3GY7A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy7A02
1O37A 3RMOH 1GHBG 5T6FA 1ZOMA 1C5ZB 2GX4A 1O3OA 5JBTA 4FUJA 1J14A 5C67A 2ZDLA 1W0ZU 3GDVA 1ELBA 1UK3A 4JZIA 1TX7A 2BDAA 5DP9A 1TPOA 4XE4A 1A46H 4OS2A 1G32B 3KN2A 2J94A 2GVFA 4IMZA 2FEQH 2GMTC 4ZAEA 1IQHA 5ESBA 1V2KT 1VGCB 3ZZCA 3SORA 1P2KA 3RXIA 5A8YA 3SGBE 1O2QA 1UK2A 3BTGE 2TGTA 1LHFH 4Q80A 3H5CB 1IQFA 4WY3A 3LH3A 1GI4A 3GCOA 5FPSA 1QIXB 5ETXA 4WH6A 3UOUA 1S6FA 3ATIA 1QJ1B 3ZZ9A 3E8LA 1DUAA 4OS4A 2AMQA 3KQDA 1GVZA 2NWNA 1XKAC 3IG6B 1TOCB 2BY6X 1HJ8A 1OWKA 5C20A 2W26A 3LGYA 1GI6A 3PM3A 4X6NA 6GCHG 1ZZZA 2FO9A 2J4IA 1UVSH 1QR3E 1AZZA 1CGHA 1GMHG 4VGCC 1V2OT 1GJDB 2JH5D 3BSQA 3T27A 3L6PA 3A8DA 4ZHAA 5JB8S 1ZJDA 3ENSB 2GTBA 2HWLB 1Z8IB 1C1RA 1HXEH 3RU4E 1BRUP 1RXPA 1P3CA 2P3FH 1DX5M 1O3CA 1SLVB 3SN8A 3EGKH 3FVFB 3DFJA 4MNXA 1YC0A 3FAOA 1W2KH 5L30H 1O5BB 2FZZA 1B5GH 1AHTH 1BBRE 1TPAE 1HGTH 2BYAX 3PWCA 1CE5A 1KXBA 3VB5A 1DANH 1FPCH 1TX8A 1TA2A 4RKJB 1QRWA 3DD2H 1D3PB 1ZHRA 2C8WB 1GCDA 2WPJS 1RTKA 1C1WH 2ZGBH 1VZQH 1XVMA 4X6MA 1KTSB 1C5NH 3D62A 2QXJA 1DVAH 1UVTH 2D1JA 2LPRA 1G3CA 4UDWH 2Z7FE 1Z6JH 2SNVA 3PO1B 1DITH 1AMHA 3RXEA 1BHXF 4MTBA 1W14U 2WPKS 1THSH 1FY8E 2XW9A 1QQUA 4X1PU 1C2HA 4D7FA 2AS9A 2VH6A 1VJ9U 1ZPZA 5DJ7A 1TFXA 2Z3EA 3UUZA 3NPSA 1HCGA 1YPHC 4ISNA 3RXDA 1LQEA 2ZFTA 1SOZA 2R2WU 2VH0A 5L2ZH 1XUHA 4Y71A 1NRRH 1N8OC 3M7QA 2O8MA 3UNQA 1O3JA 2OCVB 1O2NA 4AFZA 1BCUH 2F83A 2WV5A 1JRTA 1O3DA 1SR5C 2EC9H 1O3IA 1F0UA 2V0BA 4TPIZ 1GHAG 1Y8TA 3AVZA 2UUJB 2ZDNA 2FWWA 2BDBA 1UCYK 3QK1A 3QUMP 3GYLB 2QCYA 1C4V2 4DG4A 2FLBH 3TJVA 3PV4A 1BZXE 1O2RA 3RXLA 1NN6A 2B9LA 3MYWA 4FU7A 1YGCH 5LGOA 1C1NA 1RIWC 3ELAH 1QBNA 2TIOA 2ZPSA 2R2MB 3GY2A 5TCAA 1SGYE 1LHEH 1O2UA 2BD8A 4Z6AH 4ZKRU 1C2EA 4INLA 2G55A 1FONA 1J9CH 2BD4A 2FYRA 2SGDE 2UUYA 2PGQB 3RXBA 7LPRA 1ZTKA 2Z9KA 3D65E 5C5NA 4I8LA 1L4ZA 1C2KA 1PFXC 3MNXA 2AMPA 1F5RA 1ZR0A 1QL7A 4ABDA 4BAKB 1C5LH 3GY3A 3LIWA 3MO6A 2NU0E 3KEEA 1YCPK 4NG9H 1PYTD 5FHTA 1LPZB 2H9TH 3A7TA 4GCHG 1ZHPA 1O39A 1BMLA 3PLPA 2QY0B 2PKAA 4CBOA 1ZYOA 1P2JA 4ZKSU 4D7GA 2ZTZA 1GMCF 1XVOA 2BLOA 1JIRA 1LVOA 2ZHQH 4I8JA 2VVCA 2ZU3A 1H9IE 4INKA 2BD3A 1SI5H 2PWXA 5AF9H 4FUCA 5FPTA 4DCDA 9LPRA 1TQ0B 1T8OA 2VIVA 1C1MA 3GCHB 3E0PB 2Z9IA 2GZ7A 3BTME 2QF3A 3KNXA 3LONA 4BXWA 2Y80A 4XFQA 3ODFA 3MFJA 4Y8XA 3Q3KA 5DP6A 2O9QA 3NKKA 2Y6TA 5LPFA 2RG3A 2RA3A 3QGJA 4B75A 1C5OH 4K8BA 1SGNE 1D6RA 1TPSA 3UNRA 1E38B 3K6ZA 1J8AA 5CE1A 5GCHG 1B7XB 1PPGE 1V2TT 3FZDA 1QGFA 1KXAA 4NA7A 5A0AE 1TBQH 1LHCH 4UEHH 3RDZA 1E35B 1EP5A 1KDQB 1K2I1 1KLTA 2Z9LA 1V2UT 2IPHA 4DJZB 3M35A 3UPEA 1P9SA 1GBFA 1L2EA 2ZDKA 2A4GA 2VINA 1ETTH 5H4IB 1EPTA 1Y5UT 7KMEH 3SUGA 3ZZ8A 2PGBB 1EZXC 2WPIS 1DWCH 1OWJA 2BDHA 2FTLE 2M5TA 3HGNA 5IYTA 4KELA 2ZFPH 5BRRE 2QGRA 1WAYB 3MNCA 1FV9A 1GBEA 1BTHH 1ARBA 1W0YH 2XCNA 4AN7A 4NZQA 1YYY1 1GCTB 3LDXH 4THNH 1NFWA 3OU0A 2FXRA 1AVWA 1CHOF 5C1UA 2ZU4A 4F4OC 1O2TA 6CHAB 3MU0A 1EASA 3SGQE 3P6ZB 3GY5A 1DOJA 3RXHA 1T32A 1A5HA 4Y7BA 2ZNKH 1BJUA 5E0JA 1LHDH 3ZYDA 5A0BA 1XM1A 1F92A 4B73A 4A7IB 1QB6A 2CXVA 4K69A 4XOJA 2OLGA 1RTFB 3LGTA 1OX1A 2ZA5A 2FS8A 1ZMLA 3SV8A 3F68H 4OGYA 3FP6E 2XBYA 2FODA 1TNGA 3BTDE 4I8GA 4M7GA 2ZCKP 3FZZA 5ESTE 4UFDH 1O3FA 2P59A 3URDA 2JH6D 1TYNA 4X1SU 4B74A 1C1VH 1NRSH 4E05H 3D23A 4ZKOU 1TGBA 3S9AA 1B0EA 3H7OA 1QTFA 2XTTB 1Z8JB 3CENA 1GHZA 2PHBA 4IC5A 2QXHA 2TPIZ 4B76A 2VVUA 1HB0B 2FI3E 1MMJN 4WH8A 1C5MD 2Q6GA 1QY6A 2HLCA 3ESTA 1HAPH 3HK3B 5C2ZA 2IJOB 1ESTA 4NGAH 3I29A 1HAVB 5K7RA 1GHBF 5DP3A 2R0LA 2W5EA 5HM9A 1IQGA 2BDIA 3OX7U 1CU1A 4JYVH 1ZTLA 3KGPA 3BIUH 1BTPA 4FXGH 4GPGA 3VEQB 1OPHB 2C3SA 4MPVA 4X6OA 2ZECA 1NRNH 3MU4A 1DE7H 3PYHA 1SGFA 2JH0D 2HOBA 4LK4A 3MH5A 1F2SE 1Q2WA 4U32A 2VVVA 1ABJH 3C27B 3PMHB 1TLDA 1DS2E 1IQIA 4JZFH 5AFZH 4NFFA 1O2JA 2VIDA 1QRXA 1IQLA 4X0WU 3RP2A 4JMYA 1C4U2 1ANDA 4CR9A 1ELFA 1P57B 2ZGJA 2ZFRH 2A31A 4X1QU 1AVGH 1ESAA 2F3CE 1MU6B 1OP2A 1V2LT 1VGCC 3SBKA 1UHBB 3AW1A 1PPEE 5TCCA 3K65B 4X2XA 4MVNA 1O5EH 6GCHF 2H1UA 4ZMAH 2OINA 1O3EA 5EXMA 4WXVA 3SNBA 5EXLA 4BOHA 3A8BA 2RA0A 3RXGA 2P8OC 4LXBH 1O2WA 1TMUH 3STIA 4X1RU 1JIMA 1GBCA 4D76A 1C1PA 1K1LA 1AFQB 1GJ5H 2GDEH 5L6NH 2BVRH 1K1JA 3KF2A 3SJ9A 2BM2A 2PTCE 3U98H 2ZWLH 5A2MH 5E8EH 2ZFFH 3BTEE 2OC7A 3OY6U 1FLEE 1GHVH 2UUKB 2ZHEH 2H9EH 5T6DA 3S7KB 1EB1H 3BTTE 1KTTB 1WTGH 1XUGA 2HNTE 8GCHG 2DE9A 2QV1A 1PPFE 1SGCA 2UWOA 1FY4A 1HV7A 1WSSH 3PTNA 3SGAE 4ZHLU 1QJ6B 2BHGA 4WJG2 2BXUH 1Z6EA 4BAHB 5DP8A 4K1EA 1O3KA 4Y0YE 3SO3A 2G5VA 4Y10E 2TGPZ 3ZZDA 1WUNH 5F6MA 1K1OA 5GDSH 1A7SA 4F49A 2TRMA 2GT8A 2BLQA 4NWKA 4JCNA 4NZLA 3F9EA 4Y11E 2J92A 2BOKA 2WPLS 4FUIA 4MDSA 4FVDA 4AFSA 1OWEA 1QA7A 2WUCA 3H7TA 2V3OH 1IQJA 1DDJA 3MTYA 1P11E 1VCWA 7ESTE 1CA8B 4E06H 4AGKA 1RTLA 4GHQA 5J4QA 1V2WT 3PO1C 2SGEE 5DKMA 1NY22 3KQBA 1EB2A 1DXPA 1CT0E 2OP9A 1W12U 3BEIB 4JYTA 4YESB 1S5SA 3T29A 1G3DA 4CHAB 3U8TH 3TIUA 1XUFA 1FAXA 1SQAA 1C1OA 1GHAF 3SU4A 1K1PA 1FN6A 5JB9S 3QWCH 1EJNA 1O2YA 2WINI 4XBDA 1C4Y2 2P94A 2CHAC 3M37A 1C1TA 2W7SA 4SGAE 2ANKH 2PR3A 1C2JA 4CRCA 2VIPA 1OXGA 3A89A 2ZPQA 1XKBC 2KAIA 1NRPH 4BNRA 4ZXXH 3BTFE 2P16A 2GP9B 2V3HH 1HAYB 4IGDA 2F9BH 1YKTA 3TITA 2Z3DA 2ZU5A 3SUFA 2HNTF 4TYDA 1MTNB 3ZVGA 1TE0A 1TGSZ 4NIYA 4TWYA 1C9TA 3ZZAA 1P8VC 4WWYA 3EAJA 2FESH 4GHTA 1BOQA 4CH8B 2P95A 5GIBA 2OC0A 4GCHF 2NU1E 3QN7A 1SGIB 3LGWA 1GJ9B 2OTVA 1HAGE 1O5CB 2GD4B 4YZUA 1EOLA 1NT1A 3ATLA 1WQSA 2QN5T 3SU6A 1LVMA 2Z94A 5LPRA 2Z6BD 1SGTA 3VB4A 1H8DH 1DLKB 2C93B 1NZQH 1PJPA 1HRTH 4KP0A 1EX3A 1G2MA 1W8BH 1FY5A 3I78A 1C1QA 4WMEA 1ZTJA 4MQAA 2GZ8A 3LH1A 3PB1E 3M5NA 1SGQE 1BBRH 1CBWC 3RLYH 3RXKA 5EG4A 2PLXA 1CSOE 4OS7A 1GI1A 2AFQB 1AN1E 1DPOA 3VPKA 2ZFQH 4E7NA 1YCPM 4NIWA 1UMAH 2D2DA 3GCHC 1SPJA 4Y6DA 5JBCS 1C5WB 4GVUA 2VWOA 3E16B 1VITG 4I33A 3M5OA 3RXOA 2I6SA 1SL3A 1V2QT 4ZROA 2AGIX 5GCHF 4UONA 1ACBE 1T31A 1CA0B 5A09A 1ELVA 3RMLH 2GCTB 2UUFB 2ZO3H 1JMOH 3EE0B 3TNSA 1QBOA 3Q77A 3B23B 2A45B 2C8ZB 1EZUC 1DT2A 3K9XB 1DSTA 1O2PA 3SI3H 4WF8A 1GDNA 1H8IH 1RJXB 1FN8A 3L33A 1DUEA 2XRCA 1CVWH 2OQ5A 1O3LA 1LKBA 3TGIE 1PYTC 4AX9H 4DIIH 5FCKA 2A1DB 4XBBA 2HNTC 3QX5H 7GCHG 1J15A 1Z1JA 3E90B 1O5GH 4MNYA 4XBCA 1P12E 4LOYH 4NSYA 4CBNA 1O2LA 1T7CA 2FOCA 1O2HA 3TK5A 4Y0ZE 1SGFG 2OBQA 5G4BA 3BTQE 3LOXA 1P05A 1YPGH 1AE5A 1LO6A 1NFXA 1NESE 2HPPH 2AEIH 1TA6A 1HIAA 3A80A 3PROA 1MZAA 1Y3YA 2H5DA 1AFEH 1EAUA 1IQNA 1MBMA 3KCGH 5FPYA 1C1UH 1QL9A 2R9PA 1C5VA 2OXSA 4XSKU 2FX6A 3MOCA 3RXMA 1UK4A 5EPYA 2BMGB 3UR9A 3SV9A 1UVOA 1FIWA 1A4WH 1TRNA 4ABHA 2TGAA 1H4WA 1P10A 1AI8H 1T4VH 2BDCA 2O8WA 2A5KA 1MUEB 2BB4A 5DP5A 1KYNA 1C2DA 2ZCLP 3HK6B 3SUDA 4FUEA 3RXVA 3KHVA 3V0XA 3NXPA 2GMTB 2NU4E 1AKSB 1TNKA 1H1BA 1P02A 2ALPA 3A7VA 1SGRE 2GGVB 3RM2H 3SQEE 3T2NA 2FOAA 3M5LA 4YO9A 3CP7A 1FNIA 3RC5A 1UTKA 4K3JA 2ZU2A 1K21H 3E6PH 1WYKA 2PW8H 4IW4E 3UNSA 2QA9E 1GHXH 3I77A 5AVDA 2F9OA 3ZVDA 1TGTA 3K6YA 1RRKA 3P8FA 2W3IA 4UE7H 3M7TA 3S7HB 1LCYA 5GWZA 1FUJA 1MTSA 2ZEBA 5JYIA 3A88A 1ID5H 2BQ7B 2ODQA 1QB1A 4Z0KA 1DY8A 5JDUB 5EQQA 1NROH 1BRCE 1Q3XA 1ELAA 3S9CA 3TJOA 3UFAA 1D9IA 4H6TA 4BAOB 1WBGB 4AOQA 3S0NA 1QJ7B 1V2NT 1W3CA 1FDPA 3PMJA 3F6UH 1GI3A 1S84A 1G36A 3ODDA 4MPXA 4XDEA 1FI8A 1GJCB 4YOIA 3U1JB 1LMWB 1UVUH 3VXFH 2XC5A 5HXFA 4DGJA 3RC4A 3KQEA 2FM2A 1INCA 5E2PA 5GPIB 4WMFA 2PTNA 2A2XH 4A1XA 1GBIA 1TONA 2H5CA 3TNTA 1VJAU 3MH4A 2ZI2H 3L3TA 1N1LA 4ASHA 3VB7A 1QFKH 4U01A 1BTUA 2B8OH 4X6PA 1VCQA 4Y8ZA 2B0FA 2J38A 2VU8E 1A3EH 1NC6A 1GJAB 1EZQA 2ULLA 1QHRB 1ZSKA 2STBE 1DLEA 4I7YH 1O2MA 3F9FA 1KSNA 2HVXA 4U30A 1UO6A 2A7CA 1AUTC 3ITIA 1HAIH 1UTMA 3V7TA 4WXIA 4ZH8A 2CGAA 2G5NA 2XC4A 2BY5X 1MAYA 1SOTA 2BDGA 5C1XA 4ISIH 3VFEA 1V2ST 2SGAA 5B6OA 8GCHF 3A82A 1U6QA 4Q7YA 1AO5A 4Q2KA 1SGPE 3P8GA 4H6SB 2H9HA 4CREA 3KIDU 1GG6B 1O3HA 3NK8A 1IHTH 1YP9A 2BD9A 3GDSA 1N8OB 2QXIA 4YM9A 2JETC 3UQVA 3GY8A 2G52A 2BQ6B 4CRGA 4ABFA 2AIQA 4UFGH 3A84A 5JPMH 1ESBA 1H9LB 1NFYA 2A5AA 3NUMA 4X8UH 3LT3A 1A3BH 3BIVH 1IQMA 4A5TS 1HDTH 4MNWA 4A92A 2V35A 2VIWA 4PROA 4MG3A 1O2VA 2OBOA 2ZG0H 3GICB 4NA8A 2OC8A 1P3EA 4CR5A 1G30B 1Y3XA 3RUOA 1S83A 1C5PA 1GJ4H 3ZZ4A 2YNAA 2VGCB 1LDTT 2ZTYA 1MTVA 3SU2A 2O8UA 3UREA 1PPBH 1HPGA 1SGDE 3RU4T 4BANB 4O03A 1LVYA 1C2IA 2IOTA 5GXPA 1NU7B 2ZP0H 4K1TA 1W13U 1EP6A 1PQ7A 2QAAA 4FUDA 1AIXH 1FMGA 1SB1H 1WV7H 5A8XA 1D3DB 3P92A 3TLOA 1TB6H 1YLDA 4FUGA 3SNEA 4AG2A 1C2GA 5FAHA 2FIRH 1WU1A 3DT0H 1MCVA 3DA9B 3QZRA 2XBWA 1GMDG 5F03A 2Z3CA 4BTTB 1IAUA 1WOFA 2ZC9H 3ATWA 3ZZ3A 1MTUA 3TVJB 4HI3A 2A7HA 3RU4D 4CHAC 1HJAB 1MKXH 3BTHE 4FVBA 3TH3H 1ELCA 1SMFE 3EA9A 2BTCE 1GI5A 2QIQA 3SJOA 5F8XA 5EQRA 1OWHA 2Q1JA 3U1IB 1P9UA 4NCYA 5BPEA 3RXQA 5DK1A 3MH7A 1HAHH 1NPMA 3UTUH 4TWWA 3B8JA 5HGGA 1TRYA 3A83A 1AB9B 3UOPA 3E0NB 4TY6A 4JZEH 1TALA 2SGQE 3RXFA 1OWIA 2A5IA 3RLWH 2XXLA 1QNJA 2PSYA 9ESTA 1UTPA 3QTOH 4B71A 1TMBH 4ZXYH 3R3GB 1AY6H 4R0IA 1GJBB 3A87A 5DG6A 3Q76A 5K0HA 2OQUA 5FX5A 2VWNA 5E2OA 3A7XA 2FTMA 4YOJA 1BBRK 3B9FH 1BMMH 3NWUA 1GMHF 4UFFH 1ZPBA 3TJUA 1XMNB 5J4SA 4OS1A 3BTKE 3M61U 1ANEA 3MMGA 3EDXB 1K1NA 1ELEE 3TPIZ 3RMNH 1O2OA 2BVXH 5FXLA 3QLPH 2ESTE 2BX3A 2UWLA 3ZV9A 1EZSC 3F9GA 4NIVA 1GI0A 2HGTH 1NS3A 2R3UA 1UTQA 2D26C 2Y7ZA 1GBAA 5T6GA 2C8XB 3GY6A 5AFYH 4NA9H 1O30A 2J2UA 4K2YA 4LZ4B 2W7UA 1OS8A 3EYDA 1OP8A 1BTYA 1TOMH 1SQOA 1VITF 2BD7A 3TGJE 1BB0B 2C8YB 4Y76A 4ABEA 1P2OA 4ABIA 3UQOA 1TGNA 1DY9A 4MLFB 4A1VA 5EPNA 3RXCA 2CN0H 1BUIA 1Z71A 3SV7A 1S0QA 1W10U 1GDUA 3DFLA 1QL8A 1O2SA 1GVLA 3TK6A 1PPZA 1O2GH 3BEUA 1Y59T 2AGEX 1BRBE 4X2YA 1YF4A 3SNAA 1S81A 3Q3YA 4FUBA 5HMAA 2LNCA 2Y7XA 1IHSH 6LPRA 2BXTH 2GCTC 1NM6A 3SV2H 1ZMNA 3AAVA 2FPZA 2BZ6H 2XCFA 1HAXB 2HRVA 3HKJB 2BD2A 4AFQA 1DWEH 2OD3B 1C2FA 5IDKA 3M3TA 2ALVA 5DP7A 2D8WA 4X2VA 1P2QA 2ANYA 4ABAA 1BA8B 4TPYA 1F0TA 3T62A 1G2LA 2AIPA 3EQ0H 1XUIA 2WUBA 1KXFA 1TQ7B 1V3XA 1GGDB 3UY9A 4Q7ZA 1ARCA 1SSXA 4DT7B 1A1RA 5CHAB 3ZVCA 1AU8A 2R0KA 3V13A 1L1JA 2BQWB 2Z9JA 8ESTE 4OS5A 2PUQH 3QDZB 3SJIA 1Z7KA 1BTZA 1O34A 3OY5U 1TNHA 1SLXB 4RKOB 4B1TA 1SGEE 1HAZB 1V2PT 2B7DH 1CT4E 2VIQA 3IWMA 1MKWH 1TX6A 3N7OA 1P03A 2A0QB 4ZUHA 2BVSH 1C5QA 4BAQB 1UTOA 1CHGA 3SJ8A 1RS0A 4GLYA 4Q7XA 1DWBH 1O36A 2ZCHP 1TRMA 2CF8H 1O3PB 5AHGH 5FCRA 1TAWA 3ZZ6A 4H4FA 1HAVA 1A0LA 1MD7A 1A2CH 2A2QH 1EJMA 2QF0A 1DXWA 4GUXA 2A7JA 2PKAB 3HATH 3A7ZA 5EXNA 1RGQA 3TK9A 1YLCA 3TGKE 2PV9B 3S69A 1T8LA 1D3TB 1AGJA 1J17T 1O3NA 2C90B 3SHAH 4JYUH 5ABWA 3GCNA 1ANBA 1Y3UA 1C5UA 2ZZUH 1MZDA 2BD5A 3P70B 1S82A 1SFIA 1HUTH 1W7XH 1KIGH 1QA0A 3C1KA 3V3MA 1A5GH 2P8OB 3GISB 1JXPA 3RXPA 4IMQA 2PSXA 2RDLA 4X8SH 1GJ8B 5SGAE 1OOKB 1O3BA 1DICA 1F0RA 2ZGXH 3RXAA 1A5IA 1M9UA 2ZGHA 1UHBA 3A8CA 1GI7B 3QO6A 4HGCA 4A6LA 1KXEA 1V2MT 1Q31A 4YT7H 1OKXA 1DFPA 1EATA 1TNIA 2UWPA 1LQDB 5EGMA 4CRAA 4CRFA 1EAIA 1BDAA 3TJNA 3BN9A 1THRH 2PFEA 4LZ1H 4AYVB 3UR6A 1P04A 1E34B 1PPCE 1G3BA 3SU0A 1QQ4A 3PMBB 3VGCB 4ABGA 1ZLRA 3SNCA 1A0HB 1O2XA 2C4FH 2P3TB 3FFGA 2WPHS 2XWAA 1OWDA 1NTPA 1SVPA 4X2WA 4WVPE 3OTJE 3ZZ5A 3U8OH 2A4OA 1H9HE 1BJVA 1SBWA 1ZHMA 4O3UA 1EPTB 3RXJA 2Z9GA 4AYYB 1O5AB 3LKWA 1JOUB 1Y3WA 5EOKA 1Y3VA 2CF9H 4MPUA 1D3QB 4KTUA 3URCA 2VWMA 1G9IE 3GDUA 1HXFH 1E0FD 3G01A 1VCPA 1EKBB 1G37A 4DY7B 3A7YA 1O35A 4OS6A 4X8VH 4ISLA 3WY8A 1SLUB 1Y5AT 1NO9H 3GY4A 2FDAA 2QC2A 3Q3XA 4SGBE 4AB8A 1JBUH 3F1SB 1TBZH 1QRZA 2Y5GA 1GBTA 4ABJA 3AW0A 3BG4B 1K28D 3TH4H 1BQYA 4RN6A 4AFUA 1F7ZA 4CRBA 4YLQH 1GVKB 1EXFA 1GI8B 3EA7A 1ZGIA 3ATMA 2PKSB 1Z1IA 1GBJA 1GBHA 1JWTA 2ZDVH 3RXRA 1GG6C 3UIRA 3KQCA 2PUXB 1GCTC 2HALA 1NFUA 3S9BA 4R8TB 3MWIU 4K1SA 1EAWA 2QXGA 6CHAC 2J9NA 1BT7A 1NU9A 4UD9H 1RFNA 3PMAB 1A0JA 3UWIA 1LPGB 2GCHG 2XNIA 2CV3A 3ZVAA 2CHAB 2AERH 5DPAA 3GCTG 2FI4E 5E0HA 2ZGCA 2ODYB 4ISHH 1QCPA 4JK6A 1GDQA 1ZMJA 2HPQH 3MU1A 2FMJA 4YLUA 1XUKA 3SU5A 4D8NA 1AQ7A 1BRAA 3Q00A 3TH2H 1J16A 1FXYA 4AORA 2VGCC 1QURH 1GWAA 4CH2B 2FI5E 1MKXK 2GV7A 1EQ9A 1C1SA 1GMDF 2RCEA 3LJJA 3MU5A 4B2BA 1FIZA 1SC8U 2G81E 3W94A 4MNVA 3ZZ7A 2STAE 1BMNH 1GBBA 4K5ZA 1V6DA 2H2ZA 1V2JT 1W11U 4GSOA 4DW2U 3A86A 3EA8A 1P06A 2VWLA 1O38A 3MU8A 2ZQ1A 1KXDA 2FYQA 2Q6FA 2TGDA 1CGIE 1S6HA 2VIOA 1Z8GA 2F9VA 4JZ1A 1L4DA 4BAMB 4NIXA 1THPB 4VGCB 1O0DH 3T5FH 1HJAC 1MCTA 4O97A 2XC0A 1C2MA 1ZSJA 1K1MA 3O8CA 1TNJA 1ETRH 1EJAA 3M3SA 1XXFA 4I8HA 1CBWB 1ETSH 3BG8A 1OSSA 4U2WA 1O33A 1ELDE 4ESTE 3SZNA 1GHWH 3LJOA 3E91A 2FLRH 1O5DH 2ZPRA 1C5XB 1HFDA 2BZAA 1AE8H 1EAXA 1ZRBA 3RXUA 3MO3A 5A8ZA 3GY7A 3DHKH 5F8TA 2EI6A 2G4TA 2GZ9A 3RM0H 3SU1A 1AB9C 4Y79A 3A8AA 4K60A 1RD3B 3VB6A 4IN2A 1WTHD 1W7GH 2G51A 1FPHH 3E3TA 1O31A 2EA3A 3STJA 3HPTB 3W95A 4IN1A 4YOGA 1SG8B 4FUFA 2BY8X 2ILNA 3MNBA 3O8RA 3MO9A 3SI4H 5CMXH 4KKDA 1B0FA 2Y81A 3SUEA 1OYQA 4X1NU 3AASA 3BEFB 3SQHE 1C2LA 1NRQH 4JZDH 3FP8E 1PQAA 1GBDA 4KGAA 1C5YB 2GV6A 1YPEH 2IN2A 2AMDA 1ELTA 3JZ1B 4YTAA 6ESTA 1WQVH 5C1YA 4ABBA 2XYAA 3VB3A 2ANMH 4KTSA 4CRDA 1PPHE 1ZSLA 2XBXA 4I8KA 1AFQC 3NCLA 1P0SH 5I46H 1MBQA 4H42U 2FOHA 3MHWU 4ZKNU 1DSUA 1T8MA 1KLIH 1XXDA 1EOJA 2SGFE 1HJ9A 1BTXA 1TBRH 2VJ1A 2NU2E 1P09A 3ATKA 1P2MA 2FOMB 3MH6A 2THFB 3UWJH 4FU9A 5JBAS 4K8YA 1S85A 2BDYA 3TU7H 3PLKA 3A85A 1UVPA 1MQ5A 4HFPB 3QGNB 3RMMH 4OGXA 4QT8C 2F9NA 1CGJE 1K9OE 2WV4A 1VR1H 5TJXA 1P2IA 1C5RA 1ANCA 3E1XB 1FAKH 4O3TA 1YPKH 1P2NA 1V2VT 1UTNA 1TWXB 3MI4A 2EEKA 3P8NA 1UTJA 3P95A 4Y7AA 4ZHMU 3HGPA 4DOQA 1TNLA 5PTPA 2V6NA 4RSPA 1MD8A 1RIWB 2AGGX 3P17H 1LVBA 2JKHA 2WYJA 1VITH 1C9PA 1GBKA 4IS5A 1K1IA 1UTLM 2O8LA 2A32A 2K1QA 3KL6A 4J1YA 4YT6H 4JK5A 3M3VA 2F91A 2BY7X 2GKVE 3NZIA 3P8OA 2FS9A 2SGPE 5EQSA 3LC3A 3ZVFA 2J95A 3U9AH 2WPMS 1TIOA 5C5OA 1ZRKA 1UCYH 2F9PA 2G4UA 3T26A 4B2CA 3SU3A 4NSVA 4IC6A 3AAUA 4E7RG 2B5TB 1GBMA 1E37B 1KXCA 1TABE 5T3HA 3RXTA 2ZF0H 1WCZA 1MKWK 2ODPA 3LGVA 4BTUB 2FP7B 1D6WA 2A4RA 1GL0E 1OYTH 1GGDC 1GJ6A 2BOHB 4FUHA 2F9UA 1UCYE 2KAIB 3GYMA 1LKAA 2ZFSA 3LU9B 4IBLH 1BITA 5CHAC 1OP0A 3LGIA 2AH4X 3SOSA 3SJKA 5HYOA 1O2ZA 1YBWA 1AKSA 1BHXB 2G00A 3LC5A 3LGUA 2ZQ2A 4MPWA 3PWBA 4GAWA 4J2YB 1SHYA 2XWBI 3O8DA 2AYWA 2OUAA 2GDDA 1YPJH 2FOEA 3PTBA 5I25A 1PQ8A 1AZ8A 4D9QA 3SHCH 2EI7A 2YNBA 2ZTXA 5EW2H 1AVXA 4I32A 1FY1A 1YCPH 3A7WA 3CS7A 4HZHA 8LPRA 1N6XA 1AWFH 1GHYH 3BF6H 2VB0A 4BTIB 1GMCG 2R3YA 3FP7E 2BLWA 1GL1A 1GJ7B 1BIOA 1O2KA 1ELGA 3IITA 1SHHB 2NU3E 1HBTH 5FX6A 1AD8H 1E36B 1MTNC 2Y5FA 1V2RT 1O32A 4X8TH 1IQEA 1F5KU 1XUJA 4D9RA 2A4QA 4ISOA 1PQ5A 1SFQB 2H6MA 2ANWA 2ZHDA 3VXEH 5DGJA 3JZ2B 1ZGVA 1F5LA 1C5TA 3O8BA 5F8ZA 2ZHFH 1O5FH 1ORFA 2I6QA 2ASUB 2FOGA 3SW2B 1MAXA 5GJ4B 2DE8A 1MH0A 3OSYA 1BTWA 3BV9B 5C3NA 5DP4A 3U8RH 4TY7A 1JRSA 3SNDA 5L2YH 1LPKB 4INHA 1G3EA 4KTCA 1KY9A 4DIHH 3ZZBA 3RXSA 1TMTH 5EU8A 5FBEA 4NFEA 1IOEA 3F9HA 1L1GA 2ZDMA 1TPPA 4DURA 3LPRA 1HYLA 1S0RA 2QYIA 4DVAU 1KDQA 3T28A 4B2AA 1A61H 5LH8A 2W3KA 1HAOH 2DUCA 1MU8B 3V12A 3K2UA 2G8TA 3CS0A 2CJIA 1DWDH 5FBIA 5JBBS 2O8TA 3GOVB 2JETB 3A81A 4AG1A 2EI8A 1MQ6A 1GBLA 1L1NA 1QB9A 4WMDA 1FQ3A 1T8NA 3OYPA 3VGCC 3QZQA 2CMYA 1Y5BT 1YPMH 1BMAA 2P3UB 1GI2A 1YPHE 1GPZA 3M5MA 3U69H 1CQQA 1N6YA 2ZDAH 1CA0C 3ZYEA 3R0FA 2XBVA 3ZV8A 2P93A 1SLWB 1CHOG 4O9VA 2GT7A 1SQTA 7GCHF 4I31A 1LTOA 1L0ZA 3FANA 1EUFA 1K22H 1GI9B 4FU8A 1O2IA 3QTVH 5E0GA 2ZKSA 1EPTC 3PLBA 2Y82A 5DO4H 1O3MA 3ZVEA 1YM0A 4NWLA 1AWHB 1TGCA 1LHGH 3MNSA 1CT2E 1KLJH 2FOBA 2J34A 3ZVBA 2ZU1A 1HIAB 4Y8YA 5EW1H 4A1TA 1FJSA 1XX9A 1O3GA 2ZIQH 4AGJA 2Q6DA 1FZZA 1X7AC 2Y5HA 2ZHWH 3DUXH 4UFEH 1FY3A 3RC6A 2SFAA 1ZJKA 8KME2 2WYGA 1ABIH 2BY9X 1F0SA 5LPEA 3BG4C 4HTCH 4BXSA 1DM4B 3M36A 1D4PB 1HLTH 1T4UH 1CO7E 1IQKA 1P01A 2TBSA 3HKIB 2GCHF 1YPLH 1HNEE 2PKSC 3GCTF 4AZ2B 3M7UA 1MTWA 1QBVH 2FOFA 5EODA 2BX4A 1AUJA 2BLVA 2SNWA 1C5SA 1O3AA 3D49H 5A0CA 1Z8RA 2VNTA 3SV6A 3T25A 3BTWE 5HM2A 4AB9A 1UJ1A 1ZPCA 2YOLA 2FX4A 2OC1A
chains in the Genus database with same CATH superfamily
1O37A 3RMOH 1GHBG 1KMHB 5T6FA 1ZOMA 1C5ZB 2GX4A 1O3OA 5JBTA 4FUJA 1J14A 5C67A 2ZDLA 1W0ZU 3GDVA 1ELBA 1UK3A 4JZIA 2JJ2D 1TX7A 2BDAA 5DP9A 1TPOA 4XE4A 1A46H 4OS2A 1G32B 3KN2A 2J94A 2GVFA 4IMZA 2FEQH 2GMTC 4ZAEA 2F43B 1IQHA 5ESBA 1V2KT 1VGCB 3ZZCA 3SORA 1P2KA 3RXIA 5A8YA 3SGBE 1O2QA 1UK2A 3BTGE 2TGTA 1LHFH 2XNDD 3H5CB 4Q80A 1IQFA 4WY3A 3LH3A 1GI4A 3GCOA 5FPSA 1QIXB 4XD7D 5ETXA 2J98B 4WH6A 3UOUA 1S6FA 3ATIA 1QJ1B 3ZZ9A 3E8LA 1DUAA 4OS4A 2AMQA 3KQDA 1GVZA 2NWNA 1XKAC 3IG6B 4HG6A 1TOCB 2BY6X 3SZEA 1HJ8A 1OWKA 5C20A 2W26A 3LGYA 1GI6A 3PM3A 4X6NA 6GCHG 1ZZZA 2FO9A 2J4IA 1UVSH 1QR3E 2KCPA 1AZZA 1CGHA 3OEHD 1GMHG 4VGCC 5EIYA 1V2OT 1GJDB 2JH5D 3BSQA 3F2GA 3T27A 3L6PA 3A8DA 4ZHAA 5JB8S 1ZJDA 3ENSB 2GTBA 2HWLB 1Z8IB 1C1RA 1HXEH 3RU4E 5CDFE 1BRUP 1RXPA 1NBMD 1P3CA 2P3FH 1DX5M 1O3CA 1SLVB 3SN8A 3EGKH 3FVFB 3DFJA 4MNXA 1YC0A 1FX0B 3FAOA 1W2KH 2J97A 2QF4A 5L30H 1O5BB 2FZZA 1B5GH 1UW7A 1AHTH 1BBRE 1TPAE 1HGTH 2BYAX 3PWCA 1CE5A 3GS9A 1KXBA 3VB5A 1DANH 1FPCH 1TX8A 1TA2A 4RKJB 2J5UA 1QRWA 3DD2H 1D3PB 1ZHRA 3DSOA 2C8WB 1GCDA 2WPJS 1RTKA 1C1WH 2ZGBH 1VZQH 1XVMA 4X6MA 1KTSB 1C5NH 1VKYA 3D62A 2QXJA 1DVAH 1UVTH 2D1JA 2LPRA 1G3CA 4UDWH 2Z7FE 1Z6JH 4M9FA 2SNVA 3PO1B 1SKYE 1DITH 1AMHA 3RXEA 5B6LA 1BHXF 4MTBA 1W14U 2WPKS 1THSH 1FY8E 2XW9A 1QQUA 4X1PU 1C2HA 4D7FA 2AS9A 2VH6A 1VJ9U 1ZPZA 5DJ7A 1TFXA 2Z3EA 3UUZA 3NPSA 1HCGA 1YPHC 4ISNA 3RXDA 1LQEA 2ZFTA 1SOZA 3WWBA 2R2WU 2VH0A 5L2ZH 1XUHA 4Y71A 1NRRH 1N8OC 3M7QA 2O8MA 3UNQA 1O3JA 2OCVB 1O2NA 4AFZA 1BCUH 2F83A 2WV5A 1JRTA 1O3DA 1SR5C 2EC9H 1O3IA 1F0UA 2V0BA 4TPIZ 1GHAG 3F0OA 1Y8TA 3AVZA 2UUJB 2ZDNA 2FWWA 2BDBA 1UCYK 3QK1A 3QUMP 3GYLB 2QCYA 1C4V2 4DG4A 2FLBH 3TJVA 3PV4A 1BZXE 1O2RA 3RXLA 1NN6A 2B9LA 3MYWA 4FU7A 1YGCH 5LGOA 1C1NA 1RIWC 3ELAH 1QBNA 2TIOA 2ZPSA 2R2MB 3GY2A 5TCAA 1SGYE 1LHEH 1O2UA 4B6EA 2BD8A 4Z6AH 4ZKRU 1C2EA 4INLA 2G55A 1FONA 1J9CH 2BD4A 2FYRA 2SGDE 2UUYA 2PGQB 1S6LA 3RXBA 7LPRA 1ZTKA 2Z9KA 3D65E 5C5NA 4I8LA 1L4ZA 1C2KA 1PFXC 3MNXA 5HIYA 2AMPA 1F5RA 1ZR0A 3OAAD 1QL7A 4ABDA 4BAKB 1C5LH 3GY3A 3LIWA 3MO6A 2NU0E 1WDIA 1YCPK 3KEEA 4NG9H 1PYTD 5FHTA 1LPZB 2H9TH 3A7TA 4GCHG 1ZHPA 1O39A 1BMLA 3PLPA 2QY0B 3PRBA 2PKAA 4CBOA 1COWD 1ZYOA 1P2JA 4ZKSU 4D7GA 4I86A 2ZTZA 1GMCF 1XVOA 2BLOA 1JIRA 1LVOA 2ZHQH 4I8JA 2VVCA 4RT1A 2ZU3A 1H9IE 4INKA 2BD3A 1SI5H 2PWXA 5AF9H 4FUCA 5FPTA 2W6JD 4DCDA 9LPRA 1TQ0B 1T8OA 2VIVA 1C1MA 3GCHB 3E0PB 2Z9IA 2GZ7A 3BTME 2QF3A 2L74A 3KNXA 3LONA 4BXWA 2Y80A 4XFQA 3ODFA 3MFJA 4Y8XA 3WW7A 3Q3KA 5DP6A 2O9QA 3NKKA 2Y6TA 5LPFA 2RG3A 2RA3A 3QGJA 4B75A 1C5OH 5EJLA 4K8BA 1SGNE 1D6RA 1TPSA 3UNRA 1E38B 3K6ZA 1J8AA 5EJ1A 5CE1A 5EJZA 5GCHG 1B7XB 1PPGE 1V2TT 3FZDA 1QGFA 1KXAA 4NA7A 5A0AE 1TBQH 1LHCH 4UEHH 3RDZA 1E35B 1EP5A 1KDQB 1K2I1 1KLTA 5T1VA 2Z9LA 1V2UT 2IPHA 4DJZB 3M35A 3UPEA 1P9SA 1GBFA 1L2EA 2ZDKA 2A4GA 2VINA 1ETTH 5H4IB 1EPTA 1Y5UT 3DSGA 3SUGA 3ZZ8A 7KMEH 2PGBB 1EZXC 2WPIS 1DWCH 1OWJA 2BDHA 2FTLE 2M5TA 3HGNA 5IYTA 4KELA 2ZFPH 5BRRE 2QGRA 1WAYB 3PV2A 3MNCA 1FV9A 1GBEA 1BTHH 1ARBA 1W0YH 2XCNA 4AN7A 4Q4LA 4NZQA 1YYY1 1GCTB 3LDXH 1YWUA 4THNH 1NFWA 3OU0A 2FXRA 1AVWA 1CHOF 5C1UA 2ZU4A 5F53A 4F4OC 1O2TA 6CHAB 3MU0A 1EASA 3SGQE 3P6ZB 3GY5A 1DOJA 3RXHA 1T32A 1A5HA 2V3MA 4Y7BA 2ZNKH 1BJUA 5E0JA 1LHDH 3ZYDA 5A0BA 1XM1A 1F92A 4B73A 4A7IB 1QB6A 2CXVA 4K69A 4XOJA 2OLGA 1RTFB 3LGTA 1OX1A 2ZA5A 2FS8A 1ZMLA 3SV8A 3F68H 4OGYA 3FP6E 2XBYA 2FODA 1TNGA 3BTDE 4I8GA 4M7GA 2ZCKP 3FZZA 5ESTE 4UFDH 3KYGA 1O3FA 2P59A 3URDA 2JH6D 1TYNA 4X1SU 4B74A 1C1VH 1NRSH 4E05H 3D23A 4ZKOU 1TGBA 3S9AA 1B0EA 2M2AA 3H7OA 1QTFA 2XTTB 1Z8JB 3CENA 2KR7A 1GHZA 2PHBA 4IC5A 2JDID 2QXHA 2TPIZ 4B76A 2VVUA 1HB0B 2FI3E 1MMJN 4WH8A 1C5MD 2Q6GA 1QY6A 2HLCA 3ESTA 1HAPH 3HK3B 5C2ZA 2IJOB 1ESTA 4NGAH 3I29A 1HAVB 5K7RA 1GHBF 2KZ4A 2R0LA 2W5EA 5DP3A 5HM9A 1IQGA 2BDIA 3OX7U 1CU1A 4JYVH 5CHBA 1ZTLA 3KGPA 3BIUH 1BTPA 4FXGH 4GPGA 3VEQB 1OPHB 2C3SA 4MPVA 4X6OA 2ZECA 1NRNH 3MU4A 5GNDA 1DE7H 3PYHA 1SGFA 2JH0D 2HOBA 4LK4A 2OK5A 3MH5A 1F2SE 4DT4A 1Q2WA 4U32A 2VVVA 1ABJH 3OE7D 3C27B 3PMHB 1TLDA 1DS2E 1IQIA 4JZFH 5AFZH 4NFFA 1O2JA 2VIDA 1QRXA 1IQLA 4X0WU 2EY4C 4JMYA 1C4U2 1ANDA 3RP2A 1ELFA 1P57B 2ZGJA 4CR9A 2ZFRH 2A31A 4X1QU 1AVGH 1ESAA 2F3CE 1MU6B 1OP2A 1V2LT 1VGCC 3SBKA 1UHBB 3AW1A 1PPEE 5TCCA 3K65B 4X2XA 4MVNA 1O5EH 6GCHF 2H1UA 4ZMAH 2OINA 1O3EA 5EXMA 4WXVA 3SNBA 5EXLA 4BOHA 3A8BA 5C0TA 2RA0A 4RI0A 3RXGA 2P8OC 4LXBH 1O2WA 1TMUH 3STIA 4X1RU 1JIMA 1GBCA 4D76A 1C1PA 1K1LA 1AFQB 1GJ5H 2GDEH 5L6NH 2BVRH 4P02A 1K1JA 3KF2A 3SJ9A 2BM2A 2PTCE 3U98H 2ZWLH 5A2MH 5E8EH 2ZFFH 3BTEE 2OC7A 3OY6U 1FLEE 1GHVH 2UUKB 2ZHEH 2H9EH 5T6DA 4B6FA 3S7KB 5KGOA 1EB1H 3BTTE 1KTTB 1WTGH 1XUGA 2HNTE 8GCHG 2DE9A 2QV1A 1PPFE 1H8ED 1SGCA 2UWOA 1FY4A 1HV7A 1WSSH 3PTNA 3SGAE 4ZHLU 1QJ6B 2BHGA 4WJG2 2BXUH 1Z6EA 1SQRA 4BAHB 5DP8A 4K1EA 1O3KA 4Y0YE 3SO3A 2G5VA 4Y10E 2TGPZ 3ZZDA 1WUNH 5F6MA 1K1OA 5GDSH 1A7SA 4F49A 2TRMA 2GT8A 2BLQA 4NWKA 4JCNA 4NZLA 3F9EA 4Y11E 2J92A 3F2FA 2BOKA 2WPLS 4FUIA 4MDSA 4FVDA 4AFSA 1OWEA 1QA7A 2WUCA 3H7TA 2V3OH 1IQJA 1DDJA 3MTYA 1P11E 1VCWA 7ESTE 1CA8B 4E06H 4AGKA 1RTLA 4GHQA 5J4QA 1V2WT 3PO1C 2SGEE 3WWFA 5DKMA 1NY22 3KQBA 1EB2A 1DXPA 1CT0E 2OP9A 1W12U 3BEIB 4JYTA 3CNRA 4YESB 1S5SA 3T29A 1G3DA 4CHAB 2YMSB 3U8TH 3TIUA 1XUFA 1FAXA 1SQAA 1C1OA 1GHAF 3SU4A 1K1PA 1FN6A 5JB9S 3QWCH 3N99A 1EJNA 1O2YA 2WINI 4ZCNA 3N7DA 4XBDA 1C4Y2 2P94A 2CHAC 3M37A 1C1TA 2W7SA 4SGAE 2ANKH 2PR3A 1C2JA 4CRCA 2VIPA 1OXGA 3A89A 2ZPQA 1XKBC 2KAIA 1NRPH 4BNRA 4ZXXH 3BTFE 2P16A 3DCLA 2GP9B 2V3HH 1HAYB 4IGDA 2F9BH 1YKTA 3TITA 1E79D 2Z3DA 2ZU5A 3SUFA 2HNTF 4TYDA 1MTNB 2LELA 3ZVGA 1TE0A 1TGSZ 4NIYA 4TWYA 1C9TA 3ZZAA 1P8VC 4WWYA 3EAJA 2FESH 4GHTA 1BOQA 4CH8B 2P95A 2K0QA 2OC0A 5GIBA 4GCHF 2NU1E 3QN7A 1SGIB 3LGWA 1GJ9B 2OTVA 1HAGE 1O5CB 2GD4B 4YZUA 1EOLA 1NT1A 3ATLA 1WQSA 2QN5T 3SU6A 1LVMA 2Z94A 5LPRA 2Z6BD 1SGTA 2QE7D 3VB4A 1H8DH 1DLKB 2C93B 1NZQH 1PJPA 1HRTH 4KP0A 1EX3A 1G2MA 1W8BH 1FY5A 3I78A 1C1QA 4WMEA 1ZTJA 4MQAA 4OM9A 2GZ8A 3LH1A 3PB1E 3M5NA 1SGQE 1BBRH 1CBWC 3RLYH 3RXKA 5EG4A 2PLXA 1CSOE 4OS7A 1GI1A 2AFQB 1AN1E 1DPOA 3VPKA 2K8IA 2ZFQH 1OHHD 4E7NA 1YCPM 4NIWA 1UMAH 2D2DA 3GCHC 1SPJA 4Y6DA 5JBCS 1C5WB 4GVUA 2VWOA 3E16B 1VITG 4I33A 3M5OA 3RXOA 2I6SA 1SL3A 1V2QT 4ZROA 2AGIX 5GCHF 4UONA 1ACBE 1T31A 1CA0B 4ACAA 5A09A 1ELVA 3RMLH 2GCTB 2UUFB 2ZO3H 1JMOH 3EE0B 3TNSA 1QBOA 3Q77A 3B23B 2A45B 2C8ZB 1EZUC 1DT2A 3K9XB 1DSTA 1O2PA 3SI3H 4WF8A 1GDNA 1H8IH 1RJXB 1FN8A 3L33A 1DUEA 2XRCA 2XOKD 1CVWH 2OQ5A 1O3LA 1LKBA 3TGIE 1PYTC 4AX9H 4DIIH 5FCKA 2A1DB 4XBBA 2HNTC 3QX5H 7GCHG 1J15A 1Z1JA 3E90B 3FN8A 1O5GH 4MNYA 4XBCA 1P12E 4LOYH 4NSYA 4CBNA 1O2LA 1T7CA 2FOCA 1O2HA 3TK5A 4Y0ZE 1SGFG 2OBQA 5G4BA 3BTQE 3LOXA 1P05A 1YPGH 1AE5A 1LO6A 1NFXA 1NESE 2HPPH 2AEIH 2WPDD 1TA6A 1HIAA 3A80A 3PROA 1MZAA 1Y3YA 4RT0A 2H5DA 1AFEH 1EAUA 1IQNA 1MBMA 3KCGH 5FPYA 1C1UH 1QL9A 2R9PA 1C5VA 2OXSA 4XSKU 2FX6A 3MOCA 3RXMA 1UK4A 5EPYA 2BMGB 3UR9A 3SV9A 1UVOA 1FIWA 1A4WH 1TRNA 4ABHA 2TGAA 1H4WA 1P10A 1AI8H 1T4VH 2BDCA 2O8WA 2A5KA 1MUEB 2BB4A 5DP5A 1KYNA 1C2DA 2ZCLP 3HK6B 3SUDA 4FUEA 3RXVA 3KHVA 3V0XA 3NXPA 2GMTB 2NU4E 1AKSB 1TNKA 1H1BA 1P02A 2ALPA 2HLDD 3A7VA 1SGRE 2GGVB 3RM2H 3SQEE 4ACBA 3T2NA 2FOAA 3M5LA 4YO9A 3CP7A 1FNIA 3RC5A 1UTKA 4K3JA 2ZU2A 1K21H 3E6PH 1WYKA 2PW8H 4IW4E 3UNSA 2QA9E 1GHXH 3I77A 5AVDA 2F9OA 3ZVDA 1TGTA 3K6YA 1RRKA 3P8FA 2W3IA 4UE7H 3M7TA 5DSFA 1LCYA 5GWZA 3S7HB 1FUJA 1MTSA 2ZEBA 5JYIA 3A88A 1ID5H 2BQ7B 2ODQA 1QB1A 4Z0KA 2IJD1 1DY8A 5JDUB 5EQQA 2J98A 1NROH 4TT3D 1BRCE 1Q3XA 1ELAA 3S9CA 5HIZA 3TJOA 3UFAA 1D9IA 4H6TA 4BAOB 1WBGB 4AOQA 3S0NA 1QJ7B 1V2NT 1W3CA 1FDPA 3PMJA 3F6UH 1GI3A 1S84A 1G36A 3ODDA 4MPXA 4XDEA 1FI8A 2RDEA 1GJCB 4YOIA 3U1JB 1LMWB 1UVUH 3VXFH 2XC5A 5HXFA 4DGJA 3RC4A 3KQEA 2FM2A 1INCA 5E2PA 5GPIB 4WMFA 2PTNA 2A2XH 4A1XA 1GBIA 1TONA 2H5CA 3TNTA 1VJAU 2AHME 3MH4A 2ZI2H 3L3TA 1N1LA 3OTPA 4ASHA 3VB7A 1QFKH 4U01A 1BTUA 2B8OH 4X6PA 1VCQA 4Y8ZA 2B0FA 2J38A 3PRDA 2VU8E 1A3EH 3OFND 3F3BA 1NC6A 1GJAB 1EZQA 2ULLA 1QHRB 1ZSKA 2STBE 1DLEA 4I7YH 1O2MA 3F9FA 1KSNA 2HVXA 4U30A 1UO6A 2A7CA 1AUTC 3ITIA 1HAIH 1UTMA 3V7TA 4WXIA 4ZH8A 2CGAA 2G5NA 2XC4A 2BY5X 1MAYA 1SOTA 2BDGA 5C1XA 4ISIH 3VFEA 1V2ST 2SGAA 5B6OA 8GCHF 3A82A 1U6QA 4Q7YA 1AO5A 4Q2KA 1SGPE 3P8GA 4H6SB 2H9HA 4CREA 2JJ1D 3KIDU 1GG6B 1O3HA 1YLNA 3NK8A 1IHTH 1YP9A 2BD9A 3GDSA 1N8OB 2QXIA 4YM9A 2JETC 3UQVA 3GY8A 2G52A 2BQ6B 4CRGA 4ABFA 2AIQA 4UFGH 1QZ8A 3A84A 5JPMH 1ESBA 1H9LB 1NFYA 2A5AA 3NUMA 4X8UH 3LT3A 1A3BH 3BIVH 3FKSD 1IQMA 4A5TS 1HDTH 4MNWA 4A92A 1NBME 2V35A 2VIWA 4PROA 4MG3A 1O2VA 2OBOA 2ZG0H 3GICB 4NA8A 2OC8A 1P3EA 1WXRA 4CR5A 1G30B 1Y3XA 3RUOA 1S83A 1C5PA 1GJ4H 3ZZ4A 2YNAA 2VGCB 1LDTT 2KX4A 2ZTYA 1MTVA 3SU2A 2O8UA 3UREA 1PPBH 1HPGA 1SGDE 3RU4T 4BANB 4O03A 1LVYA 1C2IA 2IOTA 5GXPA 1NU7B 2ZP0H 4K1TA 1W13U 1EP6A 1PQ7A 2QAAA 4FUDA 5KEDA 1AIXH 1FMGA 1SB1H 1WV7H 5A8XA 3FO8D 1D3DB 3P92A 3TLOA 1TB6H 1YLDA 4FUGA 3SNEA 4AG2A 1C2GA 5FAHA 2FIRH 1WU1A 3DT0H 1MCVA 3DA9B 3QZRA 2XBWA 1GMDG 5F03A 2Z3CA 4BTTB 1IAUA 1WOFA 2ZC9H 3ATWA 3ZZ3A 1MTUA 3TVJB 4HI3A 2A7HA 3RU4D 1YY3A 4CHAC 4FETA 1HJAB 2YMSC 1MKXH 3BTHE 4FVBA 3TH3H 1ELCA 1SMFE 3EA9A 2BTCE 1GI5A 3SYJA 2QIQA 2HVYB 3SJOA 5F8XA 5EQRA 4Z1MD 1OWHA 2Q1JA 3U1IB 1P9UA 4NCYA 5BPEA 3RXQA 5DK1A 3MH7A 1HAHH 1NPMA 2QF5A 2VBCA 3UTUH 4TWWA 3B8JA 5HGGA 1TRYA 2W6ID 3A83A 1AB9B 3U28C 3UOPA 5C0UA 3E0NB 4TY6A 4JZEH 1TALA 2SGQE 3RXFA 1OWIA 2A5IA 3RLWH 2XXLA 1BMFD 1QNJA 2PSYA 9ESTA 1UTPA 3QTOH 4B71A 1TMBH 4ZXYH 3R3GB 1AY6H 1K0HA 4R0IA 1GJBB 3A87A 5DG6A 3Q76A 1H8HD 5K0HA 2OQUA 5FX5A 2VWNA 5E2OA 3A7XA 4Q63A 2FTMA 4YOJA 4ASUD 1BBRK 3B9FH 1BMMH 3NWUA 1GMHF 4UFFH 1ZPBA 3TJUA 1XMNB 5J4SA 4OS1A 3BTKE 3M61U 1ANEA 3MMGA 3EDXB 5HKKD 1K1NA 1ELEE 2WHXA 3TPIZ 3RMNH 1O2OA 2BVXH 5FXLA 3QLPH 2ESTE 2BX3A 2UWLA 3ZV9A 1EZSC 3F9GA 4NIVA 1GI0A 2HGTH 1NS3A 2R3UA 1UTQA 2D26C 2Y7ZA 3N7EA 1GBAA 5T6GA 2C8XB 3GY6A 5AFYH 4NA9H 1O30A 2J2UA 4K2YA 4LZ4B 2W7UA 1OS8A 3EYDA 1OP8A 1BTYA 1TOMH 1SQOA 1VITF 2BD7A 3TGJE 1BB0B 2C8YB 4Y76A 4ABEA 1P2OA 4ABIA 3FOAA 1TGNA 1DY9A 4MLFB 1W0KD 3UQOA 4A1VA 5EPNA 3RXCA 2F4LA 2CN0H 3W1EA 1BUIA 1Z71A 3SV7A 1S0QA 1W10U 1GDUA 3DFLA 1QL8A 1O2SA 1GVLA 3TK6A 1PPZA 1O2GH 3BEUA 1Y59T 2AGEX 1BRBE 4X2YA 1YF4A 3SNAA 1S81A 3Q3YA 4FUBA 5HMAA 2LNCA 2Y7XA 1IHSH 6LPRA 2BXTH 2GCTC 1NM6A 3SV2H 1ZMNA 3AAVA 2FPZA 2BZ6H 2XCFA 1HAXB 2HRVA 3HKJB 2BD2A 4AFQA 1DWEH 2OD3B 1C2FA 5IDKA 3M3TA 2ALVA 5DP7A 2D8WA 4X2VA 1P2QA 2ANYA 4ABAA 1BA8B 4TPYA 1F0TA 3T62A 1G2LA 2AIPA 2WZQA 3EQ0H 1XUIA 2WUBA 1KXFA 1TQ7B 1V3XA 1GGDB 3UY9A 4Q7ZA 1ARCA 1SSXA 4DT7B 1A1RA 5CHAB 3ZVCA 1AU8A 2R0KA 3V13A 1L1JA 2BQWB 2Z9JA 8ESTE 4OS5A 2PUQH 3QDZB 3SJIA 1Z7KA 1BTZA 3DSPA 1O34A 3OY5U 1TNHA 1SLXB 4RKOB 4B1TA 1SGEE 4AC9A 1HAZB 2KCYA 1V2PT 2B7DH 1CT4E 2VIQA 3IWMA 1MKWH 1TX6A 3N7OA 1P03A 2A0QB 4ZUHA 2V7QD 2BVSH 1C5QA 4BAQB 1UTOA 1CHGA 3SJ8A 1RS0A 4GLYA 4Q7XA 1DWBH 1O36A 2ZCHP 1TRMA 2CF8H 1O3PB 5AHGH 5FCRA 1TAWA 3ZZ6A 4H4FA 1HAVA 1A0LA 1MD7A 1A2CH 2A2QH 1EJMA 2QF0A 1DXWA 4GUXA 2A7JA 2PKAB 3HATH 3A7ZA 5EXNA 1RGQA 3TK9A 1YLCA 3TGKE 2PV9B 3S69A 1T8LA 1D3TB 1AGJA 1J17T 1O3NA 2C90B 3SHAH 4JYUH 5ABWA 3GCNA 1ANBA 1Y3UA 1C5UA 2ZZUH 1MZDA 2BD5A 3P70B 1S82A 1SFIA 1HUTH 1W7XH 1KIGH 3H09A 1QA0A 3C1KA 3V3MA 1A5GH 2P8OB 3GISB 1JXPA 3RXPA 4IMQA 2PSXA 2RDLA 4X8SH 1GJ8B 5SGAE 1OOKB 1O3BA 1DICA 1F0RA 2ZGXH 3RXAA 1A5IA 1M9UA 2ZGHA 1UHBA 3A8CA 1GI7B 3QO6A 4HGCA 4P00A 4A6LA 1KXEA 1V2MT 1Q31A 4YT7H 1OKXA 1DFPA 1EATA 1TNIA 2UWPA 2WV9A 1LQDB 5EGMA 4CRAA 4CRFA 1EAIA 1BDAA 3TJNA 3BN9A 1THRH 2PFEA 4LZ1H 4AYVB 3UR6A 1P04A 1E34B 1PPCE 1G3BA 3SU0A 1QQ4A 3PMBB 3VGCB 4ABGA 1ZLRA 3SNCA 1A0HB 1O2XA 2C4FH 2P3TB 3FFGA 2WPHS 2XWAA 1OWDA 1NTPA 1SVPA 4X2WA 4WVPE 3F2HA 3OTJE 3ZZ5A 3U8OH 2A4OA 1H9HE 1BJVA 1SBWA 1ZHMA 3EE7A 4O3UA 1EPTB 3RXJA 2Z9GA 4AYYB 1O5AB 3LKWA 1JOUB 1Y3WA 5EOKA 1Y3VA 2CF9H 4MPUA 1D3QB 4KTUA 3URCA 2VWMA 1G9IE 3GDUA 1HXFH 1E0FD 3G01A 1VCPA 1EKBB 1G37A 4DY7B 3A7YA 1O35A 4OS6A 4X8VH 4ISLA 3WY8A 1SLUB 2KCAA 1Y5AT 1NO9H 3GY4A 2FDAA 2QC2A 3Q3XA 4SGBE 4AB8A 1JBUH 3F1SB 1TBZH 1QRZA 2Y5GA 1GBTA 2IPQX 4ABJA 3AW0A 3UAIC 3BG4B 1K28D 3TH4H 1BQYA 4RN6A 4AFUA 1F7ZA 4CRBA 4YLQH 1GVKB 1EXFA 1GI8B 3EA7A 1ZGIA 2L6OA 2PKSB 3ATMA 1MABB 1Z1IA 1GBJA 1GBHA 2KM0A 1JWTA 2ZDVH 3RXRA 1GG6C 3UIRA 3KQCA 2PUXB 1GCTC 2HALA 1NFUA 3S9BA 2KCOA 4R8TB 4FOUC 3MWIU 4K1SA 1EAWA 2QXGA 6CHAC 2J9NA 1BT7A 1NU9A 4UD9H 5KECA 1RFNA 3PMAB 1A0JA 3UWIA 1LPGB 2GCHG 2XNIA 2CV3A 3ZVAA 2CHAB 2AERH 5DPAA 5IK2D 3GCTG 2FI4E 5E0HA 2ZGCA 2ODYB 4ISHH 1QCPA 4JK6A 1GDQA 1ZMJA 2HPQH 3MU1A 2FMJA 4YLUA 1XUKA 3SU5A 4D8NA 1AQ7A 1BRAA 3Q00A 3TH2H 1J16A 1FXYA 4AORA 2VGCC 1QURH 1GWAA 4CH2B 2FI5E 1MKXK 2GV7A 1EQ9A 1C1SA 1GMDF 2RCEA 3LJJA 3MU5A 4B2BA 4F55A 1FIZA 1SC8U 2G81E 3W94A 4MNVA 3ZZ7A 2STAE 1BMNH 1GBBA 4K5ZA 1V6DA 2H2ZA 1V2JT 1W11U 4GSOA 4DW2U 3A86A 3EA8A 1P06A 2VWLA 1O38A 3MU8A 2ZQ1A 1KXDA 2FYQA 2Q6FA 2TGDA 3PV5A 1CGIE 1S6HA 2VIOA 1Z8GA 2F9VA 4JZ1A 1L4DA 4BAMB 4NIXA 1THPB 3OEED 4VGCB 1O0DH 3NRLA 3T5FH 1HJAC 1MCTA 4O97A 2XC0A 1C2MA 1ZSJA 1K1MA 3O8CA 1TNJA 1ETRH 1EJAA 3M3SA 1XXFA 4I8HA 1CBWB 1ETSH 3BG8A 1OSSA 4U2WA 1O33A 1ELDE 4ESTE 3SZNA 1GHWH 3LJOA 3E91A 2FLRH 1O5DH 2ZPRA 1C5XB 1HFDA 2BZAA 1AE8H 1EAXA 1ZRBA 3RXUA 3MO3A 3ZIAD 5A8ZA 3GY7A 3DHKH 5F8TA 2KFWA 3AK5A 2EI6A 2G4TA 2GZ9A 3RM0H 3SU1A 1AB9C 4Y79A 3A8AA 3VG8A 4K60A 1RD3B 3VB6A 4IN2A 1WTHD 1W7GH 2G51A 2JIZD 1FPHH 3E3TA 1O31A 2EA3A 3STJA 3HPTB 3W95A 4IN1A 4YOGA 1SG8B 4FUFA 2BY8X 2ILNA 3MNBA 3O8RA 3MO9A 3SI4H 5CMXH 4KKDA 1B0FA 2Y81A 3SUEA 1OYQA 4X1NU 3AASA 3BEFB 3SQHE 1C2LA 1NRQH 4JZDH 3FP8E 1PQAA 1GBDA 4KGAA 1C5YB 2GV6A 1W0JD 4TSFD 1YPEH 2IN2A 2AMDA 1ELTA 3JZ1B 4YTAA 6ESTA 1WQVH 5C1YA 3F0PA 4ABBA 2XYAA 3VB3A 2ANMH 4KTSA 4CRDA 1PPHE 1ZSLA 2XBXA 4I8KA 1AFQC 3NCLA 1P0SH 5I46H 1MBQA 4H42U 2FOHA 3MHWU 4ZKNU 1DSUA 1T8MA 1KLIH 1XXDA 1EOJA 2SGFE 1HJ9A 1BTXA 1TBRH 2VJ1A 2NU2E 1P09A 3ATKA 1P2MA 3KYFA 2FOMB 3MH6A 2THFB 3UWJH 4FU9A 5JBAS 4K8YA 1S85A 2BDYA 3TU7H 3PLKA 3A85A 1UVPA 1MQ5A 4HFPB 3QGNB 3RMMH 4OGXA 4QT8C 2F9NA 1CGJE 1K9OE 2WV4A 1VR1H 5TJXA 1P2IA 1C5RA 1ANCA 3E1XB 1FAKH 4O3TA 1YPKH 1P2NA 1V2VT 1UTNA 1TWXB 3MI4A 2EEKA 3P8NA 1UTJA 3P95A 4Y7AA 4ZHMU 3HGPA 4DOQA 1TNLA 5PTPA 2V6NA 4RSPA 1MD8A 1RIWB 2AGGX 3P17H 1LVBA 2JKHA 2WYJA 1VITH 1C9PA 1GBKA 4IS5A 1K1IA 1UTLM 2O8LA 2A32A 2K1QA 3KL6A 4J1YA 4YT6H 4JK5A 3M3VA 2F91A 2BY7X 2WSSD 2GKVE 3NZIA 3P8OA 2FS9A 2SGPE 5EQSA 3LC3A 3ZVFA 2J95A 3U9AH 2WPMS 1TIOA 5C5OA 1ZRKA 1UCYH 2F9PA 2G4UA 3T26A 4B2CA 2CK3D 3SU3A 4NSVA 4IC6A 3AAUA 4E7RG 2B5TB 1GBMA 1E37B 1KXCA 1TABE 5T3HA 3RXTA 2ZF0H 1WCZA 1MKWK 2ODPA 3LGVA 4BTUB 2FP7B 1D6WA 2A4RA 1GL0E 1OYTH 1GGDC 1GJ6A 2BOHB 4FUHA 2F9UA 1UCYE 2KAIB 3GYMA 1E1RD 5C94A 1LKAA 2ZFSA 3LU9B 4IBLH 1BITA 5CHAC 1OP0A 3LGIA 2AH4X 3SOSA 3SJKA 5HYOA 1O2ZA 1YBWA 1AKSA 1BHXB 2G00A 3LC5A 3LGUA 2ZQ2A 4MPWA 3PWBA 4GAWA 4J2YB 1SHYA 2GJGA 2XWBI 3O8DA 2AYWA 2OUAA 2GDDA 1YPJH 2FOEA 3PTBA 5I25A 1PQ8A 1AZ8A 4D9QA 3SHCH 2EI7A 2YNBA 2ZTXA 5EW2H 3UB0A 1AVXA 4I32A 1FY1A 1YCPH 3A7WA 3CS7A 4HZHA 8LPRA 1N6XA 1AWFH 1GHYH 3BF6H 2VB0A 4BTIB 1GMCG 2R3YA 3FP7E 2BLWA 1GL1A 2RFKC 1GJ7B 1BIOA 1O2KA 1ELGA 3IITA 1SHHB 2NU3E 1HBTH 5FX6A 5C17A 1AD8H 1E36B 1MTNC 2Y5FA 1V2RT 1O32A 4X8TH 1IQEA 1F5KU 1XUJA 4D9RA 2A4QA 4ISOA 1PQ5A 1SFQB 2H6MA 2ANWA 2ZHDA 3VXEH 5DGJA 3JZ2B 1ZGVA 1F5LA 1C5TA 3O8BA 5F8ZA 2ZHFH 1O5FH 1ORFA 2I6QA 2ASUB 2FOGA 3SW2B 1MAXA 5GJ4B 2DE8A 1MH0A 2PP6A 3OSYA 1BTWA 3BV9B 5C3NA 5DP4A 3U8RH 4TY7A 1JRSA 4YXWD 3SNDA 5L2YH 2EQNA 1LPKB 4INHA 1G3EA 4KTCA 1KY9A 4DIHH 3ZZBA 3RXSA 1TMTH 5DN6D 5EU8A 5FBEA 4NFEA 1IOEA 3F9HA 1L1GA 2ZDMA 1TPPA 4DURA 3LPRA 1HYLA 2LP6A 1S0RA 2QYIA 4DVAU 1KDQA 3T28A 4B2AA 1A61H 5LH8A 2W3KA 1HAOH 1EFRD 2DUCA 1MU8B 3V12A 3K2UA 2G8TA 2YMSD 3CS0A 2CJIA 1DWDH 5FBIA 5JBBS 2O8TA 3GOVB 2JETB 3A81A 4AG1A 2EI8A 1MQ6A 1GBLA 1L1NA 1QB9A 4WMDA 1FQ3A 1T8NA 3OYPA 3VGCC 3QZQA 2CMYA 1Y5BT 1YPMH 1BMAA 2P3UB 1GI2A 1YPHE 1GPZA 3M5MA 3U69H 1CQQA 1N6YA 2ZDAH 1CA0C 3ZYEA 3R0FA 2XBVA 3ZV8A 2P93A 3MQKC 1SLWB 1CHOG 4O9VA 2GT7A 1SQTA 7GCHF 4I31A 1LTOA 1L0ZA 3FANA 1EUFA 1K22H 1GI9B 4FU8A 1O2IA 3QTVH 5E0GA 2ZKSA 1EPTC 3PLBA 2Y82A 5DO4H 1O3MA 3ZVEA 1YM0A 4NWLA 1AWHB 1TGCA 1LHGH 3MNSA 1CT2E 1KLJH 2FOBA 2J34A 3ZVBA 2ZU1A 1HIAB 4Y8YA 5EW1H 4A1TA 1FJSA 1XX9A 1O3GA 2ZIQH 4AGJA 2Q6DA 1FZZA 1X7AC 2Y5HA 2ZHWH 3DUXH 4UFEH 1FY3A 1E1QD 4XRNA 3RC6A 2SFAA 1ZJKA 8KME2 2WYGA 1ABIH 2BY9X 1F0SA 4F48B 3BG4C 5LPEA 4HTCH 4BXSA 1DM4B 3M36A 1D4PB 1HLTH 1T4UH 1CO7E 1IQKA 1P01A 2TBSA 3HKIB 2GCHF 1YPLH 1HNEE 2PKSC 3GCTF 4AZ2B 3M7UA 1MTWA 1QBVH 2FOFA 5EODA 5FL7D 2BX4A 1AUJA 2BLVA 2SNWA 1C5SA 1O3AA 3D49H 5A0CA 1Z8RA 2VNTA 3SV6A 3T25A 3BTWE 5HM2A 4AB9A 1UJ1A 1ZPCA 2YOLA 3KQ5A 2FX4A 2OC1A
chains in the Genus database with same CATH topology
1O37A 3RMOH 1GHBG 5T6FA 1ZOMA 1C5ZB 2GX4A 1O3OA 5JBTA 4FUJA 1J14A 5C67A 2ZDLA 1W0ZU 3GDVA 1ELBA 1UK3A 4JZIA 1TX7A 2BDAA 5DP9A 1TPOA 4XE4A 1A46H 4OS2A 1G32B 3KN2A 2J94A 2GVFA 4IMZA 2FEQH 2GMTC 4ZAEA 1IQHA 5ESBA 1V2KT 1VGCB 3ZZCA 3SORA 1P2KA 3RXIA 5A8YA 3SGBE 1O2QA 1UK2A 3BTGE 2TGTA 1LHFH 4Q80A 3H5CB 1IQFA 4WY3A 3LH3A 1GI4A 3GCOA 5FPSA 1QIXB 5ETXA 4WH6A 3UOUA 1S6FA 3ATIA 1QJ1B 3ZZ9A 3E8LA 1DUAA 4OS4A 2AMQA 3KQDA 1GVZA 2NWNA 1XKAC 3IG6B 1TOCB 2BY6X 1HJ8A 1OWKA 5C20A 2W26A 3LGYA 1GI6A 3PM3A 4X6NA 6GCHG 1ZZZA 2FO9A 2J4IA 1UVSH 1QR3E 1AZZA 1CGHA 1GMHG 4VGCC 1V2OT 1GJDB 2JH5D 3BSQA 3T27A 3L6PA 3A8DA 4ZHAA 5JB8S 1ZJDA 3ENSB 2GTBA 2HWLB 1Z8IB 1C1RA 1HXEH 3RU4E 1BRUP 1RXPA 1P3CA 2P3FH 1DX5M 1O3CA 1SLVB 3SN8A 3EGKH 3FVFB 3DFJA 4MNXA 1YC0A 3FAOA 1W2KH 5L30H 1O5BB 2FZZA 1B5GH 1AHTH 1BBRE 1TPAE 1HGTH 2BYAX 3PWCA 1CE5A 1KXBA 3VB5A 1DANH 1FPCH 1TX8A 1TA2A 4RKJB 1QRWA 3DD2H 1D3PB 1ZHRA 2C8WB 1GCDA 2WPJS 1RTKA 1C1WH 2ZGBH 1VZQH 1XVMA 4X6MA 1KTSB 1C5NH 3D62A 2QXJA 1DVAH 1UVTH 2D1JA 2LPRA 1G3CA 4UDWH 2Z7FE 1Z6JH 2SNVA 3PO1B 1DITH 1AMHA 3RXEA 1BHXF 4MTBA 1W14U 2WPKS 1THSH 1FY8E 2XW9A 1QQUA 4X1PU 1C2HA 4D7FA 2AS9A 2VH6A 1VJ9U 1ZPZA 5DJ7A 1TFXA 2Z3EA 3UUZA 3NPSA 1HCGA 1YPHC 4ISNA 3RXDA 1LQEA 2ZFTA 1SOZA 2R2WU 2VH0A 5L2ZH 1XUHA 4Y71A 1NRRH 1N8OC 3M7QA 2O8MA 3UNQA 1O3JA 2OCVB 1O2NA 4AFZA 1BCUH 2F83A 2WV5A 1JRTA 1O3DA 1SR5C 2EC9H 1O3IA 1F0UA 2V0BA 4TPIZ 1GHAG 1Y8TA 3AVZA 2UUJB 2ZDNA 2FWWA 2BDBA 1UCYK 3QK1A 3QUMP 3GYLB 2QCYA 1C4V2 4DG4A 2FLBH 3TJVA 3PV4A 1BZXE 1O2RA 3RXLA 1NN6A 2B9LA 3MYWA 4FU7A 1YGCH 5LGOA 1C1NA 1RIWC 3ELAH 1QBNA 2TIOA 2ZPSA 2R2MB 3GY2A 5TCAA 1SGYE 1LHEH 1O2UA 2BD8A 4Z6AH 4ZKRU 1C2EA 4INLA 2G55A 1FONA 1J9CH 2BD4A 2FYRA 2SGDE 2UUYA 2PGQB 3RXBA 7LPRA 1ZTKA 2Z9KA 3D65E 5C5NA 4I8LA 1L4ZA 1C2KA 1PFXC 3MNXA 2AMPA 1F5RA 1ZR0A 1QL7A 4ABDA 4BAKB 1C5LH 3GY3A 3LIWA 3MO6A 2NU0E 3KEEA 1YCPK 4NG9H 1PYTD 5FHTA 1LPZB 2H9TH 3A7TA 4GCHG 1ZHPA 1O39A 1BMLA 3PLPA 2QY0B 2PKAA 4CBOA 1ZYOA 1P2JA 4ZKSU 4D7GA 2ZTZA 1GMCF 1XVOA 2BLOA 1JIRA 1LVOA 2ZHQH 4I8JA 2VVCA 2ZU3A 1H9IE 4INKA 2BD3A 1SI5H 2PWXA 5AF9H 4FUCA 5FPTA 4DCDA 9LPRA 1TQ0B 1T8OA 2VIVA 1C1MA 3GCHB 3E0PB 2Z9IA 2GZ7A 3BTME 2QF3A 3KNXA 3LONA 4BXWA 2Y80A 4XFQA 3ODFA 3MFJA 4Y8XA 3Q3KA 5DP6A 2O9QA 3NKKA 2Y6TA 5LPFA 2RG3A 2RA3A 3QGJA 4B75A 1C5OH 4K8BA 1SGNE 1D6RA 1TPSA 3UNRA 1E38B 3K6ZA 1J8AA 5CE1A 5GCHG 1B7XB 1PPGE 1V2TT 3FZDA 1QGFA 1KXAA 4NA7A 5A0AE 1TBQH 1LHCH 4UEHH 3RDZA 1E35B 1EP5A 1KDQB 1K2I1 1KLTA 2Z9LA 1V2UT 2IPHA 4DJZB 3M35A 3UPEA 1P9SA 1GBFA 1L2EA 2ZDKA 2A4GA 2VINA 1ETTH 5H4IB 1EPTA 1Y5UT 7KMEH 3SUGA 3ZZ8A 2PGBB 1EZXC 2WPIS 1DWCH 1OWJA 2BDHA 2FTLE 2M5TA 3HGNA 5IYTA 4KELA 2ZFPH 5BRRE 2QGRA 1WAYB 3MNCA 1FV9A 1GBEA 1BTHH 1ARBA 1W0YH 2XCNA 4AN7A 4NZQA 1YYY1 1GCTB 3LDXH 4THNH 1NFWA 3OU0A 2FXRA 1AVWA 1CHOF 5C1UA 2ZU4A 4F4OC 1O2TA 6CHAB 3MU0A 1EASA 3SGQE 3P6ZB 3GY5A 1DOJA 3RXHA 1T32A 1A5HA 4Y7BA 2ZNKH 1BJUA 5E0JA 1LHDH 3ZYDA 5A0BA 1XM1A 1F92A 4B73A 4A7IB 1QB6A 2CXVA 4K69A 4XOJA 2OLGA 1RTFB 3LGTA 1OX1A 2ZA5A 2FS8A 1ZMLA 3SV8A 3F68H 4OGYA 3FP6E 2XBYA 2FODA 1TNGA 3BTDE 4I8GA 4M7GA 2ZCKP 3FZZA 5ESTE 4UFDH 1O3FA 2P59A 3URDA 2JH6D 1TYNA 4X1SU 4B74A 1C1VH 1NRSH 4E05H 3D23A 4ZKOU 1TGBA 3S9AA 1B0EA 3H7OA 1QTFA 2XTTB 1Z8JB 3CENA 1GHZA 2PHBA 4IC5A 2QXHA 2TPIZ 4B76A 2VVUA 1HB0B 2FI3E 1MMJN 4WH8A 1C5MD 2Q6GA 1QY6A 2HLCA 3ESTA 1HAPH 3HK3B 5C2ZA 2IJOB 1ESTA 4NGAH 3I29A 1HAVB 5K7RA 1GHBF 5DP3A 2R0LA 2W5EA 5HM9A 1IQGA 2BDIA 3OX7U 1CU1A 4JYVH 1ZTLA 3KGPA 3BIUH 1BTPA 4FXGH 4GPGA 3VEQB 1OPHB 2C3SA 4MPVA 4X6OA 2ZECA 1NRNH 3MU4A 1DE7H 3PYHA 1SGFA 2JH0D 2HOBA 4LK4A 3MH5A 1F2SE 1Q2WA 4U32A 2VVVA 1ABJH 3C27B 3PMHB 1TLDA 1DS2E 1IQIA 4JZFH 5AFZH 4NFFA 1O2JA 2VIDA 1QRXA 1IQLA 4X0WU 3RP2A 4JMYA 1C4U2 1ANDA 4CR9A 1ELFA 1P57B 2ZGJA 2ZFRH 2A31A 4X1QU 1AVGH 1ESAA 2F3CE 1MU6B 1OP2A 1V2LT 1VGCC 3SBKA 1UHBB 3AW1A 1PPEE 5TCCA 3K65B 4X2XA 4MVNA 1O5EH 6GCHF 2H1UA 4ZMAH 2OINA 1O3EA 5EXMA 4WXVA 3SNBA 5EXLA 4BOHA 3A8BA 2RA0A 3RXGA 2P8OC 4LXBH 1O2WA 1TMUH 3STIA 4X1RU 1JIMA 1GBCA 4D76A 1C1PA 1K1LA 1AFQB 1GJ5H 2GDEH 5L6NH 2BVRH 1K1JA 3KF2A 3SJ9A 2BM2A 2PTCE 3U98H 2ZWLH 5A2MH 5E8EH 2ZFFH 3BTEE 2OC7A 3OY6U 1FLEE 1GHVH 2UUKB 2ZHEH 2H9EH 5T6DA 3S7KB 1EB1H 3BTTE 1KTTB 1WTGH 1XUGA 2HNTE 8GCHG 2DE9A 2QV1A 1PPFE 1SGCA 2UWOA 1FY4A 1HV7A 1WSSH 3PTNA 3SGAE 4ZHLU 1QJ6B 2BHGA 4WJG2 2BXUH 1Z6EA 4BAHB 5DP8A 4K1EA 1O3KA 4Y0YE 3SO3A 2G5VA 4Y10E 2TGPZ 3ZZDA 1WUNH 5F6MA 1K1OA 5GDSH 1A7SA 4F49A 2TRMA 2GT8A 2BLQA 4NWKA 4JCNA 4NZLA 3F9EA 4Y11E 2J92A 2BOKA 2WPLS 4FUIA 4MDSA 4FVDA 4AFSA 1OWEA 1QA7A 2WUCA 3H7TA 2V3OH 1IQJA 1DDJA 3MTYA 1P11E 1VCWA 7ESTE 1CA8B 4E06H 4AGKA 1RTLA 4GHQA 5J4QA 1V2WT 3PO1C 2SGEE 5DKMA 1NY22 3KQBA 1EB2A 1DXPA 1CT0E 2OP9A 1W12U 3BEIB 4JYTA 4YESB 1S5SA 3T29A 1G3DA 4CHAB 3U8TH 3TIUA 1XUFA 1FAXA 1SQAA 1C1OA 1GHAF 3SU4A 1K1PA 1FN6A 5JB9S 3QWCH 1EJNA 1O2YA 2WINI 4XBDA 1C4Y2 2P94A 2CHAC 3M37A 1C1TA 2W7SA 4SGAE 2ANKH 2PR3A 1C2JA 4CRCA 2VIPA 1OXGA 3A89A 2ZPQA 1XKBC 2KAIA 1NRPH 4BNRA 4ZXXH 3BTFE 2P16A 2GP9B 2V3HH 1HAYB 4IGDA 2F9BH 1YKTA 3TITA 2Z3DA 2ZU5A 3SUFA 2HNTF 4TYDA 1MTNB 3ZVGA 1TE0A 1TGSZ 4NIYA 4TWYA 1C9TA 3ZZAA 1P8VC 4WWYA 3EAJA 2FESH 4GHTA 1BOQA 4CH8B 2P95A 5GIBA 2OC0A 4GCHF 2NU1E 3QN7A 1SGIB 3LGWA 1GJ9B 2OTVA 1HAGE 1O5CB 2GD4B 4YZUA 1EOLA 1NT1A 3ATLA 1WQSA 2QN5T 3SU6A 1LVMA 2Z94A 5LPRA 2Z6BD 1SGTA 3VB4A 1H8DH 1DLKB 2C93B 1NZQH 1PJPA 1HRTH 4KP0A 1EX3A 1G2MA 1W8BH 1FY5A 3I78A 1C1QA 4WMEA 1ZTJA 4MQAA 2GZ8A 3LH1A 3PB1E 3M5NA 1SGQE 1BBRH 1CBWC 3RLYH 3RXKA 5EG4A 2PLXA 1CSOE 4OS7A 1GI1A 2AFQB 1AN1E 1DPOA 3VPKA 2ZFQH 4E7NA 1YCPM 4NIWA 1UMAH 2D2DA 3GCHC 1SPJA 4Y6DA 5JBCS 1C5WB 4GVUA 2VWOA 3E16B 1VITG 4I33A 3M5OA 3RXOA 2I6SA 1SL3A 1V2QT 4ZROA 2AGIX 5GCHF 4UONA 1ACBE 1T31A 1CA0B 5A09A 1ELVA 3RMLH 2GCTB 2UUFB 2ZO3H 1JMOH 3EE0B 3TNSA 1QBOA 3Q77A 3B23B 2A45B 2C8ZB 1EZUC 1DT2A 3K9XB 1DSTA 1O2PA 3SI3H 4WF8A 1GDNA 1H8IH 1RJXB 1FN8A 3L33A 1DUEA 2XRCA 1CVWH 2OQ5A 1O3LA 1LKBA 3TGIE 1PYTC 4AX9H 4DIIH 5FCKA 2A1DB 4XBBA 2HNTC 3QX5H 7GCHG 1J15A 1Z1JA 3E90B 1O5GH 4MNYA 4XBCA 1P12E 4LOYH 4NSYA 4CBNA 1O2LA 1T7CA 2FOCA 1O2HA 3TK5A 4Y0ZE 1SGFG 2OBQA 5G4BA 3BTQE 3LOXA 1P05A 1YPGH 1AE5A 1LO6A 1NFXA 1NESE 2HPPH 2AEIH 1TA6A 1HIAA 3A80A 3PROA 1MZAA 1Y3YA 2H5DA 1AFEH 1EAUA 1IQNA 1MBMA 3KCGH 5FPYA 1C1UH 1QL9A 2R9PA 1C5VA 2OXSA 4XSKU 2FX6A 3MOCA 3RXMA 1UK4A 5EPYA 2BMGB 3UR9A 3SV9A 1UVOA 1FIWA 1A4WH 1TRNA 4ABHA 2TGAA 1H4WA 1P10A 1AI8H 1T4VH 2BDCA 2O8WA 2A5KA 1MUEB 2BB4A 5DP5A 1KYNA 1C2DA 2ZCLP 3HK6B 3SUDA 4FUEA 3RXVA 3KHVA 3V0XA 3NXPA 2GMTB 2NU4E 1AKSB 1TNKA 1H1BA 1P02A 2ALPA 3A7VA 1SGRE 2GGVB 3RM2H 3SQEE 3T2NA 2FOAA 3M5LA 4YO9A 3CP7A 1FNIA 3RC5A 1UTKA 4K3JA 2ZU2A 1K21H 3E6PH 1WYKA 2PW8H 4IW4E 3UNSA 2QA9E 1GHXH 3I77A 5AVDA 2F9OA 3ZVDA 1TGTA 3K6YA 1RRKA 3P8FA 2W3IA 4UE7H 3M7TA 3S7HB 1LCYA 5GWZA 1FUJA 1MTSA 2ZEBA 5JYIA 3A88A 1ID5H 2BQ7B 2ODQA 1QB1A 4Z0KA 1DY8A 5JDUB 5EQQA 1NROH 1BRCE 1Q3XA 1ELAA 3S9CA 3TJOA 3UFAA 1D9IA 4H6TA 4BAOB 1WBGB 4AOQA 3S0NA 1QJ7B 1V2NT 1W3CA 1FDPA 3PMJA 3F6UH 1GI3A 1S84A 1G36A 3ODDA 4MPXA 4XDEA 1FI8A 1GJCB 4YOIA 3U1JB 1LMWB 1UVUH 3VXFH 2XC5A 5HXFA 4DGJA 3RC4A 3KQEA 2FM2A 1INCA 5E2PA 5GPIB 4WMFA 2PTNA 2A2XH 4A1XA 1GBIA 1TONA 2H5CA 3TNTA 1VJAU 3MH4A 2ZI2H 3L3TA 1N1LA 4ASHA 3VB7A 1QFKH 4U01A 1BTUA 2B8OH 4X6PA 1VCQA 4Y8ZA 2B0FA 2J38A 2VU8E 1A3EH 1NC6A 1GJAB 1EZQA 2ULLA 1QHRB 1ZSKA 2STBE 1DLEA 4I7YH 1O2MA 3F9FA 1KSNA 2HVXA 4U30A 1UO6A 2A7CA 1AUTC 3ITIA 1HAIH 1UTMA 3V7TA 4WXIA 4ZH8A 2CGAA 2G5NA 2XC4A 2BY5X 1MAYA 1SOTA 2BDGA 5C1XA 4ISIH 3VFEA 1V2ST 2SGAA 5B6OA 8GCHF 3A82A 1U6QA 4Q7YA 1AO5A 4Q2KA 1SGPE 3P8GA 4H6SB 2H9HA 4CREA 3KIDU 1GG6B 1O3HA 3NK8A 1IHTH 1YP9A 2BD9A 3GDSA 1N8OB 2QXIA 4YM9A 2JETC 3UQVA 3GY8A 2G52A 2BQ6B 4CRGA 4ABFA 2AIQA 4UFGH 3A84A 5JPMH 1ESBA 1H9LB 1NFYA 2A5AA 3NUMA 4X8UH 3LT3A 1A3BH 3BIVH 1IQMA 4A5TS 1HDTH 4MNWA 4A92A 2V35A 2VIWA 4PROA 4MG3A 1O2VA 2OBOA 2ZG0H 3GICB 4NA8A 2OC8A 1P3EA 4CR