 4K69A 3KL6A 1FN6A 2VIQA 4INHA 1PYTD 2ZNKH 1VGCC 3AW1A 2KAIA 4CHAC 4JZDH 3M61U 3ATLA 4NIXA 2ZPSA 3SV6A 4ASHA 1MKWK 1DITH 2BD3A 2FZZA 1MCVA 1Y5UT 2ZFSA 1TPSA 2PKSB 4MNVA 3S0NA 1NESE 2A5KA 1E1RD 2OD3B 2C8WB 3JZ1B 3GDUA 3K6YA 1MTVA 2XXLA 1A3BH 4UDWH 1SVPA 2FIRH 1QGFA 1ZHMA 6CHAC 4WY3A 3RXMA 1OWHA 2TBSA 2VIPA 4YOIA 1SGPE 2XC5A 1F5LA 1C2DA 1WBGB 2A7JA 2VWOA 1A0LA 2TGPZ 2XC4A 3RXUA 4CRDA 2FOCA 3LOXA 2UUFB 4MNYA 6ESTA 2J38A 1GVKB 2ZHDA 1EB1H 5F8ZA 3FOAA 4DIIH 2STAE 1L0ZA 3BTTE 6CHAB 1O3JA 1K0HA 1S84A 4A6LA 4IS5A 1LVBA 1MBQA 1UJ1A 1T8OA 1ZZZA 8GCHF 1PYTC 3VPKA 1O5CB 1YC0A 2ASUB 1EXFA 4QT8C 2O8WA 2VVCA 3TNSA 2PV9B 3GCHB 1SOTA 2A2QH 1ORFA 4Q7YA 2HPPH 1KYNA 5DP7A 2ZECA 3A83A 8LPRA 2BDIA 1QL9A 5C0TA 4FUGA 1A5HA 1MD7A 1TGNA 2P93A 3RXQA 5EJZA 2B5TB 4AB8A 1Z6JH 3WWFA 5DN6D 2YNBA 2ZCLP 2GD4B 3FZZA 1SHYA 2PTCE 4ASUD 3KEEA 1S85A 1FAKH 1TABE 2WPHS 1W14U 2FP7B 4CRAA 2G51A 2BLOA 1B7XB 4NA9H 5DJ7A 1MTNB 2SFAA 4B75A 2PTNA 4U2WA 1K28D 1TNKA 1AVXA 1UHBA 6LPRA 1O3MA 3QX5H 4B2BA 1N6YA 3M3VA 4AYVB 1LKAA 4TYDA 1W10U 1GMCG 4H6SB 3U8RH 1XUHA 1IHSH 2FESH 3SU2A 2K8IA 1B0EA 2Y5GA 1IHTH 4GHQA 1SMFE 1PQ7A 1H9HE 2TPIZ 5LPRA 1EQ9A 2HPQH 1MAYA 3BTQE 3K6ZA 3MH4A 2KM0A 2QGRA 1PPCE 1GJ8B 2OLGA 1ZPZA 3RXIA 5DPAA 1ELCA 3VEQB 1EJAA 1SFIA 1NZQH 1H9LB 1PQAA 3UOUA 3IWMA 5EXNA 2OQ5A 4I8GA 1O37A 4FUHA 4KGAA 4DOQA 1ELVA 3UQOA 2FYQA 5HMAA 2R2WU 3VG8A 1F2SE 1GMHF 3IITA 3TJNA 1C2HA 3PO1B 1CQQA 2BDYA 5B6OA 1O3LA 5GPIB 3SN8A 5EU8A 1O2VA 4ABAA 1G2MA 3AAVA 3KF2A 1KMHB 3TH2H 1A4WH 2ZCHP 1TRYA 4TY6A 2GTBA 1OPHB 2OBQA 1P04A 2ZFTA 4UFDH 3CENA 1SLVB 1P09A 4ZROA 2ODYB 3SJIA 5JBAS 2G00A 1TFXA 3ZZ8A 1QBVH 4ZH8A 1C4U2 1DLEA 1MQ6A 2QXHA 1XUJA 2BQWB 5JB9S 3F1SB 5EQSA 2ANWA 3DT0H 3LGVA 4NFFA 5LPFA 3BG4B 3UWIA 1G32B 2PW8H 1YYY1 2VVVA 1K1LA 3BTGE 2LNCA 3BSQA 4ISOA 1NN6A 1JRSA 2UWPA 1FIWA 3E3TA 2A1DB 3RXFA 5F53A 4TWYA 2C93B 5G4BA 4AFQA 4ACAA 1ANEA 1O30A 3GCOA 1AVGH 1E34B 5A2MH 2AEIH 1TGTA 2XTTB 3LGWA 1GI5A 1YM0A 3M3TA 3SNDA 2QAAA 2EEKA 4CR9A 3E6PH 1WU1A 2FOMB 1V2NT 1KTTB 3BG4C 2HLDD 3QTVH 5FCKA 2BLVA 1AI8H 1QB1A 4BAKB 2J97A 3PRDA 1DSUA 1C2MA 1CHOG 1FMGA 2H2ZA 1LVMA 4Z0KA 1XKBC 1KLIH 1MTWA 3EE7A 3GY6A 1K1IA 1UCYE 1W7GH 1S0RA 1KY9A 3OSYA 5BRRE 3AK5A 3T2NA 2A4GA 3OYPA 1YY3A 1TA2A 1SGFG 4ABGA 1TNLA 2ALPA 3NXPA 1O38A 3NK8A 4K3JA 1UW7A 2GZ8A 3UREA 1IQIA 1ZR0A 2H9EH 2BD5A 3SORA 3F68H 3ZVEA 4BAOB 5C17A 1A61H 1P06A 1TBZH 3V3MA 5SGAE 3W94A 4IN1A 2CMYA 1O3FA 1G37A 4FUEA 1WDIA 1O36A 1E0FD 1L2EA 1V2MT 1ZPCA 2FOGA 4I31A 4WMFA 1TOCB 1LPGB 3E90B 4JZFH 3ZVDA 2YNAA 4X6MA 3MI4A 1TX8A 4K5ZA 3BTWE 1E36B 3ZZ7A 5AHGH 1GHWH 2PGQB 5AFYH 2ZFFH 1GMHG 1ZHPA 1CA8B 1O2GH 4XFQA 2ZG0H 3CNRA 1SGQE 2FOBA 4J2YB 1S6LA 3UQVA 2FOEA 1ZHRA 5DP5A 2HOBA 1WQSA 1RFNA 4WXVA 4ZXYH 1E38B 2YMSC 1GBLA 2RCEA 5DK1A 2LPRA 1G9IE 1HNEE 3VGCC 1XUFA 3TJOA 1MKXK 4OS7A 4ZKSU 1RD3B 2SGFE 2VIVA 1TX6A 1UTNA 1ELGA 1XUGA 2KCYA 2FI4E 4ZAEA 1BMLA 1SC8U 3URDA 1NRQH 3ZVFA 2ZFQH 1YCPH 2BY7X 3OY5U 3TK5A 1ANDA 4A1TA 2GCTC 3SI3H 1TALA 4A92A 2WV4A 1IQKA 1C1VH 1O39A 4CH8B 2F9NA 3MU5A 1QFKH 4Q7XA 1UCYH 3QTOH 4X6OA 1EPTB 1HUTH 3RXLA 3DSOA 4THNH 3SQHE 1SQTA 2G4UA 2HVXA 1QRZA 1YBWA 2H6MA 3UPEA 1TGBA 2OC8A 2Q6DA 1BTHH 3P6ZB 1LCYA 2J2UA 1LVOA 1AO5A 1HAPH 3KYFA 4B6EA 1XUIA 5CDFE 3P17H 1TAWA 1YPJH 2QF3A 1QA0A 2P3FH 4IMQA 4WMDA 2R9PA 1DLKB 3A89A 2JJ2D 5HKKD 3B9FH 1KIGH 2XW9A 1AKSB 3S7HB 2SNWA 3ZVCA 1P2OA 3A7TA 1ARBA 1NC6A 4RT0A 5J4QA 1C1NA 1TNIA 1V2ST 3BEIB 3RXCA 3BTHE 1C5NH 1FPCH 1OYTH 4SGAE 4H6TA 1WUNH 3G01A 1GBAA 3NRLA 1LHEH 4I8KA 4FETA 2Z3DA 1P57B 2R3UA 3PB1E 4Q7ZA 2VIWA 2HALA 4TY7A 1Y3WA 3KNXA 1HDTH 1E1QD 4KTCA 1O2TA 4UFFH 1OWJA 5GIBA 5GXPA 1O3OA 2UUJB 2HVYB 3BIUH 1A3EH 1O3KA 3RC5A 4JYUH 4AYYB 1SGRE 2RDEA 1O32A 4JZIA 2JH6D 4ISIH 1YPKH 1L1JA 1FONA 1SHHB 3RMMH 2BZAA 2ZDLA 2PR3A 4MNXA 3SI4H 1D6WA 1W0YH 1Z8GA 3LDXH 2WPKS 3PRBA 4X1RU 4A1VA 3A7WA 4YZUA 2I6QA 2F3CE 3KCGH 3EGKH 1H9IE 1CGIE 4A5TS 2ZU3A 1UTKA 1EOJA 1THPB 2KX4A 1Y3UA 1CGHA 1P10A 2BVSH 1O2UA 1QTFA 3HK3B 5FHTA 3QGNB 2J4IA 2JH5D 3H7OA 4ESTE 3PV5A 1DUEA 2NWNA 2B0FA 1O2QA 1O5DH 5EPYA 5LH8A 4FVBA 3OEHD 4DIHH 3O8RA 3UNSA 3KHVA 3NWUA 5T6DA 4XSKU 4BXSA 5KEDA 3T28A 2J94A 1A2CH 1BTPA 3UY9A 1LKBA 4FUBA 5E0JA 1NY22 1PPGE 3A7YA 1O2MA 2RA0A 4NG9H 1DXPA 3A85A 1BJUA 2J98A 2VWMA 1YCPK 3HKIB 3MO9A 1FX0B 4YLUA 5FAHA 1FY5A 4KP0A 3M3SA 3VXEH 3Q3YA 1BRUP 2UUKB 1FZZA 1SGNE 1D4PB 5T3HA 4P02A 1JMOH 4JMYA 4CRCA 1AUJA 5CHAB 3I77A 4Y79A 1DWDH 4RI0A 1O5GH 4O3UA 3VXFH 2P94A 5GDSH 5C67A 4B1TA 1YKTA 1W0JD 1L4ZA 1C9PA 1O2ZA 4H42U 1HJAB 4E05H 1BTZA 2Z94A 4ABIA 1SQRA 3UFAA 1QCPA 4Y7AA 1D3TB 2TRMA 2BLWA 2ZKSA 3P8OA 4CHAB 1HRTH 3ITIA 2ZC9H 1CE5A 1UO6A 2QA9E 3RMOH 1P2MA 4IC5A 5ESBA 3SO3A 5HYOA 2ZU2A 2FS9A 1A5IA 2FLRH 2Z9JA 3PLPA 4I8JA 2OUAA 2PKAB 4B76A 3H09A 1N6XA 1BTXA 2QIQA 2YOLA 3A82A 5ESTE 3TGKE 3NCLA 1TX7A 2ZEBA 4AFUA 1BBRE 1E37B 1QJ6B 3MOCA 5ETXA 3SGBE 3GY8A 1DS2E 5DG6A 1PQ8A 1RGQA 1BJVA 1ZGIA 1ANCA 1PPHE 3OEED 1C5YB 1BCUH 1EZQA 1TGSZ 2DUCA 1ESAA 2GCHF 1BMMH 1TPPA 2IPQX 1D6RA 3V13A 2WPIS 3GYLB 1ZYOA 1BMFD 3A87A 1Y5BT 3AASA 1EB2A 1O3IA 4AGKA 5A09A 5GNDA 3KQ5A 1GDUA 4SGBE 1P12E 4Y0ZE 4I32A 2SGDE 4GVUA 1SQOA 1QQ4A 4BOHA 1XKAC 1MZAA 3ESTA 1AFQC 3Q77A 1J8AA 2J92A 2GP9B 1CSOE 4JZ1A 2ZA5A 1KLTA 1O5FH 1UK4A 1SLUB 1C1PA 1DDJA 1Y59T 3A7XA 3GCHC 1GG6C 4XBCA 1C5MD 1GJBB 2F91A 3M5NA 4GCHF 1C5TA 1JOUB 1EFRD 4DT7B 4XBBA 1IAUA 4X1NU 2SGQE 3EA8A 4NA8A 1NO9H 1B5GH 1QQUA 4X0WU 2Y5FA 2QYIA 4BANB 3E1XB 1BTWA 1C5UA 4K8YA 2FLBH 1ZLRA 2TGTA 3HGNA 3DSGA 1A1RA 3LC5A 3TJUA 1ELFA 1AKSA 1MQ5A 2UWLA 3RDZA 4NFEA 2QXIA 3SHCH 1C2GA 2VGCC 1C1RA 3DFJA 3FP7E 1ABJH 3DD2H 1TBRH 4X8TH 1HBTH 3BEUA 1RTKA 4UE7H 1MAXA 2F43B 1UCYK 4NIVA 1V2RT 3HPTB 2W7SA 1MH0A 4ZCNA 1UVSH 2V3OH 5I46H 2IOTA 3TH3H 1AWHB 5HM9A 5H4IB 1LO6A 3BEFB 4MG3A 2DE9A 2PKSC 1K2I1 1V6DA 1O0DH 1AU8A 3SOSA 2STBE 2WPMS 3MH6A 4K1SA 3RU4T 3T27A 2VB0A 2F9VA 3BG8A 1GBIA 4AB9A 1E79D 4FU7A 1AE8H 2PHBA 1MKWH 3P8FA 3M7TA 2GT8A 4Y6DA 4HGCA 2XCFA 4NIWA 1NRPH 2W3KA 5K0HA 1AMHA 1CT0E 2F9UA 4YOJA 1IQHA 4JYVH 1H8IH 1CVWH 2A4OA 5JBBS 5KECA 4A7IB 4BNRA 3N7EA 5C0UA 5DGJA 4Q63A 2F9BH 3BTEE 3SNBA 1DWEH 3H5CB 2A45B 4AC9A 4FXGH 4I8LA 1WQVH 2EQNA 2FODA 1W2KH 2ZDMA 3E91A 1OWEA 4H4FA 3RXHA 1QY6A 1HAVB 1TE0A
chains in the Genus database with same CATH topology
2Z9IA 2ANMH 2RDLA 4PROA 3K2UA 3SV9A 5LPEA 4A1XA 3FVFB 1TGCA 1AN1E 1HIAB 2ODPA 3V7TA 1P3CA 1S0QA 7ESTE 1ZMLA 2AMQA 1ZJKA 4YO9A 1NFUA 1BTYA 2BY8X 3O8BA 3EA7A 3RXAA 3ZZCA 1AHTH 2CF8H 3MO6A 1TWXB 1P2QA 4WH6A 3PWBA 1ELTA 4E06H 3M7QA 4DG4A 3BTKE 2FO9A 2NU4E 2VWLA 3W95A 1P05A 3EA9A 2O8UA 1XM1A 3LH3A 1RIWB 4U30A 3U98H 4KTSA 1NFWA 2VIOA 2H9TH 4OS1A 3PMHB 4BTUB 1G3DA 4Z6AH 1OSSA 2WUBA 1A7SA 6GCHF 3SNCA 2OC7A 2AMPA 4ABEA 1V2TT 2ZQ1A 2XWAA 1T8MA 1VCPA 2A31A 2BDGA 3TK9A 2R0KA 1ZPBA 2ANYA 1SB1H 1AFEH 1EZSC 2XYAA 2XBWA 2TGAA 3SUGA 3ZYDA 5TCAA 3UWJH 3RU4D 2WYJA 3DFLA 4U32A 1X7AC 2R3YA 2SGEE 3UNRA 1T4UH 1V2PT 1C9TA 1GMDF 5A0CA 4MQAA 3MO3A 2JETC 2KAIB 1Y3VA 3PYHA 1FDPA 3EDXB 2W3IA 2BD4A 3SJKA 1GBKA 1DFPA 1EZUC 1BT7A 1J15A 1P2IA 4DJZB 1KXDA 4I33A 4YOGA 2IJOB 4XE4A 2FEQH 1O5EH 4RN6A 5L6NH 4CRFA 1OOKB 1GJAB 4MTBA 1GPZA 1PPZA 1KXEA 1TNJA 2CHAB 1V2QT 2V35A 4IN2A 3UOPA 3DA9B 4DVAU 4RSPA 1ZOMA 1VGCB 2FS8A 2THFB 1W0ZU 2ZGHA 4D9QA 1HAZB 1TRNA 5GCHG 4D7GA 3P8NA 5IYTA 3LONA 1DANH 2WPJS 1ETTH 1SGEE 3C1KA 1UHBB 1QRWA 1THSH 2BXTH 5LGOA 1GI1A 1CA0C 7GCHF 1EPTC 3SU4A 1FJSA 5FBIA 4O03A 3TIUA 3L33A 4MDSA 1BZXE 3Q76A 4K60A 4HFPB 1YPMH 2AERH 5C1UA 2FMJA 2VU8E 3T25A 4X6PA 2WPLS 4HTCH 4WMEA 5E0GA 1DT2A 1FV9A 5TJXA 4ZXXH 4B2CA 5GCHF 1QL7A 3A84A 1QNJA 1LMWB 3QLPH 3STIA 5F03A 1V2UT 2ZTYA 2ZP0H 1TNGA 4VGCC 1LHFH 1EX3A 1P3EA 2SGAA 3UNQA 2P16A 5E0HA 1TNHA 1TONA 1J14A 1QBNA 4Y7BA 1P9UA 2AGIX 4U01A 3NZIA 3LGIA 1TQ7B 3AW0A 4ABDA 4FUFA 1EUFA 2HNTC 3A8CA 1Q2WA 4BAHB 1WAYB 9ESTA 1ACBE 1IQFA 1NU9A 2FTLE 1O2JA 2ZWLH 3RC6A 5DP9A 2BTCE 5EXMA 1GL0E 4INLA 1LHCH 4UFGH 4ZHAA 3M5MA 2Z7FE 4IC6A 2ZDNA 2BHGA 3QN7A 1QURH 5EG4A 4Y8YA 2P59A 2K1QA 1PFXC 1TLDA 1IQNA 1LHGH 1P2KA 1QB9A 3SU6A 5DO4H 1MU8B 1MBMA 1A46H 3V12A 1B0FA 1HAXB 3RMLH 2Y6TA 2BLQA 1HJ9A 4K2YA 2G8TA 3PLKA 2NU0E 1FY4A 4JCNA 3MWIU 3A88A 1HGTH 3DUXH 1C1WH 2G81E 1W12U 3TITA 2ZHWH 1DPOA 2AIQA 1HJ8A 1RIWC 1CT2E 4WH8A 2ZU5A 2ZIQH 1QL8A 3I29A 1UVUH 3PM3A 1Z8IB 1CU1A 3GISB 3ODDA 4ABFA 2PLXA 1YGCH 5J4SA 2VJ1A 2FPZA 1FNIA 1GHYH 1VCQA 4LOYH 2VNTA 2GDDA 1GI6A 2JH0D 1ZRKA 1T4VH 1O3CA 3HK6B 4NSVA 1Y3YA 4GCHG 1YF4A 7KMEH 1O2WA 1QIXB 3LKWA 4MPVA 1T7CA 4B2AA 1BHXF 4D8NA 2J9NA 3ZV8A 1O2IA 1D3DB 1VJ9U 4GAWA 1HAOH 3SW2B 3F9GA 1OKXA 4Y76A 4I7YH 2H5CA 4O97A 1RJXB 4WVPE 1Z6EA 4CREA 4Y10E 4FUDA 1ESBA 4JZEH 1DVAH 2B9LA 3EAJA 2ULLA 4UONA 1NU7B 3U9AH 1RTFB 1XXDA 2UWOA 5DKMA 5I25A 3PTBA 1WOFA 2VIDA 1P0SH 1UK3A 2CHAC 2OQUA 1O5AB 1SSXA 2FI5E 3U1JB 1DUAA 3S9AA 3T62A 1AZ8A 4ZKNU 2HNTE 1RRKA 1GI3A 3LGUA 2PSYA 2ZI2H 1DOJA 5E2OA 2XCNA 2OINA 4DGJA 1YLDA 4HI3A 4OS2A 1IQJA 8ESTE 4Y0YE 1UTQA 3GDSA 2BY5X 1HXEH 1UVPA 1CA0B 3ZZ5A 4FUCA 1GCTC 4CRGA 2Z9GA 1G3EA 1T8LA 4MPWA 1SR5C 4R0IA 4UD9H 2EI7A 1DWBH 2BYAX 1MU6B 1C5QA 2XRCA 5E8EH 3OY6U 1DWCH 1CHOF 3OU0A 2D26C 3LC3A 2ODQA 1C5LH 3ZVAA 3JZ2B 1HFDA 1SG8B 5L30H 2IN2A 2OBOA 1C5RA 3KIDU 4E7NA 2ZPQA 2ZU4A 3WY8A 1YPEH 1HCGA 2BD7A 2IPHA 4ABBA 3PLBA 1OS8A 1P03A 1C2LA 2Q1JA 1PPFE 1DY9A 1GGDC 1SFQB 1SGYE 1O3AA 1EAXA 3QDZB 5GWZA 2FOFA 4UFEH 5A8ZA 3A7ZA 2Z9KA 2G52A 2XWBI 2PSXA 1AFQB 2BDHA 3D65E 4O9VA 2EC9H 1F0RA 4KELA 1GVLA 2ZTXA 1NRRH 1GJ7B 3HATH 5IDKA 1Q3XA 1C5VA 1LQDB 2QXGA 2A4RA 3RLYH 5FXLA 2M5TA 3TH4H 2GV6A 1TA6A 1N8OB 5JPMH 3RLWH 2JETB 4BAQB 1P9SA 4TPIZ 3AAUA 4Y11E 3KQDA 4M7GA 1KXFA 5EW1H 2FOHA 4FVDA 2P8OB 2VWNA 2H9HA 4BTTB 1G3BA 1O35A 3ZYEA 3KN2A 1TPOA 3E16B 2CJIA 3TGJE 1N1LA 2AS9A 2G5NA 1J16A 1OWKA 1NRNH 3EYDA 3ZZ4A 1BRCE 3V0XA 3U69H 1HJAC 1YP9A 1EAUA 3P92A 3MNSA 5FPTA 1W3CA 1WTHD 1EKBB 1O2NA 4NZQA 1ABIH 3SV2H 4IGDA 1HXFH 1CBWC 3PMBB 3RXRA 3SJ9A 1GDNA 4YTAA 3GY5A 4I8HA 4FU8A 4R8TB 1ETSH 1GBFA 4NA7A 3TNTA 4Y8XA 4NSYA 1SQAA 3DHKH 3E0NB 3TU7H 3MU8A 3D62A 1TMUH 3SV8A 2ZU1A 1K1NA 3PV4A 3GY3A 1O2HA 3PTNA 5CHAC 2A4QA 1BIOA 2P3UB 1YPHC 4RKJB 1FUJA 3ZVBA 8KME2 1MD8A 1GWAA 2F83A 2XNIA 1BMAA 4YLQH 2HGTH 1Y5AT 1LPZB 2GVFA 2D2DA 1GJDB 2P3TB 2OXSA 4XDEA 4E7RG 5C3NA 3ENSB 3KQBA 3FAOA 1TOMH 1G36A 2BX4A 3ZVGA 3E0PB 1C4V2 1VITG 1XVMA 1V2VT 2CF9H 5JBCS 1SLXB 3PMAB 2WYGA 3T26A 3MU0A 2G4TA 1EP5A 4IW4E 1SI5H 3N7OA 1YCPM 4BAMB 2W7UA 3STJA 2W5EA 3FP8E 4ABHA 1FY1A 1YLCA 3O8CA 3RXGA 5FX5A 4CBNA 1O3NA 3GDVA 1C2IA 1GHBG 1JXPA 3A8BA 3TVJB 4DURA 1PQ5A 3URCA 4NGAH 1ELAA 1WV7H 4GLYA 1GBHA 1EJMA 2FYRA 2GDEH 4OS4A 1KTSB 1L4DA 1OWIA 3LJOA 4X8UH 1YPGH 1NROH 3UR9A 4D76A 3SNAA 1O31A 2AIPA 2VINA 2NU2E 1HAGE 1SGDE 4B73A 1P8VC 2Z6BD 4WJG2 3T29A 1FPHH 2PFEA 3KQCA 1HIAA 1GCTB 3AVZA 1C1MA 2R0LA 3MTYA 3RM2H 2Z9LA 2QN5T 2D1JA 3D49H 1O3PB 2BD9A 3GCTF 3QO6A 1QJ1B 3GOVB 1O3DA 1RTLA 3GY4A 5C2ZA 1P2NA 4NWLA 3I78A 3RXTA 3HKJB 1HLTH 5L2ZH 1XX9A 1K1OA 5EODA 1HAIH 1QB6A 5C5OA 4GUXA 4NIYA 2C8ZB 2GMTB 4WXIA 2BOHB 4ZUHA 2WV5A 1HB0B 1AE5A 1DXWA 3SU3A 2BY6X 3ODFA 2BD8A 1V2OT 2H1UA 5GJ4B 2HNTF 3LU9B 3Q3KA 1K22H 1DX5M 1V2KT 2OC0A 4X1QU 1WTGH 1TYNA 3SJ8A 1O34A 4X1PU 3RMNH 4CH2B 1EATA 3SUFA 1QRXA 1GMDG 3VB5A 3VB7A 4D7FA 1PJPA 1BBRK 3R0FA 3TLOA 5BPEA 1ZTJA 2BZ6H 1C5WB 1O2YA 1V3XA 5DP8A 2GCHG 2Z3EA 4BXWA 4MVNA 1KDQA 3S69A 1HYLA 1ZMNA 3P8GA 4RKOB 1FXYA 1LTOA 1O2OA 2QF0A 3FZDA 1AB9B 1F7ZA 2SGPE 2ZPRA 2Y81A 1HV7A 3RXJA 3GYMA 1ID5H 2ZDAH 3QUMP 1C4Y2 2ZGBH 1NTPA 2BDAA 1UK2A 4B71A 5ABWA 3BIVH 5AFZH 1O2PA 1AIXH 5CMXH 2C8XB 1K21H 4X6NA 1Z71A 5EQRA 1TMBH 2WUCA 2XBYA 2OP9A 1FQ3A 1KSNA 3ATMA 1GI4A 2Y5HA 1T31A 2GZ7A 1GBMA 1D9IA 3LJJA 5JBTA 2ZHFH 1NS3A 1D3PB 2G55A 2Y80A 1FI8A 1UTPA 2BQ6B 1SGIB 1T8NA 2XBVA 3M36A 1AB9C 1BBRH 2EA3A 3A81A 2GX4A 2VH6A 1O2XA 5F6MA 3SGAE 1GHVH 4NWKA 1GJ4H 1THRH 4KKDA 1SOZA 2ZHEH 2BB4A 2QCYA 3BV9B 2AMDA 1CBWB 1MTUA 2ESTE 4ZKRU 3QZRA 5JDUB 3MU1A 1E35B 3PMJA 2ILNA 2F9OA 1XUKA 2GCTB 1SGFA 1GJ5H 3GCNA 2J95A 5C1YA 2BM2A 1YPLH 2C8YB 1GHXH 3A7VA 1OP0A 3RM0H 2PUQH 1C5PA 4ISNA 3B23B 1BB0B 2ANKH 2HLCA 2CV3A 3NKKA 3PO1C 1GBBA 2FWWA 3B8JA 4AG2A 6GCHG 3MMGA 1QBOA 4YESB 1BHXB 1F0TA 2ZQ2A 3BTDE 4FUJA 4JYTA 2Y82A 3VB3A 3SNEA 2XC0A 3F9EA 2EI6A 1Y8TA 4ZKOU 1ZTKA 5EOKA 3MH7A 2Y7XA 1UVTH 3IG6B 1TRMA 1NFYA 2BX3A 2AFQB 1SBWA 1G30B 2RG3A 2RA3A 2ZFPH 4TWWA 1GHAG 2OTVA 3OX7U 4ZMAH 3SUEA 4AOQA 5C20A 1J9CH 1UVOA 5A8XA 1RS0A 1F0UA 2B8OH 3RC4A 5FX6A 1MCTA 1PPBH 3U1IB 2HRVA 1Q31A 4GHTA 1OP8A 5K7RA 4DY7B 2GT7A 2Z3CA 1CT4E 1O2LA 2C90B 3BTME 4ZHMU 3VB4A 1BRBE 5EQQA 1TMTH 2ZF0H 3QZQA 1JIRA 3A8DA 1C5XB 3TGIE 4MPUA 1Y3XA 2ZDVH 4HZHA 1BDAA 1IQLA 1EJNA 1MTNC 5F8TA 1SPJA 1Z8JB 4AFSA 1M9UA 3RXOA 3SBKA 1ZRBA 3S9BA 1PPEE 2P8OC 2QY0B 1VR1H 2BVRH 1OWDA 3QGJA 5E2PA 3SHAH 5JB8S 2PWXA 3ZZAA 4AGJA 2BD2A 4AORA 3MNBA 3VGCB 2NU1E 1MZDA 1UTJA 1LVYA 1LPKB 1O5BB 1OP2A 5PTPA 1S82A 3SU1A 2SNVA 1NFXA 2AH4X 1D3QB 1OYQA 3GICB 4NZLA 3VFEA 1U6QA 1C1UH 1A0HB 4AX9H 2F9PA 1G2LA 2WINI 2GMTC 1S81A 4DCDA 1ANBA 3MFJA 4LZ1H 2GZ9A 1ZSLA 1QJ7B 1AWFH 2ZTZA 4ABJA 3Q00A 1H4WA 1NM6A 3LT3A 1EP6A 1HAHH 2QXJA 4OGYA 2FXRA 1P11E 2W26A 4X8SH 5EPNA 2V6NA 2BVXH 3KGPA 3UIRA 4AG1A 1BTUA 3SU5A 1FY8E 3UR6A 4X1SU 2QV1A 3A8AA 2BQ7B 3LPRA 1KXAA 3GY2A 2P95A 2ALVA 5HGGA 1NPMA 1ARCA 1AD8H 3CS7A 1ZTLA 2QC2A 1ZSJA 2O9QA 4K8BA 1W8BH 2D8WA 3MHWU 1TQ0B 1VCWA 1Z7KA 1TBQH 8GCHG 1JRTA 3C27B 4F49A 1BRAA 2DE8A 2C4FH 1OX1A 1P02A 1GJ9B 1C1SA 2VVUA 4AFZA 4MNWA 1EASA 3ATIA 4VGCB 1GI7B 2PGBB 3M7UA 4WWYA 1C2FA 4X8VH 1F5KU 4F4OC 3TPIZ 1W13U 3S7KB 1BITA 2BMGB 1ZGVA 2B7DH 4GSOA 2O8LA 4X2WA 2G5VA 1KXCA 3RXDA 3RXVA 1HAYB 3R3GB 3HGPA 2A7HA 1A5GH 1O3BA 1V2LT 1GBTA 1JBUH 1F92A 3BF6H 1EAIA 5FBEA 3M5LA 4J1YA 2A5AA 1EPTA 4INKA 1GHAF 4GPGA 3SV7A 1Z8RA 7GCHG 3A80A 1S5SA 2PKAA 3VB6A 3M37A 1O33A 1VITH 5FPSA 3PROA 1GI9B 1RXPA 1BOQA 1CO7E 1QA7A 4NCYA 1V2WT 1K1PA 2AGGX 2ZO3H 3UTUH 1ELEE 5C5NA 2O8MA 2O8TA 3L3TA 4LK4A 1NT1A 1C2EA 3L6PA 1L1GA 3P95A 1IQGA 5CE1A 1N8OC 1ETRH 4X2XA 2BXUH 4OS5A 4XBDA 3T5FH 1AY6H 2FX4A 3SQEE 3LGTA 4ISLA 1L1NA 2JKHA 1C2KA 1SGCA 3E8LA 2NU3E 2I6SA 3U8OH 3D23A 3MU4A 5EXLA 3RXEA 3MH5A 5HM2A 5HXFA 1Z1JA 1GHBF 1WYKA 3RP2A 1EZXC 1GG6B 1P2JA 1MMJN 5T6FA 1GDQA 1KLJH 3RXKA 3ZZ3A 2CN0H 3EE0B 1FY3A 3GY7A 5FPYA 3LIWA 3SUDA 4X2VA <