3GY8A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy8A02
1IQJA 2BDGA 2F9PA 5EPNA 1QA7A 1O32A 1TPSA 4MPWA 5DP3A 2W5EA 3TK6A 4DY7B 5C5NA 1FQ3A 1LPZB 1OWJA 1NO9H 3A80A 1KDQB 2O8UA 4ESTE 3UQVA 1UTQA 1C5TA 2HVXA 4X6PA 1MD7A 1WOFA 1BMAA 7GCHG 3BEIB 4YLUA 3EA9A 4K8BA 2BD2A 2C93B 4KTUA 1TMUH 1NM6A 1TGCA 1MQ6A 5FPSA 3SGAE 4DW2U 2ZPQA 3TIUA 2AGIX 4Y79A 4RSPA 1BTUA 3SHCH 5EW2H 1ZPCA 2YOLA 1L0ZA 1MD8A 2FPZA 4B2BA 5PTPA 4DOQA 1DM4B 4QT8C 1GI9B 1V2OT 1F0SA 3RMMH 1ARBA 3VGCC 4U01A 2BLWA 3ZVDA 4XSKU 3GY5A 4DIIH 1HXFH 4GSOA 8GCHG 2PKSC 4TY7A 1F92A 1TGNA 1XUKA 1UVPA 1GMCG 4X6NA 1ANEA 3EA8A 2HPQH 3G01A 5CHAC 2OLGA 5E0HA 4IN1A 4CR9A 2QC2A 2DUCA 1HAZB 3A7VA 4D7FA 4TPIZ 2OBOA 4YO9A 4Y0YE 3A87A 4K1TA 1LHCH 3BTQE 2AGEX 3SW2B 2ZC9H 3EE0B 2BQ7B 1TNKA 1ZRBA 1UHBA 3BIVH 4CH8B 1HBTH 1PQ8A 2PSYA 1LPGB 1DVAH 1NROH 2OC1A 1C5XB 4CRGA 2TGAA 3BEUA 1UJ1A 1BJUA 2TGTA 4OS4A 2BDHA 1NPMA 1MTUA 2JH6D 4BOHA 1DLEA 2HRVA 2R2WU 5F8TA 1O2QA 3IWMA 3MU0A 1EATA 1EJAA 2WPHS 1YF4A 4RN6A 2ODYB 1AE8H 1SL3A 1WUNH 1C1VH 2ANKH 3Q76A 1AKSB 1LKBA 1NFXA 1Z6EA 3E90B 1BITA 2ZFQH 2STBE 2ZP0H 1DDJA 2NU0E 1HV7A 3NPSA 2F9OA 3DA9B 2KAIB 4DT7B 1YYY1 4Y7BA 2BD5A 5E8EH 4AZ2B 2G4TA 4WWYA 1TNLA 3BTKE 5LGOA 1V2WT 3E8LA 2TPIZ 4H42U 7GCHF 4A5TS 2NU4E 5L2ZH 2Y5FA 2UWOA 6CHAB 1TNGA 2A45B 2VGCB 2FLRH 1ARCA 1TPAE 1L1NA 3ZZAA 2BZAA 1RGQA 2R9PA 1SHHB 3A88A 1KDQA 3MTYA 5ETXA 2FOCA 3LJOA 1LPKB 4B76A 1CHOG 3RXIA 4OS2A 1CT2E 1Q3XA 2XTTB 2ZFPH 6GCHF 1C9PA 2XWAA 4Q2KA 5JB9S 1TGSZ 2ZPRA 1F5RA 3MU8A 1ZZZA 1QBNA 2ZGHA 1C4U2 2H5DA 1XUIA 1C2DA 2IN2A 1C1NA 4Y7AA 5EW1H 3MNBA 1RRKA 2ODQA 1JRSA 2B8OH 3P95A 4J1YA 4B2AA 3VB3A 3PWBA 2P16A 1VCQA 2SGEE 2K1QA 1QL9A 1FPCH 4ZMAH 3GISB 2BD9A 2UUYA 3FAOA 1HNEE 2OINA 4CRBA 1A3EH 1SFIA 1MTVA 5DJ7A 5F8XA 1EAUA 1CT4E 4FU8A 1KIGH 1KXBA 2ANMH 1S0RA 3KGPA 1BRUP 1D3DB 3ZV9A 3ZZ5A 2SGPE 1O36A 3KQCA 2ZG0H 4NGAH 3SORA 1PPCE 1ELFA 4AOQA 4BAKB 1CQQA 3SU1A 1GHBF 4MTBA 1H8IH 3LIWA 1YBWA 1K1OA 1BZXE 1MAYA 3AASA 5HMAA 4Y8YA 2Z3EA 2VVCA 1ELBA 3P8FA 1GJDB 1FNIA 1ELAA 1K1IA 1V2VT 2Z3DA 1AD8H 1CU1A 2W3KA 3QWCH 3OU0A 3P70B 1GBHA 2AEIH 2GD4B 3BTGE 3ATWA 1YPEH 3BV9B 2WV5A 4NIYA 3LGTA 3UR9A 2QY0B 2AS9A 3L33A 4AYYB 4JMYA 2FZZA 1ZJDA 1GBTA 3AAVA 1FPHH 1Y5AT 2Y6TA 2BX3A 3P8GA 3TITA 3NXPA 2VWNA 4UFDH 3B23B 1SPJA 2ZFSA 4JZ1A 2AYWA 3LPRA 1AHTH 2G51A 2B7DH 1YPHE 2SFAA 1V2ST 2VGCC 4Q80A 1KXDA 4HZHA 3VXFH 2W7UA 1EX3A 4OS7A 3RU4E 5C3NA 4KGAA 1BIOA 1O2KA 5JBCS 2BQWB 1RTLA 2XRCA 1MAXA 3Q00A 2BTCE 2ZGXH 4R0IA 1PQAA 1S5SA 1O3MA 1EOJA 1GI4A 5GWZA 3T62A 1D3TB 2OUAA 3ODFA 2BMGB 1H9HE 4GCHF 3KCGH 5FCKA 2OBQA 4ASHA 3SGQE 2VWMA 1IOEA 1ZGIA 3BG4C 1TA6A 1CA8B 1GI0A 4H6SB 1INCA 2P94A 2QN5T 4Y10E 1BTHH 1O2JA 1WBGB 3RXVA 1O0DH 4RKJB 4OS1A 4BAOB 1SBWA 1QJ1B 1YCPM 1WU1A 1KXAA 2O8WA 3BF6H 3GDVA 5IYTA 3GY2A 2TGPZ 1L2EA 1QL7A 1GMHG 3PV4A 1FV9A 1ZHRA 1ZTKA 1ESTA 1FMGA 1TOCB 4YZUA 1S6FA 1F7ZA 1ZHPA 4U32A 4BNRA 1QQ4A 3RXUA 1O38A 2M5TA 2LNCA 2C4FH 1TQ0B 3GCTG 2NU1E 2D1JA 8LPRA 2XBWA 4AX9H 5F6MA 2F9BH 1BBRK 3MNCA 2A7HA 4IW4E 2QXIA 1GWAA 3MO3A 1O2OA 1O3NA 1DE7H 1GBFA 1SGPE 5TCCA 3MO6A 1C4V2 4ABEA 3A84A 4AYVB 1DT2A 1J17T 1GI5A 1HJAC 1HAPH 1EB2A 1UTPA 1O2VA 1WQVH 3UR6A 2Q6FA 3TPIZ 3SJOA 4E06H 1FJSA 3SJIA 4MNYA 4WH6A 2VIDA 4WF8A 5L2YH 2Z9LA 1P2IA 3V7TA 3QTVH 3EAJA 1H8DH 3M5MA 4CBOA 1V2NT 2ZHDA 1MKXK 1NN6A 1PPGE 2PV9B 2ZU1A 3MNSA 5AFZH 1OYQA 1TPPA 4ABFA 3PTNA 4K3JA 1XX9A 1DLKB 2ALPA 4UFFH 2NU2E 4O03A 3M61U 2VB0A 1BB0B 1SMFE 2J38A 1VJ9U 4I8HA 1L4DA 2KAIA 3U8RH 3UNRA 1ANBA 1GI1A 1JBUH 5JB8S 1QQUA 5J4QA 4RKOB 1K1PA 3FZZA 1FIWA 1SG8B 3BG4B 2ZFTA 2AIQA 5FAHA 1DFPA 4FUGA 2OC8A 1SLVB 2VWOA 1LO6A 3U98H 4CRAA 1J14A 3QK1A 3ZVFA 3RXTA 1IQLA 3H5CB 1BBRE 3M5OA 2A0QB 1ETSH 1WAYB 1OS8A 4X8SH 5C1YA 3SQHE 2ZGBH 2FOBA 1TMTH 5T6GA 2CF8H 1S83A 4MPUA 1J15A 3UQOA 4NSVA 2ZTXA 5EG4A 1G3CA 4XBCA 1YC0A 2GDEH 5DGJA 1MTWA 3GDUA 4IS5A 1HDTH 3Q3KA 1C5QA 1KYNA 1BTWA 3K9XB 1XMNB 3HGPA 3ZVCA 3E1XB 1D6RA 3K2UA 1A61H 3ZYEA 5CE1A 1EP6A 3PLBA 4BAQB 1HAVB 4X1QU 1GGDB 3VB7A 1NU7B 4K8YA 1UCYK 2WPJS 2BDBA 3DFJA 2HWLB 5AF9H 3CS0A 3RU4D 1GBKA 2G5VA 3KQDA 1UMAH 1AN1E 4F49A 1YPHC 2WYGA 4AB8A 1FY3A 5E0GA 2PHBA 4INKA 2B5TB 3WY8A 1J9CH 1RIWB 1SFQB 2HNTF 1ELVA 1PPBH 2GZ7A 1QJ7B 3E91A 4MDSA 3QGNB 1Y3WA 4NWKA 3RMOH 5I25A 2VIWA 1HAXB 2GMTB 1AB9B 1IQHA 1SGQE 1A0HB 4X1SU 1GJ7B 2CJIA 3V12A 2VIVA 3RMNH 2O8LA 2FTLE 1NRRH 1HUTH 1P2KA 4AFZA 2XBVA 2HGTH 2BDIA 2C8ZB 3RM0H 1P12E 3PROA 4NSYA 1MZAA 4LZ1H 3S69A 3GY8A 5A0CA 4MNWA 1CHOF 3MMGA 4WJG2 3STJA 3ZVAA 4F4OC 2GKVE 3DFLA 1CGIE 2R0KA 5JBBS 4ZH8A 2G81E 2CXVA 4X2WA 2PKAA 1GBDA 2FDAA 2ILNA 4ABAA 3MI4A 1TWXB 3FFGA 3M7QA 2H5CA 1BOQA 1K28D 2ANYA 1BA8B 4UD9H 3KF2A 2VH6A 1HCGA 5K0HA 1BTYA 1GDQA 3SGBE 1HIAA 2SGQE 5A8XA 3VB5A 2Y80A 1O3HA 1QB6A 1BHXB 3SUDA 4GAWA 1C1TA 1AVXA 1QURH 1CO7E 1CA0B 1EUFA 1QIXB 4MLFB 3OYPA 1C2IA 2EA3A 2H2ZA 4CRCA 1AFQC 4A1XA 1X7AC 1WV7H 1GMDG 4ABBA 4MNXA 2Z9JA 1QCPA 2BVXH 2UUJB 4YT6H 5E2OA 2BDCA 1ETRH 1LKAA 2FOHA 3SV6A 1FONA 2A2XH 2ZECA 1T7CA 2C8YB 4FVDA 2FX6A 2J9NA 1SR5C 4BAMB 1U6QA 3E0NB 5EQSA 1O2ZA 3I29A 2STAE 8KME2 2GZ9A 3A82A 1FY4A 5H4IB 4LZ4B 3DHKH 2BOKA 5A8YA 1B0EA 1SGDE 1O2UA 1JOUB 4HGCA 1CA0C 1P2QA 4K2YA 2F91A 4KTSA 3SJKA 1AMHA 2UWPA 2PGBB 1H1BA 1DS2E 3UFAA 3PMHB 1AUTC 3B8JA 3DT0H 4WY3A 3FVFB 2Y7XA 1EAWA 3O8DA 1QRXA 1BTZA 1B0FA 3PMJA 2BDYA 2F83A 2GT7A 3P8OA 2AFQB 1KTSB 2BVSH 3IG6B 2J2UA 2OQUA 3LONA 3EDXB 5GPIB 1GBIA 2D8WA 3N7OA 1G2MA 2A5IA 3BG8A 3GY7A 1ZMNA 1C1WH 1C5VA 2J95A 4R8TB 5J4SA 3HGNA 3UOUA 3DD2H 3M3VA 1GBJA 3ESTA 2ZZUH 1QJ6B 2CN0H 4CRFA 1AZZA 3SU4A 1YCPH 3MH6A 4TY6A 2D26C 1F5LA 2V0BA 5F03A 2J94A 3VGCB 2ZDVH 2Y5HA 3U1JB 1ZRKA 1A4WH 1VCWA 2Z7FE 2ZIQH 3SU6A 3URCA 1NESE 1ORFA 1NTPA 1UVUH 3UREA 1PQ7A 1THRH 1TNJA 1ZSJA 2BD8A 4WXIA 2H9EH 4DIHH 1S81A 4GCHG 2PKSB 3ZYDA 2JH0D 4GVUA 5DK1A 2P3TB 2ZQ1A 2ZDMA 1KLTA 1LMWB 2VJ1A 4E7NA 1O2WA 3RXGA 1XVMA 1KXEA 3T5FH 4HFPB 5C2ZA 1P8VC 1EB1H 3ZVGA 4GPGA 2THFB 2I6SA 1TBRH 3BTME 2GP9B 2BD7A 2P3FH 1T8MA 1NT1A 3PTBA 1BUIA 1QNJA 2CGAA 4ZAEA 5HXFA 4DURA 1OKXA 2PWXA 4TWWA 1GMHF 1HLTH 5T6DA 3UPEA 2OQ5A 2BDAA 5LPFA 3GY6A 1A0LA 1DX5M 2VIOA 4CR5A 1AE5A 1ETTH 2ALVA 2XW9A 4UONA 2JETC 1CT0E 4D9QA 1A5GH 2PUXB 1SC8U 2C90B 3O8BA 1OYTH 1V2RT 4BXWA 1C1RA 1AI8H 2GCHG 1V2JT 3A7ZA 3NUMA 3ZVEA 1F5KU 1SHYA 5L30H 1SGRE 3BTWE 4NA8A 4BANB 2FESH 1UK3A 1P11E 1TYNA 2ZU5A 2ZHFH 1GI2A 1V3XA 3V0XA 1HAHH 3S9AA 1NS3A 1QBOA 1SGTA 2XBYA 1IQNA 2ZWLH 2PR3A 4SGBE 1D3QB 2BM2A 1BTXA 4JYUH 2ZDAH 1LCYA 1YKTA 1JXPA 3TVJB 1PYTD 1OPHB 1GG6B 4I8LA 3MYWA 3LGWA 4OS5A 2AERH 2P59A 1RJXB 3GICB 3KIDU 3LOXA 3M3SA 2LPRA 4ABDA 1QA0A 1D6WA 1T8LA 1T8NA 1P05A 1PPHE 2FOMB 3D65E 3T2NA 5A8ZA 4Y8ZA 1GGDC 1O3AA 1TOMH 1AO5A 5BPEA 1GJ6A 2BXTH 3ATKA 2RDLA 1TPOA 1SLXB 1YP9A 1MU6B 3MU5A 1GCTC 2SNVA 1T32A 2UWLA 3S7HB 7LPRA 3GCOA 4GHTA 2QIQA 1LQEA 2VH0A 1W14U 3MU4A 2SGAA 1O3EA 1TB6H 1ESBA 3OX7U 3SI3H 1Z8JB 2V6NA 4X6MA 3AVZA 1XKBC 5EQQA 3M36A 1C2HA 3RP2A 1GMDF 3U1IB 1DITH 3M7UA 2ZHWH 1O5AB 5LPRA 1C5WB 3ENSB 1C5ZB 2FM2A 1O30A 1UK2A 2GT8A 1BRAA 1O37A 3EQ0H 2Q1JA 3QO6A 3QUMP 3A83A 4I7YH 1L1JA 4VGCC 2BYAX 2CHAB 2XC5A 4UEHH 2C3SA 3ZV8A 2DE9A 4A1VA 2VINA 1ZPZA 4WXVA 2H6MA 1ELEE 3SNDA 1N8OC 1O5FH 3L6PA 4AFSA 3PWCA 5ESBA 2ZHQH 3MFJA 3KHVA 2OXSA 2VIQA 3ELAH 4UFGH 1GHYH 2AH4X 1OWIA 2O9QA 3V3MA 3TJVA 1W13U 3TH4H 4YOJA 2BX4A 4BAHB 2G00A 1DICA 1GJBB 1N8OB 9ESTA 3PMBB 3TH3H 2ZI2H 2C8WB 3K6YA 3RC5A 1OP8A 1ZLRA 2D2DA 4X6OA 1N1LA 3RXSA 2ZCKP 3RMLH 1C2LA 3QLPH 2A1DB 2ZDLA 4A1TA 1KLJH 4YOIA 1ZSKA 1O3KA 2F9VA 2FOGA 1TABE 2HALA 2HNTC 1TALA 2ZGJA 2F9UA 1NY22 1VCPA 4JZIA 1OXGA 3VPKA 1TX8A 3A81A 1O2YA 1H9IE 4ZHAA 1O5BB 1JIRA 4MG3A 1THSH 2NU3E 1GI8B 1IQMA 4FUIA 1AUJA 1L4ZA 1GVLA 5T6FA 3SV7A 1GI6A 1TMBH 3M5NA 1V2QT 1SQAA 3SHAH 1SGNE 5EXNA 1BBRH 3E3TA 3UIRA 1P9SA 1DOJA 3A8CA 1SI5H 3QGJA 2VIPA 3TJUA 5TCAA 1O5DH 1O3GA 1P3EA 1GHBG 2FYRA 1XM1A 1RTFB 1QTFA 1SQOA 4X8UH 3MH5A 1ACBE 1DUEA 5A0BA 3RLYH 4WMEA 2ZFRH 2QV1A 3GCHB 1ANCA 1C2KA 3OY5U 3A7YA 4NFEA 4CHAB 1K1MA 3BIUH 3U9AH 6ESTA 1ZOMA 3RXLA 2PKAB 1VGCC 3SUGA 5FPTA 4D76A 1SGFA 2PW8H 1BTPA 4ISNA 1GG6C 1MH0A 2V35A 8ESTE 1P10A 1P9UA 1GCTB 3PLKA 4UDWH 1E35B 2AIPA 2FI4E 1XKAC 1W8BH 1RFNA 4WVPE 5GDSH 4ABHA 1OWHA 5AVDA 2BD3A 2GCTC 2ZCHP 3M5LA 1F0TA 2WUCA 4A6LA 1O2TA 5DP7A 1B5GH 1QRWA 4XBBA 1OP2A 1O3JA 3RC4A 1T31A 1WQSA 1E34B 1QGFA 3T25A 1FI8A 1UTNA 2ULLA 1CGJE 5B6OA 1K1JA 1IQFA 1V6DA 5FXLA 1C2GA 2F9NA 4AFQA 3TGIE 1FN6A 4KKDA 4Y6DA 2PGQB 3JZ2B 1O2LA 3VFEA 1C9TA 1FDPA 2C8XB 3PYHA 4ZXYH 3K65B 1QHRB 3R0FA 1DWCH 4SGAE 1FAKH 1WTGH 2UUKB 1SOTA 2TIOA 4E7RG 3OY6U 1P06A 2G55A 1Y8TA 2BLVA 5LPEA 5F8ZA 3T27A 4OGYA 1GHVH 5EXLA 2ZDNA 2XWBI 2BLOA 2GX4A 4Y76A 1C2JA 3VB4A 3D62A 1Y3YA 1FIZA 1FY8E 1YCPK 1AIXH 1TNHA 1PQ5A 1G9IE 1JRTA 3ZZ8A 1NRQH 2JKHA 1LTOA 3CS7A 1Z6JH 1W11U 3KEEA 2BOHB 2H9TH 1KSNA 3KQEA 3LKWA 2FEQH 4B1TA 3LC5A 3FP6E 2FOAA 2O8TA 4K5ZA 3MU1A 2ZPSA 1IAUA 1YLCA 5EPYA 1EZUC 1DPOA 2TBSA 3ZZ4A 3ITIA 3GYMA 1ANDA 1S84A 2ANWA 1V2UT 1YPJH 4Z0KA 4B73A 4KP0A 2WUBA 2QCYA 4M7GA 1MTSA 3AAUA 2TRMA 2GCTB 3Q3YA 1H9LB 1C5SA 1O2SA 1PPFE 1FUJA 1W0ZU 2DE8A 3LU9B 2ZQ2A 2TGDA 1BRBE 2G52A 2BY7X 1G2LA 1P03A 2W26A 4MPXA 1C5UA 3RXOA 3KN2A 4CHAC 2GZ8A 1NRNH 4DGJA 5SGAE 2QF0A 3GCHC 3SI4H 4MPVA 2Z9GA 5A09A 4IBLH 4AGJA 1TFXA 4H6TA 3MHWU 1FY1A 1DXWA 2OCVB 3RXKA 2BXUH 1BJVA 4JYTA 3GYLB 1YPLH 5EOKA 3LH3A 1RTKA 2P95A 3NKKA 1EPTB 1AGJA 1UHBB 1GI7B 7ESTE 1KXFA 3SUFA 1LHEH 3RXAA 1EAXA 1GVKB 3Q77A 2A4GA 1ESAA 3A7XA 3CENA 1V2KT 2XC0A 1TA2A 2XYAA 1GJ4H 2AMQA 1BRCE 1ZGVA 4K1SA 5FCRA 1UTLM 3V13A 1DY9A 3PO1C 4FUJA 3RXEA 3LDXH 2XCNA 1KLIH 4CREA 4UFEH 2A4QA 3M37A 1MKXH 3P17H 1O34A 1W7XH 2GV6A 3ATLA 1MTNB 2SNWA 1TRMA 1G32B 2GCHF 1C1SA 2BY6X 1Y59T 3RXCA 3SU0A 4OS6A 1BMNH 1HGTH 5HM2A 2XC4A 2Z9IA 2OTVA 1C5PA 4X1RU 1O3BA 4MNVA 1PPEE 1SVPA 1XUHA 2FMJA 2WINI 3BTEE 3T26A 3ZZ6A 2ZO3H 1YLDA 1P01A 1EOLA 1ZSLA 2WPKS 1F0UA 4NIXA 2WV4A 1CSOE 3AW0A 3RXPA 5C5OA 1BMLA 3QDZB 5DG6A 5TJXA 2OD3B 1QFKH 1ZTJA 4ABIA 1FXYA 1AU8A 3KNXA 3P6ZB 4A92A 3ATMA 1O3IA 2IPHA 1GBCA 1C5MD 1VR1H 3P92A 1C1PA 1CBWC 2CHAC 1P0SH 1IHSH 1HXEH 3RXFA 1O3CA 4ZKSU 3W94A 2W7SA 1LQDB 4ABGA 1D3PB 4BTIB 1O31A 4Q7YA 3MOCA 1MQ5A 3EGKH 2BZ6H 3QZQA 3ZZDA 4H4FA 2B9LA 1MCTA 3M3TA 3SO3A 4Z6AH 1MBQA 3U8OH 1Z7KA 2O8MA 3MNXA 1O3DA 4B2CA 3JZ1B 5GIBA 2ZEBA 3A8BA 3UTUH 1UCYH 1AWFH 1NU9A 1V2TT 2B0FA 3F9HA 3ZZ3A 3H7TA 3RC6A 3ZZ9A 4AGKA 2Y5GA 5G4BA 1GBAA 1D4PB 1UTKA 4AN7A 1MKWH 2GMTC 1W7GH 2A31A 4O97A 1JMOH 1ID5H 1G3BA 1O3PB 1TQ7B 1WSSH 3CP7A 5ESTE 4NG9H 4X0WU 1C5NH 2BY9X 1TAWA 1GPZA 4X1NU 1PFXC 1THPB 3MH4A 1MMJN 3EYDA 2FP7B 1DANH 1RD3B 1EZSC 3SBKA 2A2QH 2J34A 1GL1A 1XVOA 1HAVA 3KQBA 5I46H 1LVOA 2UUFB 1JWTA 4IC6A 1Z8GA 1G37A 5AHGH 2FYQA 1BQYA 1KXCA 1T4UH 2BB4A 2PLXA 1GHWH 1HRTH 3VEQB 4UE7H 1O2PA 4WH8A 1UVSH 4JZEH 4Y8XA 3SJ9A 1E0FD 4JZDH 3TNSA 1H4WA 2HNTE 1BT7A 9LPRA 3TJOA 1GI3A 1NRPH 3SU5A 3I78A 3M7TA 2HPPH 4NA9H 5FBIA 3O8CA 1K1LA 1LVBA 1BCUH 1AZ8A 4AORA 2FS8A 3SNEA 2QA9E 1HFDA 2FWWA 4JK6A 4JCNA 1GBEA 4FUBA 1WYKA 3LGVA 3UWJH 4XBDA 1ELGA 1P02A 2NWNA 5FHTA 3A8DA 3FP7E 1M9UA 2FOEA 3M35A 5DP8A 1RXPA 5E0JA 1GJCB 1GHAF 1QR3E 5DPAA 3MH7A 4LK4A 4GUXA 1SGIB 5C20A 2ZDKA 3SUEA 3C27B 3SOSA 1YPGH 4LOYH 3NCLA 1A7SA 6LPRA 3TGJE 2RA0A 2R0LA 3BTDE 5JBTA 3BN9A 1CGHA 2IOTA 1TLDA 3NWUA 3P8NA 1GCDA 3UNSA 7KMEH 5EQRA 3SQEE 5EODA 1J16A 1NC6A 2QXGA 4FUCA 1P04A 2GGVB 3SU3A 3RXQA 1Y3VA 4K69A 4Y0ZE 4O3TA 1E37B 1TGBA 4NIVA 4XDEA 1FLEE 1W10U 5AFYH 3SNBA 2BQ6B 1UK4A 2W3IA 2Y81A 1GJAB 1C1UH 1ABIH 1CBWB 4OGXA 3D23A 2WPLS 1IQKA 4BTTB 3DUXH 1YPKH 2XXLA 3ZZ7A 1N6YA 1YGCH 1A46H 1HJAB 2Q6DA 2RCEA 4J2YB 2FXRA 2Y82A 1HJ8A 3RLWH 1EXFA 1UCYE 1SQTA 1Y5UT 2FI5E 1HYLA 1TRNA 2SGDE 1UVTH 1TIOA 3VB6A 1G3DA 2OC7A 2A4RA 3GY3A 1SLWB 4AFUA 2VVUA 2OC0A 4X8TH 4O3UA 1C5LH 1GJ8B 5DKMA 3TGKE 5C1UA 1O2RA 2H9HA 1S82A 1SGYE 4O9VA 4BXSA 5JBAS 3H7OA 3F68H 1O2GH 1UTOA 2QXJA 5T3HA 1RS0A 2OP9A 3GY4A 3LGIA 4YESB 1PJPA 5C1XA 1A0JA 1MTNC 3E0PB 3TLOA 2ZU4A 4IMQA 1AVWA 1DWBH 3HKJB 1LVMA 4MVNA 1P2MA 2QF3A 3PM3A 2XCFA 3RXJA 2QXHA 4INHA 2FODA 1E38B 1Z1IA 3A7WA 5DP5A 4DG4A 2J92A 3I77A 1TNIA 1MKWK 1G3EA 4PROA 2BVRH 1BDAA 1DXPA 3QTOH 1TONA 1K21H 2Q6GA 1FZZA 1V2PT 1O3LA 2J4IA 2Z3CA 3BEFB 2FX4A 1AFQB 4X8VH 4ISLA 1P09A 4ISOA 3SV9A 1Z71A 1O3OA 3T29A 4VGCB 1W2KH 3GCNA 3S9CA 2P8OC 3SNAA 1EPTC 1OWKA 3MWIU 1WTHD 1ABJH 1MU8B 1W12U 1E36B 2G5NA 2PTNA 1O3FA 1Y3XA 3PO1B 3TU7H 1C5RA 1IQGA 5FBEA 4X1PU 1OP0A 3ODDA 1C1MA 1KY9A 4YTAA 1EQ9A 4INLA 1BMMH 1W0YH 1YPMH 4TYDA 3TH2H 1O35A 1SB1H 4K60A 3HKIB 3FANA 4AG2A 3D49H 4B74A 1DUAA 1Y3UA 4XFQA 1GBLA 5L6NH 1XXFA 1GBBA 4IGDA 1GHZA 1AVGH 1AFEH 3HK6B 1ZYOA 2Z94A 5GXPA 2ZGCA 1QRZA 1GJ9B 5JYIA 3UY9A 1HIAB 2GDDA 2WPIS 3EA7A 3RU4T 3BTTE 1HAGE 4Q7ZA 3RM2H 3F1SB 2PTCE 1GDUA 1ZTLA 1C2EA 5FPYA 3TJNA 1A2CH 2PFEA 4Y71A 5A0AE 4I31A 4JYVH 6GCHG 3AW1A 3F9EA 1OOKB 1W3CA 2HLCA 1VZQH 2GTBA 1DWEH 2ODPA 3ZZCA 5DO4H 1C2MA 2GV7A 1XUGA 1RIWC 4NZLA 4YT7H 5GCHF 1EKBB 4NCYA 3SZNA 5A2MH 1SGCA 2BY8X 2H1UA 2IJOB 2QAAA 3F9GA 1QY6A 3LH1A 4LXBH 1Q31A 1GJ5H 5JDUB 1EZQA 1O2HA 2ESTE 4HI3A 4ABJA 3Q3XA 4Y11E 1O39A 2VNTA 1OSSA 4D9RA 1G30B 3UUZA 1K22H 3A86A 1L1GA 4GLYA 3GDSA 5LH8A 4ISHH 3RDZA 1O5GH 1PPZA 3BTFE 1P2JA 1DSTA 2HOBA 1A5IA 1C4Y2 1QL8A 1ZJKA 2Z9KA 2VU8E 3W95A 1A3BH 2V3HH 6CHAC 4X2VA 4I32A 2ZTYA 3T28A 1T8OA 1NFYA 3SJ8A 4GHQA 1YM0A 5HM9A 2JETB 2G4UA 1GBMA 5IDKA 1TRYA 1OX1A 2RA3A 4I33A 4TPYA 1BHXF 1N6XA 1QB9A 4A7IB 4TWYA 1JIMA 2ZA5A 3RXRA 1S6HA 4CBNA 3A8AA 1UTMA 2AGGX 4JK5A 4NFFA 3LJJA 4MQAA 3UNQA 2PSXA 1MBMA 3QN7A 4BTUB 2FO9A 1AY6H 1J8AA 3ZZBA 2ZTZA 1XUJA 1C1QA 2YNAA 2R2MB 4X2YA 1B7XB 1EASA 1TBQH 1ZMLA 2ZCLP 1DY8A 4IC5A 1Q2WA 2I6QA 1VGCB 1A1RA 2QGRA 3LGUA 1LHDH 1XXDA 1S85A 1A5HA 2ZHEH 1TBZH 1ZHMA 2BD4A 3QZRA 3C1KA 1Z8RA 4ZUHA 4NIWA 1ZPBA 2ASUB 4XE4A 4ZHLU 3ZVBA 3BTHE 1S0QA 2CMYA 4E05H 4FUEA 3RUOA 3E6PH 2BLQA 1T4VH 3PLPA 2XNIA 1Z8IB 3STIA 2BY5X 1CHGA 1HPGA 1AKSA 1SGFG 4IN2A 5GCHG 1TGTA 3URDA 1MZDA 2WYJA 1NFWA 1PYTC 1GHXH 1LVYA 4ZHMU 4D7GA 4I8JA 2ZKSA 1VJAU 3LGYA 2CF9H 4B75A 4I8GA 1SGEE 1GDNA 4YM9A 2RG3A 1IQEA 3L3TA 4FU7A 3U8TH 2XBXA 4U30A 3S7KB 3PMAB 3LT3A 1IHTH 1UVOA 5CHAB 3FZDA 4JZFH 4YOGA 2EC9H 3BSQA 3OTJE 2A7CA 4ISIH 2QYIA 2P8OB 1NRSH 3A89A 2SGFE 1C5YB 1NZQH 3KL6A 5FX6A 5HGGA 1LHGH 1O5CB 3RXMA 3S0NA 8GCHF 1MCVA 4D8NA 3MO9A 1O2IA 1Y5BT 2V3OH 5CMXH 1VITF 1KTTB 4NA7A 3R3GB 3VXEH 1QBVH 2R3YA 3LC3A 3SV8A 4DCDA 1G36A 3A85A 5FX5A 1VITH 2AMDA 3F9FA 1EP5A 5DP6A 5EGMA 5ABWA 3A7TA 2ZU2A 4IMZA 1ZMJA 1XUFA 2P93A 2VVVA 5K7RA 3GOVB 2A7JA 1GL0E 1SOZA 1OWDA 2VWLA 1GVZA 2WPMS 2A32A 1TX7A 3TK5A 1F2SE 4CRDA 4ZKOU 4ZKNU 1P57B 4KELA 3F6UH 4FUFA 3RXHA 2JH5D 3SNCA 1LHFH 1V2MT 1HAIH 1D9IA 1C5OH 3NZIA 5C67A 4FXGH 5GJ4B 1SSXA 1O2NA 1TX6A 4K1EA 1GHAG 3SV2H 1AQ7A 2GVFA 5DP4A 4FU9A 3S9BA 2Z6BD 4ZXXH 1DSUA 1ELDE 3TNTA 4B71A 4NWLA 1DWDH 2EEKA 3O8RA 5EXMA 2R3UA 1EJMA 2FI3E 3UOPA 2F3CE 1AB9C 3UWIA 3SN8A 2AMPA 2Y7ZA 2P3UB 5EU8A 3NK8A 2FIRH 1C2FA 4FUDA 4DJZB 1O2MA 4THNH 2ZU3A 4DVAU 4FVBA 2FTMA 4XOJA 1GMCF 3TK9A 1P2OA 5BRRE 2ZNKH 2CV3A 3SU2A 3E16B 3FP8E 2PUQH 1HAYB 3IITA 1UO6A 1CE5A 1EZXC 2FLBH 4YLQH 1FAXA 3RXBA 1F0RA 4WMDA 1HB0B 2FS9A 1K9OE 5E2PA 1ZR0A 1HJ9A 3GCTF 2FOFA 1Z1JA 4HTCH 1P2NA 2EI7A 2BHGA 1ELTA 4ZKRU 4AG1A 2YNBA 4FUHA 3RXDA 2G8TA 1C1OA 1AWHB 2EI8A 1MUEB 4Q7XA 1FY5A 5DP9A 1K1NA 3B9FH 3OSYA 2A5KA 3PB1E 1V2LT 4I8KA 4ZROA 2ZFFH 1P3CA 3HPTB 4KTCA 2A4OA 1O33A 3HATH 1FN8A 1UTJA 1VITG 2ZF0H 1O5EH 5HYOA 3K6ZA 4AB9A 4NZQA 1SLUB 1TE0A 5JPMH 1ELCA 1WCZA 1K2I1 1CVWH 3HK3B 2EI6A 1QB1A 1IQIA 4WMFA 1HAOH 1O2XA 4X2XA 1OWEA 3QX5H 1NFUA 2A5AA 1LDTT 3U69H 3ATIA 4U2WA 1EAIA 1EJNA 4CH2B 1EPTA
chains in the Genus database with same CATH superfamily
1IQJA 2BDGA 2F9PA 5EPNA 1QA7A 5GNDA 1O32A 1TPSA 4MPWA 5DP3A 2W5EA 3TK6A 4DY7B 5C5NA 1FQ3A 1LPZB 1OWJA 1NO9H 3A80A 1KDQB 4XD7D 2O8UA 4ESTE 3UQVA 1UTQA 1C5TA 2HVXA 4X6PA 1MD7A 1WOFA 1BMAA 7GCHG 3BEIB 4YLUA 3EA9A 4K8BA 2BD2A 2C93B 4KTUA 1TMUH 1NM6A 1TGCA 1MQ6A 5FPSA 3SGAE 4DW2U 2ZPQA 3TIUA 2AGIX 4Y79A 4RSPA 1BTUA 3SHCH 5EW2H 1ZPCA 2YOLA 1L0ZA 1MD8A 2FPZA 4B2BA 5PTPA 4DOQA 1DM4B 4F48B 4QT8C 1GI9B 1V2OT 1F0SA 4I86A 3RMMH 1ARBA 3VGCC 4U01A 2BLWA 3ZVDA 4XSKU 3GY5A 1H8HD 4DIIH 1HXFH 4GSOA 8GCHG 2PKSC 4TY7A 1F92A 1TGNA 1XUKA 1UVPA 1GMCG 4X6NA 1ANEA 3EA8A 2HPQH 3G01A 4RT1A 5CHAC 2OLGA 5E0HA 4IN1A 4CR9A 2F43B 2QC2A 2DUCA 1HAZB 3A7VA 4D7FA 4TPIZ 2OBOA 3N99A 4YO9A 4Y0YE 3A87A 4K1TA 1LHCH 3BTQE 2AGEX 3SW2B 2ZC9H 3EE0B 2BQ7B 2KCYA 1TNKA 1ZRBA 1UHBA 3BIVH 4CH8B 1HBTH 2PSYA 1PQ8A 1LPGB 1YWUA 1DVAH 1NROH 2IPQX 1C5XB 2OC1A 4CRGA 2TGAA 3BEUA 1UJ1A 1BJUA 2TGTA 4OS4A 2BDHA 1NPMA 1MTUA 2JH6D 4BOHA 1DLEA 2HRVA 2R2WU 5F8TA 1O2QA 3IWMA 3MU0A 1EATA 3N7DA 1EJAA 2WPHS 1YF4A 4RN6A 2ODYB 1AE8H 1SL3A 1WUNH 1C1VH 2ANKH 3Q76A 1AKSB 1LKBA 1NFXA 1Z6EA 3E90B 4XRNA 1BITA 2YMSC 2ZFQH 2STBE 2ZP0H 1DDJA 2NU0E 1HV7A 3NPSA 2F9OA 3DA9B 2KAIB 4DT7B 1YYY1 4Y7BA 2BD5A 5E8EH 4AZ2B 2G4TA 4WWYA 1TNLA 3BTKE 5LGOA 1V2WT 3E8LA 2TPIZ 4H42U 7GCHF 2KR7A 4A5TS 2NU4E 5L2ZH 2Y5FA 1YLNA 2UWOA 6CHAB 1TNGA 2A45B 2L74A 2VGCB 2FLRH 1ARCA 1TPAE 5EJLA 1L1NA 3ZZAA 2BZAA 1RGQA 2R9PA 1SHHB 3A88A 1KDQA 3MTYA 5ETXA 2FOCA 3LJOA 1LPKB 4B76A 1CHOG 5KECA 3RXIA 4OS2A 1CT2E 1Q3XA 2XTTB 3F3BA 2ZFPH 6GCHF 5C94A 1C9PA 2XWAA 4Q2KA 5JB9S 1TGSZ 2ZPRA 1F5RA 5B6LA 3MU8A 1ZZZA 3NRLA 1QBNA 2ZGHA 1C4U2 2H5DA 1WXRA 1XUIA 1C2DA 2IN2A 1C1NA 4Y7AA 5EW1H 3MNBA 1NBMD 1RRKA 4ACAA 2ODQA 1JRSA 2B8OH 3P95A 4J1YA 4B2AA 3VB3A 3PWBA 2P16A 1VCQA 2SGEE 2K1QA 1QL9A 1FPCH 4ZMAH 3GISB 2UUYA 2BD9A 3FAOA 1HNEE 2OINA 4CRBA 1A3EH 3KYGA 1SFIA 1MTVA 5DJ7A 5F8XA 1EAUA 1CT4E 4FU8A 1KIGH 1KXBA 2ANMH 1S0RA 3KGPA 1BRUP 1D3DB 3ZV9A 3ZZ5A 2SGPE 1O36A 3KQCA 2ZG0H 4NGAH 3SORA 1PPCE 1ELFA 4AOQA 4BAKB 1CQQA 3SU1A 1GHBF 4MTBA 1H8IH 3LIWA 1YBWA 1K1OA 1BZXE 1MAYA 2JJ2D 3AASA 5HMAA 4Y8YA 2Z3EA 2VVCA 1ELBA 3P8FA 1GJDB 1FNIA 1ELAA 1K1IA 5EIYA 1V2VT 2Z3DA 1AD8H 1CU1A 2W3KA 3QWCH 3OU0A 3P70B 1GBHA 2AEIH 2GD4B 3BTGE 3ATWA 1YPEH 3BV9B 2WV5A 4NIYA 3LGTA 3UR9A 2QY0B 2AS9A 3L33A 4AYYB 4JMYA 2FZZA 1ZJDA 1GBTA 3AAVA 1FPHH 1Y5AT 2Y6TA 2BX3A 2WPDD 3P8GA 3TITA 3NXPA 2VWNA 4UFDH 3B23B 1SPJA 4ASUD 2ZFSA 4JZ1A 2AYWA 1H8ED 3LPRA 1AHTH 2G51A 1SQRA 2B7DH 1YPHE 2SFAA 1V2ST 2VGCC 4Q80A 1KXDA 4HZHA 3VXFH 2W7UA 1EX3A 4OS7A 3RU4E 5C3NA 4KGAA 1BIOA 1O2KA 2W6JD 5JBCS 2BQWB 1RTLA 2XRCA 1MAXA 3EE7A 2BTCE 2ZGXH 3Q00A 1PQAA 4R0IA 1S5SA 1O3MA 1EOJA 1E79D 1GI4A 3T62A 5GWZA 1D3TB 2OUAA 3ODFA 2BMGB 1H9HE 4GCHF 2YMSB 3KCGH 5FCKA 2OBQA 4ASHA 3SGQE 2VWMA 1IOEA 1ZGIA 3BG4C 1TA6A 1CA8B 1GI0A 4H6SB 1INCA 2P94A 2QN5T 3DSGA 4Y10E 1BTHH 1O2JA 1WBGB 3RXVA 1O0DH 1NBME 4RKJB 4OS1A 4BAOB 1SBWA 3DCLA 1QJ1B 1YCPM 1WU1A 1KXAA 2O8WA 3BF6H 3GDVA 1E1RD 5IYTA 3GY2A 2TGPZ 1L2EA 1QL7A 1GMHG 3PV4A 1FV9A 1ZHRA 1ZTKA 1ESTA 1FMGA 1TOCB 4YZUA 1S6FA 1F7ZA 1ZHPA 4U32A 4BNRA 1QQ4A 3RXUA 1O38A 2M5TA 2LNCA 3ZIAD 2C4FH 1TQ0B 3GCTG 2NU1E 2D1JA 8LPRA 1FX0B 2XBWA 4AX9H 5F6MA 2F9BH 1BBRK 3MNCA 2A7HA 4IW4E 2QXIA 1GWAA 3MO3A 1O2OA 1O3NA 1DE7H 1GBFA 1SGPE 5TCCA 3MO6A 1C4V2 4ABEA 3A84A 4AYVB 1DT2A 1J17T 1GI5A 1HJAC 3FO8D 1EB2A 1HAPH 1UTPA 1O2VA 1WQVH 3UR6A 2Q6FA 3TPIZ 3SJOA 4E06H 1FJSA 3SJIA 4MNYA 4WH6A 3F0OA 2VIDA 4WF8A 5L2YH 2Z9LA 1P2IA 3V7TA 3QTVH 2V7QD 3EAJA 1H8DH 3M5MA 4CBOA 1V2NT 4HG6A 3DSPA 2ZHDA 1MKXK 1NN6A 1PPGE 2PV9B 2ZU1A 3MNSA 5AFZH 1OYQA 1TPPA 4ABFA 3PTNA 4K3JA 1XX9A 1DLKB 2ALPA 4UFFH 2NU2E 4O03A 3M61U 2VB0A 1BB0B 1SMFE 2J38A 1VJ9U 4I8HA 1L4DA 2KAIA 3U8RH 3UNRA 1ANBA 1GI1A 1JBUH 5JB8S 1QQUA 5J4QA 4RKOB 1K1PA 3FZZA 1FIWA 1SG8B 3BG4B 2ZFTA 2AIQA 5FAHA 1DFPA 4FUGA 2OC8A 1SLVB 2VWOA 1LO6A 3U98H 4CRAA 1J14A 3QK1A 3ZVFA 4RT0A 3RXTA 1IQLA 3H5CB 1BBRE 1YY3A 3M5OA 2A0QB 1ETSH 1WAYB 1OS8A 4X8SH 5C1YA 3SQHE 2ZGBH 3F2HA 2FOBA 1TMTH 5T6GA 2CF8H 1S83A 4MPUA 1J15A 3UQOA 4NSVA 2ZTXA 5EG4A 1G3CA 4XBCA 1YC0A 2GDEH 5DGJA 1MTWA 3GDUA 4IS5A 1HDTH 3Q3KA 1C5QA 1KYNA 1BTWA 3K9XB 1XMNB 3HGPA 3ZVCA 3E1XB 1D6RA 3K2UA 1A61H 3ZYEA 5CE1A 1EP6A 3PLBA 4BAQB 1HAVB 4X1QU 1GGDB 3VB7A 1NU7B 4K8YA 1UCYK 2WPJS 3AK5A 2BDBA 3DFJA 2HWLB 5AF9H 3CS0A 3RU4D 1GBKA 2G5VA 3KQDA 1UMAH 4B6FA 1AN1E 4F49A 1YPHC 2WYGA 4AB8A 1FY3A 5E0GA 2PHBA 4INKA 2B5TB 3WY8A 1J9CH 1RIWB 1SFQB 2HNTF 1ELVA 1PPBH 1S6LA 2GZ7A 1QJ7B 3E91A 4MDSA 3QGNB 1Y3WA 5C0UA 4NWKA 3RMOH 5I25A 2J98A 2VIWA 1HAXB 1EFRD 2GMTB 1AB9B 1IQHA 1SGQE 1A0HB 4X1SU 1GJ7B 2CJIA 3V12A 2VIVA 3RMNH 2O8LA 2FTLE 1NRRH 1HUTH 1P2KA 3OEHD 4AFZA 2XBVA 2HGTH 2BDIA 2C8ZB 3RM0H 1P12E 3PROA 4NSYA 1MZAA 4LZ1H 3S69A 3GY8A 5A0CA 4MNWA 1CHOF 3MMGA 4WJG2 3STJA 3ZVAA 4F4OC 2GKVE 3DFLA 1CGIE 2R0KA 5JBBS 4ZH8A 2G81E 2CXVA 4X2WA 2PKAA 1GBDA 2FDAA 2ILNA 4ABAA 3MI4A 1TWXB 3FN8A 3FFGA 3M7QA 2H5CA 2OK5A 1BOQA 1K28D 2ANYA 1BA8B 4UD9H 4OM9A 2WV9A 3KF2A 2VH6A 1HCGA 5K0HA 1BTYA 1GDQA 1OHHD 3SGBE 1HIAA 2SGQE 5A8XA 3VB5A 2Y80A 1O3HA 1QB6A 1BHXB 3SUDA 4GAWA 1C1TA 1AVXA 2GJGA 1QURH 1CO7E 1UW7A 1CA0B 1EUFA 1QIXB 4MLFB 3OYPA 1C2IA 2EA3A 2H2ZA 4CRCA 1AFQC 4A1XA 1X7AC 1WV7H 1GMDG 4ABBA 4MNXA 2Z9JA 1QCPA 2BVXH 2UUJB 4YT6H 5E2OA 2BDCA 1ETRH 1LKAA 2FOHA 3SV6A 1FONA 2A2XH 2ZECA 1T7CA 2C8YB 4FVDA 2FX6A 2J9NA 1SR5C 4BAMB 1U6QA 3E0NB 5EQSA 1O2ZA 3I29A 2STAE 8KME2 2GZ9A 3A82A 1FY4A 5H4IB 4LZ4B 3DHKH 2BOKA 1W0JD 5A8YA 1B0EA 1SGDE 1O2UA 3F2FA 1JOUB 4HGCA 1CA0C 1P2QA 4K2YA 2F91A 4KTSA 3SJKA 1AMHA 2UWPA 2PGBB 1H1BA 1DS2E 3UFAA 3PMHB 1AUTC 3B8JA 3DT0H 4WY3A 3FVFB 2Y7XA 1EAWA 3O8DA 1QRXA 1BTZA 1B0FA 3PMJA 2BDYA 2F83A 2GT7A 3P8OA 2AFQB 1KTSB 2BVSH 3IG6B 2J2UA 2OQUA 3LONA 3EDXB 5GPIB 1GBIA 2D8WA 3N7OA 1G2MA 2A5IA 3BG8A 3GY7A 1ZMNA 1C1WH 1C5VA 2J95A 4R8TB 5J4SA 3HGNA 3UOUA 3DD2H 3M3VA 1GBJA 3ESTA 2ZZUH 1QJ6B 2F4LA 2CN0H 2KZ4A 4CRFA 1AZZA 3SU4A 4FETA 1YCPH 3MH6A 4TY6A 2D26C 1F5LA 2V0BA 5F03A 2J94A 3VGCB 2ZDVH 2Y5HA 3U1JB 1ZRKA 1A4WH 1VCWA 2Z7FE 2ZIQH 3SU6A 3URCA 1NESE 1ORFA 1NTPA 1UVUH 3UREA 1PQ7A 1THRH 1TNJA 1ZSJA 2BD8A 4WXIA 2H9EH 2RDEA 4DIHH 1S81A 4GCHG 2PKSB 3ZYDA 2JH0D 4GVUA 5DK1A 3N7EA 2P3TB 2ZQ1A 2ZDMA 1KLTA 1LMWB 2VJ1A 4E7NA 1O2WA 3RXGA 1XVMA 1KXEA 3T5FH 4HFPB 3F2GA 1P8VC 1EB1H 3ZVGA 5C2ZA 4GPGA 2THFB 2I6SA 1TBRH 3BTME 2GP9B 2BD7A 2P3FH 1T8MA 1NT1A 3PTBA 1BUIA 1QNJA 2CGAA 4ZAEA 5HXFA 4DURA 1OKXA 2PWXA 4TWWA 1GMHF 1HLTH 5T6DA 3UPEA 2OQ5A 2BDAA 5LPFA 3GY6A 1A0LA 1DX5M 2VIOA 4CR5A 1AE5A 1ETTH 2ALVA 2XW9A 4UONA 2JETC 1CT0E 4D9QA 1A5GH 2PUXB 1SC8U 2C90B 3O8BA 3PRBA 1OYTH 1V2RT 4BXWA 1C1RA 1AI8H 2GCHG 1V2JT 3A7ZA 3NUMA 3ZVEA 1F5KU 1SHYA 5L30H 1SGRE 3BTWE 4NA8A 4BANB 1E1QD 2FESH 1UK3A 1P11E 1TYNA 2ZU5A 2ZHFH 1GI2A 1V3XA 3V0XA 1HAHH 3S9AA 1NS3A 1QBOA 1SGTA 2XBYA 1IQNA 2ZWLH 2PR3A 4SGBE 1D3QB 2BM2A 1BTXA 4JYUH 4FOUC 2ZDAH 1LCYA 1YKTA 1JXPA 3TVJB 1PYTD 1OPHB 1GG6B 3PV5A 4I8LA 3MYWA 3LGWA 4OS5A 2AERH 2P59A 1RJXB 3GICB 3KIDU 3LOXA 3M3SA 2LPRA 4ABDA 1QA0A 1D6WA 1T8LA 1T8NA 1P05A 1PPHE 2FOMB 3D65E 3T2NA 5A8ZA 4Y8ZA 1GGDC 1O3AA 1TOMH 1AO5A 5BPEA 1GJ6A 2BXTH 3ATKA 2RDLA 1TPOA 1SLXB 2AHME 1YP9A 1MU6B 3MU5A 1GCTC 2SNVA 1T32A 2UWLA 3S7HB 7LPRA 3GCOA 1K0HA 4GHTA 2K8IA 2QIQA 1LQEA 2VH0A 1W14U 3MU4A 2SGAA 1O3EA 1TB6H 1ESBA 3OX7U 3SI3H 1Z8JB 2V6NA 4ACBA 4X6MA 3AVZA 1XKBC 5EQQA 3M36A 1C2HA 3RP2A 1GMDF 3DSOA 3U1IB 1DITH 3M7UA 2ZHWH 1O5AB 5LPRA 2KCAA 1C5WB 3ENSB 1C5ZB 2FM2A 1O30A 1UK2A 2GT8A 1BRAA 1O37A 3EQ0H 2Q1JA 3QO6A 3QUMP 3A83A 4I7YH 1L1JA 4VGCC 2BYAX 2CHAB 2XC5A 4UEHH 2C3SA 3ZV8A 2DE9A 4A1VA 2VINA 1ZPZA 4WXVA 2H6MA 1ELEE 3SNDA 1N8OC 1O5FH 3L6PA 4AFSA 3PWCA 5ESBA 4AC9A 2ZHQH 3MFJA 3KHVA 2OXSA 2VIQA 3ELAH 4UFGH 1GHYH 2AH4X 1OWIA 2O9QA 3V3MA 3TJVA 1W13U 3TH4H 4YOJA 2BX4A 4BAHB 2G00A 2CK3D 1DICA 1GJBB 1N8OB 9ESTA 3PMBB 3TH3H 2ZI2H 5KEDA 2C8WB 3K6YA 3RC5A 1OP8A 1ZLRA 2D2DA 4X6OA 1N1LA 3RXSA 2ZCKP 3RMLH 1C2LA 3QLPH 2A1DB 2ZDLA 2RFKC 4A1TA 1KLJH 4YOIA 1ZSKA 1O3KA 2F9VA 2FOGA 1TABE 2HALA 2HNTC 1TALA 2XOKD 2ZGJA 2F9UA 1NY22 1VCPA 2QF5A 4JZIA 1OXGA 3VPKA 1TX8A 3A81A 1O2YA 1H9IE 4ZHAA 1O5BB 1JIRA 4MG3A 1THSH 2NU3E 1GI8B 1IQMA 4FUIA 1AUJA 1L4ZA 1GVLA 5T6FA 3SV7A 1GI6A 1TMBH 3M5NA 1V2QT 1SQAA 3SHAH 1SGNE 5EXNA 1BBRH 3E3TA 3UIRA 1P9SA 1DOJA 3A8CA 1SI5H 3QGJA 2VIPA 3TJUA 5TCAA 2J97A 1O5DH 1O3GA 1P3EA 1GHBG 2FYRA 1XM1A 1RTFB 1QTFA 1SQOA 4X8UH 3MH5A 1ACBE 1DUEA 5A0BA 3RLYH 4WMEA 2ZFRH 2QV1A 4B6EA 3GCHB 1ANCA 1C2KA 3OY5U 3A7YA 4NFEA 4CHAB 1K1MA 3BIUH 3U9AH 6ESTA 1ZOMA 2KCPA 3RXLA 2PKAB 1VGCC 3SUGA 5FPTA 4D76A 1SGFA 2PW8H 1BTPA 4ISNA 1GG6C 1MH0A 2V35A 8ESTE 1P10A 5HIZA 1P9UA 1GCTB 3PLKA 4UDWH 1E35B 2AIPA 2FI4E 1XKAC 1W8BH 1RFNA 4WVPE 5GDSH 4ABHA 1OWHA 5AVDA 2BD3A 2GCTC 2ZCHP 3M5LA 1F0TA 2WUCA 4A6LA 1O2TA 5DP7A 1B5GH 5F53A 1QRWA 4XBBA 1OP2A 1O3JA 3RC4A 1T31A 1WQSA 1E34B 1QGFA 3T25A 1FI8A 1UTNA 2ULLA 1CGJE 5B6OA 1K1JA 1IQFA 1V6DA 5FXLA 1C2GA 2F9NA 4AFQA 3TGIE 1FN6A 4KKDA 4Y6DA 3UB0A 2PGQB 3JZ2B 1O2LA 3VFEA 1C9TA 1FDPA 2C8XB 3PYHA 4ZXYH 3FOAA 3K65B 1QHRB 3R0FA 1DWCH 4SGAE 1FAKH 1WTGH 2UUKB 1SOTA 2WSSD 2TIOA 4E7RG 3OY6U 1P06A 2G55A 1Y8TA 2BLVA 5LPEA 5F8ZA 3T27A 4OGYA 1GHVH 5EXLA 2ZDNA 2XWBI 2BLOA 4P02A 2GX4A 4TT3D 4Y76A 1C2JA 3VB4A 2WHXA 3D62A 1Y3YA 1FIZA 1FY8E 1YCPK 1AIXH 1TNHA 1PQ5A 1G9IE 1JRTA 3ZZ8A 1NRQH 2JKHA 1LTOA 3CS7A 1Z6JH 1W11U 3KEEA 2BOHB 2H9TH 1KSNA 3KQEA 3LKWA 2FEQH 4B1TA 3LC5A 3FP6E 2FOAA 2O8TA 4K5ZA 3MU1A 2ZPSA 1IAUA 1YLCA 5EPYA 1EZUC 1DPOA 2TBSA 3ZZ4A 3ITIA 3GYMA 1ANDA 2K0QA 1S84A 2ANWA 1V2UT 1YPJH 4Z0KA 4Q63A 4B73A 4KP0A 2WUBA 2QCYA 4M7GA 1MTSA 3AAUA 2QE7D 2TRMA 2GCTB 2YMSD 3Q3YA 1H9LB 1C5SA 1O2SA 1PPFE 1FUJA 1W0ZU 2DE8A 3LU9B 2ZQ2A 2TGDA 1BRBE 2G52A 2BY7X 1G2LA 1P03A 2W26A 4MPXA 1C5UA 3RXOA 3KN2A 4CHAC 2GZ8A 1NRNH 4DGJA 5SGAE 2QF0A 3GCHC 3SI4H 4MPVA 2Z9GA 5A09A 1COWD 4IBLH 3OTPA 4AGJA 1W0KD 1TFXA 4H6TA 3MHWU 1FY1A 1DXWA 2OCVB 3RXKA 2BXUH 1BJVA 4JYTA 3GYLB 1YPLH 5EOKA 3LH3A 1RTKA 2P95A 3NKKA 1EPTB 1AGJA 1UHBB 1GI7B 5CHBA 7ESTE 1KXFA 3SUFA 1LHEH 3RXAA 1EAXA 3CNRA 1GVKB 3Q77A 2A4GA 1ESAA 3A7XA 3CENA 1V2KT 2LELA 2XC0A 1TA2A 2XYAA 1GJ4H 2AMQA 1BRCE 1ZGVA 4K1SA 5FCRA 3H09A 1UTLM 3V13A 1DY9A 3PO1C 4FUJA 3RXEA 3LDXH 2XCNA 1KLIH 4CREA 4UFEH 2A4QA 3M37A 1MKXH 3P17H 1O34A 1W7XH 2GV6A 3ATLA 2KFWA 3U28C 1MTNB 2SNWA 1TRMA 1G32B 2GCHF 1C1SA 2BY6X 1Y59T 3RXCA 5KGOA 3SU0A 4OS6A 1BMNH 1HGTH 4Z1MD 5HM2A 2XC4A 2Z9IA 2OTVA 1C5PA 4X1RU 1O3BA 4MNVA 1PPEE 1SVPA 1XUHA 2FMJA 2WINI 3BTEE 3T26A 3ZZ6A 2ZO3H 1YLDA 1P01A 1EOLA 2M2AA 1VKYA 1ZSLA 4Q4LA 1F0UA 2WPKS 4NIXA 2WV4A 1CSOE 3AW0A 3RXPA 5C5OA 1BMLA 3QDZB 5DG6A 5TJXA 2OD3B 1QFKH 1ZTJA 4ABIA 1FXYA 1AU8A 3KNXA 3P6ZB 4A92A 3ATMA 1O3IA 2IPHA 5EJ1A 1GBCA 1C5MD 1VR1H 3P92A 1C1PA 1CBWC 2CHAC 1P0SH 1IHSH 1HXEH 3RXFA 1O3CA 4ZKSU 3W94A 2W7SA 1LQDB 4ABGA 2J98B 1D3PB 4BTIB 1O31A 4Q7YA 3MOCA 1MQ5A 3EGKH 5HIYA 2BZ6H 3QZQA 3ZZDA 4H4FA 2B9LA 2JDID 1MCTA 3M3TA 3SO3A 4Z6AH 1MBQA 3U8OH 1Z7KA 2O8MA 3MNXA 1O3DA 4B2CA 3JZ1B 5GIBA 2ZEBA 3A8BA 3UTUH 1UCYH 1AWFH 1NU9A 1V2TT 2B0FA 3F9HA 2HLDD 3ZZ3A 3H7TA 3RC6A 3MQKC 2KM0A 3ZZ9A 4AGKA 2Y5GA 5G4BA 1GBAA 1D4PB 1UTKA 4AN7A 1MKWH 2KCOA 2GMTC 1W7GH 2A31A 4O97A 1JMOH 1ID5H 1G3BA 1O3PB 1TQ7B 1WSSH 3CP7A 5ESTE 4NG9H 4X0WU 1C5NH 2BY9X 1TAWA 1GPZA 4X1NU 1PFXC 1THPB 3MH4A 1MMJN 4F55A 3EYDA 2FP7B 1DANH 1RD3B 1EZSC 3SBKA 2A2QH 2J34A 1GL1A 1XVOA 1HAVA 5C17A 3KQBA 5I46H 1LVOA 2UUFB 1JWTA 4IC6A 1Z8GA 1G37A 3OEED 5AHGH 2EQNA 2FYQA 1BQYA 1KXCA 1T4UH 2BB4A 2PLXA 1GHWH 1HRTH 3VEQB 4UE7H 1O2PA 4WH8A 1UVSH 4JZEH 4Y8XA 3SJ9A 1E0FD 3PRDA 4JZDH 3TNSA 1H4WA 2HNTE 5DSFA 1BT7A 2IJD1 9LPRA 3TJOA 1GI3A 1NRPH 3SU5A 3I78A 3M7TA 2HPPH 4NA9H 5FBIA 3O8CA 1K1LA 1LVBA 1BCUH 1AZ8A 4AORA 2FS8A 3SNEA 2QA9E 1HFDA 5C0TA 2FWWA 4JK6A 4JCNA 1GBEA 4FUBA 1WYKA 3LGVA 3UWJH 4XBDA 1ELGA 1P02A 2NWNA 5FHTA 3A8DA 3FP7E 1M9UA 2FOEA 3M35A 5DP8A 3OE7D 1RXPA 5E0JA 3SYJA 1GJCB 1GHAF 1QR3E 5DPAA 3MH7A 4LK4A 4GUXA 1SGIB 5C20A 2ZDKA 3SUEA 3C27B 3SOSA 1YPGH 4LOYH 3NCLA 1A7SA 6LPRA 3TGJE 2RA0A 2R0LA 3BTDE 5JBTA 3BN9A 1CGHA 2IOTA 1TLDA 3NWUA 3P8NA 1GCDA 3UNSA 7KMEH 5EQRA 3SQEE 3UAIC 5EODA 1J16A 1NC6A 2QXGA 4FUCA 1P04A 2GGVB 3SU3A 3RXQA 1Y3VA 4K69A 4Y0ZE 4O3TA 1E37B 1TGBA 4NIVA 4XDEA 1FLEE 1W10U 5AFYH 3SNBA 2BQ6B 1UK4A 2W3IA 2Y81A 1GJAB 1C1UH 1ABIH 1CBWB 3KQ5A 3D23A 3PV2A 4OGXA 2WPLS 1IQKA 4BTTB 3DUXH 1YPKH 2XXLA 3ZZ7A 1N6YA 5CDFE 1YGCH 1A46H 1HJAB 2Q6DA 2RCEA 4J2YB 2FXRA 2Y82A 1HJ8A 3RLWH 1EXFA 1UCYE 5HKKD 1SQTA 1Y5UT 2FI5E 1HYLA 1TRNA 2SGDE 1UVTH 4DT4A 1TIOA 4YXWD 3VB6A 1G3DA 2OC7A 2A4RA 3GY3A 1SLWB 4AFUA 2VVUA 2OC0A 4X8TH 4O3UA 1C5LH 1GJ8B 5DKMA 3TGKE 2WZQA 5C1UA 1O2RA 2H9HA 1S82A 1SGYE 4O9VA 4BXSA 5JBAS 3H7OA 3F68H 1O2GH 1UTOA 2QXJA 5T3HA 1RS0A 2OP9A 3GY4A 3LGIA 4YESB 1PJPA 5C1XA 1A0JA 1MTNC 3E0PB 3VG8A 3TLOA 2ZU4A 4IMQA 1AVWA 1DWBH 3HKJB 1LVMA 4MVNA 1P2MA 2QF3A 3PM3A 2XCFA 3RXJA 2QXHA 4INHA 2FODA 1E38B 1Z1IA 3A7WA 5DP5A 4DG4A 2J92A 3I77A 1TNIA 1MKWK 1G3EA 4PROA 2BVRH 1BDAA 1DXPA 3QTOH 1TONA 1K21H 2Q6GA 1FZZA 1V2PT 1O3LA 2J4IA 2Z3CA 3BEFB 2FX4A 1AFQB 4X8VH 4ISLA 1P09A 4ISOA 3SV9A 1Z71A 1O3OA 3T29A 4VGCB 1W2KH 3GCNA 3S9CA 2P8OC 3SNAA 1EPTC 2HVYB 1OWKA 3MWIU 1WTHD 1ABJH 1MU8B 1W12U 1E36B 2G5NA 2PTNA 2QF4A 1O3FA 1Y3XA 3PO1B 3TU7H 1C5RA 3WWFA 1IQGA 5FBEA 4X1PU 1OP0A 3ODDA 1C1MA 1KY9A 4YTAA 1EQ9A 4INLA 1BMMH 1W0YH 1YPMH 4TYDA 3TH2H 1O35A 1SB1H 4K60A 3HKIB 3FANA 4AG2A 3D49H 4B74A 1DUAA 1Y3UA 4XFQA 1GBLA 5L6NH 1XXFA 1GBBA 4IGDA 1GHZA 1AVGH 1AFEH 3HK6B 1ZYOA 2Z94A 5GXPA 2ZGCA 5FL7D 1QRZA 1GJ9B 5DN6D 5JYIA 3UY9A 1HIAB 2GDDA 2WPIS 3EA7A 3RU4T 3BTTE 1HAGE 4Q7ZA 3RM2H 3F0PA 3F1SB 2PTCE 1GDUA 2J5UA 2VBCA 1ZTLA 1C2EA 5FPYA 3TJNA 3OFND 1A2CH 2PFEA 4Y71A 5A0AE 4I31A 4JYVH 6GCHG 3AW1A 3F9EA 1OOKB 1W3CA 2W6ID 2HLCA 1VZQH 2GTBA 1DWEH 2ODPA 3ZZCA 5DO4H 1C2MA 2GV7A 1XUGA 1RIWC 4NZLA 4YT7H 5GCHF 4RI0A 1EKBB 4NCYA 3SZNA 5A2MH 1SGCA 2BY8X 2H1UA 2IJOB 2QAAA 3F9GA 1QY6A 3LH1A 4LXBH 1Q31A 1GJ5H 3WW7A 5JDUB 1EZQA 1O2HA 2ESTE 4HI3A 4ABJA 3Q3XA 4Y11E 1O39A 2VNTA 1OSSA 4D9RA 1G30B 3UUZA 1K22H 3A86A 1L1GA 4GLYA 3GDSA 5LH8A 4ISHH 4ZCNA 3RDZA 1O5GH 1PPZA 3BTFE 1P2JA 1DSTA 2HOBA 1A5IA 1C4Y2 1QL8A 1ZJKA 2Z9KA 2VU8E 3W95A 1A3BH 2V3HH 3W1EA 6CHAC 4X2VA 4I32A 2ZTYA 3T28A 1T8OA 1NFYA 3SJ8A 4GHQA 1YM0A 5HM9A 2JETB 2G4UA 1GBMA 5IDKA 1TRYA 1OX1A 2RA3A 4I33A 4TPYA 1BHXF 1N6XA 1QB9A 4A7IB 4TWYA 1JIMA 2ZA5A 3RXRA 1S6HA 4M9FA 4CBNA 3A8AA 1UTMA 5T1VA 2AGGX 2V3MA 4JK5A 4NFFA 3LJJA 4MQAA 3UNQA 2PSXA 1MBMA 3QN7A 4BTUB 2FO9A 1AY6H 1J8AA 3ZZBA 2ZTZA 1XUJA 1C1QA 2YNAA 3FKSD 2R2MB 4X2YA 1B7XB 1EASA 1TBQH 1ZMLA 2ZCLP 1DY8A 4IC5A 1Q2WA 2I6QA 2L6OA 1VGCB 1A1RA 2QGRA 3LGUA 1LHDH 1XXDA 1S85A 1A5HA 1KMHB 2ZHEH 1TBZH 1ZHMA 2BD4A 3QZRA 3C1KA 1Z8RA 4ZUHA 4NIWA 1ZPBA 2ASUB 4XE4A 4ZHLU 3ZVBA 3BTHE 1S0QA 2CMYA 4P00A 4FUEA 4E05H 3RUOA 3E6PH 2BLQA 1T4VH 3PLPA 2XNIA 1Z8IB 3STIA 2BY5X 1CHGA 1HPGA 1AKSA 1SGFG 4IN2A 5GCHG 1TGTA 2EY4C 3URDA 1MZDA 2WYJA 1NFWA 1PYTC 1GHXH 1LVYA 4ZHMU 4D7GA 4I8JA 2ZKSA 1VJAU 3LGYA 2CF9H 4B75A 4I8GA 2KX4A 1SGEE 1GDNA 4YM9A 2RG3A 1IQEA 3L3TA 4FU7A 3U8TH 2XBXA 4U30A 3S7KB 3PMAB 3LT3A 2JJ1D 1IHTH 1UVOA 5CHAB 3FZDA 4JZFH 4YOGA 2EC9H 3BSQA 3OTJE 3WWBA 2A7CA 4ISIH 2QYIA 2P8OB 1NRSH 3A89A 2SGFE 1C5YB 1NZQH 3KL6A 5FX6A 5HGGA 1LHGH 1O5CB 3RXMA 3S0NA 8GCHF 1MCVA 4D8NA 3MO9A 1O2IA 1Y5BT 2V3OH 5CMXH 1VITF 1KTTB 4NA7A 3R3GB 3VXEH 1QBVH 2R3YA 3LC3A 3SV8A 4DCDA 1G36A 3A85A 5FX5A 1VITH 2AMDA 3F9FA 1EP5A 5DP6A 5EGMA 5ABWA 3A7TA 2ZU2A 4IMZA 1ZMJA 1XUFA 2P93A 2VVVA 5K7RA 3GOVB 2A7JA 1GL0E 1SOZA 1OWDA 2VWLA 1GVZA 2WPMS 2A32A 1TX7A 3TK5A 1F2SE 4CRDA 4ZKOU 4ZKNU 1P57B 3OAAD 3GS9A 3F6UH 4KELA 4FUFA 3RXHA 1WDIA 2JH5D 1LHFH 3SNCA 2XNDD 1V2MT 1HAIH 1D9IA 1C5OH 3NZIA 5C67A 4FXGH 5GJ4B 1SSXA 1O2NA 1TX6A 4K1EA 1GHAG 3SV2H 1AQ7A 2GVFA 5DP4A 4FU9A 3S9BA 2Z6BD 2PP6A 4ZXXH 1DSUA 1ELDE 3TNTA 4B71A 4NWLA 1DWDH 2EEKA 3O8RA 5EXMA 2R3UA 1EJMA 2FI3E 2LP6A 3UOPA 1MABB 3SZEA 5IK2D 2F3CE 1AB9C 3UWIA 3SN8A 2AMPA 2Y7ZA 2P3UB 5EU8A 3NK8A 2FIRH 1C2FA 4FUDA 4DJZB 1O2MA 4THNH 2ZU3A 4DVAU 4FVBA 2FTMA 4XOJA 1GMCF 3TK9A 1P2OA 5BRRE 1SKYE 2ZNKH 2CV3A 3SU2A 3E16B 3FP8E 2PUQH 1HAYB 3IITA 1UO6A 1CE5A 1EZXC 2FLBH 4YLQH 1FAXA 3RXBA 1F0RA 4WMDA 1HB0B 2FS9A 1K9OE 5E2PA 1ZR0A 5EJZA 4TSFD 1HJ9A 3GCTF 2FOFA 1Z1JA 4HTCH 1P2NA 2EI7A 1QZ8A 2BHGA 1ELTA 4ZKRU 4AG1A 2YNBA 4FUHA 3RXDA 2G8TA 1C1OA 1AWHB 2EI8A 1MUEB 4Q7XA 1FY5A 5DP9A 1K1NA 3B9FH 3OSYA 2A5KA 3PB1E 1V2LT 3KYFA 4I8KA 4ZROA 2ZFFH 1P3CA 3HPTB 4KTCA 2A4OA 2JIZD 1O33A 3HATH 1FN8A 1UTJA 1VITG 2ZF0H 1O5EH 5HYOA 3K6ZA 4AB9A 4NZQA 1SLUB 1TE0A 5JPMH 1ELCA 1WCZA 1K2I1 1CVWH 3HK3B 2EI6A 1QB1A 1IQIA 4WMFA 1HAOH 1O2XA 4X2XA 1OWEA 3QX5H 1NFUA 2A5AA 1LDTT 3U69H 3ATIA 1BMFD 4U2WA 1EAIA 1EJNA 4CH2B 1EPTA
chains in the Genus database with same CATH topology
1IQJA 2BDGA 2F9PA 5EPNA 1QA7A 1O32A 1TPSA 4MPWA 5DP3A 2W5EA 3TK6A 4DY7B 5C5NA 1FQ3A 1LPZB 1OWJA 1NO9H 3A80A 1KDQB 2O8UA 4ESTE 3UQVA 1UTQA 1C5TA 2HVXA 4X6PA 1MD7A 1WOFA 1BMAA 7GCHG 3BEIB 4YLUA 3EA9A 4K8BA 2BD2A 2C93B 4KTUA 1TMUH 1NM6A 1TGCA 1MQ6A 5FPSA 3SGAE 4DW2U 2ZPQA 3TIUA 2AGIX 4Y79A 4RSPA 1BTUA 3SHCH 5EW2H 1ZPCA 2YOLA 1L0ZA 1MD8A 2FPZA 4B2BA 5PTPA 4DOQA 1DM4B 4QT8C 1GI9B 1V2OT 1F0SA 3RMMH 1ARBA 3VGCC 4U01A 2BLWA 3ZVDA 4XSKU 3GY5A 4DIIH 1HXFH 4GSOA 8GCHG 2PKSC 4TY7A 1F92A 1TGNA 1XUKA 1UVPA 1GMCG 4X6NA 1ANEA 3EA8A 2HPQH 3G01A 5CHAC 2OLGA 5E0HA 4IN1A 4CR9A 2QC2A 2DUCA 1HAZB 3A7VA 4D7FA 4TPIZ 2OBOA 4YO9A 4Y0YE 3A87A 4K1TA 1LHCH 3BTQE 2AGEX 3SW2B 2ZC9H 3EE0B 2BQ7B 1TNKA 1ZRBA 1UHBA 3BIVH 4CH8B 1HBTH 1PQ8A 2PSYA 1LPGB 1DVAH 1NROH 2OC1A 1C5XB 4CRGA 2TGAA 3BEUA 1UJ1A 1BJUA 2TGTA 4OS4A 2BDHA 1NPMA 1MTUA 2JH6D 4BOHA 1DLEA 2HRVA 2R2WU 5F8TA 1O2QA 3IWMA 3MU0A 1EATA 1EJAA 2WPHS 1YF4A 4RN6A 2ODYB 1AE8H 1SL3A 1WUNH 1C1VH 2ANKH 3Q76A 1AKSB 1LKBA 1NFXA 1Z6EA 3E90B 1BITA 2ZFQH 2STBE 2ZP0H 1DDJA 2NU0E 1HV7A 3NPSA 2F9OA 3DA9B 2KAIB 4DT7B 1YYY1 4Y7BA 2BD5A 5E8EH 4AZ2B 2G4TA 4WWYA 1TNLA 3BTKE 5LGOA 1V2WT 3E8LA 2TPIZ 4H42U 7GCHF 4A5TS 2NU4E 5L2ZH 2Y5FA 2UWOA 6CHAB 1TNGA 2A45B 2VGCB 2FLRH 1ARCA 1TPAE 1L1NA 3ZZAA 2BZAA 1RGQA 2R9PA 1SHHB 3A88A 1KDQA 3MTYA 5ETXA 2FOCA 3LJOA 1LPKB 4B76A 1CHOG 3RXIA 4OS2A 1CT2E 1Q3XA 2XTTB 2ZFPH 6GCHF 1C9PA 2XWAA 4Q2KA 5JB9S 1TGSZ 2ZPRA 1F5RA 3MU8A 1ZZZA 1QBNA 2ZGHA 1C4U2 2H5DA 1XUIA 1C2DA 2IN2A 1C1NA 4Y7AA 5EW1H 3MNBA 1RRKA 2ODQA 1JRSA 2B8OH 3P95A 4J1YA 4B2AA 3VB3A 3PWBA 2P16A 1VCQA 2SGEE 2K1QA 1QL9A 1FPCH 4ZMAH 3GISB 2BD9A 2UUYA 3FAOA 1HNEE 2OINA 4CRBA 1A3EH 1SFIA 1MTVA 5DJ7A 5F8XA 1EAUA 1CT4E 4FU8A 1KIGH 1KXBA 2ANMH 1S0RA 3KGPA 1BRUP 1D3DB 3ZV9A 3ZZ5A 2SGPE 1O36A 3KQCA 2ZG0H 4NGAH 3SORA 1PPCE 1ELFA 4AOQA 4BAKB 1CQQA 3SU1A 1GHBF 4MTBA 1H8IH 3LIWA 1YBWA 1K1OA 1BZXE 1MAYA 3AASA 5HMAA 4Y8YA 2Z3EA 2VVCA 1ELBA 3P8FA 1GJDB 1FNIA 1ELAA 1K1IA 1V2VT 2Z3DA 1AD8H 1CU1A 2W3KA 3QWCH 3OU0A 3P70B 1GBHA 2AEIH 2GD4B 3BTGE 3ATWA 1YPEH 3BV9B 2WV5A 4NIYA 3LGTA 3UR9A 2QY0B 2AS9A 3L33A 4AYYB 4JMYA 2FZZA 1ZJDA 1GBTA 3AAVA 1FPHH 1Y5AT 2Y6TA 2BX3A 3P8GA 3TITA 3NXPA 2VWNA 4UFDH 3B23B 1SPJA 2ZFSA 4JZ1A 2AYWA 3LPRA 1AHTH 2G51A 2B7DH 1YPHE 2SFAA 1V2ST 2VGCC 4Q80A 1KXDA 4HZHA 3VXFH 2W7UA 1EX3A 4OS7A 3RU4E 5C3NA 4KGAA 1BIOA 1O2KA 5JBCS 2BQWB 1RTLA 2XRCA 1MAXA 3Q00A 2BTCE 2ZGXH 4R0IA 1PQAA 1S5SA 1O3MA 1EOJA 1GI4A 5GWZA 3T62A 1D3TB 2OUAA 3ODFA 2BMGB 1H9HE 4GCHF 3KCGH 5FCKA 2OBQA 4ASHA 3SGQE 2VWMA 1IOEA 1ZGIA 3BG4C 1TA6A 1CA8B 1GI0A 4H6SB 1INCA 2P94A 2QN5T 4Y10E 1BTHH 1O2JA 1WBGB 3RXVA 1O0DH 4RKJB 4OS1A 4BAOB 1SBWA 1QJ1B 1YCPM 1WU1A 1KXAA 2O8WA 3BF6H 3GDVA 5IYTA 3GY2A 2TGPZ 1L2EA 1QL7A 1GMHG 3PV4A 1FV9A 1ZHRA 1ZTKA 1ESTA 1FMGA 1TOCB 4YZUA 1S6FA 1F7ZA 1ZHPA 4U32A 4BNRA 1QQ4A 3RXUA 1O38A 2M5TA 2LNCA 2C4FH 1TQ0B 3GCTG 2NU1E 2D1JA 8LPRA 2XBWA 4AX9H 5F6MA 2F9BH 1BBRK 3MNCA 2A7HA 4IW4E 2QXIA 1GWAA 3MO3A 1O2OA 1O3NA 1DE7H 1GBFA 1SGPE 5TCCA 3MO6A 1C4V2 4ABEA 3A84A 4AYVB 1DT2A 1J17T 1GI5A 1HJAC 1HAPH 1EB2A 1UTPA 1O2VA 1WQVH 3UR6A 2Q6FA 3TPIZ 3SJOA 4E06H 1FJSA 3SJIA 4MNYA 4WH6A 2VIDA 4WF8A 5L2YH 2Z9LA 1P2IA 3V7TA 3QTVH 3EAJA 1H8DH 3M5MA 4CBOA 1V2NT 2ZHDA 1MKXK 1NN6A 1PPGE 2PV9B 2ZU1A 3MNSA 5AFZH 1OYQA 1TPPA 4ABFA 3PTNA 4K3JA 1XX9A 1DLKB 2ALPA 4UFFH 2NU2E 4O03A 3M61U 2VB0A 1BB0B 1SMFE 2J38A 1VJ9U 4I8HA 1L4DA 2KAIA 3U8RH 3UNRA 1ANBA 1GI1A 1JBUH 5JB8S 1QQUA 5J4QA 4RKOB 1K1PA 3FZZA 1FIWA 1SG8B 3BG4B 2ZFTA 2AIQA 5FAHA 1DFPA 4FUGA 2OC8A 1SLVB 2VWOA 1LO6A 3U98H 4CRAA 1J14A 3QK1A 3ZVFA 3RXTA 1IQLA 3H5CB 1BBRE 3M5OA 2A0QB 1ETSH 1WAYB 1OS8A 4X8SH 5C1YA 3SQHE 2ZGBH 2FOBA 1TMTH 5T6GA 2CF8H 1S83A 4MPUA 1J15A 3UQOA 4NSVA 2ZTXA 5EG4A 1G3CA 4XBCA 1YC0A 2GDEH 5DGJA 1MTWA 3GDUA 4IS5A 1HDTH 3Q3KA 1C5QA 1KYNA 1BTWA 3K9XB 1XMNB 3HGPA 3ZVCA 3E1XB 1D6RA 3K2UA 1A61H 3ZYEA 5CE1A 1EP6A 3PLBA 4BAQB 1HAVB 4X1QU 1GGDB 3VB7A 1NU7B 4K8YA 1UCYK 2WPJS 2BDBA 3DFJA 2HWLB 5AF9H 3CS0A 3RU4D 1GBKA 2G5VA 3KQDA 1UMAH 1AN1E 4F49A 1YPHC 2WYGA 4AB8A 1FY3A 5E0GA 2PHBA 4INKA 2B5TB 3WY8A 1J9CH 1RIWB 1SFQB 2HNTF 1ELVA 1PPBH 2GZ7A 1QJ7B 3E91A 4MDSA 3QGNB 1Y3WA 4NWKA 3RMOH 5I25A 2VIWA 1HAXB 2GMTB 1AB9B 1IQHA 1SGQE 1A0HB 4X1SU 1GJ7B 2CJIA 3V12A 2VIVA 3RMNH 2O8LA 2FTLE 1NRRH 1HUTH 1P2KA 4AFZA 2XBVA 2HGTH 2BDIA 2C8ZB 3RM0H 1P12E 3PROA 4NSYA 1MZAA 4LZ1H 3S69A 3GY8A 5A0CA 4MNWA 1CHOF 3MMGA 4WJG2 3STJA 3ZVAA 4F4OC 2GKVE 3DFLA 1CGIE 2R0KA 5JBBS 4ZH8A 2G81E 2CXVA 4X2WA 2PKAA 1GBDA 2FDAA 2ILNA 4ABAA 3MI4A 1TWXB 3FFGA 3M7QA 2H5CA 1BOQA 1K28D 2ANYA 1BA8B 4UD9H 3KF2A 2VH6A 1HCGA 5K0HA 1BTYA 1GDQA 3SGBE 1HIAA 2SGQE 5A8XA 3VB5A 2Y80A 1O3HA 1QB6A 1BHXB 3SUDA 4GAWA 1C1TA 1AVXA 1QURH 1CO7E 1CA0B 1EUFA 1QIXB 4MLFB 3OYPA 1C2IA 2EA3A 2H2ZA 4CRCA 1AFQC 4A1XA 1X7AC 1WV7H 1GMDG 4ABBA 4MNXA 2Z9JA 1QCPA 2BVXH 2UUJB 4YT6H 5E2OA 2BDCA 1ETRH 1LKAA 2FOHA 3SV6A 1FONA 2A2XH 2ZECA 1T7CA 2C8YB 4FVDA 2FX6A 2J9NA 1SR5C 4BAMB 1U6QA 3E0NB 5EQSA 1O2ZA 3I29A 2STAE 8KME2 2GZ9A 3A82A 1FY4A 5H4IB 4LZ4B 3DHKH 2BOKA 5A8YA 1B0EA 1SGDE 1O2UA 1JOUB 4HGCA 1CA0C 1P2QA 4K2YA 2F91A 4KTSA 3SJKA 1AMHA 2UWPA 2PGBB 1H1BA 1DS2E 3UFAA 3PMHB 1AUTC 3B8JA 3DT0H 4WY3A 3FVFB 2Y7XA 1EAWA 3O8DA 1QRXA 1BTZA 1B0FA 3PMJA 2BDYA 2F83A 2GT7A 3P8OA 2AFQB 1KTSB 2BVSH 3IG6B 2J2UA 2OQUA 3LONA 3EDXB 5GPIB 1GBIA 2D8WA 3N7OA 1G2MA 2A5IA 3BG8A 3GY7A 1ZMNA 1C1WH 1C5VA 2J95A 4R8TB 5J4SA 3HGNA 3UOUA 3DD2H 3M3VA 1GBJA 3ESTA 2ZZUH 1QJ6B 2CN0H 4CRFA 1AZZA 3SU4A 1YCPH 3MH6A 4TY6A 2D26C 1F5LA 2V0BA 5F03A 2J94A 3VGCB 2ZDVH 2Y5HA 3U1JB 1ZRKA 1A4WH 1VCWA 2Z7FE 2ZIQH 3SU6A 3URCA 1NESE 1ORFA 1NTPA 1UVUH 3UREA 1PQ7A 1THRH 1TNJA 1ZSJA 2BD8A 4WXIA 2H9EH 4DIHH 1S81A 4GCHG 2PKSB 3ZYDA 2JH0D 4GVUA 5DK1A 2P3TB 2ZQ1A 2ZDMA 1KLTA 1LMWB 2VJ1A 4E7NA 1O2WA 3RXGA 1XVMA 1KXEA 3T5FH 4HFPB 5C2ZA 1P8VC 1EB1H 3ZVGA 4GPGA 2THFB 2I6SA 1TBRH 3BTME 2GP9B 2BD7A 2P3FH 1T8MA 1NT1A 3PTBA 1BUIA 1QNJA 2CGAA 4ZAEA 5HXFA 4DURA 1OKXA 2PWXA 4TWWA 1GMHF 1HLTH 5T6DA 3UPEA 2OQ5A 2BDAA 5LPFA 3GY6A 1A0LA 1DX5M 2VIOA 4CR5A 1AE5A 1ETTH 2ALVA 2XW9A 4UONA 2JETC 1CT0E 4D9QA 1A5GH 2PUXB 1SC8U 2C90B 3O8BA 1OYTH 1V2RT 4BXWA 1C1RA 1AI8H 2GCHG 1V2JT 3A7ZA 3NUMA 3ZVEA 1F5KU 1SHYA 5L30H 1SGRE 3BTWE 4NA8A 4BANB 2FESH 1UK3A 1P11E 1TYNA 2ZU5A 2ZHFH 1GI2A 1V3XA 3V0XA 1HAHH 3S9AA 1NS3A 1QBOA 1SGTA 2XBYA 1IQNA 2ZWLH 2PR3A 4SGBE 1D3QB 2BM2A 1BTXA 4JYUH 2ZDAH 1LCYA 1YKTA 1JXPA 3TVJB 1PYTD 1OPHB 1GG6B 4I8LA 3MYWA 3LGWA 4OS5A 2AERH 2P59A 1RJXB 3GICB 3KIDU 3LOXA 3M3SA 2LPRA 4ABDA 1QA0A 1D6WA 1T8LA 1T8NA 1P05A 1PPHE 2FOMB 3D65E 3T2NA 5A8ZA 4Y8ZA 1GGDC 1O3AA 1TOMH 1AO5A 5BPEA 1GJ6A 2BXTH 3ATKA 2RDLA 1TPOA 1SLXB 1YP9A 1MU6B 3MU5A 1GCTC 2SNVA 1T32A 2UWLA 3S7HB 7LPRA 3GCOA 4GHTA 2QIQA 1LQEA 2VH0A 1W14U 3MU4A 2SGAA 1O3EA 1TB6H 1ESBA 3OX7U 3SI3H 1Z8JB 2V6NA 4X6MA 3AVZA 1XKBC 5EQQA 3M36A 1C2HA 3RP2A 1GMDF 3U1IB 1DITH 3M7UA 2ZHWH 1O5AB 5LPRA 1C5WB 3ENSB 1C5ZB 2FM2A 1O30A 1UK2A 2GT8A 1BRAA 1O37A 3EQ0H 2Q1JA 3QO6A 3QUMP 3A83A 4I7YH 1L1JA 4VGCC 2BYAX 2CHAB 2XC5A 4UEHH 2C3SA 3ZV8A 2DE9A 4A1VA 2VINA 1ZPZA 4WXVA 2H6MA 1ELEE 3SNDA 1N8OC 1O5FH 3L6PA 4AFSA 3PWCA 5ESBA 2ZHQH 3MFJA 3KHVA 2OXSA 2VIQA 3ELAH 4UFGH 1GHYH 2AH4X 1OWIA 2O9QA 3V3MA 3TJVA 1W13U 3TH4H 4YOJA 2BX4A 4BAHB 2G00A 1DICA 1GJBB 1N8OB 9ESTA 3PMBB 3TH3H 2ZI2H 2C8WB 3K6YA 3RC5A 1OP8A 1ZLRA 2D2DA 4X6OA 1N1LA 3RXSA 2ZCKP 3RMLH 1C2LA 3QLPH 2A1DB 2ZDLA 4A1TA 1KLJH 4YOIA 1ZSKA 1O3KA 2F9VA 2FOGA 1TABE 2HALA 2HNTC 1TALA 2ZGJA 2F9UA 1NY22 1VCPA 4JZIA 1OXGA 3VPKA 1TX8A 3A81A 1O2YA 1H9IE 4ZHAA 1O5BB 1JIRA 4MG3A 1THSH 2NU3E 1GI8B 1IQMA 4FUIA 1AUJA 1L4ZA 1GVLA 5T6FA 3SV7A 1GI6A 1TMBH 3M5NA 1V2QT 1SQAA 3SHAH 1SGNE 5EXNA 1BBRH 3E3TA 3UIRA 1P9SA 1DOJA 3A8CA 1SI5H 3QGJA 2VIPA 3TJUA 5TCAA 1O5DH 1O3GA 1P3EA 1GHBG 2FYRA 1XM1A 1RTFB 1QTFA 1SQOA 4X8UH 3MH5A 1ACBE 1DUEA 5A0BA 3RLYH 4WMEA 2ZFRH 2QV1A 3GCHB 1ANCA 1C2KA 3OY5U 3A7YA 4NFEA 4CHAB 1K1MA 3BIUH 3U9AH 6ESTA 1ZOMA