3GYCA

Crystal structure of putative glycoside hydrolase (yp_001304622.1) from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
381
structure length
381
Chain Sequence
EISPRAITMWDFSWLERRWPGAGYEDWDQVLDELSERGYNAIRIDAYPHLIAENPMKKWLLKEVWNQQDWGSPDMNEVQVQPNLNLFLSKCKERDIKVGLSSWYRLDVDEVCLKLDTPEKLADCWLTILRSIEEDGLLDTILYVDLCNEWPGDSWAPFFAKTYPNVGWGNWYKEESLRWMKTSLEKMRQVYPDMPFLYSFDHGDVKKYEEVDCSFLDLYEHHIWMAQQNGGEFYKLVGYGYNRFLPDDYKNVVKNAERVYRERPGYWQKLLTDKIELMASVARKNRRPLVTTECWGLVDYKDWPLLKWDWVKDLCELGTITAARTGMWVGVATSNFCGPQFAGMWRDVEWHKRLTSIIRSSPLDESLTKNNEVAAKLLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glycoside hydrolase
publication title Crystal structure of putative glycoside hydrolase (YP_001304622.1) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Hydrolase
total genus 158
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12876 Cellulase-like Sugar-binding cellulase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gycA00
1G5AA 1VEMA 3ZJKA 3BC9A 1XSJA 2PI6A 3DHUA 4GI8A 4J3SA 4PEEA 3HU7A 3WDJA 4LYPA 1JFXA 1W1TA 3GTNA 3T0AA 2NT1A 2Y2WA 1XCWA 1OBAA 2OWWA 5E6YA 1CWYA 1GOQA 4DUVA 2WMGA 2NSXA 4C7GA 2G4FA 1QW9A 3BXWA 3BMVA 3POCA 5I78A 3EYPA 4IPNB 1UH4A 3GH5A 2DH3A 3SCVA 1WZKA 4R27A 1BFNA 2BHZA 4CU8A 5CLWA 1VFFA 1UR2A 1V02A 4MJ4A 2EPLX 2W61A 5CGMA 2ZE0A 2ZX5A 3CZLA 3VILA 2X09A 4TVUA 4BQ5A 3D5HA 1W2VA 3SCNA 3VGDA 2WW5A 4ML4A 3CGTA 3EMZA 2FHBA 2WZIA 1BGAA 2W92A 1EOMA 3N15A 3TP4A 4TX6A 1SYTA 4MDOA 1SR0A 5C8BB 5ABHA 1EDGA 1RP8A 4AW7A 5D9NA 3N18A 5A2BA 4D1JA 1FH7A 1H11A 1CXHA 3BMWA 1GOOA 2WAGA 2QPSA 1JXJA 4BQ3A 4ACYA 1TZ7A 3ARSA 2WCGA 4EANA 2XFFA 1O7AA 2WYSA 2VC9A 1C92A 4JHOA 1HN1A 1BG9A 4LYRA 2AAAA 5A3HA 4UZUA 5CZKA 2BY0A 4WK9A 3EDEA 1QBAA 4P7LA 3MMDA 4JKLA 2VVSA 2XWDA 1B9ZA 5I2UA 7TAAA 3WH8A 4M29A 4B16A 1DWJM 1C3FA 1BYCA 4X0NA 3VM7A 4MB4A 3CUFA 4X0VA 1OCQA 1UWQA 1ISYA 3HN3A 2BS9A 3SCQA 2AOSA 4CD6A 2VO5A 5EBAA 1KGXA 3U5UA 3ARWA 4YN5A 1U33A 3CLWA 1DWFM 2V5CA 5BRPA 3VNYA 3T0DA 1WZAA 2ZUMA 1HJWA 3CMGA 2RGLA 3QHOA 3OB8A 3CZEA 5GPRA 2E0PA 1W2PA 1B2YA 2EXOA 3GBEA 3IAQA 1V3MA 2WHJA 4HA3A 5CGTA 1UZ1A 4GI9A 4JCLA 3A4XA 5I0DA 3GYCA 3GZAA 3CPUA 3ZR6A 3NUKA 1E43A 2J7FA 3PZQA 2ZUUA 5A8MA 3AHZA 1HL8A 1PIGA 4AMCA 3UR7A 4Q7NA 4U2YA 3BH4A 1IV8A 5JBEA 2X8RA 3OLEA 1EHNA 1KCLA 1OT1A 2PWFA 2XIBA 3VD3A 1BYDA 2VVNA 3OGSA 6TAAA 2WC4A 4D71A 2VRKA 1WZMA 2WKGA 1C90A 4QAWA 2XTKA 4GXPA 3RJXA 1CZ1A 2E9LA 3G6MA 3OA5A 2G3MA 4KGJA 1VBRA 4U31A 1BYBA 2HISA 5M3WA 1G1YA 1FA2A 1CNVA 1QPKA 1GQIA 3L4UA 2GUYA 4PSRA 1KXVA 2A3HA 1BQCA 4BS0A 5BWFA 1BHGA 3T0BA 2GK1A 1VAHA 3L4TA 3WN6A 2PWHA 1E0WA 5BXSA 1JYVA 1E6XM 3WDHA 1ZBCA 4PMUA 1XD0A 3VUPA 2BVDA 4WSJA 4R5EA 4H8VA 5I79A 2XUCA 4AZ6A 1JZ3A 2VX6A 2ZX7A 4QFUA 3PZIA 5CSUA 3MV11 4URIA 5E0FA 4MNMA 4W7WA 1OT2A 3ZSSA 2DSZA 2YL9A 3EMCA 4W87A 5JBDA 1C7SA 3AS0A 3VIOA 4KRTA 4J3VA 2YDSA 2PWDA 1W9PA 2VNCA 2YA2A 3POHA 2GDVA 1W9BM 3IJ8A 1GUVA 2Z1SA 1H1NA 2W5FA 1UA3A 2DSWA 1FH8A 3E1F1 5D4YA 1P6WA 3IAPA 4WIWA 4K68A 1KGUA 4MNKA 4UNIA 4FLQA 1W9VA 3WQVA 4MJ2A 4U3AA 2J8FA 5HNNA 3M46A 1M01A 3AQUA 1TFVA 3FHAA 2FHFA 1C8QA 4IUGA 4D1IA 1E0XA 1VJZA 3JUGA 1O6IA 1LF1A 1Q6FA 5LYRA 2E40A 2ZUWA 1EIBA 2VT0A 2GVYA 2TAAA 1VIWA 2VUYA 2WZEA 1UWIA 1ZJBA 2WWDA 1DP0A 1W9UA 4M1RA 2XSBA 4S3KA 1C91A 1PX4A 3WD4A 1WDSA 4XZWA 1HT6A 1E56A 3FXYA 1B0IA 3O6AA 3WKZA 2WPGA 3B9AA 2XM1A 3WNKA 2WHKA 2YJQA 3WQ6A 3SCPA 3NJ3A 3VIFA 1E40A 2BHUA 2EQDA 1I75A 1UR0A 4PMNA 3VKKA 4MB5A 1E72M 4AZIA 4H04A 1ZBKA 1MXGA 1TCMA 2JIEA 1E6ZA 3L4ZA 3VIHA 1JZ5A 3M6DA 2Y24A 5I5RA 1GVIA 3WELA 4ZENA 4UFIA 1BSIA 1SMAA 3N1AA 2J74A 1E1FA 3N04A 1GHSA 1TR1A 1GOIA 1J10A 1JL8A 3AJ7A 3L4WA 2B31A 3AIRA 4W8BA 3AIQA 1ODUA 1BYAA 1PJ9A 3CH9A 2ZUSA 1PAMA 4PMQA 1Q6CA 2ZXAA 1XD1A 3VDAA 4OBSA 4M82A 3SCWA 2WHLA 2W66A 2YIHA 3SUSA 1XV8A 3I3DA 4DM1A 5M5DA 1ZS2A 4RE3A 4UOQA 4AZCB 1WCGA 1Q6EA 3ZIZA 1QHPA 2DT0A 4NZCA 2JEPA 2OYKA 3BLPX 2F61A 3L2LA 2VX5A 1KWGA 1GCYA 4HZ6A 1ZB5A 5ABFB 3S2CA 5F7UA 1PIFA 1CBGA 3CZGA 1UA7A 1TVPA 4P8WA 2YA0A 3PZOA 1XRVA 4WLCA 3ZJ7A 3W82A 3F4VA 4Z2JA 4WSKA 2VTFA 4F66A 3FY1A 4F8XA 1E9LA 4J3TA 1B3XA 3EBVA 1WPCA 5A8QA 2V38A 3WENA 2WC3A 3CHCA 4MNJA 3CO4A 2D24A 1G94A 1TA3B 4DM2A 4ZFMA 3PZMA 2BY1A 2WWCA 3WD2A 5AYIA 2J8GA 3WUFA 1J12A 2J78A 2XM2A 3MKKA 2HVMA 4HMDA 1BGGA 3CZKA 4P8XA 3OG2A 3ZM8A 3ZR5A 2XGIA 4XUYA 1CYGA 3G6LA 2J7GA 3W25A 3AS2A 1CGYA 1M04A 3BCDA 3OGVA 4Z2GA 4DUXA 2E9MA 1ZU8A 2C0HA 1RPKA 1KWKA 1ITCA 4CGTA 3EDKA 1JI2A 5DFAA 4QLLA 1FH9A 1V0LA 1JZ6A 4AD3A 2Y8VA 1LWJA 3UG4A 3WD0A 1W1VA 1EO5A 3K8KA 1WDPA 3GXMA 3AFBA 3W53A 2W4XA 2VZVA 4MDPA 4J28A 3A3HA 4JKMA 5LA1A 3ARPA 2XVPA 3B9DA 1LLOA 3ZO9A 1WZLA 1V6UA 4KWUA 2DQXA 2V5DA 4YHEA 4BF7A 3VTRA 1K9EA 4H8UA 1K9TA 2QPUA 1JIBA 2EPKX 1Q4NX 4E8DA 2Z1KA 5KEZA 3J7HA 4D72A 1HP5A 2A3CA 4UR9A 4UQAA 2VMFA 1LL6A 3VO0A 4TTUA 1OD0A 1UD5A 1GJWA 3THCA 5HPOA 1XSIA 5DO8A 4IPLA 1NWRA 2D23A 4PTXA 5CPQA 3TTOA 4AEFA 1GHRA 2FH8A 3RM9A 1H09A 2J75A 2WXDM 1OWQA 5A6AA 1B30A 4JFVA 3VD9A 3AIWA 3AS1A 4H7VA 1QBBA 1DWAM 5D9OA 3UG5A 4NSBA 2CBUA 3GM8A 4HMEA 2CYGA 3PZGA 3AMCA 5JBFA 1KQYA 4PMRA 5CLTA 5AC4A 3NSMA 1HX0A 1J0HA 2CKRA 1XGZA 1XCXA 3B8SA 4OZOA 5BXRA 3U5YA 2PC8A 2UWFA 2CXGA 3L4YA 1E6PA 2J47A 3LPFA 4W5ZA 3RILA 2W62A 1E4LA 1R86A 2XG9A 2BXYA 4FLRA 1H41A 2J7DA 2FGLA 4D6HA 4AD5A 3UG3A 1CGWA 3AMDA 3HJEA 3OGRA 5HDRA 4AZ7A 2EPOA 4XZBA 4GZEA 3WF2A 1JYWA 3EDJA 3NSNA 4U5IA 1OGGA 1MYRA 1Q6DA 2E8ZA 4YHGA 1C8YA 2XJ7A 1GOMA 2E3ZA 5FIPA 3W24A 4RE4A 3GNPA 4W7UA 3QOMA 1KCKA 4Z2HA 1OGSA 4PSPA 5HOSA 2DT1A 3W0KA 4W8AA 3KL3A 4PRWA 1W3HA 3AZTA 1XC6A 5GNYA 3SUVA 3WQWA 1CXEA 3WFLA 2DT2A 3IJ7A 2W67A 5M17A 1KFWA 3AXIA 1XH2A 5CXPA 3SCOA 2D20A 3WL1A 1V3KA 2YL6A 2OWXA 1JDAA 1UD4A 3MUY1 3MU7A 4JL1A 4WKAA 3QHNA 4PBGA 4CD5A 1GNXA 2D3LA 4E8CA 4LXFA 2G41A 3AHVA 1SMDA 1UWTA 4PUDA 5I6SA 4JFSA 3U7BA 2XVGA 3VGBA 1GW1A 5A94A 4AZCA 3WDPP 1OIFA 1MW0A 1BG4A 3BAIA 3PBGA 1V0KA 3OLDA 2JE8A 3ARTA 4KH2A 2QV4A 4AZHA 2ZICA 5ABFA 1E1EA 5BXTA 1HKIA 2WHMA 1H5VA 1UQZA 4BCEA 1H2JA 1MFVA 1CENA 5CG0A 3W26A 1VFOA 1JDDA 4FMVA 2VJXA 2DT3A 1FOBA 4GKLA 1AQ0A 3U7VA 2DSKA 1ZBWA 2WLYA 2CEQA 3VDHA 2EO7A 1VEOA 4EKJA 3AMLA 1W1PA 4CN6A 1ISXA 4PTVA 1UD6A 1HKKA 2BY3A 1HL9A 3WEMA 1WP6A 2V3EA 3VIJA 1OSEA 4U5KA 4CD4A 3DC0A 3UR8A 1K6AA 4HPHA 4FLOA 4DWSB 4GZJA 1VJSA 4RL3A 4HOXA 1K9FA 2E8YA 1JG9A 1C8XA 1ISVA 5ABGA 3A6OA 2CBIA 2A3BA 1VF8A 3ZT5A 1UWSA 4L4OA 3O9NA 6A3HA 3AHXA 1XH1A 1PZ3A 1UQYA 4A4AA 1MQPA 1PPIA 1QI2A 4ZXOA 3GXFA 3T09A 1BTCA 4JFUA 2CITA 3APGA 1HJUA 3RMEA 2WC7A 1YQ2A 4TXEA 2ZXBA 3VMPA 2IUZA 3PHAA 3ARVA 4B3KA 4PMXA 1GOKA 2YBTA 1RH9A 5D8ZA 4GPNA 1KBKA 1LWHA 3WSUA 2VRJA 3NCOA 3VMOA 2O92A 5IHSA 3RM8A 4GI6A 1DWIM 4AZ5A 4L4PA 3WNPA 4JZ5A 2O9PA 1J9YA 3TONA 2VQUA 1V0NA 9CGTA 1GQJA 3GNOA 1QNOA 1KB3A 4F79A 5BYWA 4TVDA 1UWUA 4HOWA 1AVAA 3L4VA 4D6DA 2BVYA 3OIHA 3VPLA 3WH7A 4P7RA 2QMJA 2EJ1A 4CKQA 2VX7A 3VDBA 3OLIA 2BHYA 3QGVA 3DHPA 1I1XA 4NRRA 3PZUA 3ALGA 2OSWA 8A3HA 3VMNA 1F4HA 3PZTA 2GJPA 1H0IA 2CETA 1GPFA 3AOFA 4UOJA 4EAMA 3VINA 3ARYA 4LGXA 3CMJA 2G3JA 5I24A 1ISWA 2JEQA 1UKPA 4HMCA 5BRQA 1SFSA 1CEOA 4ATWA 4AY1A 3WQ8A 1UHVA 1ECEA 1KXTA 1E3XA 4IM4A 4UFJA 1PZ2A 4BA0A 2XGBA 3WMSA 4DWSD 2ZUTA 2G3NA 4F9DA 3WEOA 5DT7A 4KMQA 3THDA 4E4PA 4D6JA 2QF8A 2ZWYA 5IXEA 1JAEA 1UWRA 3CBWA 1D7FA 4KGLA 4ZEPA 1HJQA 2J7CA 2PWGA 3F5JA 2ZX6A 1DTUA 3BLKA 1US2A 3AZSA 3GBDA 2WVVB 3RDKA 2WNWA 2IXUA 5JUVA 2XVNA 1KXHA 3PTKA 4J7RA 4EE9A 4JIEA 5GNZA 2DSUA 3WMCA 5CPSA 4A3HA 3WD3A 1TG7A 4XX6A 4JKKA 4PCTA 4B9YA 4HZ8A 1I1WA 4D6GA 4F9JA 4YPJA 5I3DA 3VIPA 4GZIA 3WH6A 1MVYA 3CTTA 2J25A 4UCFA 2VR5A 5A8NA 4PMZA 2JIWA 4OJYA 1NWTA 5I23A 1NP0A 1KGWA 1E15A 4GQQA 1OGBA 1E4IA 1EHAA 2UY4A 3PZVA 4QLJA 1R7OA 1IT0A 2YL8A 5D8WA 2EBNA 2OYLA 5HPCA 1G0CA 3SUUA 2QMKA 1QNQA 1EH9A 4XV0A 2D22A 3D3AA 1JDCA 1TE1A 5EFFA 3MMWA 4QLKA 4U2ZA 1OIMA 3KL5A 5IHRA 1ZL1A 1UR8A 3WF0A 5AC5A 3NSXA 4H2CA 3ARRA 1QNPA 5A2AA 4B9ZA 4WF7A 5M03A 3PZNA 2ZWZA 2D1ZA 4W7VA 3W4RA 3FN9A 2WSPA 2VR4A 3TA9A 3AYSA 1VFUA 2CESA 2V3FA 3FHQA 1H4PA 5FD0A 4QCEA 3FNDA 1HJVA 1TMQA 1V6XA 3GDBA 4QP0A 4TUFA 3VIKA 2V3GA 1HIZA 4MADA 3S6TA 2WMFA 3AZRA 3LPPA 1ZJAA 1QHOA 2WSKA 4AIUA 1GJUA 1MWOA 1VBUA 4U33A 5AYBA 3W6LA 1WAWA 4PTWA 4DWSC 1J0YA 3IK2A 1X6NA 3CUGA 4HTYA 4P7QA 4BQ4A 3VD5A 2UY5A 4TX8A 3WL0A 1PEZA 2XHYA 2D0FA 2D0GA 5TD4A 3MV01 1KBBA 3M7SA 2PBGA 1CGVA 1QNSA 1E6RA 4B15A 4V2XA 1FHLA 1FP8A 2WVTA 5E6ZA 1EDTA 4AIEA 4DWSA 3A4AA 4UOZA 3AYRA 5D9MA 3WF4A 1V0MA 4Z2IA 3RO8A 1V03A 4MNLA 4Q22A 8CGTA 4W88A 3ZQ9A 3WDRA 4FF5A 3W37A 4LQ1A 5FKYA 1GORA 4PMDA 2XSAA 1XH0A 4WJXA 3PTQA 1FFQA 2O9TA 1QW8A 4V28A 2YDRA 3MO4A 1LQ0A 4HOZA 4GO9A 3K1DA 1QI0A 1GQLA 2DEPA 1CTNA 1PX3A 1AMYA 1GVYA 2J7HA 3NIYA 3T2OA 5DT5A 3LPGA 1HP4A 3WBEA 3N17A 2QLYA 3PZ9A 2YDQA 3T2PA 3OZOA 1E3ZA 2FH6A 2VURA 1CGTA 3VGEA 5BCAA 3AIUA 3ARUA 1B3VA 4J3UA 4UFHA 1LG1A 5EMYA 3RM4A 5A6BD 4M24A 3BSHA 3N9KA 2VCCA 3WQ4A 4W93A 3BGAA 2JALA 2J7BA 4OOZA 2XYLA 1V08A 1JZ7A 3SCSA 1ZBVA 3OLGA 2MANA 4W5UA 1U30A 4D6IA 1BF2A 3ARQA 4J3XA 7CGTA 1UKOA 2FGZA 3PN8A 4HA1A 1PX8A 2BXZA 1NP2A 3IJ9A 1XYFA 3L2MA 1Q6GA 4W8LA 3MSGA 2WVSA 4BQ2A 2FDMA 1JGIA 1FP9A 2G3IA 2VQTA 5CPTA 1DHKA 1C7TA 1NOFA 2D2OA 2VL4A 2X05A 1JF5A 1R8LA 1ODZA 1G01A 2VCBA 2DH2A 1CLVA 4X9YA 4NRSA 4Z2KA 4D6EA 1M53A 4JFTA 5E0CA 4TTGA 4C7DA 2EEXA 3WMBA 1BVNP 5JIWA 2ZIDA 3AHTA 3A47A 4FLSA 1HKJA 2WZHA 2PF0A 4U3CA 1E70M 1LJYA 3OZPA 4CU6A 3LPOA 3UESA 3K46A 3KWXA 3N11A 1V3LA 2WCSA 5GNXA 4BZYA 1BVZA 1QVBA 1E4MM 1MQRA 2C8NA 1DWGM 1UKSA 3WDIA 5JIPA 4GINA 3FW6A 2WVVA 3VGHA 3SEPA 4D6CA 1IZKA 3VD4A 3WD1A 3BAJA 4OIFA 1B90A 2F8QA 1UH3A 4TVCA 1W32A 1NM9A 3CHFA 4UQ9A 3UETA 1CDGA 1UG6A 4LPCA 1J0KA 1V6YA 3AICA 2X1IA 2ZX9A 1J0ZA 1JXKA 1G9HA 5A1AA 2WMIB 4AWEA 3RCNA 3NDZA 2DIJA 4LYQA 4UFLA 5BROA 3T2QA 1UD8A 3PTMA 1GONA 1UZ4A 2V3DA 4J3WA 1NWSA 1V6VA 4EK7A 1XHGA 1WDQA 4OKDA 4GQRA 4AYSA 5C70A 5EFDA 4KRUA 3VX1A 3F5KA 1E73M 4UQCA 3NYDA 1V3JA 1CLXA 1HKMA 1Z32X 3K4AA 2WANA 3F5LA 3KZSA 3VVGA 1JFHA 1BPLB 2GJXB 1VB9A 5A6BA 2ESCA 5A6MA 2VZTA 4S3JA 1CXKA 4OBRA 1CIUA 1FFRA 2D3NA 3VGFA 2J4GA 3AISA 1NWUA 6CGTA 1GOWA 2W91A 3ZT7A 3W28A 1E6SM 1CXFA 2YBUA 1OM0A 4W85A 3CZ8A 2UY3A 4RE2A 3UCQA 2ZXDA 1QI5A 1EXPA 3WFZA 5A8PA 2WLZA 5A2CA 1MFUA 1J0IA 4GIAA 2WCAA 3HMCA 3SUTA 5A69A 3TTQA 3TTYA 3WY1A 5IFPA 1AQHA 3W38A 3WDQA 5A8OA 5A95A 1D3CA 2ZUNA 1TA3A 3K4DA 3M07A 2CBJA 3WNLA 5LA2A 3BAKA 3CUHA 2CIPA 1LL4A 1EA9C 4AD0A 4IISA 2WM0A 5DF0A 4ZE5A 1GQKA 1NARA 3BAYA 1WKYA 2NW0A 2JFEX 3BAXA 1V3HA 4H41A 4NF7A 2XIIA 3ZOAA 3EDDA 3WH5A 3VX0A 4Z2LA 2BNJA 4AC1X 1US3A 4QCFA 4OOUA 4D6FA 1FHDA 4UFMA 2UY2A 3SURA 2ZX8A 4JL2A 1HJSA 3VIIA 1MXDA 4UFKA 3MSDA 4PMOA 5E70A 3WUBA 1KXQA 1EO7A 1QI4A 1B3WA 1NOWA 1RD6A 1HF6A 2BFGA 1KR0A 3AI0A 3FAWA 1QHZA 1Y7VA 1E6QM 2VRQA 4DUWA 1EOKA 4PUEA 1EGZA 4UQBA 1JZ4A 1VEPA 1CXLA 5CJ5A 1UR1A 3CHDA 4HP5A 3K8MA 2VX4A 4C7FA 4PTMA 5A6SA 1E5JA 2DSVA 2G8ZA 2PBOA 3ZJ8A 4P7OA 4OUEA 2A3EA 5E9AA 1E6NA 1UKTA 1MW2A 3QHMA 3WUGA 4PN2A 2EPNA 4MTVA 1X6LA 3W27A 2VZUA 4MB3A 1F4AA 3GH7A 2CHNA 1XSKA 4JHZA 2DDXA 2RGMA 2BY2A 3GNRA 3MUAA 3WF3A 4CN4A 3GH4A 2X0YA 3N13A 3WUEA 5LA0A 3AMGA 3VDCA 4CCCA 3A4WA 4ACZB 2VZSA 2BVTA 1L0PA 2OLHA 2VZOA 1HNYA 5FCZA 1UR9A 3SIMA 4AIOA 4E2OA 2FHCA 4QDMA 3VD7A 2Y8KA 4CCEA 1V02E 3MMUA 2GFTA 3AS3A 4AD2A 3ARXA 1C93A 1OB0A 4AISA 3VNZA 4GO8A 3CUIA 1CPUA 4CU7A 3WNMA 2J62A 1UD2A 1W3JA 4ZE4A 1MQQA 4HA4A 3MUZ1 2GSJA 3QR3A 3L4XA 3SUWA 4AXNA 1B3ZA 1L8NA 2QHAA 2DPEA 2ZXQA 3AIEA 4M8UA 2WMJA 1M7XA 3AIVA 4AD1A 4HU8A 1UKQA 2CKSA 3ECQA 3VIMA 4TOQA 1JD9A 1OD8A 1E71M 2E9BA 1TVNA 5ABEA 3VM5A 2WB5A 4M80A 1JZ2A 1NOUA 4LX4A 3WNNA 5HBFA 1JYXA 1EQCA 4MPKA 4HPGA 2NT0A 1QOXA 2WBKA 2X2YA 3I3BA 2WMIA 5FOOA 1N82A 3SCTA 1VRXA 2PB1A 4PYSA 3UEQA 1E4NA 2AMGA 1JD7A 1UR4A 1EQPA 1HVQA 1J11A 3W29A 3W81A 4CD7A 2ZUVA 2A3AA 4P7NA 1NQ6A 1PBGA 5CQ1A 1E0VA 3OBAA 1WE5A 1A3HA 3KEHA 1JF6A 4CVWA 4B3LA 1UD3A 2EPMX 4HU0A 3VGGA 1NH6A 5DEZA 3ZMRA 5A6LA 3B9EA 1UYQA 3CIVA 1TUXA 2J7EA 4Y7EA 2YA1A 1CGUA 1H3GA 1VENA 4J27A 2XWEA 3DYMA 1S46A 2GJXA 2XPKA 4WKHA 4CN1A 3AXHA 3DECA 1WNOA 3ARZA 2YLAA 5IDIA 7A3HA 2J77A 3VOCA 1W91A 1R87A 3CHEA 2OWCA 1WDRA 3AROA 4UTFA 3ZT6A 3GXDA 4W89A 2J79A 2Y5EA 3EDFA 3TOPA 2X0HA 5E09A 3AXXA 1JZ8A 2BV9A 2YLLA 3QOKA 1MW3A 1YHTA 1BLIA 1QI3A 4AD4A 3K8LA 5FL0A 3T08A 3CZJA 1W3LA 1GZJA 1IZJA 3GXIA 2W63A 4PCSA 3BSGA 4UZSA 4H8HA 1ISZA 3EMQA 1D2KA 3UERA 4CUCA 1HXJA 4HZ7A 2YKKA 2DGAA 2DIEA 2WBGA 3WIJA 3TTSA 3KL0A 1HJXA 1E5NA 1J0JA 4UQDA 1MW1A 1W9XA 5GQBA 3ZJ6A 1R7AA 3WH9A 2OYMA 1UUQA 1J01A 3DYOA 3NDYA 3WQ5A 1AQMA 3WF1A 2WKLA 1WB0A 2GJRA 3W6MA 2E4TA 4AZGA 1B3YA 3AIBA 5CSYA 2VOTA 3BAWA 4ATLA 5FL1A 3MANA 5I77A 4JCMA 1RP9A 1UH2A 1V6WA 4PMVA 4CVUA 1BAGA 2ZOXA 4MB1A 1CXIA 1QNRA 1XYZA 2CNCA 4JFWA 3DYPA 4M56A 5HXMA 2IXVA 1JI1A 2PWEA 3AHYA 2O9RA 1OINA 2WVUA 4CD8A 2OSXA 3VIGA 1X1NA 1WO2A 1VFMA 3II1A 5EB8A 1ESWA 3RIKA 4V27A 4W86A 3SCRA 4UQEA 3MS8A 1DWHM 3RPMA 3RJYA 1ITXA 2WMKA 3MUIA 3WEZA 1LG2A 1M03A 5DMYA 4FK9A 2F2HA 1JNEA 3WNOA 2XFRA 4M81A 4P8UA 3AMKA 2GDUA 3ZSTA 3KE0A 3WBAA 3FAXA 1W1YA 1DEDA 2XFYA 2CPUA 3BCFA 5ECUA 5BXPA 3VU2A 5C71A 2C7FA 1LL7A 4MAVA 3CUJA 4AEEA 2O9OA 1CGXA 2Q8XA 1JYNA 3IANA 1U2YA 4WKFA 3U57A 1B31A 1A47A 1H49A 2WMHA 5AY7A 2YOCA 4MAZA 3N12A 5A6JA 2GK1B 2OSYA 3SCUA 2D0HA 2JF7A 4ACZA 3I3EA 1H0GA 5KZ6A 5D9PA 4A3YA 4NI3A 1W9DM 1JAKA 1CECA 4JAWA 5IFTA 1K9DA 2VI0A 1JNDA 5A6KA 1J18A 4ATDA 2CHOA 4ZXLA 1R85A 2XVKA 1HVXA 2CERA 1UOKA 1KR1A 3LMYA 1KQZA 2JF6A 4N42A 2CBVA 4PMYA 2CCRA 4P8VA 4W84A 2YL5A 2VCAA 2WK2A 3ALFA 2Y4SA 1W3KA 4N0RA 1E55A 4XB3A 4CCDA 2XVLA 1B1YA 3O2LA 1EDQA 4AZBA 1V3IA
chains in the Genus database with same CATH superfamily
4O18A 2PC4A 4GI8A 2PI6A 2OU4A 4LYPA 3MWCA 3T0AA 2NT1A 1R9XA 4DEFA 1VLWA 4OFCA 3MA8A 1FWBC 5FJJA 1EWEA 3GXTA 4NAFB 4HNUA 1V4YA 3L66A 4C7GA 2Z26A 2PE4A 3LHVA 3VZZA 2OGJA 1JRCA 1ZPTA 1R2TA 3O3RA 3W7KA 5JVLA 1W1ZA 2ZZ3A 3SCVA 3LEPA 2HNHA 4R27A 3GVQA 4JTDA 4CU8A 4QG9A 1V02A 2EPLX 2ZE0A 1IIGA 4M6PA 3BJTA 3W7NA 1JDEA 2PU1A 2FHBA 3UT0A 1SYTA 4MLJA 4ZGYA 2FFIA 3BCJA 3NO3A 1RBAA 5D9NA 5CBIA 3GU2A 5A2BA 3IUIA 1FH7A 1CXHA 2EKGA 2WAGA 2QPSA 2I5GA 4GWEA 4L65A 4GACA 4XD5A 1TZ7A 4LY8A 5KITA 3C2OA 2BY0A 3EDEA 2HXTA 1QBAA 5LHEA 3HQNA 1P0NA 4BK9A 1P6BA 2GVEA 1QPRA 4OT7A 1RY8A 1B9ZA 1AG1O 3W2UA 1VLIA 3CH0A 7TAAA 3WLIA 2DZVA 4AH7A 4M29A 4B16A 1A5OC 1OCQA 1DOSA 1ML1A 3G24A 4GY1A 3M41A 2VO5A 1NAL1 3DHFA 1FRBA 3W7HA 4RNIA 4S2CA 5EBAA 1KGXA 1I45A 2R6OA 5D02A 1Y5XA 4YN5A 3CLWA 4O28A 4D9PA 2GQ3A 4F0KA 1UP2A 5BRPA 3T0DA 2ZUMA 1HJWA 4ERGA 2H9AA 3CU2A 2A7PA 4XUGA 4IF2A 4Q8UA 5GPRA 1MSSA 2C1HA 4GJJA 2E0PA 2Q3RA 3M16A 4WCJA 3ISIX 3ITLA 4DJDD 5D03A 4PRRA 1JPIA 4JY9A 3RR1A 3ITTA 4ZQNA 3K2GA 4HA3A 4DZ5A 4JCLA 5I0DA 5JH2A 3TXVA 3T44A 5HUOA 3EX3A 3BLIA 5TAOA 4DBWA 3PWAA 1GVQA 3AHZA 3LRMA 3DOPA 5CC3A 3UR7A 4MKSA 4KW2A 4U2YA 2Y5JA 3TQ0A 3AU2A 3G22A 1YTDA 4YJ5A 1KCLA 3CC1A 2XIBA 2ZQ0A 5LIUX 2PODA 6TAAA 4NJKA 2CZFA 1HL2A 1BSLA 3IPWA 4C6LA 1D8WA 3R1ZA 3TN6A 3REQA 3V36A 3G6MA 4KGJA 3N2OA 5HWJA 5REQA 1ZAJA 1MRAA 1FA2A 4WUIA 1DPMA 2DW6A 3C2FA 3TAKA 4RDZA 2FTPA 4PTDA 1J6OA 3EPMA 4RPPA 2ZC1A 2PWHA 3QFWA 4LV4A 3QW3A 2AGTA 3UWYA 1Y65A 1JYVA 5G5IA 4O19A 1W5OA 1XD0A 2PU0A 3DFHA 2BVDA 4WSJA 4R5EA 4H8VA 1EJTC 5I79A 2XUCA 3BJSA 4C90A 2ZX7A 2VFEA 4I7WA 4WHBA 5E0FA 2DZWA 5CJMA 1PVNA 2X40A 4W87A 5JBDA 1C7SA 2NQ9A 2AQOA 4J3VA 4HT3A 3WLJA 3M6YA 3MBDA 1W9PA 4H9VA 2VNCA 1FCQA 3POHA 1FUYA 3LZ3A 3D6NA 1TPUA 1WDWA 2W5FA 3S47A 4CQDA 1UA3A 3E1F1 1Q2SA 3NZ1A 3IAPA 3K5XA 5CAKA 4MJ2A 4B3ZA 3B4YA 1M01A 4IT1A 1Z89A 4IUGA 1E0XA 1VJZA 2P8BA 1TCDA 3JUGA 4N9CA 4DJDA 1Q6FA 2E40A 1EIBA 4G9PA 1ZJBA 1DP0A 4M1RA 2XSBA 4S3KA 2GGEA 2ON3A 1ZSXA 4FXFA 1B0IA 1FXPA 3O6AA 3WKZA 5GVJA 5FJRA 5I00A 1OFDA 2HMCA 3G1VA 2EQDA 1I75A 1CB2A 4XO6A 4ZO9A 4CNPA 1E72M 4YNGA 4EPDC 4GY7A 5D2VA 4NZ1A 3ITVA 1ZBKA 1MXGA 1F61A 3ITYA 4R53A 1H62A 3L65A 3VIHA 1DQXA 2W9MA 4IQEA 4LAKA 5I5RA 4S3AA 1IEVA 5FACA 4ZENA 1KKRA 2DVXA 3T1GA 2AMXA 2NLYA 1RBLA 1XDJA 3NVTA 3RX3A 3N04A 4JS3A 2B0MA 4ORMA 3L4WA 1BWKA 1BYAA 5CGQA 4HN4A 1Q6CA 1EYWA 3NURA 1O5RA 2PDCA 4X60A 4OBSA 3QBUA 5C5YA 4UTIA 1ECQA 4ICMA 5D2XA 3T0CA 1XV8A 3W7RA 4LEQA 3OU8A 4Y6GA 3I3DA 5M5DA 4PUNA 1F3TA 1NU5A 4UOQA 4E6MA 1Q6EA 5FEXA 4NZCA 2OYKA 1PTDA 3BLPX 2P88A 2FTWA 5ENLA 4ADTA 8XIMA 1UA7A 1TVPA 6TIMA 3PZOA 2YW4A 1TV8A 2PDXA 3ZJ7A 2PP1A 4NY2A 3F4VA 4O1BA 3SY8A 3DFNA 3HA1A 5A8QA 3Q67A 4QM1A 1XLEA 2P3ZA 1I2NA 2CWXA 3OO2A 1XLHA 4S39A 3OZYA 2BY1A 3GW3A 5DANA 5AYIA 4Q4OA 2XM2A 2HVMA 1BRLA 3TTEA 3PANA 3W1NA 2VM8A 1F8IA 4P8XA 4XUYA 1W5QA 3G6LA 2X7VA 1M5WA 1CGYA 2F2KA 4KCTA 3LG3A 3GTXA 2C0HA 3T9PA 2QCDA 4YVPA 1KWKA 3E3HA 2VEMA 4O13A 3ES8A 3Q45A 3GFYA 2Y8VA 4XAYA 3WD0A 1W1VA 4FHAA 3GXMA 3INPA 3P6LA 2VZVA 3ARPA 3DU0A 2WZTA 1V77A 1U83A 1GTHA 2QCFA 2A79A 4NJJA 1EL3A 4Q32A 5F1VA 1NSJA 1V6TA 2R8WA 4DAFA 3AXKA 4PRTA 2YYTA 1Q4NX 4E8DA 2OZ3A 3I7QA 3SIZA 1UW9A 3V3WA 3VO0A 4TTUA 1OD0A 5FAJA 4JN7A 1GJWA 2DVTA 5HPOA 2O4QA 3S1VA 3L0GA 2Z1VA 5ECVA 1AL8A 1XYMA 4IPLA 1NWRA 4C91A 2D23A 3UNTA 2Y6ZA 3LCLA 1GHRA 2FH8A 3KZPA 2J75A 3NOYA 1SQ7A 4V1YA 4F3HA 3VD9A 2C16A 1X8FA 1TPH1 3AIWA 3AS1A 1YTEA 3CJPA 2EPHA 1FVPA 2WKJA 3GM8A 3A9IA 2CYGA 2Y7FA 4B5NA 3OVQA 3SN1A 2P50A 4PMRA 5CPNA 2PZ0A 1QK2A 4F0HA 2DUXA 3CQ0A 1KRMA 2LLEA 2RDUA 3IUDA 1J0HA 1VRDA 3B0XA 4G7EB 2CKRA 5LNUA 3R12A 2PC8A 3L4YA 2W62A 1LCOA 1R86A 1V51A 3XIMA 2BXYA 4FLRA 5I3IA 1YADA 1XUZA 4D6HA 2AGKA 1GOXA 1KLYA 4XZBA 1JYWA 1PWMA 3KHDA 3EWBX 2IS7A 1DVJA 1C8YA 1IHIA 2XJ7A 3VABA 3KCLA 3W24A 1AD1A 2A2IA 3GNPA 3QOMA 1KCKA 3OHMB 4OU1A 1OGSA 4PSPA 5HOSA 1X6UA 2J88A 1WV2A 4OVXA 2GOKA 4LALA 4KESA 5H1WA 1W3HA 3UFYA 1XC6A 2J9YA 3SUVA 1RBOB 1A5NC 2W67A 1KFWA 1XH2A 3SCOA 2D20A 3WL1A 3P14A 3STPA 1YBQA 2RDTA 4WKAA 4JL1A 3JS3A 3OVPA 4XSLA 4CD5A 4PBGA 3WLQA 4E8CA 1EA0A 2G41A 4PUDA 1TJRA 2YX0A 5I6SA 1GKPA 4JTEA 1LQ2A 1SJAA 2XVGA 3LXBA 4RZ5A 4NX0A 1OIFA 1BXNA 5HULA 2HSAA 3PBGA 1U5JA 3S5YA 4BEQA 1H1ZA 5ABFA 2WHMA 3UW6A 4PFHA 2PRHA 1CENA 5CG0A 3W26A 1YXCA 4FMVA 4A21A 4NAEA 2AKZA 3KVKA 2DT3A 3SECA 5PTDA 3C2VA 5EMMA 1DJZA 3C8FA 1ZBWA 2O7QA 1VEOA 4QDPA 1MEWA 2QDGA 1VKFA 3VK5A 4CN6A 5I09A 4HNOA 3A9BA 3VFCA 4XAPA 3MJYA 4C6EA 3TSBA 3R10A 2C1IA 3DC0A 3UR8A 4KEUA 4GZJA 1VJSA 2JGYA 4EAYA 1ISVA 5ABGA 1JCLA 4UTLA 4AMAA 3L68A 2CBIA 2A3BA 2PLKA 1XC4A 2J24A 2OCZA 3WJWA 3AHXA 2PSNA 4LS2A 4YTSA 4WGXA 3B97A 4QRNA 1QI2A 4ZXOA 4RZ6A 3D0CA 4AU0A 2CITA 3APGA 4J1OA 1HJUA 1DQUA 2QJIA 1YQ2A 3VMPA 3ARVA 1GOKA 5BU9A 1RH9A 2G0WA 3UR2A 3DBPA 4GRSA 4WOQA 4H1ZA 5CPLA 3WSUA 5HWMA 4ZTYA 3U4FA 4XZIA 5KSWA 4AZ5A 2CLMA 1XIMA 1OF6A 1M3UA 3TYZA 2IKIA 2NQ5A 3GG1A 3EXTA 5BYWA 1NFGA 3SY1A 2BWGA 3S2MA 1XCFA 3DN5A 3M9YA 1K70A 1ZCCA 2XN0A 3QF0A 2EJ1A 4CKQA 4HA0A 3BGJA 4IJBA 3L5MA 3SRDA 3TX9A 3W7QA 3DHPA 3MHGA 1I1XA 1B57A 2OSWA 8A3HA 2GJPA 3GG8A 4I3GA 1GPFA 4EXQA 3AOFA 4UOJA 5HMDA 4F2UA 4IMFA 1VFTA 5K4ZA 4NQ1A 4AY1A 1ECEA 4E5TA 1E3XA 2Y7GA 4DWSD 3WMSA 3C61A 2ZUTA 1KV5A 4AUBA 3HG3A 4E4PA 2WPBA 1VC4A 2PF8A 3V7PA 2ZWYA 5IXEA 1D7FA 1HFBA 1TYGA 4KGLA 4X2RA 4LUIA 2ZBTA 4PR4A 1DTUA 2J6XA 2Z1XA 1US2A 3BWWA 2WVVB 4JIHA 2KX9A 2DZTA 4RKAA 2GUUA 5DCDA 4WXZA 3WMCA 2I1OA 3B8UA 5KETA 2F9RA 1CX9A 4B9YA 3EX6A 3LCFA 5L9FA 4NNAA 4YPJA 4MUZA 3PC0A 3FS2A 4GZIA 1RR2A 5FI8A 1XQLA 2XIMA 4DUOA 1T6MA 3CTTA 3G5EA 1VFHA 4C60A 5HQEA 2JIWA 1TMLA 4OJYA 3N6JA 7REQA 4PBEA 1KGWA 1W56A 9XIMA 3TCEA 3T4CA 1YDYA 3EAUA 6PTDA 2YL8A 4KEMA 5D8WA 3URNA 1LOLA 5LGXA 2FVMA 1EH9A 3D3AA 2EG6A 2E5CA 4PC8A 2OO6A 4DXKA 2V68A 3C52A 4EPEC 1DKWA 3ARRA 1QNPA 4XVDA 1P4CA 3ANUA 4JIIX 3U48A 3URAA 5M03A 4ZO8A 1GGOA 4A05A 3W4RA 4EX4A 4GUGA 2VR4A 3AYSA 3MP3A 5I3JA 2PDPA 5FD0A 1LROA 3FNDA 2CZDA 3GDBA 4QP0A 1Z69A 3RGTA 4RNFA 1AH3A 2V3GA 4L9ZA 4K37A 4DJED 1B9BA 3W7CA 1ZJAA 2FQIA 4AIUA 3TLQA 3LBOA 4IIEA 3TC6A 3TFXA 4U33A 4FALA 3SO7A 1F8MA 5TIMA 4DWSC 3KS6A 4HTYA 1YEYA 3VD5A 1OQFA 2Y61A 1JUBA 4MZYA 2XHYA 2D0GA 5HWNA 3M7SA 1PCWA 9XIAA 3RO6A 3EOOA 1E6RA 2ADAA 1N2VA 2Y7EA 4GLEA 4IG2A 4F0SA 4DWSA 3G1FA 1RHCA 4NNCA 2PLJA 5D9MA 3UZZA 4MNLA 3VCRA 4LVAA 5I3KA 3RXZA 4PMDA 1XH0A 5K9DA 2A3LA 3C3UA 1FFQA 2YCLB 3UJFA 1GQNA 3MO4A 2Z2BA 4JOMA 4IIDA 3E5PA 2DEPA 1CTNA 1AMYA 2C18A 1H7NA 5ABTA 1W8GA 5DT5A 4E2VA 3WBEA 3N17A 1RSCA 4I5UA 2YDQA 4NZFA 3HOJA 4GUHA 3VGEA 1M1BA 3AIUA 1B3VA 2QJGA 3RM4A 2EG8A 3KTCA 4B5SA 3GYEA 1CW2A 1W0MA 4OOZA 4F0MA 4PODA 1SO4A 4W5UA 1W54A 1U30A 3T40A 3HTWA 1R3RA 3OVGA 3WK1A 4A2RA 2PGWA 1G4TA 3BL3A 2FGZA 5F1UA 2VGIA 4EIVA 3PBUA 3IJ9A 1QAPA 2WZMA 3S5OA 2FDMA 2G3IA 4NXSA 5FF0A 4DXVA 4CQ8A 2BOGX 2D2OA 2OEJA 3BOFA 2X05A 4BF5A 3FX4A 4I6KA 1G01A 5SWUA 4D6EA 1M53A 4C7DA 3WMBA 1FWRA 1ICPA 3A47A 1HKJA 3IK4A 1E70M 3COTA 4DJEA 1LJYA 1UP3A 2J6VA 4V33A 7TIMA 3ZYZA 3UQNA 4BZYA 5BNKA 4A3UA 3QC0A 3W7PA 3WDIA 5JIPA 4GINA 1W3NA 4XZMX 1SM9A 3D47A 1H7PA 5AYXA 2BMBA 4KERA 3S0CA 3NQBA 4JTAA 5M2FX 1R9YA 2Z2AA 3QV8A 1EZ2A 1F05A 2QJHA 1G9HA 1R6WA 2PPGA 5E93A 2ZE3A 4GKTA 5HJXA 2DIJA 5BROA 4QROA 1GONA 3LLXA 3MZ2A 2Z29A 1XHGA 3FXGA 4GQRA 4AYSA 2NXGA 2ZZ6A 4C1NB 1IXNA 4WJEA 4Q4KA 4UQCA 4LCSA 2E28A 4EP8C 1YX1A 3SB0A 1KBLA 4GI4A 1A5SA 3GR4A 1EJ7L 4KQNA 2ESCA 5A6MA 5FSDC 4PGLA 3ME3A 3LSCA 1CIUA 4O16A 1KTCA 4A22A 3E0WA 4DQWA 3DFOA 4US5D 5HMEA 4XSMA 3AISA 2DZSA 1GOWA 2W91A 4NL1A 3W28A 5EBUA 2YBUA 3TJ4A 2TODA 3VNIA 2Q71A 1EXPA 4RV3A 1OYCA 3OP2A 1QASA 3HPSA 4GIAA 1NF7A 2VDIA 3TTQA 3L2IA 1AQHA 1FBAA 3HO8A 4QR6A 5A95A 4GZ7A 2CBJA 1I2QA 5LA2A 3BAKA 2CIPA 5DF0A 3WLHA 4RCXA 1NARA 3BAYA 2JFEX 3BVJA 1LYXA 4F4RA 1XPGA 3LZ5A 3MTWA 4NF7A 5T9CE 3ZOAA 4GUJA 3S5ZA 4FS9A 3EWDA 2DZUA 3LHZA 3PPHA 1US3A 3F2CA 4OOUA 3GY1A 3ZVHA 2V8ZA 2UY2A 4QAIA 3SURA 1XBYA 2ZX8A 2C91A 2G3FA 4HK6A 1HJSA 2CLOA 3LNPA 3QVQA 4AHQA 3WUBA 2WNNA 4O11A 4JYFA 2BFGA 1DJYA 3MSYA 3AI0A 2OPJA 5HINA 4EWND 4CNTA 3HGRA 3EOSA 4F0LA 1E6QM 1F5ZA 4Q8PA 3BLLA 4NUWA 1VJIA 1VEPA 1VPXA 4GGBA 5CJ5A 3UYIA 2FLIA 3O6CA 5HANA 4WDUA 3TSMA 1R3WA 2HEJA 3GNXA 5KMYA 1DXIA 2X42A 1RXOB 3U9IA 4BR1A 4JEQA 4WSHA 4UTWA 4RNHA 1PZ1A 3UJRA 2EPNA 1OCJA 1X6LA 4LNYA 3GTFA 4MB3A 1ICSA 1VFSA 1XSKA 3MKCA 4G6CA 4Y2WA 2INZA 3QY6A 3GNRA 1I8JA 3UPBA 5HUPA 3OVRA 3QM3A 2VELA 5LA0A 4CCCA 3W7IA 2D2GA 5GJNA 2VZSA 1L6GA 2PRLA 3BUVA 3LGEA 1UJQA 1DIKA 4RX0A 1GEQA 2ZRWA 2Y8KA 3T0TA 1V02E 3MMUA 3W22A 1LP6A 2CZVA 1OYBA 3LRKA 1YPFA 3K30A 4JICA 4CU7A 2J62A 3RR4A 1K4HA 2R24A 2GSJA 3ONBA 3L4XA 5G4WA 1V93A 2DY3A 1L8NA 1DYSA 2QHAA 2QCEA 1Z7AA 3JR2A 4M8UA 2WMJA 4REQA 1UKQA 1S2CA 1Q13A 5F2GA 3VIMA 1BQGA 2E9BA 1XYBA 1OG0A 2WB5A 3EB2A 4KETA 1JYXA 3S46A 1EQCA 4MPKA 1VCVA 1QOXA 1P0BA 3I3BA 1N82A 3UVIA 3GO2A 3UCCA 5MKGA 1UUOA 2H3BA 3SFKA 1UJPA 3QMRA 4NXKA 4H9TA 1Q3NA 4QGCA 2A3AA 1IXQA 2O7SA 3M5ZA 2BASA 1A3HA 5KZDA 2G97A 4CVWA 1UD3A 2XZ7A 2CFFA 1TTJA 1E9YB 2DUZA 2PWVA 1UYQA 3CLMA 2PDUA 3QYSA 4Y7EA 2HVOA 1H3GA 4CCZA 1R46A 4ZQCA 3DYMA 3NQGA 1J2BA 4HVXA 3OODA 2GJXA 4QG8A 4RLIA 5I02A 4I5XA 3S2JA 1WNOA 5IDIA 2FMOA 3CHEA 4IMEA 3SRHA 3N9RA 2OWCA 1CLKA 2Y5EA 4PB4A 2REQB 1JZ8A 2BV9A 2CZ5A 2QIWA 5AC7A 3T08A 4LS0A 5T26A 1GZJA 5E9XA 1A80A 2HCVA 4CNSA 5T91A 4IJRA 4PCSA 4UZSA 4H8HA 1GPWA 3EMQA 4DO6A 1H51A 3F1QA 1A4MA 4CUCA 3T6CA 1HXJA 1VS1A 4PA8A 3U2CA 2E77A 2YKKA 2WBGA 4LNCA 1NIUA 3KCJA 2OEKA 1Q45A 3TTSA 2HXUA 1E5NA 4AXKA 4JTQA 5GQBA 3ZJ6A 3M0YA 3QZEA 1R7AA 5A8GA 4DRSA 2OYMA 3HIJA 1J01A 3GDRA 2VFGA 4MJMA 4XQ6A 3CQKA 3TOYA 2H9AB 2ACUA 1EKOA 3WLTA 3LLFA 1B3YA 3AIBA 3S3GA 3BAWA 4ZB5A 4ATLA 5FL1A 1Q7MA 3M64A 4LUJA 4ENLA 3W83A 1RP9A 4NYYA 3TYEA 5BWAA 1RK5A 3MB9A 1BAGA 3GIYA 4XBJA 2ZOXA 1CXIA 2PDQA 2Q09A 4AHOA 1UWAA 2GPTA 1DJNA 1QNVA 4IQLA 2O9RA 1RALA 3B0UX 5CZ0A 1ESWA 1OX5A 3G8EA 1DWHM 4QTGA 1R3SA 1ITXA 3R94A 1SR9A 1TR9A 3IVUA 2F2HA 2HE5A 3SJ3A 3REQB 2V30A 2ONEA 2XFRA 4Z17A 1PYMA 2PDIA 5REQB 3FGCA 3NQ7A 3KE0A 4EPKA 3WBAA 2XFYA 2VWTA 2XISA 1FWAC 3N29A 5BXPA 1PV8A 2YCEA 4OV9A 2P0IA 1E51A 1LUCA 2C7FA 4D8AA 3CUJA 1CGXA 3R5EA 3RITA 5C9RA 1S1RA 1U2YA 4TMBA 3QC3A 2WMHA 4O4WA 3GIQA 4KWSA 4DN1A 3I3EA 4R85A 5D9PA 1LBMA 1CECA 5IFTA 1CI1A 1K9DA 2DUAA 1A5LC 2RDWA 3B9NA 1JNDA 1AH0A 2Z00A 2XH7A 2CHOA 2Y1HA 4UWMA 2O56A 3LMYA 4C6BA 4N42A 3UGVA 4W4QA 3HPZA 2VCAA 3UA4A 2Y4SA 4N0RA 4XB3A 3P60A 1V3IA 3T07A 1G5AA 1QOPA 1VEMA 3ZJKA 1PUDA 3HU7A 1JFXA 3GTNA 5D38A 1ZGDA 1NFBA 4ONVA 4FZIA 3E38A 2OWWA 3FJ6A 5E6YA 1GOQA 4DUVA 3ZWTA 2NSXA 4JTFA 2G4FA 4IQJA 3SRKA 3B40A 5LXXA 1Q65A 3S2LA 4KPLA 3PS7A 1A3WA 3LBCA 1SSGA 3POCA 5C2XA 5I78A 3EYPA 1UH4A 1RA0A 2PTDA 4H6RA 2DH3A 3W71A 3N34A 2JKAA 1WZKA 3PPFA 3N6QA 4INFA 5CLWA 1VFFA 3KRUA 3S1GA 1UR2A 3UWQA 1FQ0A 2W61A 5CGMA 2GGHA 3CZLA 2ZZ7A 1WOBA 3VILA 2QPXA 3D5HA 4LH8A 3RU8X 3SCNA 1KFLA 3W00A 3VGDA 5LHFA 3RU6A 3EMZA 2WZIA 2DVUA 4XD3A 3N15A 3KBJA 4YIWA 4N9DA 2NX3A 3CV6A 1O1ZA 1XLIA 2VP8A 5ABHA 3BJFA 4JYEA 1KRBC 2V67A 5LGZA 5K4XA 2V5KA 1UCWA 1JXJA 4BQ3A 3FA4A 1GKRA 2PWUA 2E1DA 3I7SA 1BG9A 4LYRA 3P7YA 4Z0SA 4FA3A 3CNYA 3MMDA 1OEPA 2VVSA 2NX9A 1FKWA 2QZRA 5F4SA 4IJCA 4R9XA 4PE8A 4FR6A 3BG5A 1F74A 1PDZA 4JX5A 5CPMA 3WH8A 1CB7B 1IR1A 3N4AA 4MB4A 3WQOA 1ISYA 1MUMA 3HN3A 2CZEA 1XKJA 1ZRQA 1R0MA 3WK0A 1KM0A 4K39A 4F40A 3U5UA 3W70A 4AHPA 2CLFA 2OOGA 5LKYA 3HURA 1ICQA 2VWSA 4JQ4A 2V5CA 1WZAA 4AIBA 1OZMA 3CMGA 2RGLA 3QHOA 4G1NA 1Y5VA 3OB8A 3CZEA 2C14A 4MF4A 3XINA 1FWEC 3HPXA 2A85A 1EPXA 3GBEA 2UV8G 2DZPA 3VOGA 1TB3A 5CGTA 1PTGA 3UXAA 3G77A 1R5YA 2ZUUA 4NJGA 3UJSA 3LCXA 4IICA 3VCNA 4XKMA 1HL8A 1PIGA 3EA3A 4AMCA 1BRLB 4WJ8A 3LTSA 3BH4A 5JBEA 1EHNA 1XLBA 3OLEA 1C9WA 3KBNA 3OGSA 2WC4A 3E0FA 2QJJA 1WZMA 3RLHA 3W1RA 3QY8A 4S3BA 1CZ1A 4XG1A 1VBRA 1BD0A 1BYBA 3TW6A 1W5PA 5M3WA 1G1YA 4HNVA 1YDNA 1XFCA 4QXIA 1KXVA 2A3HA 1GYMA 2NQLA 3TK7A 1BHGA 2GK1A 1JULA 1QATA 3EA1A 1L6FA 1AMKA 4PCPA 1FHUA 5BXSA 1E6XM 1ZBCA 1KBJA 4PMUA 1KM6A 2R82A 4UTMA 3VOHA 4C6CA 1L9WA 1QPOA 2VX6A 4G7FA 2OJPA 3PZIA 4YTTA 5CSUA 3MV11 1OY0A 4MNMA 1GJPA 2IKGA 3O7UA 2V81A 4K3ZA 1Q8JA 2ACSA 1R9ZA 4B91A 1EJUC 1YPXA 3AS0A 4KRTA 2YDSA 2YA2A 1W9BM 1P1XA 3A5VA 2OMAA 1A5MC 5D32A 1FH8A 5D4YA 4KT2A 3GFZA 1DTNA 4MNKA 4UNIA 4FLQA 1W9VA 3WQVA 3VYLA 1QDSA 3LM3A 1IEQA 1XLKA 3MVTA 1O6IA 1LF1A 3I68A 2C1GA 2TAAA 1VIWA 4ZO7A 2VUYA 7PTDA 2WZEA 3PJXA 3BW4A 1JEZA 1W9UA 3VNKA 1QU4A 1C91A 1UIPA 3BPWA 1WDSA 1HT6A 1E56A 3FXYA 1KRCC 1I0DA 2WPGA 5AHMA 2HVNA 3PSVA 3W23A 3WQ6A 3SCPA 2BHUA 1QW7A 4FIQA 4PMNA 2Q6ZA 3VKKA 4MB5A 2OQLA 4XZNX 4ZTXA 2HK0A 3A64A 3ZS4A 2JIEA 4O0ZA 1Z44A 3M6DA 1O94A 2Y5SA 4GC4A 1KM5A 3EKZA 3RCYA 3O8AA 3EWZA 3W9ZA 4UFIA 3HPAA 2F6XA 1A0DA 4TQTA 3N1AA 1PL9A 5H91A 1XYAA 4OUIA 4QBXA 1UMLA 1F6PA 2Y88A 4W8BA 3IGXA 3AIQA 1ODUA 3OBKA 3BARA 2ZXAA 2YCJA 3GC4A 3UZYA 3VDAA 1YBQB 2UBPC 4GUFA 1I2OA 4M82A 4FO4A 2J9ZA 2WHLA 2NV2A 3UZ5A 2YIHA 3SUSA 4RW3A 1PS9A 2Z24A 3QZ6A 4BI7A 1OFAA 4RE3A 2JEPA 1TWSA 2Z4GA 2CLHA 2XINA 3CWHA 1V7AA 1KWGA 1ZB5A 5ABFB 5F7UA 4DNMA 2PLCA 3IGHX 2CXEA 5KZMA 4DYKA 1KFJA 3W82A 4NAEB 3W07A 3FY1A 3TH6A 3M1ZA 1B3XA 1EC7A 3N2CA 1SJBA 3QV7A 4JR5A 2V38A 3WENA 2WC3A 3CHCA 3CO4A 4IX0A 4ZFMA 1Z42A 3BGGA 3PZMA 5CSRA 2YBVA 2J78A 3MKKA 5I3HA 4HMDA 5HQLA 3PB2A 2I5IA 5C2CA 3NEVA 3DG3A 1R30A 3ZM8A 3ZR5A 3W2MA 3E2RA 4LCRA 2BG5A 2J7GA 3MDUA 3H70A 4B5WA 3FV9A 3WLKX 3KBVA 3E5BA 3BCDA 1PB0A 2IMRA 4Z2GA 3C2RA 1XDMA 1JQXA 3VKDA 4DUXA 4FOJA 2ZRUA 1RPKA 4KIEA 3NWRA 4GJ1A 3EDKA 1JI2A 4GQGA 3TWBA 1KV8A 1LWJA 4Z42C 1TPWA 4PUWA 2O4MA 5BZAA 1EXBA 3BZJA 2EKCA 1TKKA 5LA1A 1A4LA 4O52A 2P0OA 3APYA 1ZQ5A 5E5CA 3B9DA 5LIWX 3HZ3A 4ZO6A 1LLOA 1WZLA 1V6UA 4A8NA 3PF3A 2G4JA 1K9TA 2QPUA 1JIBA 3UJEA 2EPKX 4I7VA 2CLIA 5KEZA 1DV7A 1OX6A 1HP5A 1OHLA 1Z41A 4UQAA 5IBXA 1LL6A 1KM1A 4ZL1A 2Z25A 1TPB1 4QISA 1XRFA 3H55A 3THCA 1XSIA 2V5JA 3ERPA 4S3FA 3DENA 3TTOA 3IVTA 1WXJA 1XL9A 3CL8A 3R79A 3RYSA 1EJWC 4IWWA 4Q8WA 2ISFA 5A6AA 2J27A 1LLWA 1DWAM 2E6AA 3PJUA 3USZA 1KQYA 1RPXA 4CQBA 1UPMB 3NSMA 4K1WA 4OZOA 5XINA 2UWFA 2VDHA 2J47A 4ZB0A 1MDRA 4W5ZA 1E4LA 1VCFA 3DFQA 2XG9A 1H41A 3W1TA 4AD5A 2VC6A 3UXLA 1CGWA 3FIGA 5HDRA 4AZ7A 1LRTA 1WOAA 1DBTA 1I60A 2DJXA 3GDKA 1TJPA 3EDJA 4IIBA 3TVAA 4FPSA 2A21A 4YHGA 1XX1A 1GOMA 4RE4A 2V82A 4Z2HA 1IWPA 1PIIA 1A3XA 1QTWA 5AZ0A 3GLCA 4PUKA 3PG8A 3WJYA 3RAOA 4A8LA 3FA5A 4W8AA 1OJXA 3URQA 4N6EA 4L9YA 1KM2A 1Q2RA 1KRAC 3NFUA 3GXNA 3DHDA 4I9AA 3WK3A 3DDMA 4DWDA 4EWJA 3TSDA 3KOXA 1N8WA 5M17A 5F2MA 5CXPA 5K9XA 3GNNA 2YL6A 2OWXA 4KFPA 4DBEA 1XXXA 1JDAA 3IARA 1UD4A 4ROQA 3MU7A 3P8IA 4Y9MA 3QHNA 3PUOA 1GNXA 4WZHA 1R3TA 4KFOA 1C29A 1SMDA 3H7RA 4JFSA 5D33A 3WQGA 3T8LA 3U7BA 3VGBA 1O5QA 4AZCA 1EC9A 3HQPA 1MW0A 1F3XA 3BAIA 3QKZA 1UC5A 3W7EA 5EYWA 4CEUC 3W7OA 1IYXA 2XH2A 4LUSA 4M3PA 5BXTA 5HR6A 4POCA 4YXGA 1MFVA 4YCOA 1FWFC 4S38A 1N8IA 3W7DA 4GA8A 3HFTA 1GWJA 2VJXA 3V18A 3NO1A 4J5NA 1DORA 1NDVA 3M5XA 4PULA 1AQ0A 4K8HA 3VDHA 3NQDA 1M41A 1XIGA 4YTRA 4NYUA 1TV2A 4PTVA 1UD6A 4MHBA 2QDHA 1WP6A 2V3EA 3TZFA 5DBUA 4U5KA 5D09A 4IG2B 5AKQA 4HBKA 4HPHA 4DWSB 4RL3A 4HOXA 5B80A 3RK8A 4Y8EA 2C19A 4E4UA 5BOFA 3SN0A 2DU2A 3B0YA 4LVBA 3GKFA 1XH1A 2R1PA 4M51A 1UQYA 1HKWA 3GHRA 1PPIA 3RNDA 2J8TA 5LNSA 3BK0A 3QJAA 1BTCA 1KM4A 3GAKA 2P3EA 3BW3A 2WM1A 3RMEA 2QJNA 4TXEA 1OC5A 3PHAA 1J2WA 2C3ZA 4PMXA 2YBTA 5D8ZA 3CB8A 2ABBA 2VRJA 4XZHA 3ZLFA 1VGAA 4GI6A 4MYAA 2R9RA 5D37A 3JRKA 4JZ5A 3P84A 4Y8FA 3TONA 1V0NA 2B81A 3ZLGA 3A4JA 3E96A 4O1AA 4HKPA 1HQTA 3GNOA 4TVDA 2C0AA 1UWUA 1AVAA 4D6DA 2BVYA 4CQCA 3VOIA 3TLLA 8XIAA 2IKHA 1IXOA 3QGVA 3GB6A 3LM7A 1K8XA 4NRRA 3PZUA 5G2HA 3PY2A 3ALGA 4NILA 3I6EA 2PDNA 2CETA 3UYCA 4EAMA 3NNTA 3ARYA 3VINA 3TW9A 2G3JA 5I24A 3DKJA 1UKPA 1V7YA 1M7PA 1MEIA 1VH7A 1KXTA 2POZA 3NQAA 3LHWA 4BA0A 2IQTA 1PWLA 3TQKA 2G3NA 3WEOA 4GQBA 4H9ZA 4HCLA 2HE8A 4JTLA 3OPSA 1JAEA 1X39A 1UWRA 3OYXA 4ZEPA 1HJQA 3F5JA 2ZX6A 3CQIA 3RDKA 4QQUA 2X1UA 4EE9A 4LBRA 1IWAA 4JIEA 5DLCA 3ITOA 3KWSA 1TV5A 2DSUA 4J2MA 1O60A 5CPSA 1TWIA 1RV8A 4A3HA 3WD3A 4B5VA 3LBMA 4FXJA 1KW1A 3LQGA 2Y63A 4D6GA 4H4IA 4HD5A 4F9JA 5I3DA 4K7VA 3BDKA 2FZBA 4Q8TA 1ME8A 3R2GA 3KXQA 1I2PA 3EX4A 4US6A 1LT7A 1H7WA 4UCFA 5A8NA 2VR5A 3UWZA 4BWLC 2JBMA 3MCOA 4PMZA 2QJMA 4Q6JA 3W1MA 2BDQA 2VYOA 1V79A 3DEQA 2H3DA 1XYCA 1SFTA 1G0CA 3P74A 3SUUA 2PTXA 1QNQA 2X30A 2QS8A 2YCIX 1TE1A 3LTYA 3MMWA 1TPFA 3K4WA 3P5YA 5AHEA 4V1XA 1ZL1A 3NSXA 4WF7A 1Q5MA 3OA3A 3TXZA 2OZTA 3JVAA 4IGHA 2O0TA 2CESA 4IL0A 1H4PA 3UZWA 4IL2A 4L6HA 1L2UA 4QCEA 3BG9A 1X7IA 1HJVA 1VHCA 1PZ0A 2GSHA 4Y9AA 1HIZA 3S6TA 5MF5A 2DQWA 4N9BA 5BMWA 4AX7A 3AZRA 3UXKA 3WMLA 1QHOA 3KM8A 2WSKA 4CQAA 4QX4A 4N4QA 1AW5A 3WQDA 2CLLA 2NXHA 4LBUA 1NDZA 1K4GA 4B5TA 4IGSA 4PBFA 3R13A 5JMUA 2ZTJA 3BV4A 4QSFA 3R25A 3OZMA 2HQAA 2UY5A 4L1XA 1PEZA 2I9EA 2D0FA 3MV01 1NQKA 1XLFA 4FB7A 2PDMA 4A2SA 1FP8A 2ZZ5A 5E6ZA 3GU9A 4AIEA 3WK2A 1TWZA 4HTBA 4UOZA 3AYRA 4BI5A 3QTPA 3WF4A 1ZUAX 3RO8A 1V03A 3EOLA 5CEWA 8CGTA 3TW7A 1FXQA 4W88A 3ZQ9A 4FF5A 1Z6KA 4IPJA 3LHTA 1GORA 3ZVHB 3GHTA 4ZQRA 1QW8A 4R9OA 3FVDA 3OOQA 2YDRA 3LCWA 3QV6A 4E3VA 1K02A 4HOZA 5FESA 1GQLA 1GVYA 2QDEA 2GGIA 1T8XA 3OBEA 1OK6A 3OZOA 3TUUA 1E3ZA 2FH6A 2E25A 5BCAA 2INEA 1ZJHA 1A0CA 1TWWA 5A6BD 3W72A 3N9KA 3W7LA 3P3BA 1E9IA 2VCCA 1PKNA 3WQ4A 4HQVA 4W93A 3OQ8A 1YDOA 2PUZA 1P7TA 4HK5A 2J13A 3ARQA 4AF0A 3G18A 5F2IA 3DGBA 3QGAC 3TJIA 3UWEA 2BXZA 1XICA 4O1EA 1WBJA 2YSWA 1FHVA 4BQ2A 1JGIA 2VQTA 2ACRA 3ONCA 1DHKA 1NOFA 2VL4A 4ILSA 7XIMA 1ODZA 3FJNA 1BKHA 3UG8A 4ADSA 2NUWA 3MYPA 1EP1A 2DORA 4JFTA 5E0CA 2EEXA 1N8FA 1Z3NA 5JIWA 3M43A 3RHGA 3TJXA 3HFYA 3DFYA 3DZ1A 2HZGA 4L7ZA 3W87A 3H21A 4WXYA 5HJLA 1RAKA 3EWCA 2FB2A 3NPVA 3LPOA 3UESA 1XLMA 3H2FA 2CC0A 1XLGA 3VKCA 1TREA 2WCSA 5GNXA 5I3FA 1E4MM 3I6TA 2C8NA 3ABQA 4AY8A 1S5MA 3VGHA 2OB3A 2C13A 1U1HA 4D6CA 4REQB 5AOUA 3VD4A 4K8EA 3TMQA 1B90A 4GH3A 3CHFA 4UQ9A 3TYAA 2NXIA 5G1TA 3UETA 1CDGA 3P93A 3W1QA 1UG6A 3PP7A 1DHPA 4DYJA 1XJBA 4TX9A 2YXGA 5CC5A 3RRXA 5BMXA 1JXKA 3C4UA 3A12A 3GR7A 3RCNA 4UTHA 3UBPC 3NAVA 4UFLA 3PTMA 4XZ9A 3T8QA 4IFKA 1ZHAA 3PJWA 3TCSA 4O1DA 1WDQA 3ICJA 3TWAA 4E38A 4ERIA 5C70A 2OEMA 4WOZA 3F5KA 1E73M 5JU6A 2E5DA 3H4GA 3NYDA 1CLXA 2XU2A 3OHIA 4MZ8A 1JFHA 2C15A 1P5BA 3STEA 2GJXB 3WLSA 1VB9A 2E68A 4FF7A 5A6BA 3GTHA 4F0RA 4J9JA 1FFRA 4O1FA 3MCNA 2D3NA 3IGUA 4GNJA 2A7RA 3AALA 1E0TA 1NWUA 3M0HA 3SGGA 4WVXA 1UASA 5D2TA 1ADDA 2HWGA 1OM0A 3CZ8A 1WAUA 2UY3A 4RE2A 1XI3A 3UCQA 2ZXDA 4QIUA 2GZXA 4D2JA 4HK7A 3WFZA 5A8PA 4EXBA 1FWCC 4RDWA 4YVXA 3WY1A 1TZ9A 4J4KA 4MM1A 2AAMA 2VKZG 5DY2A 2ZUNA 3K4DA 3WNLA 3M07A 1LL4A 5CPOA 4RK8A 4LANA 4ZE5A 1GQKA 2PDKA 1WKYA 1YPIA 3B03A 4C6FA 4H41A 2XIIA 4Z2LA 2BNJA 4XD4A 3NQ8A 1G4PA 4UTKA 1IEXA 4QJ3B 4IMAA 3KOZA 1B4EA 3VOJA 4D6FA 4UFMA 4MKVA 1ONWA 3IVSA 2CWNA 2PFHA 4JL2A 1A49A 4FX8A 3DX5A 2HNEA 3S6OA 5E70A 1EO7A 1PCKA 1NOWA 4GX8A 5HK4A 3FAWA 2FVLA 1LQAA 2VRQA 4DUWA 1EOKA 2H90A 3DC8A 1SJCA 4MSSA 1RLDA 1JZ4A 2EJAA 1XQKA 1K8ZA 1UR1A 3CHDA 4DI9A 4HP5A 5A6SA 1RZMA 2PZNA 2PBOA 3ZJ8A 1EZWA 4P7OA 3GDLA 4PUJA 4GFIA 1E6NA 3E0IA 2X16A 3QHMA 3WUGA 5LSMA 1H1YA 2BX7A 3APTA 1LUCB 1ZLPA 4IXXA 1F4AA 3GH7A 2CHNA 2DDXA 3NZQA 5LIYX 2BVWA 2VOMA 4LRTA 4CN4A 4XAGA 1S2VA 3W1XA 3NGJA 3AMGA 3GVGA 3CM4A 2BVTA 1L0PA 2INFA 3W84A 4ZSTA 2VZOA 5FCZA 1UR9A 1P0KA 4AIOA 4LWWA 3CV2A 4QDMA 3VD7A 4CCEA 5GJPA 4NZ5A 3CEPA 5K9CA 4EF8A 4JGDA 3BANA 4N6FA 3LV5A 4GO8A 4O53A 4YYCA 4DO4A 1H50A 1UD2A 4ZE4A 2VUNA 1QO5A 4BHYA 3CT7A 1KM3A 1K7XA 4HNCA 5EL1A 4AXNA 3I4EA 1KTBA 4TO8A 4DJDC 2DPEA 1EJVC 1K3UA 1M7XA 3CYVA 4AD1A 3TYDA 2BP1A 3P82A 2OELA 1OD8A 3EB4A 1TIWA 1TVNA 1NTHA 1YYAA 3CWNA 1NOUA 5CBJA 5HBFA 3LXCA 1F73A 3HGJA 1UB3A 4HPGA 1BXCA 6ENLA 3K1GA 1VRXA 4JNZA 2YFOA 1E4NA 4ZFCA 3IV3A 1EQPA 1HVQA 4CD7A 3W81A 3VNMA 4GMEA 3M0KA 2FZ9A 1PBGA 1E0VA 4KRZA 4QSHA 1WE5A 3B8WA 1OCBA 3EOEA 2ZZ1A 1SW0A 4HU0A 3IIOA 4O17A 1NH6A 3G1AA 5DEZA 3O07A 3VGGA 3ZMRA 3T55A 5A6LA 1FKXA 3B9EA 1TUXA 2J7EA 4N9EA 4FP1A 1UPPA 2YA1A 4CNUA 4RXFA 1TSIA 2BSLA 2GL5A 5I07A 3RRAA 1DIOA 1OABA 4JTUA 2NLIA 2XPKA 4CN1A 3AXHA 3NQMA 2JKEA 4ECLA 2ZTKA 1YW1A 2J77A 4JTTA 7A3HA 4UTTA 4QJ5B 1R87A 2HK1A 3LU2A 4HHMA 3AROA 4UTFA 5U7SA 1GEHA 1THFD 3ZT6A 3I65A 3VFLA 3H53A 3GXDA 3QEZA 4W89A 3EDFA 4Z1DA 4ES4A 2X0HA 4HHHA 2P53A 1YHTA 1B4KA 3BTNA 3RF9A 3K8LA 4O0QA 4LU0A 1SW7A 3GXIA 2W63A 3VI2A 1ISZA 4B90A 1ONEA 2QR6A 4FI4A 3QSTA 1DJGA 1QMLA 4BFAA 3F4CA 2DGAA 4YMZA 1FDJA 3WIJA 3LYEA 1HJXA 4DELA 1Y0EA 3QV9A 3R43A 3BW2A 4LAZA 3WH9A 1UUQA 3DYOA 3NDYA 4JN8A 2W3ZA 1GVOA 3C2EA 1PDYA 2F6UA 3WF1A 3TV8A 4HU4A 3CV7A 4A6GA 1R3YA 1AW1A 4XK2A 5CSYA 2VOTA 2XIOA 3F03K 4WY0F 1IT8A 2TPSA 2Y0FA 3MANA 3TEVA 5FJTA 3P62A 4JCMA 1YXYA 2IPJA 2XFWA 4DJFD 4PMVA 4CVUA 1OYAA 5HNRA 4MB1A 3ATYA 1XYZA 2IW0A 3DYPA 1VPYA 4LAOA 2IXVA 3PUEA 3G8RA 3BOLA 2HJPA 1OINA 4RW5A 4CD8A 3VIGA 2R1MA 1X1NA 1WO2A 1I9CB 4B5UA 3MP4A 2DJLA 3TZNA 3RIKA 2W0UA 3VDGA 4DBUA 3EEGA 4Z1BA 3RPMA 3RJYA 3MUIA 3WEZA 4H3DA 3IIPA 1LG2A 1M03A 4FK9A 3MHFA 1XIDA 2PRMA 1XYLA 4IMGA 4ZOCA 1ZAIA 3NQEA 3ZSTA 4I8DA 1DEDA 3DFPA 3P80A 1OZQA 2A6LA 2QNEA 1SPQA 3VU2A 1LL7A 4AEEA 3IANA 2HS8A 1H61A 4O54A 3N12A 2GK1B 5CZTA 1S5WA 1YNQA 1JCTA 4ACZA 2IPGA 1OK4A 4NI3A 4WY0A 1W9DM 3MPGA 3CUXA 3M47A 2A5HA 1OC7A 4L6DA 5KINA 2VI0A 1KFKA 4YTQA 1Q8AA 4ATDA 3B8IA 4JTGA 3WLMA 1R85A 4K36A 2TMDA 2Z27A 2D69A 5FJIA 2VEFA 2JF6A 2Z28A 2I56A 2CBVA 4PMYA 1TTIA 1E55A 2PDFA 1HKVA 4CCDA 4AVOA 2I17A 2AQVA 3H23A 3SSJA 4FXSA 1FWWA 5EPDA 3PPGA 3STCA 1XSJA 1TRIA 1AQFA 1W1TA 4LJ3A 2Y2WA 1S38A 2UZ9A 1XCWA 1QR7A 1EB3A 1ITQA 2V69A 2RDXA 3KDOA 1F76A 4FSAA 3KBMA 1CWYA 1XGDA 3O6YX 2WMGA 4MIMA 4AWUA 4RZBA 4PH6A 1XBXA 3BXWA 3ANYA 4MFEA 1IEWA 3PULA 2VDGA 4PTNA 3I7RA 3NR0A 4CNOA 4Z08A 3GH5A 4A29A 3WZ0E 4LOCA 1BFNA 4L9XA 3MW7A 4DJFA 1HO1A 2PDYA 1A5UA 2TSYA 3LERA 2ZX5A 2RKXA 2X09A 4BQ5A 1W2VA 2ISVA 2WW5A 4ML4A 4OBTA 4XIAA 3V1PA 2QT3A 4HNTA 3TP4A 4GCXA 1SR0A 3OG3A 5C8BB 1K7EA 2QXWA 2YFNA 1EDGA 1RP8A 2ZA2A 1GK8A 3CAKA 2B7PA 5T9BG 3N18A 2A1YA 3QLDA 2NQZA 1H11A 3O63A 1KD0A 3BMWA 2P8CA 5FJUA 4XTDA 3NL5A 3O05A 3RLUA 1QWGA 2XIQA 1HN1A 2AAAA 5A3HA 4LUTA 1EF3A 2Q01A 3ID7A 3V16A 4P7LA 5AZ1A 1TJ2A 2ALDA 2BOEX 3NQ6A 2XWDA 3ABRA 3KVLA 5I3GA 5I2UA 5D04C 1IQ8A 3MBFA 4ICCX 4X0NA 1XG4A 4X0VA 1UWQA 3BQ6A 1V8EA 3EWUA 3SCQA 2AOSA 4JIPA 5DQPA 2F6KA 4KCWA 1JUEA 4BI6A 2PP0A 3ARWA 1VD6A 1U33A 4IIHA 4UXDA 5HAOA 5DXXA 3VNYA 3SFWA 1WQ5A 1EJSC 1PKMA 3W7GA 4ALDA 1XIJA 1B54A 1W1A1 1W2PA 1B2YA 1O5KA 1ZP3A 1L6SA 3OTRA 3AWOA 1D8CA 3FKKA 3IAQA 3MT1A 1V3MA 1SZFA 2WHJA 2AL2A 1IZCA 4JBRA 4NP7A 1UP0A 1UZ1A 5HMSA 3GYCA 3GZAA 3GKAA 3LSBA 4H9XA 3ZR6A 2ATMA 1WXZA 3PZQA 3W2NA 1K77A 4RPQA 3DG7A 4NZ3A 1JPMA 3C86A 1RK6A 2A0NA 4Q7NA 4L64A 4MMWA 3QTGA 3G1SA 1BYDA 2VVNA 4MWAD 4JEJA 3E74A 4D71A 2VRKA 3NZRA 1F9CA 4Z1CA 4Z1AA 1C90A 1U1UA 4QAWA 2XTKA 4GXPA 4FEZA 4LB4A 3R0DA 3NZGA 3G1DA 3U3HA 1D9EA 3AXMA 4B2DD 2FYMA 4PUMA 1XIHA 3OA5A 2G3MA 4U31A 1QOQA 2GWNA 2CLEA 4IUOA 2HISA 2KZHA 4DF2A 4AFYA 3P61A 4GISA 1QPKA 1GQIA 2IPWA 4PL1A 2GUYA 4PSRA 1QPQA 5KZEA 3BSMA 2QCHA 4HGXA 4ZBCA 1MO0A 4BS0A 4LW7A 1JGMA 5BU6A 3LV6A 1VAHA 4X61A 2FMNA 5FEPA 3WN6A 1T96A 4XIMA 3VUPA 3WJZA 2GVJA 2NWSA 4LY4A 3M5VA 3WJSA 4MOZA 3W85A 5CKSA 5HATA 1EEPA 3KOWA 2H8ZA 3CL7A 4URIA 4W7WA 4GVHA 1OT2A 2DSZA 4ADUA 3EMCA 3LX9A 3THAA 2GYIA 1QPNA 3VIOA 1XLLA 1ONXA 4ASTA 4IMDA 3B0PA 3PNZA 4CQ9A 4YVVA 1X8CA 3IJ8A 1GUVA 5DCEA 1H1NA 1NY1A 4MVAA 2DSWA 4WIWA 2GJLA 1WUFA 4IX2A 2G37A 1Y8BA 4K6AA 4U3AA 3TYCA 2B7QA 2J8FA 3M46A 1GZ1A 3FHAA 4D1IA 3TQVA 2NUYA 5LYRA 2ZUWA 2VT0A 3NYZA 3TAOA 1UWIA 2WWDA 3WQFA 3LB0A 3IJDA 4XZWA 1OADA 1UR3M 3BMXA 1ME7A 3B9AA 3FEQA 4H7CA 1X96A 3MI2A 1XUUA 2YJQA 3E9AA 4TR9A 4XWUA 1E40A 4G56A 4C1NA 4H9MA 3CUZA 1NF0A 4GYPC 4AZIA 4H04A 5CSSA 1K1DA 4MWAA 1E1CA 1E6ZA 2NX1A 3L4ZA 2CLPA 1FWNA 3WELA 1YMYA 4LRSA 3RPTA 4QEHA 4B2DA 3MWAA 1E1FA 1GHSA 3EPNA 4GYPA 3FYPA 3W1AA 3UWVA 4M5PA 1OG6A 1J10A 1SFLA 3AIRA 4GNVA 4E0CA 1PJ9A 3CH9A 1WXYA 1PAMA 2B7OA 4RE0A 1XD1A 3KTSA 1Y5WA 1S1PA 3NXLA 3SCWA 3CAVA 3QPYA 4ZOEA 5CH9A 4DIAA 4DPPA 4AZCB 3KTXA 3IJIA 4O57A 2F61A 3W7JA 3L2LA 4HZ6A 3XISA 4S1FA 1PIFA 2D73A 3CZGA 2I9UA 1FDZA 1FWTA 4JTHA 2A6NA 1XRVA 3QMSA 3AYVA 4WLCA 3EPOA 3WG6A 4Z2JA 4WSKA 2VTFA 4F66A 1EC8A 1XIBA 1E9LA 4J3TA 4PCFA 4LS1A 3EBVA 1WPCA 2JGQA 3BQ5A 3LS9A 2D24A 4AEOA 1G94A 1TA3B 3U6WA 2OLAA 3PAOA 2WWCA 2J8GA 2QGYA 3WUFA 3ABOA 4HU3A 4C6JA 1BGGA 5F4XA 1H7OA 4C5YA 3LNMA 2XGIA 1CYGA 3W25A 4OV4A 3H2EA 1PXGA 2CU0A 4NU7A 2OX1A 3G1YA 4ZQOA 5HR7A 4FX6M 2E9MA 2OO0A 4RZ4A 2OXNA 4CGTA 2ZRYA 4QLLA 1FH9A 1JZ6A 4AD3A 2MUCA 3K8KA 1ZTVA 1XISA 1HW6A 3N6HA 3UD6A 3CAQA 1RJRA 2W4XA 1P6CA 3A13A 1RVKA 3E2QA 5FSEC 3V5CA 4IHCA 2QUNA 1MI3A 3ENLA 4NASA 2X0SA 3ZO9A 1AJ2A 4KWUA 5AHIA 1EEXA 3SJNA 1AODA 4BF7A 3TYBA 2NQHA 1K9EA 4LF2A 1XBVA 1R2SA 4MY9A 1VFLA 4M7TA 2A3CA 2VMFA 3IACA 5LIKX 2ZKMX 4QNWA 1UUMA 1M7JA 4PTXA 5BOEA 4AEFA 1XF0A 3RM9A 1GVSA 3W1UA 1H09A 2OKTA 4DJEC 1OWQA 4C6QA 3ZZ1A 4H7VA 1QBBA 3CTLA 4KIRA 2GQAA 2CBUA 3U8GA 3CASA 4HMEA 3PZGA 3ITCA 5JBFA 3ZXWA 4AAJA 5AC4A 1PHQA 4YTUA 5LZLA 2BZNA 4KWVA 4ZSUA 1FWDC 1K7FA 1XCXA 1JCXA 4KWWA 1SUXA 3G0SA 3U5YA 3N19B 3LPFA 4Y96A 3RILA 4GK8A 3N73A 3F4DA 1YTKA 3LENA 2J7DA 4NIRA 3LCHA 1GW9A 2FGLA 1VHNA 3UG3A 3AMDA 3OGRA 3SQMA 5JH1A 4YU1A 1XLAA 4LC8A 3PB0A 2FTYA 1XPYA 4DNHA 1OGGA 1Q6DA 2OZ8A 3HV9A 3TIMA 1KO0A 3C2YA 3VAVA 3ES7A 1EJXC 3VZXA 1EF2A 1GZGA 3A23A 4ML9A 1QUMA 3WFAA 2QUMA 3P0XA 1GVRA 3KL3A 2NUXA 3L21A 4JX4A 4UR7A 3GW0A 3WQWA 4XBSA 4GC3A 2REQA 5EA9A 2DT2A 3IJ7A 4NHVA 3AXIA 1A53A 1M65A 2QCNA 4UNKA 3OW1A 4XAZA 1UWTA 4LVGA 3W74A 4IZGA 1R38A 5DMLA 1WYIA 4NVTA 3EOUA 1UZHA 1GW1A 4C6MA 3P2VA 3WDPP 1VBHA 5IOBA 1V0KA 3OLDA 3DFTA 2QV4A 4AZHA 3QZAA 2ZICA 1DE6A 3H22A 1CT5A 1OFBA 3C3NA 1E1EA 4Q7BA 1HKIA 3SRFA 1UQZA 1J6PA 2GQ9A 4BCEA 1GVFA 3MUCA 4JNYA 1VFOA 1JDDA 3HM7A 4LT9A 3Q4DA 3GS6A 4GKLA 4Z1YA 2SFPA 1QT1A 1Q6RA 3TNOA 2ZVRA 3S42A 3UXDA 3M44A 4EKJA 3S1XA 1W1PA 4I9MA 1ISXA 2CHRA 3C6CA 5EMUA 1HKKA 2BY3A 2GGGA 4L1GA 1H7XA 4DPQA 3AC0A 4BJHA 1WKEA 1S3HA 4RXGA 4H9UA 4CD4A 1ZZMA 3W75A 1K6AA 3DKLA 1OFQA 4FLOA 3A24A 1K9FA 1X97A 3IUHA 1P0DA 3USBA 5LNRA 4IFRA 3A6OA 5C7HA 1SZGA 5K2ZA 3ZT5A 1UWSA 3O9NA 6A3HA 2PDBA 3VE7A 1QJWA 4IIFA 2Q02A 3PAJA 3PWGA 3QR1A 4LVDA 3T09A 4JFUA 2DFAA 4UTWC 5D2YA 2ZXBA 3QH2A 2IUZA 1MMFA 2YR1A 2Z1BA 3GTIA 1XFBA 4GPNA 1KBKA 2IQ0A 3NCOA 2O92A 3RM8A 3FCPA 1XS2A 2AQWA 2DIKA 4L4PA 2QQ6A 4L6OA 4DXXA 2O9PA 4X9SA 1J9YA 2VQUA 9CGTA 5CCZA 3N2BA 5DCBA 4F79A 1M6JA 4H9YA 4HOWA 3QSRA 2FDSA 2QGHA 3L4VA 4QS6A 1VYRA 1P7TB 3WH7A 2Y70A 2QMJA 2QF7A 4NJIA 4AF0B 3PTDA 3VDBA 3VXGA 4GYJA 1KCXA 2PLMA 1FTXA 3N2TA 5IRPA 3PZTA 1H0IA 1VIZA 1ADOA 4LGXA 1XINA 2F7FA 2JEQA 1FWJC 4HMCA 2PCQA 3GRIA 1KA9F 4RV8A 3Q58A 1JCYA 1CEOA 2IPFA 1Q4WA 1UHVA 3NQFA 5FEWA 2ZYFA 4UFJA 1ALDA 2XGBA 4I90A 3EA2A 4FNRA 5DT7A 3THDA 5EMLA 2BB0A 1N7KA 3G2GA 2QF8A 2TRSA 4C5ZA 1KTNA 2WNZA 3RUBL 4YL2A 1EUNA 2J7CA 2PWGA 2OQHA 3BLKA 4ZQMA 1O4UA 3L7RA 3AZSA 3GBDA 3RCMA 2WNWA 5IM51 3GAYA 1RY0A 2XVNA 4J7RA 4OTKA 5JUVA 3O06A 4JIRA 1LTDA 3QQ0A 1YRRA 2ZC8A 4XX6A 4JKKA 3NXFA 4HZ8A 1I1WA 2VEPA 3EWWA 7ENLA 2OOFA 3WH6A 1POJA 3WQEA 3CXOA 3FEMA 1MVYA 1RQBA 1RQHA 3LK6A 3IJLA 4HZMA 2EHHA 2A4AA 2J25A 2E6YA 1KFCA 3UJ2A 3LCIA 2G95A 3VNDA 1UIOA 3M0MA 1NWTA 1G4SA 4IFKB 2FGBA 3UPMA 1E4IA 1EHAA 2UY4A 3PZVA 1O5XA 1VBJA 1T99A 2QCGA 2EBNA 2OYLA 4DI8A 3M0IA 4Q4RA 1T0OA 3PM6A 2D22A 5EFFA 4Q6XA 4QLKA 2QKFA 2E6DA 2VXNA 4GNKB 1QCWA 1OIMA 2VFIA 2VGGA 3KL5A 3M0VA 1OFEA 4H2CA 4B9ZA 4YWSA 3SAZA 2ZWZA 4W7VA 1J79A 3FN9A 3TA9A 1AW2A 2GQ8A 2V3FA 3EB3A 3FHQA 1AJ0A 3NQCA 1V6XA 4TUFA 4CLMA 1YDVA 3VIKA 2PP3A 3WLLA 2QULA 1EPVA 2OFJA 2WMFA 3QRHA 4KEZA 2OLSA 4HPNA 2X2GA 3R0UA 4R7JA <