3GYCA

Crystal structure of putative glycoside hydrolase (yp_001304622.1) from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
381
structure length
381
Chain Sequence
EISPRAITMWDFSWLERRWPGAGYEDWDQVLDELSERGYNAIRIDAYPHLIAENPMKKWLLKEVWNQQDWGSPDMNEVQVQPNLNLFLSKCKERDIKVGLSSWYRLDVDEVCLKLDTPEKLADCWLTILRSIEEDGLLDTILYVDLCNEWPGDSWAPFFAKTYPNVGWGNWYKEESLRWMKTSLEKMRQVYPDMPFLYSFDHGDVKKYEEVDCSFLDLYEHHIWMAQQNGGEFYKLVGYGYNRFLPDDYKNVVKNAERVYRERPGYWQKLLTDKIELMASVARKNRRPLVTTECWGLVDYKDWPLLKWDWVKDLCELGTITAARTGMWVGVATSNFCGPQFAGMWRDVEWHKRLTSIIRSSPLDESLTKNNEVAAKLLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glycoside hydrolase
publication title Crystal structure of putative glycoside hydrolase (YP_001304622.1) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Hydrolase
total genus 158
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12876 Cellulase-like Sugar-binding cellulase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gycA00
2XVGA 3WDHA 3DYPA 1JD9A 1H49A 2DSKA 3AIVA 3VM7A 4S3KA 2ZUVA 1DEDA 1SFSA 3CUGA 2D24A 2EQDA 1VFFA 3AMCA 1MW3A 1TZ7A 4M82A 5FIPA 3FY1A 1JNEA 3MU7A 5D9NA 1V0KA 2GJXA 3K1DA 3PZUA 1ZB5A 4MB1A 4BQ5A 1V02A 1AQMA 1RH9A 4V27A 3OLIA 4HZ6A 1E15A 1OSEA 2Q8XA 1GQKA 1H0IA 1QNRA 1UKQA 2XM2A 3VOCA 5CPQA 1JFXA 1WZLA 4GZJA 2QLYA 3RM9A 3WY1A 1B3XA 1VBUA 1QOXA 4HA3A 5LA0A 4JCMA 4NRSA 3BH4A 2XG9A 2O9PA 1M01A 2CXGA 2O9TA 5HPCA 3FAWA 1GJUA 2O92A 5BCAA 2HVMA 2DH2A 1EHNA 2JF7A 1HP4A 2VCAA 4OZOA 1OGGA 3VTRA 4H8HA 1IV8A 2DEPA 4UQDA 4HMDA 2B31A 2YDQA 4TX8A 1VFMA 1LL7A 1NM9A 5CLTA 2QHAA 2NW0A 1J12A 3M46A 1CTNA 5CQ1A 5IHSA 1E73M 3OLGA 1LG1A 2VQTA 1WE5A 1B1YA 3VIJA 4CD7A 3K8LA 2XUCA 4R27A 1R8LA 3CZJA 4OOZA 3CZEA 3F5KA 1Q6CA 1BG9A 1VJSA 5HNNA 5JIPA 1LWJA 2OYKA 3VKKA 3A6OA 1WZAA 1VBRA 3KL0A 3WUEA 4TXEA 4FLRA 2EO7A 3CHFA 1VEOA 4KGLA 4OBRA 1WP6A 4P8UA 3WQ6A 1ODUA 3CHCA 1KQYA 4CVUA 1C8YA 4KRTA 3UG5A 1C8XA 5JUVA 3WIJA 3SCVA 3WMSA 1EHAA 5A1AA 4NI3A 3THDA 4BS0A 3GNRA 1XSJA 4ACZA 4J3UA 4JKLA 1UH2A 3QOKA 2PWHA 4HZ7A 2WMGA 3VU2A 1RPKA 2EEXA 1ECEA 3POHA 4OUEA 2EPNA 4GQRA 3CIVA 4LYRA 3PZVA 2O9RA 1FFQA 3A4WA 3NDZA 5EMYA 1X1NA 1E0WA 1Q6GA 3FHQA 2RGLA 3SUSA 1CENA 4HTYA 4P7NA 1GZJA 3OBAA 1E4MM 4GINA 4Z2GA 4UFJA 4KGJA 4EAMA 3U57A 4AYSA 4E8DA 3AS3A 4J3WA 5A6KA 4MNJA 5E9AA 5CG0A 5I23A 4ATDA 1MW2A 2VR4A 2BFGA 5A6SA 1MW1A 2YDSA 3TONA 2EPMX 2ZX7A 4HU0A 3MUAA 4M80A 4D6EA 1BYDA 3AROA 3BC9A 3WQ5A 5A8OA 3TTOA 2X0YA 4PMRA 2VX7A 4CUCA 1JYXA 1BYAA 3W27A 2MANA 3CH9A 3W24A 3GM8A 4WKFA 3ARUA 2V38A 2WHJA 3WN6A 4AZ7A 2OYLA 1J11A 4FMVA 3RO8A 1DWHM 4CCDA 2A3BA 3AMGA 1BFNA 1X6LA 5E09A 1V03A 2G41A 1I1XA 3L2MA 3ZSTA 3QR3A 6TAAA 3APGA 1ITXA 3ECQA 4GIAA 2VNCA 2NSXA 1EQCA 5ECUA 1E5JA 4DM2A 1V6YA 1E3XA 1QBAA 1H5VA 5DO8A 4AZGA 1W9XA 2UY3A 3VIOA 3CZLA 3AZTA 3VILA 1FH7A 4JCLA 4QCFA 3CZKA 2OWCA 1G94A 1VB9A 1HKJA 2AOSA 2WMHA 3WH6A 5CSUA 4OIFA 4W89A 5A69A 1LJYA 3W81A 1MYRA 5IHRA 2ZX9A 1WDPA 5DMYA 1N82A 1CXEA 1UYQA 3IANA 1UR2A 3CZ8A 3T0DA 5I3DA 4AD0A 4WF7A 4D6IA 3L2LA 1HVQA 2JEQA 1GOMA 1VJZA 1C3FA 2WVVB 1BTCA 1ISVA 1E43A 3WH5A 1KBKA 5E0CA 4E2OA 4QAWA 2BY0A 1OD8A 1V6UA 3DYMA 3CMJA 4L4OA 4HOZA 1QW9A 4EE9A 4AMCA 2BY3A 4AZCB 3B8SA 1Q6EA 4AXNA 2IUZA 3TTSA 4UTFA 1ZBKA 2CITA 4M1RA 2D0GA 4DUWA 3BAWA 3RJXA 1TG7A 3WKZA 2BV9A 3SCOA 2NT1A 5DT5A 2XFYA 1I1WA 3N04A 3WEZA 2BVYA 5KZ6A 5BWFA 2VX6A 4Q7NA 4PBGA 4ML4A 2WYSA 4XZBA 2XIIA 3EDKA 1E9LA 1W32A 2VRQA 1QI5A 2BVDA 1KBBA 1OB0A 1JYNA 3K8MA 3RIKA 4FLSA 3SCTA 1C91A 3JUGA 2C0HA 4R5EA 2YL6A 2J75A 3W29A 2WC4A 1UWQA 4ZE4A 1W3JA 2WVUA 2ZXAA 1MW0A 2Y4SA 3VIGA 4P7QA 1JIBA 3AXXA 5I6SA 3T0BA 4YHEA 2G8ZA 1CXKA 4X9YA 1B3ZA 3ZR6A 1EOMA 3ZQ9A 2J8FA 4PUEA 2PBGA 1US2A 4W93A 3FXYA 4M8UA 5FOOA 1E4IA 1H4PA 1D3CA 2JEPA 4Z2HA 2DDXA 1KXVA 1XCXA 1TVNA 1V3MA 3WDIA 2UWFA 1VFOA 1CPUA 4JL2A 2JE8A 1B9ZA 3CHDA 4XZWA 3LMYA 1OIMA 3BAIA 4AIOA 1DWAM 5A95A 3W38A 1JF6A 3OZOA 4U2ZA 2YL9A 4P7LA 2DIJA 3MO4A 3I3DA 1R7OA 4HA4A 1IT0A 1UKSA 1W2VA 1UD2A 1B30A 2DPEA 2XTKA 3QOMA 1W3HA 5HPOA 1BVZA 3VD4A 4CU7A 2HISA 2VCCA 2WMIA 4A3YA 1HNYA 3AHZA 1CZ1A 4PCTA 1E0VA 5CSYA 1GQLA 2FH8A 4B16A 4BCEA 5A8PA 3F5JA 2BXYA 2YBUA 1W1YA 3AOFA 4DUXA 1JF5A 3A4XA 3W6LA 4B9YA 1XYZA 2BXZA 4TTUA 4AIEA 1NARA 3K4AA 1CXHA 1GQIA 1PBGA 5ABGA 3VGBA 2VO5A 3OG2A 1JFHA 3O9NA 5IFTA 5D8ZA 2YDRA 1KXHA 4P8VA 3L4WA 3W37A 3WDJA 4AWEA 3WUGA 3VGEA 4CN1A 4P8WA 1CGWA 1PAMA 3AIRA 2FGZA 4UR9A 1CXLA 2G3IA 3AIBA 3ZMRA 3ARTA 2D22A 5M03A 3B9EA 4UQCA 2D0FA 2WZIA 4HP5A 3AHVA 8CGTA 2RGMA 3A47A 4OKDA 5FD0A 2CBIA 1NP0A 3ARSA 5A6BD 4JL1A 1VEPA 2EXOA 4LX4A 4H2CA 1F4AA 4GZEA 4WJXA 1H11A 4IISA 3ZR5A 4D72A 4PMXA 2PC8A 1V0LA 2WZHA 5I2UA 1BPLB 1WAWA 1WPCA 4CU8A 1K6AA 3N11A 1GCYA 1PPIA 4W7VA 1E1EA 2GJXB 2WW5A 4PRWA 2V3EA 1DTUA 4JZ5A 2D3LA 1M53A 1V3KA 4TVDA 2CCRA 2E9MA 1HKMA 3DC0A 4V28A 3UG4A 4NF7A 3NSXA 3ALGA 4JHOA 2VQUA 4Z2JA 2ZX8A 4HA1A 3PZIA 3HMCA 3NIYA 3EDJA 2CERA 1UZ4A 1WO2A 1CGVA 2VZSA 2Z1KA 1JD7A 3AYRA 2VZOA 2JIWA 4U33A 4W8AA 2WMKA 5E70A 1MQQA 2W63A 2ZWYA 3MMWA 2VX5A 4UQAA 4AD4A 5D8WA 5AC4A 1H1NA 5A2CA 1ZL1A 3WD3A 3UERA 5I0DA 7A3HA 4WKAA 2WWCA 3VGDA 1HT6A 4F9JA 1JZ7A 3UR7A 4WLCA 3F5LA 4M56A 4N42A 3AMKA 5JIWA 1B2YA 4KMQA 4FF5A 5I24A 4BA0A 1B90A 4W5ZA 2XGIA 1JXKA 1HP5A 2W91A 4H8UA 1UH3A 3D3AA 3WMBA 3M07A 1XYFA 2WXDM 3AJ7A 3K8KA 1VF8A 4JFVA 4C7DA 4W84A 2W62A 2D23A 4B9ZA 5JBFA 2W61A 4AZIA 3MUIA 4CD5A 4CVWA 2C7FA 3SEPA 2DSZA 3TOPA 3ARQA 1V3JA 3FN9A 1LG2A 3WDPP 1OGBA 1CIUA 1O7AA 5A6LA 5CGMA 4J3VA 2EJ1A 4U2YA 1AQ0A 3VMPA 1FHLA 3E1F1 2WVSA 4UFKA 3WFLA 1RP8A 2XPKA 2VRJA 2QMKA 4X0NA 5M5DA 3ZT6A 3OB8A 5EFFA 3A4AA 1FOBA 1GOIA 3ZT7A 2CPUA 2CETA 5FKYA 2D0HA 3OLDA 4PN2A 3VINA 2WVTA 1W1PA 3HU7A 5AYIA 4RL3A 4W8LA 4ACZB 1TE1A 3N15A 4C7GA 5D9OA 3RJYA 3UETA 3RM4A 2VTFA 4KWUA 1Z32X 1OGSA 1OIFA 2X05A 1E4NA 1ISZA 4U3AA 2BY1A 2BHUA 1JDAA 2J8GA 5AYBA 5M3WA 3TA9A 1ZS2A 1KB3A 2WM0A 3ARPA 2JFEX 3WFZA 4E4PA 4A3HA 1KGUA 2VOTA 1J9YA 2V5CA 4DWSD 2VR5A 4AY1A 4J27A 1JNDA 1ISWA 1U30A 3VGGA 4TVCA 2J7CA 3VX1A 4AD3A 3F4VA 5CLWA 1ZU8A 2GK1A 2BVTA 1MFVA 2ZUNA 1CDGA 2V3FA 3EDEA 3VNZA 1EA9C 4FK9A 3KL5A 5A8QA 2ZXBA 1LL4A 3T2QA 2XFRA 3BAJA 1LQ0A 4W7WA 2WMJA 3PZNA 3QGVA 3MUZ1 2F61A 4WSKA 2XVNA 1OCQA 2EPKX 2OYMA 2VRKA 3J7HA 4UQ9A 4H04A 1KFWA 1WDRA 2W4XA 1J01A 3M6DA 3OGVA 4XB3A 2DGAA 4AISA 2O9OA 3TTYA 3FAXA 3RPMA 1J0KA 3WH9A 4D71A 1JAEA 3IJ8A 1UD4A 1J18A 2OSWA 3ARVA 5CPSA 1BVNP 1BGAA 4MADA 3GXDA 3QHOA 3AICA 2DT3A 1I75A 3U5YA 4PMQA 4B3KA 2WNWA 3ARRA 2WCGA 4H41A 3VD7A 3CHEA 5BROA 2PI6A 2OLHA 2XWDA 4UQBA 5ABHA 4PMNA 1FH8A 1TR1A 2E4TA 1HJQA 3VX0A 4D1IA 4NZCA 4PEEA 4Z2KA 3CZGA 1YQ2A 2X8RA 3NSMA 3OGSA 3EDDA 1E4LA 1UA7A 3RM8A 1EIBA 1MQPA 4RE2A 4X0VA 3SCPA 4TX6A 1Q6DA 3L4TA 1R86A 5LA2A 4AZHA 1E6PA 2VZVA 1A47A 1GHSA 4FLOA 2CYGA 4CCCA 4XX6A 4PMOA 2AAAA 3SUUA 4Z2LA 3WDRA 1TCMA 2PWDA 1WNOA 4JAWA 2XFFA 5GNXA 2PBOA 3SUVA 5C8BB 3VUPA 3K4DA 3CLWA 2PWFA 3MSDA 2DH3A 1B3YA 2DT0A 4NSBA 5GQBA 2J7DA 1EDTA 1BAGA 1ZJBA 1C90A 3ZM8A 3PTMA 1LF1A 1UD3A 2WKGA 1HF6A 1KR0A 1C8QA 4Q22A 3L4XA 1HKIA 3WF3A 1JDDA 1CGUA 2PWEA 4HPGA 4K68A 4F8XA 1CEOA 1UQZA 3KL3A 3AXIA 2J79A 2DSVA 7TAAA 4W8BA 4BF7A 4GZIA 3TTQA 4GI6A 4MB4A 1W1TA 1CGXA 4UFMA 3UG3A 2OSXA 5GPRA 4HZ8A 2FHCA 5ABEA 4J3TA 1XD1A 3VD5A 1UKOA 5I78A 2EBNA 1F4HA 2BHYA 4WSJA 2ZXDA 2W5FA 1BF2A 1UG6A 3THCA 4WK9A 3VGFA 5CZKA 4H8VA 5M17A 2E9LA 2G4FA 1DWGM 1HJUA 4LXFA 1OBAA 2X09A 3AHTA 2XJ7A 2VX4A 4YPJA 2XSBA 1SMDA 1QVBA 2VL4A 2ZE0A 1V02E 3WF2A 1GVYA 1SYTA 1LL6A 3NUKA 1G9HA 2CBJA 5F7UA 3VDHA 3L4VA 2ZUUA 3CUHA 2NT0A 1QHOA 1D7FA 2ZX5A 2WCSA 9CGTA 1JZ6A 2WZEA 3LPGA 1ESWA 3AFBA 4MB3A 4PMVA 4MDPA 3GBDA 2WMIB 1UHVA 1LLOA 1VRXA 2WANA 1JYWA 3AHYA 1KWGA 4PTXA 3NCOA 4CGTA 4UCFA 4CN6A 4ZENA 3DYOA 1V3HA 2VZUA 1HJXA 2CBUA 3D5HA 1JGIA 3SUTA 5CXPA 1C93A 2EPLX 2J77A 2J78A 2ZUTA 1WKYA 3AMDA 4JIEA 2PF0A 3MMUA 1HXJA 3AS2A 2WPGA 2J7BA 3WD4A 1EDQA 1UA3A 2VMFA 1UWSA 2FH6A 2XM1A 4PSRA 4EK7A 3VIFA 3IAPA 3BMWA 1XV8A 4N0RA 5GNZA 4NRRA 3ARYA 4W7UA 1UZ1A 2WMFA 3AZRA 3SCQA 2E8YA 5IXEA 1EH9A 1GOKA 1OT2A 1R87A 2D2OA 4UNIA 1HVXA 4UZUA 1JAKA 3WELA 4MPKA 3GZAA 1MFUA 1R7AA 3W4RA 3WNMA 5HDRA 5A2AA 4CD6A 1WDQA 4CD8A 1M04A 1E6ZA 5C71A 2DSWA 1PX3A 2ZOXA 3AISA 2W67A 3WD1A 3ARXA 4QP0A 3AMLA 5CGTA 3NYDA 2X0HA 4LGXA 1V08A 1NQ6A 3WNNA 2CBVA 1BSIA 1E55A 2JIEA 4GI9A 3PZOA 1C7TA 3IJ7A 4BQ2A 3ZSSA 4AZ5A 6A3HA 3BSHA 3FNDA 1GOQA 3WENA 6CGTA 3GYCA 4YHGA 2Y8KA 4PMUA 2ZIDA 3SUWA 1EO7A 4Z2IA 2E3ZA 3MSGA 1ODZA 1W2PA 3UESA 1JL8A 4UQEA 3EBVA 1NOWA 1QPKA 1B31A 3AYSA 1R85A 4UFHA 2DSUA 3MS8A 1GVIA 2J7GA 2OWXA 1CYGA 1GONA 1UUQA 2FDMA 2GUYA 3LPPA 1ITCA 5AY7A 2YIHA 3AIEA 2UY5A 3PBGA 1VAHA 2YA2A 3WNPA 1UKPA 4DWSC 2YLAA 1QHZA 5A94A 2F2HA 1FA2A 1P6WA 2WSPA 1W9PA 1OWQA 4MNLA 4WIWA 1HL8A 1GW1A 2E40A 2Z1SA 1KCKA 3W25A 1PEZA 1UH4A 4D6FA 5LYRA 2J62A 2WLYA 4EKJA 3VMOA 4U31A 1V6VA 1K9EA 4LQ1A 1TVPA 3WL0A 4OOUA 3WUFA 1CGTA 2A3HA 3GH4A 4QCEA 2GSJA 3U5UA 1V3LA 3WQVA 1FP8A 1JI1A 2FHBA 3OIHA 2VURA 5BXSA 3SCSA 2FGLA 1TA3A 2QV4A 2WBGA 2WCAA 3FHAA 2OSYA 4CU6A 5BRQA 4AZBA 5HXMA 2VVNA 1MQRA 1KGWA 4GXPA 3ZOAA 3AHXA 1RP9A 1CECA 2A3CA 3AZSA 3WDQA 3EMQA 4D6HA 4V2XA 1QW8A 3S2CA 4A4AA 1DWJM 3T0AA 2CHOA 1YHTA 1U2YA 1QI4A 1D2KA 4ZEPA 5A3HA 1H2JA 2CKRA 1JYVA 1JI2A 3WH7A 4HMCA 3T08A 3OA5A 3CUIA 3WL1A 5A6MA 2G3MA 1E3ZA 1KGXA 3TP4A 2C8NA 5C70A 1B3VA 3WF1A 3VDBA 1BYCA 4MDOA 1BQCA 3AXHA 1XCWA 5TD4A 3I3EA 3OZPA 1S46A 4ZFMA 1W1VA 3GH5A 5A8NA 3AIWA 1NWUA 1JDCA 4LYQA 1G01A 1W9DM 1GHRA 5E0FA 4PTWA 4IM4A 3UR8A 1XC6A 4TTGA 1M03A 3LPOA 3VO0A 2G3NA 2J7FA 3AQUA 1FP9A 2GK1B 4IPLA 3PZQA 3ALFA 2X1IA 3GNPA 3KWXA 3NDYA 2A3AA 5I5RA 4BZYA 2D20A 1JZ2A 1GOOA 4GQQA 4WKHA 3NSNA 4HPHA 4DUVA 3QHMA 3PHAA 1UWTA 3SIMA 1QNOA 2TAAA 4S3JA 2Y24A 1XRVA 1X6NA 1CXIA 5HOSA 1OD0A 3MUY1 3AS1A 2YLLA 5ABFA 3O6AA 3PTQA 1ISYA 5LA1A 4JHZA 4JKMA 3PZGA 3ZO9A 1BYBA 4ATWA 1EXPA 1W3KA 3B9AA 4F79A 4DWSA 4BQ3A 4W5UA 2PB1A 4QDMA 1TFVA 2WK2A 1QNSA 1WZKA 1PJ9A 3AS0A 1E1FA 5A2BA 1E40A 3W0KA 3GXMA 1G1YA 3MV11 4M81A 1CWYA 4UOQA 1H09A 1WB0A 2YJQA 3BAKA 1GOWA 3BAYA 3M7SA 4F66A 2FHFA 1J0YA 2DT1A 3GH7A 3G6MA 5AC5A 1MVYA 4M24A 2ESCA 1XGZA 1JXJA 1PIFA 4AZ6A 1UR4A 2F8QA 1NH6A 2WAGA 2J74A 3KEHA 2D1ZA 1CNVA 1HKKA 2WC3A 3ZIZA 1PIGA 4CD4A 3VD9A 3W6MA 4XV0A 1Q6FA 1VFUA 2VT0A 4TUFA 3CTTA 4OJYA 5DF0A 1KWKA 4PTVA 3KZSA 2WWDA 1UOKA 1UR0A 2WLZA 2W92A 3CPUA 1V6XA 5EBAA 1FFRA 1E6SM 3N13A 3MANA 4PTMA 3WD0A 2X2YA 3BAXA 3O2LA 1ISXA 4UFLA 2W66A 2YA0A 3BXWA 2Y5EA 1FHDA 3BSGA 1J0JA 3RMEA 3CUJA 4AD2A 1C7SA 2GFTA 1OM0A 1MXDA 2JF6A 5D4YA 1EO5A 5IFPA 5E6YA 3N1AA 4PMZA 3VIHA 1PX4A 1JZ5A 2DQXA 5GNYA 2CNCA 4ATLA 2WHLA 3BCDA 3A3HA 4XUYA 1HX0A 4PCSA 3ARWA 4CN4A 2DIEA 5JBEA 4W88A 1L8NA 5I77A 3WNLA 5FL0A 3WH8A 1BLIA 1RD6A 1NP2A 1UR9A 1XH2A 1E6RA 3MMDA 1A3HA 1UWUA 1EDGA 5IDIA 3WUBA 1HJVA 4MJ4A 5EB8A 4AIUA 2YA1A 1AQHA 4J7RA 1HL9A 3CBWA 3VMNA 1QI2A 3AIUA 4AEFA 1E6XM 2VZTA 4W87A 1B3WA 3VIPA 3WEMA 2UY2A 5EFDA 3PZTA 4U5IA 4JFTA 3GBEA 1PX8A 3RDKA 1H3GA 3VDCA 4H7VA 1WDSA 3OGRA 3WQWA 3IK2A 3PN8A 2XVPA 3EMZA 3VD3A 2YL8A 5DFAA 1GNXA 3CUFA 2XVKA 1H0GA 1JZ4A 1CLXA 1J0HA 4LYPA 4L4PA 1BG4A 4FLQA 4IUGA 2WB5A 5A6JA 4D6DA 3VPLA 4HOXA 4MTVA 2ZXQA 4W86A 4JFWA 4AEEA 1US3A 2XGBA 3WNOA 3KE0A 4QLKA 3RILA 1ZBWA 3CMGA 4ACYA 1GJWA 3SCUA 5BYWA 4D6CA 1K9TA 1HJSA 1KCLA 3QHNA 2YBTA 1J0ZA 3DHPA 3PTKA 3G6LA 3VNYA 3GNOA 5DEZA 2BY2A 1E72M 2QMJA 2Y8VA 5FCZA 1XH0A 1OT1A 1E5NA 3IAQA 4J3SA 3MKKA 3S6TA 4TVUA 1OINA 2EPOA 4PSPA 1NWSA 2XIBA 4HOWA 1UWIA 3N9KA 3T2OA 4E8CA 1DHKA 1Q4NX 3SCRA 1PZ2A 1VIWA 2VC9A 5BRPA 4D6GA 4MNKA 2GDVA 1GUVA 4PYSA 2BNJA 1XSIA 3SCWA 3OLEA 1BHGA 1UR8A 1W9BM 2CKSA 4GO8A 3ZJ7A 3WBAA 5KEZA 3SURA 2VVSA 1ZBVA 1UD5A 2PWGA 2J7HA 1E56A 2V5DA 4JFUA 3LPFA 3AIQA 3U7VA 5CJ5A 1LWHA 1K9DA 4UZSA 1DWFM 1VENA 3RCNA 1H41A 3FW6A 2IXUA 3EYPA 1FH9A 2DT2A 2YOCA 4B3LA 3PZMA 3T2PA 1W91A 3W82A 3BLPX 1O6IA 1K9FA 3II1A 2BS9A 5D9PA 2ZUMA 3DECA 4QFUA 1XHGA 1SR0A 1MWOA 4JFSA 1B0IA 3NJ3A 1QI3A 1QNQA 2CEQA 2VI0A 2JALA 2WBKA 2YKKA 3POCA 4GPNA 1QNPA 4GI8A 3IJ9A 3GXIA 1EOKA 3VIMA 2XYLA 3U7BA 4IPNB 1WZMA 3WBEA 3T09A 2V3GA 2WSKA 1IZJA 4MB5A 4P8XA 2J47A 4CCEA 5D9MA 3VDAA 2A3EA 3WEOA 1GQJA 1W9UA 4JKKA 2WVVA 3BLKA 4PMYA 1UD8A 2D3NA 4P7OA 3UCQA 3WQ4A 4B15A 3VVGA 1PZ3A 3WF4A 1XD0A 3EDFA 4KH2A 2OWWA 4DM1A 3N17A 2WHMA 4J3XA 4AZCA 4LPCA 2CIPA 2WKLA 4MJ2A 1EGZA 4YN5A 3HN3A 1XH1A 1KQZA 1UD6A 2UY4A 4MAZA 1U33A 1UWRA 3ZT5A 4UFIA 1TMQA 4RE4A 5I79A 1ZBCA 4AC1X 4ZXOA 2VCBA 1C92A 1M7XA 4D6JA 1TUXA 3HJEA 3N12A 1G5AA 1NOFA 2Y2WA 4RE3A 4BQ4A 1UQYA 2ZUSA 3ZJ8A 2QPSA 1KXQA 2AMGA 4ZXLA 2E9BA 4U5KA 2E8ZA 3EMCA 1JZ8A 1GPFA 4UOJA 1J0IA 4P7RA 4CKQA 1L0PA 1SMAA 1EQPA 3DHUA 2ZICA 2WHKA 1BGGA 5CPTA 5JBDA 2YL5A 2E0PA 3I3BA 1TA3B 3VGHA 4KRUA 1MXGA 4HMEA 1V6WA 5E6ZA 1QI0A 4W85A 2J7EA 2IXVA 3L4UA 2VJXA 4U3CA 2QF8A 1HN1A 2WC7A 1QBBA 1DP0A 2BHZA 5A6BA 1W3LA 4D1JA 1E70M 1NWRA 3W26A 4QLLA 2GVYA 5BXTA 1HJWA 1XSKA 1GORA 3VIKA 1J10A 2XVLA 3AI0A 4GO9A 2CESA 3GXFA 4F9DA 3WNKA 2G3JA 2ZX6A 2QPUA 4AW7A 1V3IA 4C7FA 1DWIM 1AMYA 1W9VA 1CBGA 1Y7VA 2J4GA 3CGTA 1WCGA 1IZKA 5BXPA 1KR1A 2VUYA 3GTNA 3GDBA 4ZE5A 4MNMA 1E71M 1ZJAA 2GJRA 3CO4A 3WD2A 1KXTA 3K46A 1V0MA 4GKLA 4M29A 3WSUA 4MAVA 1JZ3A 2J25A 7CGTA 3ZJ6A 4EANA 3N18A 3ZJKA 2ZUWA 4OBSA 1NOUA 4QLJA 4Y7EA 3W53A 3W28A 4AD5A 1E6NA 1E6QM 4PMDA 4URIA 4UOZA 5BXRA 3PZ9A 1E0XA 1UKTA 2XHYA 2XSAA 3ARZA 1G0CA 1HIZA 4AD1A 3BCFA 4PUDA 5ABFB 8A3HA 1JG9A 1CXFA 2ZWZA 3MV01 4TOQA 2CHNA 3WQ8A 3WF0A 5HBFA 1UR1A 1VEMA 3SCNA 1CLVA 4DWSB 4J28A 2GJPA 1V0NA 3L4ZA 3BMVA 5A6AA 1AVAA 3VM5A 1NWTA 3WMCA 1CGYA 3BGAA 2V3DA 5A8MA 3B9DA 3VIIA 5FL1A 3L4YA 2GDUA 5DT7A 2XWEA 3UEQA 4HU8A 1QHPA
chains in the Genus database with same CATH superfamily
1GVQA 3QH2A 5G1YA 2AKMA 1H49A 2Y5JA 4YNGA 4E2VA 1VZWA 4L1GA 4RW3A 2ZDSA 3R6IA 1TWIA 3AU2A 3A5FA 2D24A 3NQ7A 1VFFA 3E0LA 1MW3A 3V18A 1TZ7A 5J8LA 3FY1A 3R11A 2HXUA 3GLCA 1MSSA 3LENA 3WQEA 3K1DA 3KCOA 2V30A 4QHRA 5C2CA 1PHWA 2VFIA 1RH9A 4V27A 2PCEA 3TYDA 1H0IA 4L65A 1UKQA 2XM2A 3WQOA 1DXIA 1NSJA 5F2GA 3WY1A 2BSLA 3GO2A 3WZ0E 3UY7A 1QOXA 2HV5A 3GDTA 4BEQA 3WLIA 3PBUA 5DXXA 5HPCA 2X7WA 1FWHC 1TJ0A 3OHIA 2F7FA 4FO4A 2I17A 1WBJA 5BW6A 2DEPA 3V1PA 2YDQA 3E0VA 3NXLA 3O15A 1J12A 1TR9A 3M46A 1O5RA 1LG1A 3VNDA 3YPIA 3VIJA 1EP2A 4CD7A 4JIIX 2XUCA 3E96A 1GVOA 4XZMX 4NUWA 4IIDA 1LWJA 3VKKA 2R1PA 1XDMA 1H7NA 1VBRA 3MCMA 1RQEA 4TXEA 2EO7A 3SN1A 4HK5A 4QG6A 4JQ3A 4AMAA 2FYMA 2VFDA 1KQYA 4IIFA 3VKDA 3IRDA 5JUVA 3T42A 4IIHA 4CNUA 3DBPA 1EHAA 5A1AA 1YNYA 4NI3A 4JDBA 2NWRA 4BS0A 3GNRA 1DJZA 1PIIA 1XSJA 1GG1A 1D7KA 3KDNA 3QOKA 4HZ7A 1RPKA 2EEXA 1ECEA 3CIVA 4LYRA 2VDHA 1FTXA 1X1NA 1Q6GA 1LLZA 1GK8A 3FHQA 2RGLA 4IL0A 1DXEA 1T8QA 1KCXA 1OFOA 3LBCA 4XO6A 2CLEA 3GTXA 3ITTA 4DJDC 4LY8A 2OKTA 3OBAA 2HS6A 1DIKA 3IARA 3TOYA 1E4MM 4UFJA 4KGJA 4LRTA 2PC4A 6ENLA 2AMXA 4AYSA 4UR8A 3AS3A 3SW6A 1J79A 5CPNA 5I23A 1IXOA 1MW2A 3EX2A 1WUFA 4JYFA 3KBWA 3RUBL 3Q2DA 1MW1A 4GY0A 3Q65A 3TYBA 4XD3A 4IJRA 2VKZG 4Z1AA 2NWSA 1BYDA 3AROA 1NEYA 3VOJA 4P61A 2X0YA 3C2FA 4DAIA 1YLVA 2XIOA 3W27A 2MANA 3DIPA 3CH9A 3W24A 2YW3A 4WKFA 4DYEA 4H6RA 1OYAA 2WHJA 1FQ0A 4AZ7A 1PUDA 2JKAA 4TV6A 2G95A 4GIRA 3RO8A 2A3BA 3AAMA 1BFNA 1O95A 1X6LA 4H01A 5E09A 5HUOA 1I1XA 2ZE3A 1OX5A 6TAAA 3ECQA 4DQWA 4GIAA 3GTHA 2NSXA 2O4QA 4DF1A 4LUTA 5DO8A 4OWGA 4M51A 2ACQA 1YADA 2PDPA 3O6YX 3V0UA 3HPXA 5DXYA 4G7EB 3WBYA 3NGJA 1HKJA 1KLYA 2DZAA 3TZNA 3LLDA 5CSUA 1I4NA 2PD5A 3U0HA 3KWSA 1XLCA 2O0TA 3V5OA 2Q3OA 1WDPA 1EXBA 5DMYA 3DG7A 4EAYA 1UYQA 5LHEA 3IANA 4F2BA 1XR2A 3CZ8A 1MDLA 3PFRA 2R14A 3L2LA 1HVQA 1CT5A 1GOMA 1MDRA 3OBKA 5E0CA 4C6JA 2BY0A 1B4KA 4IIEA 1V6UA 4OU1A 3M4HA 4L4OA 1Z8AA 1O1ZA 2Q09A 3LOTA 1QW9A 4B91A 4NNBA 4MJZA 3B4UA 4HIBA 1ZBKA 4DUWA 4I5UA 3HGRA 3U4AA 3VOFA 2XFYA 4UCGA 3N04A 5KZ6A 4TMBA 1A0EA 1F05A 1N7KA 2O4MA 1XCFA 1E9LA 2NSOA 3G1FA 3MA8A 2L5HA 3K8MA 3RIKA 3KCLA 1A0CA 4AH7A 1JPHA 3C56A 4K7YA 4JTUA 2RJGA 4ZSTA 4Y90A 4GQBA 3MO7A 4IQEA 3MCNA 2AQOA 4ZE4A 4A8LA 2PFHA 3IJQA 2Y4SA 4P7QA 1CI1A 4GX9A 3LHZA 5I6SA 1SR9A 3SDOA 3SFWA 4EWJA 3T0BA 4YHEA 4JY8A 3AYTA 4X9YA 2QVHA 1XC4A 1K4HA 3GHRA 4H00A 4J5NA 3FXYA 3WLSA 4U10A 2PDHA 3CYVA 2DDXA 2ATSA 4NIRA 3WDIA 2OPJA 1K1DA 4TV5A 4NJJA 2NQLA 3M0YA 3TSBA 3CHDA 4XZWA 3U2OA 2VOMA 3BAIA 1KC7A 5A95A 4NYYA 2HK1A 3OZOA 3GC5A 4MWAB 3VNKA 1GZGA 3KS6A 3I3DA 4HA4A 2DPEA 3QV6A 2OKOA 1BVZA 3N6HA 4ERAA 4J1OA 4F0HA 4CU7A 1S38A 2VCCA 2WMIA 3CT7A 1NIUA 6XIAA 3CAVA 2Z28A 3SFKA 4AWUA 3PB2A 4LH8A 1ZGDA 1L9WA 4M6QA 4KESA 1C9WA 3P6LA 2P3EA 4DJFA 1E0VA 4WD0A 3K1GA 1GQLA 4M6UA 1GZ1A 4PCFA 2BXYA 3R94A 1P43A 2YZ5A 3AOFA 5JU6A 4REQA 4DUXA 3W6LA 2W6RA 5D05A 3EXRA 4GWEA 4B9YA 2BXZA 4AIEA 4DVOA 1EPXA 3M0HA 1GQIA 2V81A 1PBGA 5ABGA 5FEXA 4O16A 3NYZA 2VP8A 4RDZA 4L1WA 3IUHA 2J9ZA 5IFTA 4PL2A 4DO5A 4JTQA 3E2QA 3QGAC 2NQJA 3VGEA 4CN1A 3LI1A 4UTKA 3ERPA 5AZ0A 2QV5A 1SO5A 4E2DA 4UR9A 2G3IA 3AIBA 1VFSA 3S1UA 4LFYA 8TIMA 4UQCA 1Q7QA 4X2PA 4EXBA 1DE5A 1FUYA 1N8WA 4Z0JA 3UW6A 3R2GA 5FSDC 3FGCB 3PAJA 1TPUA 5AKQA 1F4AA 1I8JA 4MKVA 4WJXA 3KTSA 4FAMA 4PBEA 1UB3A 3G0UA 5TQLA 3MT1A 3UJRA 2YCJA 3W7KA 2QAFA 1GCYA 1POKA 3ZVIA 2GJXB 4IFKA 3WQDA 1DTUA 4JZ5A 2D3LA 1M53A 4Y9MA 1V3KA 3N3TA 1ZPTA 1OCJA 4V28A 3WBWA 4NF7A 4H4IA 1YMYA 3PZIA 1DJNA 3EDJA 2CERA 2A7PA 2VZSA 3T0TA 5G1MA 4LTSA 2JIWA 2JBMA 3REQB 2GPTA 2R6OA 3N2CA 2ZWYA 4OFCA 2PGRA 2DJXA 4C1LA 3UERA 5I0DA 7A3HA 1TPDA 3UR7A 1OFPA 5C9UA 1EX5A 1ZP4A 2KAUC 1AL8A 5LIKX 4MF4A 3F5LA 3GSMA 4N42A 5HA7A 3HB9A 4KMQA 4LF2A 9XIMA 3AO0A 3UNDA 1KV8A 4W5ZA 2IPFA 2XGIA 3PPHA 1HP5A 3UXKA 3O7UA 4QDPA 4CQBA 3QV7A 2WXDM 3AJ7A 3P82A 1Q6RA 3O1NA 3BW3A 4MFEA 4C7DA 2IKHA 5F4WA 4DHGA 1LZOA 4B9ZA 5JBFA 2W61A 4GVFA 2GUUA 2ALRA 4NT0A 1FWRA 1SUXA 3FN9A 4JNMA 3GK0A 1O7AA 5A6LA 1Q5MA 3UZWA 4LBUA 2A2IA 1AQ0A 3ZWSA 4UFKA 2QR6A 2WVSA 2XPKA 1T41A 2VRJA 3ZT6A 1QPQA 1GOIA 3ZT7A 2E1DA 3SGZA 4NXKA 5DRCA 1W1PA 3HU7A 1YPFA 1ZJIA 4ACZB 1FWNA 5K4XA 3THUA 1TE1A 5D9OA 3UETA 2VTFA 1A3WA 3H24A 4F2TA 5H1WA 2A21A 2BGSA 2J8TA 1V5XA 3EPMA 2REQA 4XTDA 3ZFHA 3MQTA 4NZFA 3U4FA 2INEA 1AW5A 1J96A 2W0UA 1R3WA 2DZPA 1QT1A 2PP3A 1OCBA 3PAOA 4RDWA 1LT8A 2BTMA 3TLQA 4E4PA 3NAVA 4RDVA 4QE5A 2C79A 1J9YA 1XKJA 2OG9A 2FTWA 3KBNA 3KRUA 1MI3A 1ZU8A 2BVTA 1CDGA 3EDEA 1JR1A 3VNZA 3PJXA 3GC2A 3MKCA 3N2BA 1OHLA 3C0SA 5CAHA 2ZXBA 2OR2A 3T2QA 1X38A 3QVQA 3W1PA 3U3HA 2CLMA 1LQ0A 4JTGA 1W5QA 4GE8A 3MUZ1 1MZHA 1Q6OA 4WSKA 3NZPA 4AF0B 3SBFA 5FJTA 2Z0IA 1VCFA 4XB3A 1HTIA 3RPMA 3GXPA 2HVOA 1FDZA 3WH9A 2Z1BA 1JAEA 3KUMA 2PDXA 2Z25A 1BVNP 1BGAA 3L2IA 1P0EA 1FHVA 4MADA 2Z24A 3QHOA 4NHVA 1XRSA 5CZJA 3U5YA 4B3KA 4H9VA 3KRSA 5BROA 3THQA 3L12A 3FX4A 2Z4GA 3G1RA 4J35A 2E4TA 2YPIA 4B2DD 4PEEA 1WKEA 1DQWA 1TVLA 1KM6A 1E4LA 2RH9A 1MQPA 4IPPA 1KM0A 2QJMA 5F1VA 2QXWA 1EEXA 2CYGA 1VC4A 3SUUA 1BRLB 1AQFA 1P0BA 1IQ8A 2EG7A 3MC5A 2H8ZA 1TCMA 2FVKA 4ECLA 4XBKA 4Y8EA 3LMZA 3SUVA 4EIVA 5C8BB 5LXXA 5EPDA 1H1YA 1S5TA 2R1KA 3MI3A 5C9RA 1V77A 2DVXA 4JQ2A 1ZJBA 5LNSA 2I14A 3ZM8A 4GX8A 1HF6A 5CPMA 4CNPA 3WF3A 2EKGA 3SM0A 1B9BA 3U2CA 2OODA 1DIOA 4IGNA 4W8BA 4BF7A 3GKAA 1UMLA 5ABTA 2J24A 3GVGA 1CGXA 4L64A 2GSHA 2Z6JA 4BI6A 1YTKA 4ZO7A 2X41A 2CFFA 4BK9A 1D8CA 3H2OA 1Z44A 1XD1A 4KWVA 1Q63A 2BHYA 2ZXDA 2W5FA 5T9BG 4AQLA 1TV5A 3THCA 1V4YA 4AHQA 4WK9A 1W8GA 2XIMA 3RF9A 4GMEA 3KBJA 3SY1A 4LUJA 4XWUA 2E9LA 3LM7A 5G4WA 1W56A 4WZHA 3GZ3A 3AC0A 3W84A 1A5LC 3FJNA 3AUJA 4PMJA 3WJXA 4RLIA 5EMJA 1SYTA 3DGBA 5G5IA 1G9HA 2DZWA 4GY1A 3TA6A 1D3HA 3GU1A 1KKRA 1BWKA 3VDHA 3IJDA 3MUCA 3CUHA 2CLHA 3RLHA 2ZX5A 3CQKA 4JTRA 4RUBA 1ESWA 3AFBA 4R3UA 3CWHA 2DV0A 4QE1A 3NL6A 2ZKMX 4BR1A 2WANA 1JYWA 4GI4A 1WOAA 4CN6A 1M7OA 5HWNA 1HJXA 1JGIA 3SUTA 4UMBA 5HR7A 4JIPA 1EUNA 3CAKA 1ZAJA 4PE8A 2QPXA 1QK0A 2PF0A 3CQIA 3AS2A 2J7BA 1LM1A 4N4QA 6TIMA 4LUYA 1FDJA 1UWSA 2FH6A 5CH9A 3IAPA 2ZVRA 1XV8A 1XDJA 2ZRUA 5FESA 1Q7MA 5C5YA 3UJEA 1L6SA 3EB4A 2E8YA 1EH9A 4ZB2A 1HVXA 4UZUA 2E6AA 3PC0A 1JAKA 5HNTA 5AZ1A 1XINA 3T05A 4LVFA 1ME7A 1LBMA 1U83A 1M9HA 1R7AA 3W4RA 1OFDA 2QJNA 3PM6A 1S5NA 4CD6A 4CD8A 2BBFA 4GD0A 1ZCCA 1QRQA 4GVGA 1X1ZA 2F6XA 3O07A 4AXKA 4O1AA 1RALA 3LHVA 4M7TA 2HBVA 2QGYA 4LGXA 4NJIA 3O3RA 1BSIA 5AYYA 5IOBA 3W7CA 3BZJA 3AXMA 3LCHA 5CC3A 1FWBC 3ZSSA 4AZ5A 3ZZ1A 2E7FA 3M7WA 1QPRA 3PP7A 3UZYA 2E3ZA 3MSGA 1ODZA 1I60A 3UESA 4XIMA 5LIUX 4IIBA 1RUSA 3HQNA 3P67A 1XLAA 3GTIA 3JS3A 3R8HA 1XIHA 1B31A 3AYSA 2DSUA 3QQ0A 1W1A1 3MS8A 5C9WA 3R58A 3T55A 4AWSA 1OYBA 2OWXA 3FFSA 1GONA 4GISA 1G4SA 3BO9A 3LPPA 3B97A 1VBJA 4IJCA 3T4CA 3RX2A 1FWEC 3NPWA 3MMTA 4DWSC 3G1SA 4MMWA 3W1QA 2F2HA 1W9PA 1UUOA 1OWQA 4RKAA 3HIJA 2E40A 3OP2A 1XF0A 4JTFA 1R3SA 1XP3A 5LYRA 2J62A 1EL3A 1KFKA 4U31A 1V7AA 4LQ1A 3WL0A 3ITGA 4GCAA 1AMKA 2GSJA 3WQVA 1FP8A 2VURA 3FHAA 4S38A 1A5MC 4NZ1A 4CU6A 5HXMA 2VVNA 2G96A 1KFJA 4GXPA 5JXQA 2KX9A 4LVAA 1RP9A 4Y96A 1CECA 3AZSA 3WDQA 1QU4A 3EMQA 3MYPA 4V2XA 1XG3A 3S9YA 1QW8A 4A4AA 1YHTA 1U2YA 2BDQA 3LDVA 1JYVA 3WH7A 3T08A 4IGMA 3WBXA 3W7HA 2PDWA 3MJMA 3P62A 2F2KA 3CQ0A 4PRRA 2P5NA 4DZAA 4MDOA 3AXHA 1R9YA 1PTGA 3OZPA 2FLIA 4EX4A 1S46A 1LROA 2B7NA 4KBXA 3CV7A 1NWUA 3LQLA 1S2UA 3RRAA 1W9DM 2AL1A 3L9CA 4QSFA 1J2WA 4O0QA 4IM4A 3FGCA 3LY0A 3NL3A 4RV8A 1W17A 4O57A 2OLAA 2X1IA 3KWXA 2VWTA 2YFOA 4DELA 1NDWA 2P8BA 4WKHA 2NUXA 3QSTA 3O05A 4WY0F 2J9YA 5E9XA 5ECVA 5FJOA 4ZR8A 5HOSA 1OD0A 3MUY1 5KSWA 3GYEA 3UJ2A 5CC5A 1ISYA 4JHZA 3EEGA 3PZGA 2W3ZA 4K1WA 4IJBA 3CB3A 4G5DA 1BYBA 3REQA 4ATWA 1EXPA 2AGTA 4QX4A 2F6KA 1XJBA 4W5UA 2G97A 2WK2A 1WZKA 2RAGA 4DXKA 3N4FA 3AS0A 2HNEA 5A2BA 4Q4RA 5FACA 1NFGA 1W37A 3D46A 3IVUA 3QSRA 4UOQA 3S1VA 3IV3A 2DT1A 1LYXA 4I6KA 1AFSA 1UASA 4H6KA 2ISWA 2FKPA 1JGMA 1XGZA 4XD5A 3E2SA 4AZ6A 1NH6A 1IIGA 1K03A 2J74A 3INPA 2AQVA 2D1ZA 1PCKA 1CNVA 4ERGA 1ZSXA 4CD4A 1JPDX 4LV9A 3W6MA 1XIDA 5A5WA 1OEPA 4OJYA 2P8CA 4Q4OA 5LNUA 3KZSA 1UR0A 4LSBA 2W92A 1YRRA 1T8XA 3GWQA 3LG3A 1EPVA 3N2MA 4QNEA 1A4MA 3N13A 3O6DA 4N9CA 3MANA 3EA3A 4GYFA 1ISXA 2V67A 4UFLA 2YA0A 1VYRA 3BSGA 1J0JA 3OQ8A 1HL2A 3P74A 3RMEA 4F0KA 1E9YB 5HAOA 2JF6A 4O28A 1YTEA 5T8GA 1UP3A 3O06A 2ZCGA 2E6YA 4FR1A 2CNCA 4U28A 3DI1A 3LTYA 4IG2B 3H7RA 1PS9A 2ISFA 2V82A 2R91A 1L8NA 2XH0A 4GNVA 1EX1A 3WNLA 3MP3A 3WH8A 5I77A 1GKRA 1BLIA 1NP2A 5HR6A 3WLMA 1O4UA 4MG4A 3B8UA 3B8WA 4KS0A 5H6HA 1EF2A 3WUBA 3GIQA 1HJVA 1Q66A 1DBTA 4MJ4A 4NXSA 3PFMA 2YA1A 1AQHA 2VXNA 4J7RA 3R8GA 4Z0SA 3AIUA 3WQFA 1E6XM 3EOUA 1LUCB 2VZTA 4W87A 3VIPA 3WEMA 1SFTA 3R43A 7ENLA 3CPRA 4U5IA 3GUWA 4JFTA 4L5ZA 4EXAA 4IMFA 4X22A 4HK7A 3TTEA 3CUFA 1H0GA 4CEUC 1W6TA 2I9EA 1BG4A 4QM1A 4XKYB 4IUGA 1AW1A 4CQDA 2WB5A 4PZVA 3A23A 4MTVA 4IZGA 4AEEA 3EX3A 3CMGA 1W3NA 3KVKA 3SCUA 4D6CA 2HVNA 1HJSA 1KCLA 1J0ZA 2ABBA 1GVRA 2C14A 3DG6A 2VEKA 3AYVA 3R13A 3TROA 1JEZA 1OT1A 1IT7A 1E5NA 4GIEA 4I90A 1I6NA 1VFHA 4J3SA 2GOKA 5D2VA 4NZ3A 2ODOA 3W2UA 1LLWA 4E8CA 4B5UA 2C16A 1P7TA 2A6NA 1GUVA 4PYSA 1XLGA 1XSIA 3SCWA 1BHGA 4ZFCA 4PUWA 1UR8A 4AX6A 2EGZA 1QNVA 3ZJ7A 2OOGA 3W1TA 2VVSA 1ZALA 4DUOA 5AVNA 4JFUA 1A5BA 2QCFA 4JYEA 1G67A 2Z7KA 4XAGA 3W1NA 1K9DA 4Q7IA 5H2ZA 3RCNA 1IWPA 4Q6JA 2QGHA 4KETA 1ME8A 4UNKA 3BLPX 3W82A 1R3TA 3IJLA 3WO8A 1U1HA 3UZJA 3MI6A 2BS9A 1XUUA 3NXFA 5AC6A 1XHGA 4MWAC 1QI3A 1QNQA 2CEQA 2Z6IA 2JALA 4GPNA 4GYPC 1QNPA 2FFCA 3LI0A 3IJ9A 3GXIA 4NAEB 1TV2A 1EOKA 1TSIA 1YDVA 4IPNB 1SPQA 3P0XA 2V3GA 4RNJA 3V16A 2J47A 4CCEA 5D9MA 2A3EA 3WEOA 1GQJA 1W9UA 1TREA 4YWIA 3BLKA 1BD0A 1QASA 4P7OA 1XICA 3CAQA 1TPH1 6REQB 3HFTA 3VVGA 3UD6A 2HPIA 4KH2A 4A3UA 4ZQPA 4HNTA 4AZCA 1K7XA 2R94A 4DX3A 2GJLA 3W9ZA 1EGZA 3HN3A 1XH1A 2UY4A 2OGJA 3L0KA 3MVTA 3ZS4A 4WUIA 4A05A 4UIOA 1M7XA 3I7SA 1TUXA 4AVNA 3HJEA 2QCDB 2A7RA 3BOXA 1NOFA 1IGSA 3N73A 3M0ZA 3TJLA 4U5KA 3VKCA 2E8ZA 5DMNA 3EMCA 1GPFA 3EPNA 4UOJA 1J0IA 4KERA 2ZICA 3BGGA 3KBSA 1NJJA 3VK5A 2FB2A 4HHHA 3KCJA 1ZP3A 2DUXA 4NG3A 3I6RA 3M5XA 4UTTA 1P0KA 4ROPA 3FJLA 1UZDA 4U3CA 4S3FA 1UC4A 3W1RA 1QUMA 3OOQA 2BHZA 2XN1A 3APTA 4D1JA 1E70M 1A3XA 4MVAA 3BJSA 2FMOA 3W07A 4GO9A 1X96A 4DJFD 2TSYA 2CESA 4F9DA 3TC3A 3WNKA 2A7NA 2QPUA 3N19B 2ZRXA 1W9VA 2J4GA 2Y7FA 1IZKA 1ADSA 3ES7A 4HD5A 5G4EA 2E09A 4UTJA 2DP3A 3GTNA 1KV5A 2G5WA 3CO4A 4JX6A 1V0MA 4M29A 1OFQA 4JTDA 3NEHA 7CGTA 2NV2A 3HJZA 2BVWA 2G3FA 3FA3A 3GHUA 5HINA 3A9IA 4EPEC 1KD0A 1UKTA 1WDWA 2C15A 5FJJA 2XSAA 3PG8A 4YLWA 3ARZA 3BCFA 5KMYA 4LBRA 5HQLA 5ABFB 8A3HA 1X7FA 4J2MA 2CHNA 3R0UA 3OBEA 5E1QA 3CV2A 4KPLA 4N9EA 1JRCA 2XN2A 3BMVA 1TJPA 5A6AA 4JIHA 3BGAA 2V3DA 3G1XA 3B9DA 1XIJA 3OVQA 4MY8A 1FKXA 4HU8A 2GGIA 3WDHA 2FZBA 5IRPA 1B54A 1JRBA 1TPWA 2R1MA 2XINA 3OO2A 3W73A 4Z42C 5IDZA 3PJUA 5MKGB 1QR7A 2EQDA 3AMCA 4JBRA 4M82A 2C91A 4LEFA 5FIPA 3MU7A 1HUVA 1KRCC 4H9MA 1AODA 2Z2BA 3PZUA 4O53A 4BQ5A 4S3BA 1AQMA 5B7YA 1E15A 2Q8XA 1GQKA 2BOGX 3MHUA 5BU6A 1SSGA 2G4JA 5TIMA 1JFXA 1WZLA 4QXIA 2QLYA 3TCSA 1DIEA 1LOLA 3WLTA 4NJGA 1EJVC 1RHCA 2GLKA 5LA0A 2YGYA 4JCMA 3B0YA 2O9PA 4C6FA 4GXMA 1RXOB 3QMSA 3NDOA 3W1XA 2HVMA 2DH2A 4X2RA 3WK2A 3OZYA 4L56A 4K36A 3OTRA 4OZOA 4H8HA 1Y65A 1UCWA 1IV8A 2BMBA 4UQDA 3KBVA 1JCLA 2DZBA 2DUAA 4H9XA 3UWVA 1PHQA 1LL7A 1W54A 2QHAA 5CQ1A 1UBSA 1E73M 3OLGA 2ALDA 5I3JA 4R88A 3LUTA 3I10A 3TJIA 3CZJA 1DJXA 3F5KA 4JQ1A 3KOXA 3W76A 1BG9A 1V6TA 1VJSA 3LRKA 4FALA 3A6OA 4DO4A 2R8WA 1WAUA 4O8AA 4KGLA 3N2TA 3CHCA 4LC6A 4FNPA 4CVUA 4QNWA 1C8XA 4PBFA 3MHGA 5RUBA 3URNA 3M5YA 1ZUAX 4JKLA 1UH2A 3BQ6A 3MWAA 4XBJA 4WJ8A 3TK7A 1FWAC 3GNNA 4HMNA 3PWIA 4S1FA 4ZQMA 1FFQA 1E9IA 3EB2A 3T8LA 1H62A 3FKKA 1M3UA 3IGHX 3JR2A 4RX0A 1CENA 1PKMA 4V1XA 1ZTVA 4DPPA 2R82A 5I3HA 3C2YA 1KRBC 4GINA 5HMDA 4Z2GA 5BWAA 1SQ7A 2EHHA 1OCNA 2OX1A 4ROQA 3U57A 1HFBA 3KOZA 4ZO6A 2OFJA 5CSRA 4C6KA 5I3GA 2VR4A 3A22A 2HE8A 5A6SA 2Y8UA 2YDSA 2EPMX 4HSOA 3MUAA 4D6EA 5DCEA 1EP1A 5BMWA 5D30A 2QEZA 4DF0A 1R5YA 1IEQA 1AJZA 5A8OA 2YFNA 3C5QA 1JYXA 1GVFA 4DXXA 1U1JA 3P81A 1EZ2A 2VD9A 4JD4A 2V38A 2INZA 3UWYA 3KM8A 2OEKA 2OYLA 1DWHM 4ASTA 3N2OA 4Q33A 4CCDA 4HSNA 3NPUA 1I9CB 3CB8A 1TPFA 4Q8TA 1V03A 5XINA 3HGOA 4LY4A 4WXZA 3QR3A 1B57A 3APGA 1ITXA 1PO9A 3KLLA 1TX2A 1G4EA 1J93A 1R0MA 2VNCA 4YTSA 1UP0A 4IP4A 1O5QA 4DM2A 4GKTA 2ANUA 1H5VA 1W9XA 3SO7A 3CZLA 3DAQA 1XXXA 1NELA 3T0CA 1HO1A 1S2TA 3MDWA 3ZLGA 3SRDA 3I65A 3ICJA 4JTHA 3EEZA 1VB9A 2AOSA 3H12A 3GHSA 3WH6A 3PNZA 3F2CA 1MYRA 5IHRA 2ZX9A 3CQJA 4IG2A 1JQVA 1C29A 3E5PA 4WF7A 4D6IA 2I56A 4S3GA 3TQKA 1HW6A 1VJZA 5GJNA 1BTCA 1ISVA 4BF5A 1KBKA 4IX0A 2GL5A 5AFDA 1OF8A 1OD8A 2QIWA 3XIMA 3FDKA 2WV8A 1ELSA 2FTYA 3B40A 4ZGYA 2BY3A 3B8SA 1Q6EA 1TTIA 4E6MA 4TMCA 2YW4A 4AVFA 3WKZA 3NQDA 1O94A 1ZENA 4DBUA 3OEXA 2NQ5A 4UTWC 3WEZA 3QPEA 4Q7NA 3SQSA 2WYSA 1TPEA 2XIIA 2VRQA 2BVDA 1KBBA 1OB0A 4I8DA 4WDUA 1OJXA 4D8LA 2B0MA 2C0HA 2YL6A 2J75A 1VP5A 1EGMA 2WC4A 1O12A 1ZNNA 4A29A 2WVUA 1Q45A 1F7BA 3PWGA 4D8ZA 4BY3A 2ON3A 3AXXA 2PP0A 2Z2UA 3EWCA 4Q3MA 3ZQ9A 2Y6ZA 3V1HA 4PUEA 3DOPA 1US2A 2Z1VA 5FOOA 5I3FA 2YZRA 3UYCA 3EWWA 1TWSA 3T44A 1YW1A 5DMMA 2XH4A 2AL2B 1UUMA 2WZTA 4JL2A 1O5XA 1B9ZA 1AJ0A 2PD9A 3S5SA 4UNLA 1TIMA 3LHWA 2IQDA 2WZMA 3TFCA 4UWMA 3W38A 4DLMA 1A4LA 2NVCA 4P7LA 2WJZA 1W2VA 1UD2A 1B30A 3L67A 3VKBA 3LBMA 3LZ3A 3Q37A 3QOMA 1DJHA 4FOKA 1E1CB 3ANVA 3KBMA 4C6IA 1TV3A 3LSBA 3SQLA 6ALDA 2G37A 4M19A 5TF0A 4AVOA 2QS8A 1S1PA 3UZZA 2HRWA 3AWOA 2BB0A 2FH8A 5A8PA 1YNQA 3BLLA 4K6AA 3S1GA 3A4XA 3S42A 5FSEC 3DU0A 3WLRA 4FS9A 1NARA 3K4AA 3RFAA 2OU4A 3V3WA 1VPQA 2GVEA 3IACA 3EA1A 3SZ8A 1KBIA 2D73A 1B5TA 5D8ZA 2VGIA 4F0LA 4AWEA 3WUGA 3W2LA 2HJPA 4P8WA 1PAMA 1H7OA 3TSMA 4F40A 1FY6A 4KCTA 1GEHA 4W4QA 1UROA 2D22A 5M03A 5I3IA 1KM5A 2RGMA 2ATMA 5MF5A 5L9FA 4OKDA 4GYPA 5HJLA 1NP0A 3MTWA 3ARSA 3GTFA 1XLHA 2HDJA 1VEPA 2EXOA 4YS1A 4H2CA 2PWVA 4IISA 4Q8QA 3HA1A 4PMXA 1FWSA 4L4LA 1R9ZA 1AZ2A 2YR1A 4CU8A 1DL3A 1K6AA 3STEA 3RCMA 1ADOA 1VLWA 4KCVA 4HYVA 2FGBA 4TVDA 1T5AA 3HPAA 2H6RA 3UG4A 2PDKA 3NSXA 3V35A 4JHOA 4MWAD 2ZX8A 3TMQA 3HMCA 3NIYA 1UZ4A 2Z1KA 1CGVA 2VZOA 4U33A 2WMKA 5CZ0A 4J2PA 2W63A 2VX5A 5AC4A 3W85A 1ZL1A 4WKAA 2WWCA 1LBFA 4C1KA 2ONEA 1UW9A 4BEUA 1JZ7A 4WLCA 2HTMA 3MDUA 2OTDA 4FF5A 5I24A 3H2EA 3STCA 3WCZA 1JUKA 1JXKA 1H7XA 3D3AA 3M07A 3GVRA 1VF8A 4RJEA 5LHFA 4Z1BA 2R1LA 3MUIA 3CIWA 1Q13A 3TOPA 4Q4SA 1ZHAA 4JDYA 3WDPP 1OGBA 3SY8A 3OHMB 1BXNA 3GR4A 1XS2A 1IXNA 1CIUA 3LHTA 1TZZA 5CGMA 3PBMA 4J3VA 3H2AA 4HT3A 3C52A 4U2YA 1R38A 3NQEA 1MNZA 3E1F1 1RP8A 4Q32A 4X0NA 3V75A 3A4AA 4LC8A 4S3CA 1FOBA 1DIDA 1XYMA 3MY9A 2DZTA 2HWGA 1RK5A 1NDZA 3BCJA 4AHPA 3NG3A 3OLDA 1YXCA 3LEPA 4PN2A 1L8PA 2PDCA 2WVTA 5AYIA 5EBUA 4FXJA 1JDFA 1RD5A 1RSCA 3N15A 3A5VA 3UGVA 3BW2A 2NZLA 3TCEA 2GWGA 1OIFA 2X05A 4Y9NA 1W8SA 4K2SA 1ISZA 5BOEA 4Q8UA 4MPQA 3O16A 3DBNA 2J8GA 1DJWA 3N9RA 3TA9A 1CCWB 1ZS2A 4HNUA 3R0KA 3ZVHA 1A53A 2B7QA 4FF7A 3PS7A 4AY1A 1VYPX 4M7SA 1JNDA 1ISWA 1XRFA 3G0XA 4GUJA 4TVCA 3VX1A 4EOUA 1TELA 5GJPA 4NL1A 4Q4KA 4FK9A 3MHFA 2I7GA 4FXRA 2FIQA 5A8QA 4GABA 2VUNA 3RN6A 3BAJA 4Q8NA 2GQ8A 5C9XA 2F61A 4DAFA 2XVNA 1Z41A 3UNTA 2JKPA 4H04A 4GBDA 2W4XA 1BXCA 2OGYA 3OGVA 3VC6A 1R3QA 3HZ3A 2O9OA 3TTYA 3FAXA 4ONVA 4D71A 3E3HA 3IJ8A 1UD4A 3ABZA 3NQ2A 4O1BA 3ARVA 4B90A 4LUTB 3AICA 3K13A 4IIGA 2PLCA 3ARRA 3FYPA 7PTDA 4H41A 3BV7A 3VD7A 2PI6A 5ABHA 4WDXA 3E12A 1HJQA 3VX0A 2BP1A 3W22A 4D1IA 4NZCA 1YQ2A 5CC7A 3QYSA 4TQTA 3H55A 3CPGA 4JIQA 2HMCA 4NAFB 1YPXA 1EIXA 4RE2A 2D2JA 1J5SA 1A47A 1GHSA 4FLOA 4JPGA 4IHCA 5C0QA 3TX9A 4AG0A 3EGJA 4PMOA 2AAAA 4PODA 3URAA 1SW7A 3GAYA 2PWDA 5CG7A 3B04A 1WNOA 3TE9A 4JAWA 2XFFA 1P4CA 1H7RA 5GNXA 1BF6A 2PBOA 3BLDA 3COTA 3QN3A 2F38A 3CJPA 2ZA3A 1OFBA 2PWFA 3MSDA 2DH3A 1O1HA 4O0KA 3DC8A 1FCBA 2X42A 1BAGA 1C90A 1S3HA 3S5ZA 1NF0A 3NQVA 3BOFA 2IKIA 4B5XA 3NPVA 4Q22A 1UBPC 1WXZA 1HKIA 1JDDA 4L6DA 2FQIA 3G0SA 2BZNA 5AHLA 2PWEA 4PB3A 4I9AA 3TMLA 2DSVA 3TTQA 1OC7A 3VZZA 1W1TA 2ZZ4A 3UG3A 2OX4A 2OSXA 1RY0A 4HKPA 5GPRA 5ABEA 4J3TA 2XISA 3LSCA 1EYWA 3RXZA 4DO7A 3H22A 5I78A 3W3OA 1BEUA 1EJ7L 2POTA 4Q7BA 3H54A 3SADA 3F4CA 2E77A 4CLMA 3KVJA 4RPQA 3N34A 3BUVA 4O18A 3H7UA 2Q8ZA 3VGFA 1M68A 1PKNA 4K8HA 3KXQA 3EZ4A 4JN7A 4FOUA 2PDLA 5M17A 1F3TA 1RK6A 1OBAA 4R9XA 2X09A 2XJ7A 2VX4A 4ZZ9A 1KBLA 1FWCC 4JQ4A 1QVBA 2ZE0A 1V02E 1U5JA 3TC7A 3LA4A 4I9JA 1LL6A 3H6OA 2E28A 4GY7A 2E68A 2NT0A 1QHOA 2V9DA 3H2NA 2ZA2A 4K38A 4H2HA 2WZEA 4TX9A 3B0XA 2PDJA 2JQXA 4P2VA 4GLEA 4J40A 4MDPA 4N4PA 2WMIB 1UHVA 4QG9A 1LLOA 2QW5A 2I57A 3U2EA 4IT1A 4PCPA 1TJ1A 2VZUA 3EKLA 3TSDA 2PDQA 5CXPA 3HM7A 2J77A 2ZUTA 3LCGA 4JTJA 1WKYA 5K9XA 4REQB 1EKOA 2PZNA 3MMUA 3EOSA 1EDQA 2VMFA 3BE7A 3OVRA 3P8IA 2XM1A 4EK7A 3VIFA 3BMWA 5GNZA 4NRRA 3ARYA 2QDGA 5HMSA 5CBBA 1FXQA 4NKCA 1RV8A 4A3RA 3SCQA 4JEQA 3MVIA 1OT2A 2TPSA 3A21A 4UNIA 2VFHA 2RDUA 5DANA 1HGYA 5CEWA 1XLDA 4MPKA 1W5NA 3BG9A 5K7JA 1MFUA 1OYCA 1XLMA 2OOFA 3E5BA 3H2MA 5EL1A 3THAA 5HDRA 4UR7A 1H1ZA 2BLEA 3MP5A 4HK6A 5D2WA 1N2VA 5CJMA 1M04A 1BVWA 1M7PA 2V68A 2E1WA 1HQTA 1PX3A 2ZOXA 3AISA 2W67A 4TR9A 3GFXA 4QP0A 3NYDA 3DESA 1VD6A 1KM4A 1V08A 1NQ6A 3GXTA 4IFKB 4CNTA 2CBVA 4GI9A 1E55A 1C7TA 2H90A 4YTTA 3QTPA 3NO1A 3WENA 2EG8A 2ZC8A 2ZFAA 1CB7B 1OVDA 3S0CA 1F3XA 1F9CA 4DJEA 4XVDA 3EBVA 2QJIA 4LS1A 2GOUA 1XISA 4H7ZA 3ZWTA 5MHBA 4LYKA 2OXNA 4NZJA 4GNKB 4S2BA 3AIEA 4PUUA 4V33A 3PBGA 1A49A 3GFYA 2YLAA 2QCEA 2CZFA 1FA2A 4I7UA 2FVLA 1YTDA 1WOBA 1F3EA 3IS4A 2WLYA 3FSUA 4EKJA 3TDFA 1V6VA 1K9EA 4A8NA 1UPPA 4PUMA 1CGTA 4M1BA 1TV7A 1TPVA 4QCEA 3NVTA 3VZXA 3G77A 1JI1A 3NL5A 3NR0A 2FHBA 2FGLA 4E3VA 2WCAA 3UWEA 1H7WA 4GC3A 2DU2A 3UF9A 4NASA 1RQHA 1MQRA 1KGWA 3TIMA 4LUIA 3SSJA 3AHXA 3ZOAA 4HHMA 5H8PA 3WJWA 3T0AA 2CHOA 1QI4A 4ZEPA 5A3HA 3VYLA 2ABAA 1AL7A 3PY2A 2REQB 2G3MA 4ZTYA 2GWNA 1XW8A 3TP4A 4GC4A 5C70A 2ISDA 3CO8A 4LAOA 3GHTA 3TFXA 5U4NA 4HU4A 1E9ZB 4Y9OA 3IIOA 3BANA 2P76A 5AHEA 4QE4A 4ZQOA 4ZFMA 3GH5A 5A8NA 1RLCL 4JX4A 1G01A 5KZMA 1HGWA 4JEJA 3LXBA 4B5WA 2NQZA 3S83A 1X39A 3WJYA 1G69A 3UR8A 4XSMA 4TTGA 3TR2A 3VFLA 1EJSC 3LPOA 2G3NA 2VWSA 5FA5A 1R3VA 1JUEA 3TYAA 3FEMA 5I5RA 2FZNA 4GQQA 4HPHA 1SW3A 3TYZA 4DUVA 1N8FA 3LQGA 4MFDA 4N6EA 3H70A 2DY3A 3RGTA 4JKMA 3GNDA 1TE6A 1QK2A 1KFLA 1ML1A 1OC6A 1W3KA 3B9AA 3OVGA 4D9PA 4EWND 1ENUA 3ZYZA 4F79A 4BQ3A 4L80A 5HMFA 5AVHA 3UG8A 1N55A 4B4FA 3QY8A 1IXQA 3MV11 3W7OA 1XIEA 3L0GA 1F3WA 1H09A 2YJQA 4JXCA 5LNWA 3BAKA 1M6JA 5KETA 3B8VA 1P1XA 2TYSA 4AU0A 4F66A 3GH7A 3GQYA 4IGHA 4RCXA 3NA8A 2GUBA 1ICPA 2ESCA 1D9EA 3S2LA 3GG0A 5SWUA 3SI9A 4ZA0A 3DCPA 3BMXA 1GOXA 2PEVA 3ZIZA 4XV0A 3TAKA 5DF0A 3QY6A 3TN6A 4KEVA 4K1GA 1QDSA 3CPUA 2NUYA 3ENLA 1V6XA 1FFRA 3KP1A 3CTLA 1ZZMA 4GFSA 3M64A 3D47A 3WD0A 1GYMA 2XH2A 3O2LA 1QPOA 3BICA 4MZYA 3VOIA 2Y5EA 2ZRYA 4TIMA 2FJUB 4GRSA 3OODA 1RAKA 1C7SA 1OM0A 1EO5A 5E6YA 5EMUA 2D2GA 3W7IA 1R30A 1VRDA 1F74A 4E38A 3ITOA 2DQXA 3RG6A 3QZ6A 1HX0A 4PCSA 2ZRWA 6XIMA 3V4BA 3S9ZA 2VFFA 4W88A 4L9YA 1UR9A 3ABSA 4IF2A 2OO0A 1E6RA 4C5YA 4IFOA 1J8VA 3T4WA 2OQLA 4MYAA 2ZTJA 4YXGA 2HROA 2Q02A 2TMDA 5G1TA 1BKHA 4G1NA 5EB8A 2V2DA 2C19A 4AEFA 4E2BA 3WJSA 3UWWA 3L5MA 2X1SA 3GBEA 1PX8A 3RDKA 1H3GA 1GEQA 3CNYA 4LNCA 3VFCA 2XGZA 4H7VA 1WDSA 3LERA 3IK2A 4PUNA 3P84A 3VC5A 3W7LA 5TAOA 2YL8A 4I6VA 2NQ9A 1GGOA 4PL1A 2HBXA 1CLXA 1OF6A 4LYPA 4L4PA 1FWGC 4FLQA 5F2IA 1L6FA 3CHVA 3VPLA 4D6DA 3B8IA 1X8FA 5G2HA 2XGBA 2Y0FA 3ONCA 3W02A 4ACYA 5D02A 2V63A 5BYWA 2DORA 3HPFA 3P60A 3QHNA 2X2GA 4KIRA 2NXIA 5H8UA 2OO6A 4AAJA 2BY2A 1YDYA 2Z1WA 1E72M 1A5AA 5FCZA 3MBDA 2LLEA 1XH0A 4RXGA 2PLKA 3W70A 1LRNA 3TWAA 3MKKA 4LCSA 3S6TA 1HKVA 4NAFA 2DFAA 2PRMA 3CH0A 2XIBA 1ONRA 3I6EA 3T2OA 5EMMA 1DHKA 1Q4NX 2VC9A 4AWTA 2QUMA 3P0WA 4D6GA 2GDVA 2BNJA 1O5KA 1XIFA 2PODA 3OLEA 4PRTA 1TB3A 4JX5A 4OECA 5EY5A 4GNJA 3PBWA 1UD5A 4BWLC 2J7HA 1E56A 4Q4PA 1Z3NA 1LWHA 4UZSA 1DWFM 4UTHA 1VENA 1GYLA 3FW6A 2IXUA 5M1TA 4AB4A 3BLEA 1E0UA 1W91A 1AD1A 4M6PA 1UJQA 1DOSA 1YDNA 3QJAA 2GDQA 4Q8MA 4UMCA 5D9PA 1LOQA 3RR1A 3QMRA 4JFSA 5C7VA 1YXDA 5CSSA 2VI0A 2WBKA 3POCA 4K8EA 2QJGA 4GI8A 3EOEA 3U7BA 3W01A 3WBEA 2PLJA 3OU8A 1IZJA 3TN3A 4MB5A 4P8XA 5DBUA 2E67A 2WVVA 4PMYA 3BLIA 1ADDA 1Q4WA 3CAWA 4LVBA 1A5UA 3P7YA 5HATA 3IVSA 3TYEA 4INFA 1JCYA 2WHMA 4J3XA 1OZMA 2Y1HA 2PWUA 1PWMA 3L5AA 3KHJA 4MAZA 4M6VA 4GQGA 3U48A 1FWFC 4AYGA 1IWAA 1WUEA 4AC1X 2VCBA 4D6JA 3VNIA 1F6PA 4WXYA 4BQ4A 1AK5A 3ZJ8A 4FSAA 2QPSA 2AMGA 2ZA1A 4BJHA 2ADAA 3F4NA 3VI2A 2ACUA 1JZ8A 1MEWA 4G2DA 5FI8A 5AECA 1S2WA 1EQPA 3W7QA 4KEZA 1VYSX 4GQ0A 4A3QA 1F73A 4PR4A 5JBDA 5LZLA 1ONXA 3CWOX 1P48A 3T40A 4HYRA 3VGHA 4KRUA 1MXGA 1XM3A 4R34A 4HMEA 1V6WA 1VBHA 2INFA 3KVMA 4I5RA 2A85A 4W85A 2IXVA 3C2VA 4XKMA 2DZVA 3VNJA 1QBBA 4X61A 1DP0A 4ZQRA 1RPXA 1SJBA 5LXEA 4BHYA 1I0BA 4NI8A 4R33A 1NDYA 3B05A 1NWRA 4QLLA 2GVYA 3FJ4A 2V69A 1XSKA 3IIVA 3AI0A 1BWLA 2OT0A 1X7IA 1O60A 2ZX6A 4LWWA 4AW7A 3PJTA 1JCJA 1DWIM 4XIAA 3M0LA 4X9SA 1PKLA 4GVHA 3PPFA 4MY9A 1XLFA 3NPXA 1POJA 3WD2A 1KXTA 3UA4A 4HSHA 1CW2A 4MYXA 4QBXA 1VH7A 3M0KA 3ZJ6A 2B81A 3O6CA 4EANA 3TR9A 3LXCA 4QLJA 4Y7EA 1WXYA 3VDGA 3S3GA 4GGBA 2CW6A 3L23A 1H5YA 2EF9A 4UOZA 1FHUA 2Q01A 2XHYA 4AIBA 3ABOA 2OZ3A 4LUSA 2YCLB 4PUJA 2NVDA 1JG9A 3ID7A 4DIAA 1XUZA 3MV01 3LGEA 3QMTA 4US5A 3WQ8A 4I7VA 1UR3M 5LIXX 4ORIA 2QUNA 1UR1A 3SCNA 4OE7A 2NXGA 2GJPA 4L61A 3G8RA 1YBQA 3UWQA 3WMCA 1CGYA 4GXWA 7REQA 3LCWA 3LRLA 3VIIA 5I02A 1QPNA 3TXVA 4E8GA 5FL1A 2IS7A 1Z9AA 3NZGA 2DUZA 3L4YA 5FJRA 2IKGA 4XUGA 3QV9A 1VHCA 1QHPA 1IE7C 1LQ2A 2ZRZA 1KLZA 4C6LA 4HVXA 2DSKA 1FCUA 5EKYA 4S3KA 4C6NA 3EOLA 1BSLA 2ZUVA 3BK0A 4BI7A 1SFSA 5EGRA 2FVMA 4NX0A 3T78A 5KZEA 1V0KA 3W7JA 1PTAA 1GVEA 1V02A 2JK2A 4RPPA 4O17A 3OLIA 4FI4A 3TYCA 1QNRA 4XAZA 3VOHA 4A6GA 4C5ZA 4Z1CA 3R7MA 5CPQA 3VOCA 4GZJA 1XPGA 1OFEA 3WLJA 3RM9A 1B3XA 3OG3A 4HA3A 1LOSA 4NRSA 3BW4A 2XG9A 3CK5A 1M01A 4HNCA 2V5KA 3WLOA 3FAWA 4HGXA 3S6OA 1GJUA 2O92A 2Y61A 1EC8A 3TQVA 1HP4A 1F76A 1N8IA 7XIMA 1GTEA 2VCAA 1OGGA 3VTRA 4US6A 3ITCA 4WJEA 5JH2A 4TX8A 2HQAA 4IMDA 4M3PA 3DZ1A 1I45A 5CLTA 2QNEA 5IHSA 1XRTA 1ZAHA 5C54A 1S2VA 2C1IA 2VQTA 1WE5A 1F2JA 4A21A 3K8LA 3PPGA 3MYOA 4OOZA 1KCZA 3CZEA 4I3GA 3TXZA 2NLYA 2OJPA 3GVWA 1Q6CA 1OQFA 3LXAA 5HNNA 3PB0A 2I5QA 4LOCA 2YXXA 5AYXA 3KL0A 3W88A 1LCOA 3HV8A 2VEIA 4FLRA 3CHFA 3QFEA 2V6AA 4OBRA 1KW1A 1WP6A 4LVDA 4P8UA 4Y6GA 3WQ6A 3TNOA 3DH7A 3MZNA 4KRTA 3TW6A 1VBGA 1PSCA 1YE6A 3WIJA 1YNPA 3WMSA 4W9TA 4ZCWA 3THDA 2JGQA 3PVFA 4Q8VA 2WMGA 3VU2A 2EPNA 4GQRA 1DHPA 3WLPA 1UC5A 4UTUA 3PZVA 4JYDA 2O9RA 3A4WA 5EMYA 1E0WA 2X40A 3UR5A 2MUCA 1G4TA 3VNMA 4NZ4A 3GY1A 3URQA 4HNVA 4P7NA 2PP1A 4YYFA 1GZJA 1Y0EA 1GW9A 4LAKA 1VS1A 4E8DA 4XK2A 4MNJA 5E9AA 5CG0A 1VHNA 3CIXA 3S4TA 4ATDA 4C1NB 1TMHA 4GIYA 4WEVX 4WR3A 3QC0A 3S6DA 3F2BA 3QF0A 5FJIA 4HU0A 1I2NA 4H9ZA 2F9RA 1UWAA 3BC9A 4S3DA 2O7QA 1WKDA 2BG5A 1A5CA 2VX7A 1P7TB 3B8TA 3GM8A 3GNXA 2OZ0A 4PTDA 4RR4A 3GVVA 3WN6A 2F6UA 1J11A 1DYSA 1M1BA 1EBHA 4EPKA 2VHLA 3AMGA 1PV8A 3WX7A 4LS0A 1I2RA 3DKJA 5HK4A 5B80A 1V6YA 1E3XA 5DLCA 3RU6A 2UY3A 3DKLA 3LNMA 1PZ1A 3G1YA 2Z2AA 1FH7A 4QCFA 1F5ZA 3PR2A 3L0NA 3PK7A 2VC5A 4IP7A 1RQBA 1G94A 3UCDA 4A8IA 4JTEA 1TRDA 2IW0A 2HE5A 1ICSA 4O15A 1KFCA 1LJYA 3W81A 1R2SA 2ZZ7A 1K02A 4JOMA 1CXEA 1ECQA 1XFBA 5FAJA 3T0DA 4C6EA 3VNLA 4HNOA 1SGJA 4DLFA 3RK8A 1VGAA 1E43A 5HJXA 4DJFC 5D03A 4QAWA 3CMJA 1SSDA 4CCZA 2OQHA 4EE9A 4AZCB 4JR5A 3U9IA 2CITA 2D0GA 1JPIA 4RZ5A 3BAWA 1A5NC 4XQ6A 4DI8A 4O50A 3EWYA 2BV9A 1M41A 1PVNA 3SCOA 1EUAA 2NT1A 2QCCA 4FNUA 2C6QA 4DJDA 2BVYA 2GGHA 4GVIA 2Q8LA 2PF8A 4MKNA 4ML4A 3B9OA 4HNLA 4LANA 3A4JA 3G8EA 1W32A 1QI5A 1JYNA 1X6UA 4LAMA 4DYKA 1C91A 4EVZA 3JUGA 3UFYA 1TPC1 2CZDA 4AEOA 3RLGA 3LCIA 4R5EA 5DN1A 5HULA 3CV1A 1W31A 3GR7A 1IZCA 5E5CA 3R12A 1S2AA 1W3JA 3KOYA 1IHIA 3I4EA 3VIGA 4C91A 3USZA 1LDCA 3PG9A 2G8ZA 1Q7ZA 3HGSA 3W6YA 1CXKA 1B3ZA 1THFD 4FXSA 3IRSA 4EXQA 3C0LA 3E0IA 3C3UA 3G5EA 1H4PA 1M65A 1XCXA 3T9PA 4IL2A 4GA8A 2JE8A 3QTGA 3RNDA 3UPWA 1OIMA 2ZZ6A 1JF6A 3RCYA 2P3ZA 2QUUA 4U2ZA 5T91A 2YL9A 5KITA 2DIJA 1XYAA 2PURA 3N14A 3MO4A 4H6QA 3VKAA 4JGDA 1IT0A 1UKSA 4LF1A 2XTKA 5HPOA 3QPYA 4QS6A 4QG8A 3C6CA 4NP7A 5FEZA 3S8HA 3C61A 1VKFA 5HWJA 4GOAA 2PDNA 1CZ1A 1KM2A 2Y88A 3RLUA 4MIMA 1RBOB 3URBA 2GQ3A 1ZRQA 1ZY9A 4B16A 4BCEA 3F5JA 2YBUA 5PTDA 3LD5A 4DWDA 4LCRA 1SJAA 4R85A 4TTUA 3W86A 2YB1A 2QVNA 4KCWA 1IF2A 1TTQA 3VGBA 1AZ1A 3OG2A 1JFHA 1VFLA 2GZXA 3S5OA 3W1AA 3FA5A 5T26A 2QYGA 1O66A 3H2CA 4LRSA 1OK4A 2YDRA 4JNZA 4O52A 3QXBA 4P8VA 3W37A 1QTWA 2PMQA 3AIRA 2FGZA 1CXLA 3ZMRA 3QW3A 4Z1DA 3ARTA 4DJED 4GH3A 3B9EA 1RCXB 3AHVA 4QJ1A 4A22A 3A47A 3AXKA 3W7RA 2CLLA 5FD0A 1TUFA 2CBIA 2BODX 5A6BD 3NZ1A 1F6YA 5D33A 4YVPA 3B0UX 4A35A 1OG0A 2VR2A 4GZEA 1S39A 2HSAA 3BG5A 1ALDA 2G0WA 1XIBA 2QQ6A 2PC8A 5K3VA 2WZHA 5F1UA 1LORA 3M5ZA 5E0KA 1KM1A 2XU2A 1PPIA 4W7VA 3EKZA 2V3EA 1M5WA 2ZDRA 4WQ6A 4KW2A 1XLBA 4MJMA 1L6WA 2E9MA 4DNMA 4OVXA 3ALGA 3M5VA 2VQUA 3KZPA 1K77A 4HA1A 3IVTA 2FTPA 4LEQA 2WOQA 1JD7A 4WY0A 4W8AA 4WGXA 5CBIA 1L6YA 1LT7A 1MQQA 5E70A 4IOTA 1CLKA 4AD4A 1H1NA 1UZHA 3VGDA 1A80A 4HCLA 2GJNA 3R5EA 1PWLA 1T40A 1RJQA 3LCLA 3CL7A 3B3DA 4M56A 3AMKA 5JIWA 3H21A 1B2YA 4IQJA 3CM4A 3HGJA 4BA0A 4R7JA 1XQLA 2W91A 4HA0A 4H8UA 3ANYA 3WMBA 2CWNA 3OZMA 3K8KA 1TV4A 1ZFJA 2W62A 1J6OA 3QKZA 4AZIA 1RCQA 4CVWA 2C7FA 3SEPA 4I8YA 2PDYA 2DSZA 3ARQA 1V3JA 4O19A 3V0TA 3ISIX 4LB4A 2Y89A 2IQ0A 1ZQ5A 4H8NA 4CQ9A 2PRLA 3VMPA 1FHLA 1V8EA 1GVSA 3WFLA 2QMKA 5I3KA 3V7PA 5M5DA 3OB8A 4WOQA 2CPUA 1EJRC 4GUFA 3BLOA 2CETA 5FKYA 5ENLA 5HQEA 3VINA 3A64A 5K9CA 1I0DA 2YCLA 4RL3A 2VEGA 3GW0A 1XQKA 2IQTA 3MZ2A 4MZ1A 2POZA 1ZCOA 4Q8WA 3RJYA 3RM4A 4KWUA 3OPSA 1Z32X 1OGSA 3M43A 4GBUA 1E4NA 4ZO9A 1SW0A 3NEVA 4U3AA 5HUPA 1T6MA 2BHUA 4ZVJA 4ZO8A 3WLLA 3BQ5A 5M3WA 4QAIA 3DFNA 3IGUA 2HS8A 1KB3A 2WM0A 4XZ9A 3O0FA 3C3NA 4O10A 2JFEX 1X97A 3WFZA 3BTNA 1OX4A 3NGFA 1QOPA 4C6PA 4O14A 4H9YA 5CKSA 1ICQA 2VR5A 4IFRA 4J27A 4ADTA 1KFEA 3DI0A 3ES8A 1TJRA 1JCMP 4AC7C 3RHGA 5D2XA 4AD3A 3F4VA 3TZFA 1LBLA 2GK1A 3CASA 1MFVA 2ZUNA 2GGGA 2ISSA 3LYEA 2E25A 1X8CA 4DF2A 1DVJA 3TQPA 2XFRA 2C71A 4A8RA 4HPXA 1GWJA 3PULA 4QEEA 4B5SA 1OCQA 4MY1A 3J7HA 2XDFA 3FS2A 5U7SA 4UQ9A 1WDRA 1LWIA 1J01A 4JTAA 3M6DA 3PUEA 2DGAA 4AISA 3WQCA 2OVLA 4YVVA 1DQUA 2CZEA 1J18A 2OSWA 1TO3A 3WK3A 4L6OA 2DT3A 3EX1A 3HURA 1I75A 2J27A 4L9XA 2RDWA 7TIMA 3PUDA 4HJWA 4JTLA 1K4GA 3CHEA 2BASA 2OLHA 2XWDA 4J4KA 4UQBA 5AC7A 3HFYA 1FH8A 3LX9A 3RYSA 3KW3A 3IUIA 3GUGA 4JTSA 3T1GA 1RZMA 2PA6A 4IGSA 4Z2KA 3CZGA 3G22A 2C1GA 5CGQA 3UZXA 2ZZ1A 1JULA 3OGSA 4RNIA 4Z08A 1UA7A 3G18A 3NZRA 1EIBA 4I5XA 4X0VA 3SCPA 3HPZA 1R86A 3L4TA 1E6PA 4MWAE 5DCDA 3L21A 4CCCA 4IXXA 3W2JA 2VYOA 3LBOA 4Z2LA 2NX1A 3DHDA 4FPSA 1VR6A 2FMNA 2DW6A 3CLWA 3IGXA 9XIAA 3IK4A 4H9TA 4B92A 1RJRA 1B3YA 2YXOA 4RXFA 2C1HA 2DT0A 4NSBA 3BURA 2J7DA 4XSLA 1VPYA 3PTMA 4S3AA 1LF1A 2WKGA 1KR0A 3EXSA 1C8QA 4O12A 1XDLA 3FK4A 1CGUA 3IWPA 3WQGA 4K68A 4PCNA 1Q8AA 1UQZA 3KL3A 1OG6A 2CLFA 4ZOCA 3H4XA 7TAAA 2ZQ0A 3UCCA 4MB4A 4ZOBA 4OTKA 3R8RA 3GR8A 4ICMA 4XVEA 2IKJA 3DXIA 2VM8A 3S2MA 3VD5A 1KRAC 1UKOA 1FX6A 4QJ3B 4DZ5A 1MNSA 1F4HA 1OZQA 3LRMA 3B0PA 4C1NA 1BF2A 1MUMA 3UXLA 5T9CE 4CNOA 1PYMA 3KOWA 4MM1A 3BJTA 1XBYA 2V5JA 1SO3A 1S5VA 4H8VA 3ZXWA 2G4FA 1DWGM 1HJUA 3KOFA 4XAYA 4LXFA 4TO8A 3WLNA 3SRKA 4YPJA 1ZAIA 5A6TC 1SMDA 2WSYA 2VL4A 3WF2A 1D8WA 3QR1A 2CBJA 5GVJA 5F7UA 3L4VA 2ZUUA 1NY1A 5M2FX 3CUXA 1ITUA 2I16A 1D7FA 9CGTA 2O55A 1JZ6A 3LPGA 3NQ8A 1GTHA 1SU5A 3LN3A 3VXGA 2Y7GA 4RV3A 4N2YA 2WNQA 3GBDA 3ABXA 2QULA 5DELA 1KWGA 3NCOA 4UCFA 3V0SA 1RCOB 4IMGA 1V3HA 3S47A 3USBA 3GRIA 1C93A 2EPLX 5GJMA 4QSHA 1WBHA 4JIEA 1ITQA 5F2MA 2CZ5A 1UP2A 2WPGA 4GUGA 1UA3A 3U8GA 3M41A 2CWXA 2VC7A 4F48A 4Z17A 3B03A 1XIMA 3N25A 5HNRA 4GUIA 4W7UA 4QQ3A 2YX0A 1IR2A <