3GYCA

Crystal structure of putative glycoside hydrolase (yp_001304622.1) from parabacteroides distasonis atcc 8503 at 1.85 a resolution
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
381
structure length
381
Chain Sequence
EISPRAITMWDFSWLERRWPGAGYEDWDQVLDELSERGYNAIRIDAYPHLIAENPMKKWLLKEVWNQQDWGSPDMNEVQVQPNLNLFLSKCKERDIKVGLSSWYRLDVDEVCLKLDTPEKLADCWLTILRSIEEDGLLDTILYVDLCNEWPGDSWAPFFAKTYPNVGWGNWYKEESLRWMKTSLEKMRQVYPDMPFLYSFDHGDVKKYEEVDCSFLDLYEHHIWMAQQNGGEFYKLVGYGYNRFLPDDYKNVVKNAERVYRERPGYWQKLLTDKIELMASVARKNRRPLVTTECWGLVDYKDWPLLKWDWVKDLCELGTITAARTGMWVGVATSNFCGPQFAGMWRDVEWHKRLTSIIRSSPLDESLTKNNEVAAKLLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative glycoside hydrolase (YP_001304622.1) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Hydrolase
molecule keywords Putative glycoside hydrolase
total genus 158
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12876 Cellulase-like Sugar-binding cellulase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gycA00
3VMPA 4JKMA 1V3HA 3K4AA 2VX7A 2X2YA 3W37A 4AEFA 1D3CA 4NF7A 2E9BA 1HKKA 4B3KA 2ZXQA 4KMQA 3KL3A 4PMOA 1HJSA 5M03A 3ARXA 5CSUA 1I1WA 1C8YA 4XX6A 2D20A 4L4OA 3RCNA 4PTWA 2JF6A 3LMYA 4ATLA 3PZOA 5A3HA 3VD9A 1UD2A 4GO9A 1C91A 2NT0A 1GHSA 3VUPA 2WMJA 2WB5A 4AIEA 1HKMA 4ZE4A 1CECA 1ECEA 2PWHA 5I0DA 2AAAA 1V6YA 1LWHA 4UFJA 3UR8A 3VD4A 1OGGA 4QLLA 1UKTA 2WVVA 3I3DA 3UESA 3ARPA 4ZXLA 2DT2A 1E4LA 2YLAA 2DSUA 1EQCA 1W9UA 3IAPA 3L4YA 1CGYA 1OWQA 2XFFA 4DWSA 4UQBA 3ZJ6A 2ZUSA 4J3SA 1J0YA 2PF0A 2WK2A 4MB1A 1WE5A 1XYZA 3W6LA 1KXTA 3VX0A 4BZYA 3GNPA 5D9PA 1DWHM 2Y5EA 4PMVA 2DEPA 3RM9A 3ARTA 3SCSA 3ARRA 5A2CA 5FD0A 4P8UA 2X0YA 2XYLA 1WB0A 1C3FA 2A3BA 5E0FA 2VCCA 1H4PA 2OLHA 2W4XA 1C8XA 1V6XA 3L4TA 4BF7A 5E6ZA 2W61A 4B16A 2VR5A 4D71A 3PTMA 1DWIM 5FIPA 4PRWA 2OYKA 2FDMA 2G3JA 3ZQ9A 1R8LA 3VPLA 3VD5A 4IISA 1KGXA 3CLWA 3BAWA 3L4WA 1TVNA 1GQIA 3VIKA 4DWSD 3WEZA 1X6LA 4HZ6A 3M7SA 3KL5A 2EPKX 4GKLA 4D1IA 1E6RA 5E6YA 3RM8A 4H8HA 1NWRA 3VTRA 2CBJA 1A3HA 4PCSA 1E0XA 1D2KA 4AYSA 4W8BA 2PC8A 1VBRA 1V08A 5I6SA 4V28A 4KRUA 1BHGA 2DH2A 5I77A 1UZ1A 3A4WA 1QNQA 2ZUVA 5GPRA 5CGMA 3VIGA 2PBGA 1VFUA 2D1ZA 1BPLB 4LQ1A 2DIEA 1PPIA 3GNOA 3VGDA 1F4AA 1XSIA 2J4GA 4Z2GA 5D8WA 1UR9A 1GOQA 4UQCA 4MB5A 1BLIA 1BYDA 1E4NA 3AIWA 4BQ3A 5AC5A 1VEMA 1QI2A 3FAWA 1JYNA 3ZSSA 4AD4A 1UA7A 2ZUUA 2RGMA 1ISZA 1WDPA 2YDSA 4FLQA 1UOKA 1EO5A 1E43A 1HIZA 1E73M 4JKLA 3QHMA 4JKKA 1SYTA 1EA9C 3ECQA 1GVIA 4D6CA 5BYWA 2CYGA 1ZL1A 4D6GA 1B90A 4JZ5A 4D72A 1N82A 1HJQA 3EDEA 1W1VA 1UD8A 3PTQA 3W27A 1DTUA 3FHQA 4MNJA 3VDBA 3NDYA 1E70M 2WMKA 2CEQA 1TG7A 3ZR6A 3AYSA 2GK1B 5D9NA 2PWGA 3PHAA 3PN8A 1XH1A 2JFEX 3OZOA 3CPUA 3F5JA 1GW1A 3BGAA 4JFTA 3MMUA 2GJRA 5IFTA 1M01A 3OLEA 1LF1A 2WMHA 5FOOA 4CN1A 3IJ7A 2EPLX 1WZMA 3AIRA 3WDHA 2W66A 4S3JA 1ZBCA 3II1A 3GBDA 1FHDA 5CPQA 2A3HA 1H41A 3WIJA 2GJXA 4F79A 4MNKA 2VVSA 3KL0A 5GQBA 3T08A 1CYGA 3OA5A 3LPPA 1M53A 1VJSA 1HT6A 6CGTA 1C7TA 3NIYA 3WN6A 2ZUTA 4Q7NA 4M29A 1UKSA 3S2CA 5DT5A 2CITA 2YLLA 2HISA 1G01A 1CLXA 3T0AA 2VL4A 2WLYA 3LPOA 1BGAA 1CXIA 2BXYA 3RO8A 4ZE5A 1CTNA 4W7UA 3UCQA 1E1EA 1KCKA 1QI5A 3WY1A 3AS3A 5JIWA 2Y2WA 4UFMA 3SCPA 3CZGA 4Z2KA 1CNVA 2FGLA 5F7UA 5JIPA 4GI9A 3WDPP 3O6AA 1E72M 4MAZA 1M7XA 4WKAA 4UOJA 3SCVA 2CERA 2BY3A 1J12A 5LA2A 4KRTA 2J47A 4QP0A 2WSKA 1IV8A 1LJYA 2YL6A 3B9EA 5I24A 1KR0A 2J7BA 3WH6A 3SEPA 2QMJA 5A2BA 3SIMA 3CZLA 4QLJA 1PZ3A 3W81A 3W53A 2O9TA 1NP0A 4HMCA 1LWJA 4H8VA 4BQ5A 4CVWA 3MUY1 1RH9A 1JAKA 1EOMA 3VILA 3MUAA 4H41A 2FH8A 4W84A 1KQZA 2W92A 4GI8A 1BTCA 1D7FA 3WKZA 3VM7A 3BAJA 1UD4A 2VRQA 4NRSA 2EQDA 3PZUA 1JDAA 3W28A 4EAMA 1GORA 1KR1A 1PJ9A 5ECUA 3CUIA 3N11A 1UKQA 2WZHA 4A4AA 2CHOA 5ABGA 2DPEA 4ACYA 1WZAA 1VFOA 1W9XA 4HOZA 1US3A 4QCEA 1W1TA 2GDUA 2WMFA 4Z2IA 1X1NA 3NCOA 1WKYA 4W87A 3AYRA 2NW0A 3DYPA 3GH5A 4HZ7A 1HL8A 4E8CA 4PTXA 1OD8A 4D6HA 1KXVA 5FL1A 4QAWA 1S46A 1V03A 3RJYA 1TVPA 1QHPA 4AMCA 3HMCA 1KCLA 1H09A 5CXPA 4CN6A 1Q6GA 1VIWA 2OWCA 5A8QA 4AZGA 1QW9A 1Y7VA 1JZ4A 2F8QA 4W7VA 2PBOA 4UFKA 1H2JA 3VINA 3WNKA 4CU6A 3CHCA 4Q22A 5A6KA 1FFRA 3OGRA 3SUSA 4NI3A 3AMCA 3B8SA 2ZUWA 1OIFA 5TD4A 2D0HA 2FHBA 4HU8A 5FL0A 4WF7A 3AXXA 3EMCA 1XH0A 2X09A 1ITXA 4EANA 3F4VA 1RP9A 2PI6A 5A94A 4LX4A 3KZSA 5CZKA 1UR4A 4IUGA 4F8XA 4AXNA 3AMDA 2YA0A 1B0IA 1PEZA 3CMGA 3PZGA 1E15A 3WQ5A 1OBAA 3THDA 3WQ4A 2EPNA 3I3EA 3VMNA 1UHVA 1XHGA 4AD2A 2CBUA 3AJ7A 4JL1A 3K1DA 1EH9A 3ZJKA 2D3LA 2VX6A 4TXEA 2VX4A 1RP8A 4CCEA 5A6LA 1UWRA 1JYVA 3OZPA 2BNJA 5A6AA 2D22A 2DSZA 5CPTA 2F61A 5HOSA 3JUGA 2XTKA 1J11A 1WZKA 2A3EA 4OUEA 4V27A 1XCXA 1XC6A 3WF1A 2XVLA 1J10A 3L4UA 4RE4A 3WUEA 3POCA 1G5AA 3BAIA 3AXIA 4GXPA 1TUXA 1X6NA 3U5YA 1MYRA 4ATDA 1LG2A 3O2LA 1CPUA 1B31A 2J62A 3WH7A 1GPFA 3K8KA 3THCA 1EGZA 1ZJAA 2CKRA 3N1AA 3MV01 1H1NA 4GQQA 4XUYA 4AWEA 4BQ2A 3L2LA 1UUQA 4MTVA 2CXGA 4CU8A 4PSRA 3VDCA 3B9DA 4D6EA 4U33A 4PN2A 1AVAA 3TOPA 3ARQA 5CQ1A 4DM1A 3WELA 5JBDA 5BRQA 1GZJA 4UFIA 1E0VA 3TTQA 2XSAA 2XFYA 2WCGA 2ZX8A 3NSMA 5A8NA 3M6DA 4UR9A 4J7RA 1NM9A 2FH6A 3AFBA 4A3HA 1DP0A 5I3DA 1QPKA 2Z1SA 4DUWA 4H8UA 3RIKA 2EPMX 3FXYA 1GOMA 1SMDA 4AZ7A 3RM4A 5CJ5A 2WVTA 3CZEA 1CGTA 3ZR5A 1UWTA 3EDDA 1W9VA 1VB9A 4TX8A 1B3WA 4NRRA 3VOCA 1R87A 3WMSA 1V3KA 3GZAA 3GNRA 2Q8XA 4UOQA 7CGTA 4OBSA 4U2YA 1B3XA 4H2CA 1KGUA 2X0HA 2WYSA 4J3XA 3OBAA 3GYCA 3ARVA 5D4YA 3OGVA 3SUUA 2GK1A 4AD5A 2X05A 4AY1A 1DWGM 1PAMA 4P7NA 1E6NA 4HP5A 2VZVA 4F66A 2VNCA 5LA1A 2OYMA 3SUWA 2DQXA 1HKJA 2XG9A 4WIWA 3N13A 2DGAA 1VFMA 5EBAA 2WVVB 3AS0A 3BCDA 1I75A 5IXEA 2JIEA 5GNZA 2E4TA 5HNNA 4RL3A 4UZUA 2J75A 3WEOA 3A3HA 4ML4A 1UR8A 1B3VA 1SMAA 4HA3A 4D6JA 2WAGA 2ZUMA 1JIBA 3IANA 3U57A 1OB0A 1U30A 2XIIA 3G6MA 1C90A 4XV0A 4GQRA 2XVKA 1Q6EA 3AMLA 1XH2A 2HVMA 3A4AA 3CBWA 2WCSA 2J7FA 1IT0A 1CGWA 4JCLA 4HOWA 2VT0A 3QR3A 5D9OA 1WZLA 2O9RA 4PUEA 2DSWA 3SURA 4AD0A 3BSGA 2E9LA 1OINA 1ISXA 1VRXA 4HMEA 4GPNA 4P7QA 3LPFA 4WKFA 2GFTA 5GNYA 1PX3A 3CUFA 4P8VA 4IPNB 3SUVA 3U7VA 1KBBA 1EIBA 1HL9A 1UKOA 1HP5A 4LXFA 1H3GA 1PX4A 3WD0A 4M1RA 2VOTA 3AS1A 1QI3A 1QNRA 4LYQA 3BH4A 4J3WA 1K9DA 5DFAA 2PWEA 2CIPA 2GSJA 1W1YA 5JBFA 4FLOA 3DC0A 4DWSC 5BWFA 4M80A 1OIMA 2V5DA 1C7SA 3PZNA 1H11A 3FY1A 5HDRA 3ZMRA 4UTFA 2VRKA 2G3IA 3U5UA 1FP8A 3IJ8A 1TFVA 2ZXAA 4S3KA 2VCBA 2XHYA 2Y24A 3IJ9A 3K46A 1E3XA 4W7WA 4P8WA 4W93A 3UETA 4PMZA 1GUVA 3ZT5A 2V3GA 1UWIA 2WVUA 3BAKA 3MMWA 3MS8A 1MWOA 5I78A 4BCEA 1UD3A 3W29A 4GZJA 4GZIA 2W63A 5I2UA 2WMGA 5A8PA 3AICA 1CEOA 1JFHA 3T0BA 1J0IA 4R5EA 2WCAA 4AC1X 2E8ZA 4OOZA 2VZUA 5CSYA 4ACZB 1CWYA 3KE0A 3WUBA 3ZJ7A 5C70A 2UY3A 4C7DA 1WAWA 2V3EA 1KWGA 4M24A 3WNMA 4J3UA 6TAAA 1V6UA 2F2HA 4M81A 1SFSA 1UKPA 3MUZ1 4PSPA 7A3HA 5ABFA 1J9YA 2RGLA 1MXDA 1ODUA 1FFQA 1QNOA 3WFLA 3NYDA 2GDVA 3GH7A 4CD6A 3D3AA 3AROA 4U2ZA 3TTYA 2OSXA 5IHRA 2DH3A 2FGZA 2WC7A 1FHLA 2YBTA 3AMGA 5BROA 4MJ2A 3AIBA 3J7HA 4WJXA 1MW0A 5I79A 3FW6A 1HVQA 4TVCA 3HU7A 2C0HA 1V3MA 4KGJA 3VNYA 4CVUA 1BAGA 1E0WA 3AHTA 1UD6A 1CXEA 1BYCA 1J0JA 2BV9A 4E4PA 1HNYA 5HPCA 4UQ9A 3CHEA 4AZHA 4MB3A 3T2QA 1BVNP 3VDHA 1R86A 3KWXA 1PIFA 3OLDA 2V3DA 3WQVA 3RMEA 1ZBWA 3G6LA 1JZ3A 3PZIA 2WNWA 1V02A 4DM2A 1UD5A 4AIUA 3POHA 1BFNA 3SCOA 3MSDA 3VGFA 5CLWA 2VZTA 3FHAA 1FH9A 1YHTA 3WBAA 2ZX9A 4K68A 5BXSA 3BMWA 4JIEA 1CXFA 4MDPA 1WCGA 2WBGA 2IXUA 3MKKA 4LGXA 1XCWA 5DF0A 1L0PA 3WF4A 3WSUA 1NP2A 2ZUNA 3BLKA 1MQRA 3WMCA 2X1IA 5D8ZA 3VM5A 1JZ7A 1IZKA 1PBGA 5M17A 1UA3A 3KEHA 3W82A 3WH9A 1W3LA 3AZSA 1BF2A 2W5FA 1FA2A 2ZXDA 4PEEA 4D6DA 3OLIA 3AHYA 5AC4A 1CBGA 2VO5A 3VX1A 1OT1A 2TAAA 5E9AA 1OCQA 1HKIA 4OBRA 4AD3A 2XSBA 1MW2A 1C92A 4PMRA 4QCFA 3WNPA 2YL5A 3MO4A 1UH3A 2XM1A 4CD7A 3BSHA 4OIFA 3WQWA 1ESWA 2XGBA 3ZIZA 1BG9A 1TA3A 5FKYA 1UR1A 3K8MA 1EOKA 2VQTA 1XD0A 4PMUA 1ZBKA 1ZS2A 2ZXBA 3WNLA 4HA1A 3GDBA 2BVYA 5CPSA 5I5RA 4CU7A 1BGGA 2WWCA 2YKKA 1KGWA 2WHJA 2XGIA 3EDFA 2QPSA 1B9ZA 3WH5A 5C8BB 4U5IA 4AISA 4PUDA 4CD5A 1XGZA 2JF7A 3WL1A 1KXQA 5A6BA 2A3AA 4IM4A 3CUJA 2WHLA 4A3YA 4UQEA 4IPLA 2VMFA 1CGXA 2Y8VA 1I1XA 3BLPX 4H04A 4WKHA 5A6MA 1VEPA 2X8RA 3IAQA 1J0ZA 2W91A 5A6SA 2EXOA 3QHOA 3SCRA 3ZT7A 1W9DM 3DECA 1M04A 1HXJA 1WP6A 1QHOA 5EFDA 5HXMA 1HF6A 5IFPA 3VO0A 5A1AA 3A4XA 3VGEA 5BXRA 4B3LA 1GQJA 1W3KA 2ZWZA 3I3BA 1E55A 2E40A 1OD0A 2YDRA 1C93A 1NH6A 2XFRA 3CZJA 3APGA 4B9ZA 1AQHA 2BY0A 1VF8A 4LYRA 4CCCA 4D6IA 3GTNA 4W5ZA 1U33A 1E6PA 3VNZA 5BRPA 2IXVA 5I23A 4GI6A 3M07A 2Z1KA 4CUCA 1G0CA 4LYPA 5A6BD 4URIA 2YA1A 3CUGA 4OOUA 3N12A 4HMDA 4U3CA 2YBUA 1EO7A 1VJZA 2OSWA 1JL8A 1VBUA 4U5KA 4BA0A 4DUXA 3EDKA 1WNOA 4GIAA 1E6XM 1K9TA 1OGBA 1PIGA 3T09A 3WDJA 3SCTA 1JDDA 2XVGA 4MAVA 3EBVA 1EQPA 4TVDA 1JDCA 3VIJA 1R85A 2Y8KA 5ABEA 4FLRA 4DWSB 1CXLA 1CGVA 1DEDA 1NWSA 1WO2A 3K4DA 3L4VA 4FMVA 1SR0A 4MNLA 3WQ8A 4YHEA 1V6WA 5IHSA 3VGBA 2J7DA 3EMQA 2QMKA 1ITCA 2ZWYA 1W3JA 1LG1A 3B9AA 3WF3A 1BG4A 1V3IA 4YN5A 3AS2A 3SCUA 2PB1A 2E9MA 3ARZA 5ABHA 3GXFA 1HN1A 3VU2A 1MQQA 1TE1A 4AW7A 1CLVA 3CGTA 4EE9A 2ZOXA 1VENA 3MMDA 2EEXA 3U7BA 1BYAA 4U31A 3SCWA 2YL9A 1JFXA 5EFFA 4HU0A 1UYQA 1KFWA 2ZE0A 4J3TA 1ZJBA 3UG4A 2OSYA 2E8YA 3ARSA 3ZM8A 3MANA 2UY4A 1WPCA 3CZ8A 1TZ7A 4P7RA 2J7HA 3BAXA 1WDSA 2E0PA 4WSKA 3UG5A 1JG9A 1QOXA 4D6FA 4KGLA 1LL4A 2AMGA 4PTMA 4F9DA 1HJWA 4UCFA 3WUFA 1V3LA 3AIVA 1W32A 1DWJM 2D3NA 2PWFA 4YHGA 2OYLA 3RPMA 5LA0A 2CHNA 3S6TA 2XVNA 1VAHA 2CBIA 2C7FA 3L4ZA 1LQ0A 5KEZA 5DO8A 2UY5A 2G8ZA 3EDJA 1E4IA 2ZX7A 3VDAA 3DYOA 1Z32X 3ARYA 4J3VA 2D0FA 2XJ7A 1UG6A 2ZICA 1XV8A 4MADA 1JI2A 2V38A 2G4FA 3VKKA 4BS0A 1E4MM 5A95A 1E71M 1JD9A 3W4RA 1JGIA 4JFVA 5KZ6A 4CKQA 1JZ8A 3N17A 4AZIA 2FHFA 1EDTA 4P8XA 3VD7A 2FHCA 3NSNA 1UWSA 3VIOA 1RD6A 1Q6FA 2VURA 1Q6DA 3WUGA 3UR7A 1Q4NX 3OG2A 2A3CA 4TTUA 4W5UA 3WEMA 2VQUA 2DDXA 2BY1A 1HVXA 2ZX6A 8CGTA 2QLYA 2IUZA 4PMQA 1FP9A 4QFUA 3WD4A 1JYXA 4PYSA 1A47A 5EB8A 1B1YA 4X0VA 1ZB5A 1ISVA 4UQAA 2J25A 2G41A 1CGUA 1XSKA 2DIJA 4HZ8A 2C8NA 3TTOA 1H0IA 2WLZA 5BXPA 3WNOA 2VC9A 3PBGA 4ZXOA 1R7AA 1NWUA 1V6VA 1JF6A 1W1PA 3TONA 5ABFB 2J8GA 1MFVA 2J7EA 3VGHA 4U3AA 3W26A 1E1FA 1NOFA 3NDZA 1MW1A 4AZCA 1MVYA 4F9JA 1EHNA 4MPKA 4AIOA 4E8DA 3CH9A 4MDOA 1JZ2A 3WMBA 1NOUA 1JYWA 2CNCA 2VRJA 1QW8A 1P6WA 2DT0A 4M8UA 1H49A 3L2MA 4HTYA 4XZWA 1V3JA 3VIIA 1V0LA 5CG0A 2VZOA 1MFUA 2XPKA 3TTSA 1QI4A 3M46A 4J28A 3E1F1 2YJQA 3A47A 3WL0A 1HJXA 4M56A 3SCQA 1UR2A 3RJXA 4W8LA 4P7LA 3GXMA 2QPUA 2O9PA 4X0NA 3AQUA 4TUFA 2QV4A 1NARA 4N42A 4ZFMA 2D24A 2VVNA 2CKSA 1IZJA 1XRVA 1ISWA 3AIQA 3AIEA 4DUVA 1PX8A 3OGSA 3OLGA 1NOWA 4AZCB 4ACZA 4E2OA 1DWFM 1W2VA 2J7CA 1E6SM 1GJWA 3FN9A 3AMKA 3UEQA 3A6OA 3VVGA 1K6AA 1UQYA 4AZ5A 4TOQA 2XM2A 2XWEA 2NSXA 3ARUA 1UR0A 4FF5A 3ZSTA 1H5VA 5HBFA 2J77A 3VIHA 3BXWA 3F5LA 3WDIA 3AI0A 2EO7A 3MV11 1QNSA 1GONA 3PZ9A 4GZEA 2WMIA 2WZIA 1BYBA 1BQCA 1C8QA 1J18A 1V0KA 2VJXA 1R7OA 3W24A 1B30A 1G9HA 3T2OA 4WLCA 1JXJA 2JALA 3AZTA 2QF8A 3ZO9A 2YOCA 3CZKA 5M5DA 1GCYA 4W88A 1E5JA 2O9OA 3VGGA 2BVTA 3GH4A 7TAAA 4WK9A 4GO8A 1GVYA 4UFHA 1JXKA 1W91A 5DMYA 2EBNA 2VCAA 2G3MA 3SCNA 2EJ1A 1DWAM 4HPHA 1HJVA 4CD4A 1JNDA 1OM0A 2VTFA 4JCMA 1JNEA 1CDGA 4UFLA 1VFFA 1BVZA 5CGTA 5E70A 1B2YA 4JHZA 2GJXB 4KWUA 3TP4A 1DHKA 3UERA 1V0MA 1QBBA 3WF0A 1GOIA 1OT2A 3EYPA 1G94A 3WD1A 2YA2A 1GHRA 5EMYA 1KBKA 5JBEA 1FH8A 1QNPA 1TA3B 1W9PA 4AZ6A 1AQMA 1GOKA 3ZOAA 4ZENA 4QDMA 1E56A 3ARWA 1YQ2A 2DSVA 3HJEA 1F4HA 1FH7A 2WC3A 3QOMA 2WPGA 1J0HA 3N9KA 3N18A 4PMNA 3QOKA 2G3NA 4OJYA 1XSJA 4ATWA 4FLSA 3WQ6A 3O9NA 5E09A 2CCRA 4UZSA 5BCAA 3N04A 3T2PA 5A8MA 5A69A 1EXPA 3OB8A 1QI0A 1MW3A 3DYMA 2VUYA 3WD2A 9CGTA 3WENA 2OWXA 1JD7A 4MNMA 3WBEA 2GUYA 1GOWA 1US2A 3W25A 4CGTA 4JHOA 2BHUA 4B9YA 2BHZA 3DHPA 4CD8A 3VMOA 5HPOA 1NQ6A 4XB3A 4AEEA 1XD1A 3QGVA 4FK9A 2VR4A 1UWUA 1AMYA 1J01A 2WANA 3MSGA 4UQDA 5IDIA 3NSXA 3WH8A 2W67A 4Z2JA 2WXDM 3D5HA 4YPJA 3W38A 2BFGA 1M03A 1L8NA 2WHKA 4M82A 1EHAA 4QLKA 2BY2A 5AYBA 1QHZA 4C7FA 4W86A 1LL7A 2WHMA 1E9LA 1UQZA 8A3HA 2WM0A 2VX5A 1GOOA 1U2YA 2DT1A 1W2PA 5E0CA 1GJUA 4PTVA 2W62A 4HPGA 1TCMA 4PMYA 1KB3A 4J27A 5GNXA 3FAXA 3FNDA 1NWTA 2Y4SA 2WW5A 4PMDA 1B3YA 3VIMA 2QHAA 3ALFA 1Q6CA 4H7VA 2D0GA 2JEQA 2JEPA 1O7AA 1GQKA 1JZ6A 1TMQA 1EDQA 1HX0A 4MB4A 5JUVA 4ZEPA 3AOFA 1UZ4A 2XUCA 2V5CA 3OIHA 5LYRA 2DSKA 5BXTA 2J78A 1V02E 3SUTA 2NT1A 2WSPA 4B15A 3W6MA 1WDQA 1KXHA 1UH4A 3AHZA 4MJ4A 4UNIA 4R27A 4CN4A 4JFUA 5A2AA 4HOXA 4TX6A 3MUIA 3N15A 1OSEA 1JZ5A 3NJ3A 3BMVA 2CESA 2ESCA 4HA4A 5AY7A 3LPGA 3GM8A 3RILA 2PWDA 3AHXA 3GXDA 4JAWA 1B3ZA 2UY2A 3BCFA 2UWFA 2OWWA 1ZU8A 1FOBA 3CHDA 3ZT6A 3AZRA 2BHYA 2XVPA 1W3HA 2D2OA 3HN3A 4JFSA 5CLTA 3WDRA 3T0DA 3CMJA 3AIUA 4JFWA 2J79A 1V0NA 1CXKA 3AISA 2D23A 2JE8A 1UH2A 1CZ1A 3VIPA 4PMXA 1JI1A 3NUKA 2O92A 2J74A 2BVDA 3IK2A 3CTTA 2XIBA 1XYFA 1E5NA 2E3ZA 1LLOA 4Z2HA 1UWQA 5C71A 3AHVA 4UOZA 1E6QM 3ZJ8A 1QBAA 4BQ4A 1E40A 2BXZA 2WMIB 4W89A 2J7GA 1KQYA 2CETA 3GBEA 2BS9A 1AQ0A 2YL8A 3PTKA 3PZTA 4RE2A 3TA9A 4AZBA 3L4XA 3QHNA 3W0KA 4EK7A 1H0GA 3PZQA 3WD3A 2WC4A 3UG3A 1WDRA 3WDQA 4OZOA 1GNXA 1J0KA 4X9YA 1CIUA 4JL2A 4L4PA 4TVUA 3WFZA 1QVBA 4NZCA 2WWDA 5FCZA 4GINA 1K9EA 3AXHA 2ZIDA 4P7OA 1CENA 3MU7A 2DT3A 2ZX5A 3GXIA 4Y7EA 2GJPA 5A8OA 1JAEA 2VI0A 1LL6A 6A3HA 5A6JA 3VIFA 1JF5A 3CIVA 2B31A 2WKLA 1O6IA 4WSJA 1RPKA 1ODZA 2WZEA 3CHFA 1E3ZA 4TTGA 1EDGA 3BAYA 2WVSA 2JIWA 2J8FA 3VD3A 3DHUA 1TR1A 3CUHA 4Z2LA 5M3WA 4PBGA 1HP4A 1ZBVA 1KWKA 1VEOA 3PZMA 1W9BM 4AD1A 4LPCA 4N0RA 1MQPA 2WBKA 3RDKA 1E6ZA 3K8LA 2YIHA 4W8AA 2XWDA 5D9MA 4EKJA 2EPOA 1PZ2A 2V3FA 5AYIA 4D1JA 4OKDA 2VZSA 3BC9A 1G1YA 3WF2A 1CXHA 4KH2A 4XZBA 4RE3A 4W85A 5DEZA 1K9FA 2WKGA 4NSBA 1HJUA 4CCDA 1ISYA 5DT7A 3ALGA 2AOSA 4PCTA 3PZVA 3WNNA 2MANA 4C7GA 2GVYA 2YDQA 3F5KA 1GQLA 1BSIA 1OGSA 2CPUA 3EMZA 2CBVA 3CO4A 1MXGA 4V2XA
chains in the Genus database with same CATH superfamily
4Y9MA 4DO6A 3H53A 5FF4A 4M6PA 3NZGA 4G7EB 2E9BA 4J35A 3NL6A 1IEIA 1EJUC 4CNSA 3RF9A 4ERAA 2Y89A 2TYSA 4CNUA 3RCNA 1M5WA 4K1WA 3LMYA 1VPXA 3B8WA 4PGLA 2PDPA 1UD2A 2C14A 1C91A 3OYXA 1I2RA 1ME7A 3HGSA 3DBNA 4H83A 3EPMA 4Y6GA 3MDWA 2QF7A 5I0DA 4K38A 5GJMA 4RV8A 1TV7A 4FNSA 1OGGA 4QLLA 1IGWA 4UB9A 4ZXLA 1YRRA 4FALA 1VJIA 1PO9A 3ZWSA 3O0FA 1O95A 1Z42A 4BY3A 1EFZA 4DWSA 2CLIA 4C90A 2PF0A 2WK2A 7XIMA 3SY8A 4DIAA 3W6LA 1KXTA 4LOCA 1H5YA 4MWAD 4ZB2A 4O53A 4J2PA 2DEPA 1F2JA 1BXNA 1VYSX 3SCSA 1OABA 5FD0A 2IS7A 4Y90A 2X0YA 1ITQA 1Z6KA 3NO1A 1C3FA 2QZRA 4JDYA 1WKEA 4PH6A 3L4TA 4RDYA 4BF7A 4B16A 5AVHA 3PTMA 5FIPA 2OYKA 3UXKA 1LM1A 4RXFA 1I6NA 1KGXA 1XYLA 3CLWA 1PHQA 3P84A 2AL1A 3VIKA 4D9PA 1YPXA 3FYOA 2QCCA 2QUVA 3P7YA 1X6LA 3M7SA 4O19A 4NXKA 4UNLA 1E6RA 2PCQA 4C6LA 1BKHA 4H8HA 1NWRA 1ADSA 2GQ8A 3UWUA 3V1HA 3PPCA 4L80A 1GOXA 3IVTA 5I6SA 1V08A 3M0LA 4V28A 3UWEA 2G50A 2NX1A 1Y0EA 2GPTA 2BODX 2P10A 3GDLA 3LN3A 5AB3A 4R9XA 1ELSA 1VFUA 2D1ZA 5HWNA 3RX4A 3GNOA 3LXBA 5KINA 3LLDA 4L4LA 1YDYA 3R6IA 3LGDA 2V63A 2PLCA 1BLIA 3CH0A 5AC5A 4WXYA 1VEMA 1QI2A 1I45A 1UA7A 4JTEA 2YDSA 2YZ5A 3BOFA 2O4MA 3PSVA 5REQA 2TPSA 3QV9A 3DAQA 4POCA 2R24A 1I2NA 1IIGA 1GVIA 1JCMP 4D6GA 1B90A 1N82A 1UR3M 3PTQA 4F48A 3NDYA 1E70M 3C0SA 2CZ5A 2GK1B 4AQLA 1XIJA 1KM6A 3F5JA 4HT3A 4NAEB 5EMMA 3LHVA 1LT7A 5FOOA 1OG0A 1JPDX 3H54A 1EJVC 3STEA 2VC5A 4IP4A 1MXSA 3WDHA 4XK2A 5KZDA 1ZBCA 3GU9A 1H41A 3WIJA 2RDXA 3CUXA 5EMKA 4AWTA 4A35A 3IGXA 3T08A 1CYGA 3UGRA 4FOKA 4L6DA 4O1AA 1AZ1A 1X7IA 5EMLA 3QQWA 2VXNA 7REQA 3MWAA 3ITVA 5KETA 4ZE5A 1YNPA 4FOJA 1O1ZA 4PBFA 1QI5A 3W1RA 1B57A 1RXOB 3CHVA 4DJFC 3CZGA 4Z2KA 3E0LA 4G9PA 4RZ4A 2C15A 4PB5A 3T81A 3O6AA 1E72M 5FSDC 4IIBA 5BW6A 3UPMA 4UOJA 3SCVA 1R6WA 3ABQA 3SO7A 1RCOB 2W3ZA 2NVDA 2CERA 1K1DA 1J12A 5LA2A 2J47A 4QP0A 5BOFA 4N4QA 2WSKA 1IE7C 2OGYA 1S2CA 2CZVA 1UPPA 2YL6A 3B9EA 1EJWC 2J7BA 3SEPA 1QW7A 2QMJA 1ZALA 2NLIA 1A49A 3SIMA 5FJRA 4C6DA 4EF9A 1NP0A 1LWJA 2PODA 4UBPC 4BQ5A 3MUY1 4LWWA 5C9WA 1VFSA 4GVGA 1AZ2A 2FH8A 3OHIA 3E38A 1RY8A 1KQZA 4AB4A 4DYKA 4GI8A 4YIWA 1UD4A 3OTRA 4NRSA 4O54A 2EQDA 3E2RA 3GG8A 3PZUA 3S1UA 3MPGA 3HB9A 1OC6A 5ECUA 1KR1A 2Z2UA 2PF8A 2WZHA 4A4AA 5J04A 3G3MA 1R3YA 5D32A 2YB4A 1WZAA 4ACYA 4EACA 1ZCCA 1WYIA 2OJPA 1W1TA 2GDUA 1CCWB 2WMFA 1Q3NA 5C9UA 3YPIA 1WKYA 4W87A 3JW7A 3LNPA 3AYRA 2NW0A 3DYPA 3WJZA 5FL1A 2V5LA 3KRUA 1WBHA 3EOEA 5CXPA 4BWLA 4CN6A 3PBMA 4XKYA 4OV9A 3I4EA 4S3EA 2X42A 3KCJA 3FFSA 3KS5A 3CHCA 4Q22A 3SUSA 3B8SA 2ZUWA 1NEYA 3RMJA 3PVFA 3KHDA 1W31A 1UUOA 5C9RA 1P0KA 4TMBA 4WF7A 3AXXA 3MP3A 1XH0A 3GHUA 3F4VA 1KW1A 2PI6A 3SQMA 1UR4A 4IUGA 2ISDA 4AXNA 3AMDA 4DJDD 1OX6A 3JR2A 5SWUA 1B0IA 2Z1WA 4JR5A 4ML9A 1RSCA 1D3GA 4R85A 3FEQA 1GVFA 2NQZA 1UHVA 3M0VA 1OFBA 2EAWA 1K02A 1U5HA 4XBKA 3AJ7A 1LUCA 2J6VA 2D3LA 2VX4A 3TKFA 4NASA 4H00A 2BNJA 4CEUC 2ZZ4A 2XH0A 4QGCA 4R7OA 2DSZA 2FTPA 4J40A 3JUGA 2F84A 5DCDA 2A3EA 3PNUA 4Q7BA 3B0PA 2NWRA 4V27A 4KW2A 4QS5A 4RE4A 4HKPA 3WUEA 3POCA 1G5AA 3AXIA 1CPUA 4GYKA 1TB3A 2FMNA 1QATA 4QHRA 3THCA 3P0WA 5JQ9A 3A22A 1YNYA 1OFOA 1SFLA 4BQ2A 2XIJA 3DCPA 5HNRA 4CNPA 4Q4RA 1HQTA 4AMAA 4CQDA 3VUSA 4D6EA 4IP5A 2NX9A 3UZWA 1ZRQA 1AVAA 4YLWA 1ZAHA 3VFLA 3M5XA 5BRBA 2XSAA 4XD5A 1DXIA 2XFYA 2WCGA 5A8NA 2Z4GA 3UZ5A 3PJTA 2R1KA 3KTCA 4J7RA 3AFBA 3ES7A 1K3UA 3W01A 3FXYA 5DN1A 3CL7A 1W1IE 3RM4A 3CZEA 1CGTA 3ZR5A 2QUTA 1W9VA 3FYYA 4NZ1A 4LUTA 1KO0A 1TE6A 6REQB 1EZWA 3UY7A 2C91A 4DPQA 5HUOA 1AW2A 3RITA 3VNIA 3PB2A 2WYSA 2QJNA 2DFAA 1Q2RA 3GYCA 2Y8UA 4AY1A 4O4VA 3OOQA 3UA4A 1P48A 5CC6A 3LCHA 1DIEA 1DWGM 3W7EA 4G7EA 4P7NA 3NQ8A 1BD0A 5FI8A 3G2GA 1NFGA 4F66A 2VNCA 5BZAA 4LF1A 4WIWA 1KCZA 2DGAA 4UZUA 2J75A 3A3HA 1JEZA 4FR1A 4Q8QA 1EPXA 1XC4A 4N6EA 5BOOA 3KRBA 4QBXA 3DG7A 3ITYA 2OODA 2HCVA 4V15A 3TSDA 3C2RA 1XLGA 1KFEA 4CNOA 1IT0A 4A8RA 2DORA 3QR3A 5D9OA 5I3GA 4S39A 3HPZA 3EPOA 3SURA 4BF5A 1OINA 1VRXA 4HMEA 3C2YA 4WKFA 3E3HA 1PZ1A 2Z7GA 5F4WA 4Q3MA 5GNYA 1PX3A 4A2RA 3CNYA 4R9OA 3MI3A 4XG1A 3U7VA 5CAKA 1IR2A 2CWXA 2HXTA 1QXLA 5G4WA 2PU1A 5EPDA 1K77A 1B54A 2BZNA 2PWEA 4A3UA 4PCNA 3P80A 3DC0A 4DWSC 4OT7A 1T41A 4S3AA 1A80A 3PZNA 5HDRA 3DFHA 1TJRA 4DELA 2VRKA 1NDZA 3U5UA 3IJ8A 4C65A 1TFVA 5K2ZA 1T0OA 4O52A 4DQWA 1FDJA 3W71A 4JIPA 1TPEA 3W7IA 4W93A 4G2DA 2E28A 1UP0A 5C9XA 1MWOA 1UD3A 4M5PA 1SJDA 1F9CA 4ORIA 1VFHA 4IG2A 3SJNA 4N4PA 4XZNX 4BEQA 3C4UA 2MUCA 3AICA 1CEOA 3NVDA 1KLZA 1IZCA 3TZNA 4LVGA 2E8ZA 4O0KA 2CC0A 2VZUA 3OW1A 5AHLA 3CJPA 3R4IA 4ACZB 1VPYA 2UY3A 1KWGA 3WLPA 1FWIC 3CEUA 4HJFA 1EIXA 3HFYA 1V6UA 2QGYA 4NQ1A 2ABBA 1FWSA 1QNOA 3WFLA 3EGJA 3EWZA 1FBAA 3GH7A 4CD6A 5LGXA 4JEQA 2H8XA 1Y5VA 4U2ZA 2DH3A 3BG9A 4H7CA 1FHLA 3OA3A 4GGHA 2YX0A 3A5FA 3OBEA 1MW0A 3AALA 3W02A 1S1PA 5HQMA 3C0JA 5B80A 5K3VA 1BYCA 5D09A 1J0JA 4GJIA 2HROA 3EX1A 4UQ9A 3T8QA 4I9AA 4LUIA 3UWQA 4LEFA 3TR9A 3T2QA 1BVNP 4YTQA 2VGFA 4UCGA 4Q7IA 1GVSA 2QUMA 2V3DA 3LCXA 3M0ZA 3BL3A 3WQVA 4I8YA 3PZIA 5D38A 3S2NA 3POHA 1S2TA 3KWSA 3VGFA 3IARA 5K9CA 4O1BA 5BXSA 3BMWA 4WQ6A 1WCGA 1R3TA 4O1EA 1QUMA 4LUSB 1NTHA 3MKKA 5DF0A 3L65A 1IWPA 2HQAA 2ZUNA 3VM5A 1FCUA 4C6KA 1JZ7A 1FHVA 5M17A 3AC0A 3TR2A 2DVXA 3S9ZA 4GBDA 1H61A 3P0XA 1XISA 8RUCA 4US6A 3W82A 1W3LA 2W5FA 5BMWA 4PEEA 1MDRA 1FUYA 1CBGA 2HSAA 2FFIA 1OT1A 1I60A 1W17A 3SADA 4F2BA 1XIEA 3DKJA 1FVPA 3D6NA 5LNUA 1QR7A 1XG3A 4GX8A 3JZUA 4LC8A 4MZYA 7REQB 1C92A 3F03K 4LAZA 3HQ1A 2YL5A 1TKKA 2ISSA 3MO4A 4I9TA 1UH3A 3PTDA 4RE0A 4S3GA 2Z1VA 3VC5A 4XKMA 1KNWA 1TCDA 2Z26A 3R0UA 4MLJA 3DOPA 1F7BA 3R79A 3K8MA 3NPUA 1EOKA 2VQTA 2REQA 3WBXA 1ZBKA 4KESA 2CLEA 5CBIA 1ZS2A 2ZXBA 1V77A 1MMFA 3TJXA 5CPSA 1POKA 3SRDA 3CWOX 1Q6RA 4XZLX 4JIIX 3H2NA 5DANA 3I68A 1XGZA 1SW7A 2A3AA 3I6TA 4IM4A 1G4PA 1DHPA 3LHTA 2FMOA 1T96A 1GVQA 2PD9A 1XQKA 3TLLA 2C79A 4JGDA 1W9DM 1XRFA 3H2MA 2WNZA 3TJLA 1WP6A 4IIGA 1RBLA 4LY8A 5HXMA 1HF6A 1DIKA 3VOFA 2QS8A 2DZVA 2OFJA 3VGEA 3G1XA 3KLKA 3DHDA 1OD0A 4HB7A 3VK5A 5C2XA 2BY0A 1AFSA 3BICA 4LYRA 3U48A 5HQLA 5PTDA 3WQFA 3TWBA 2BTMA 1F3XA 4PBEA 1U33A 3DFPA 3ZWTA 5I23A 2ISFA 2RUSA 1TPDA 4CUCA 5A6BD 4OOUA 3FVMA 2RHGA 3LRLA 4YYFA 4OUIA 5HANA 2PDHA 1H1YA 5I00A 5LXEA 2YBUA 3W7MA 1VJZA 2QDDA 1VBUA 4QDWA 2NXIA 4R53A 4ICNA 1E1CA 4DI9A 1PIGA 3WDJA 1XLMA 2HK1A 2B7QA 1TJ2A 2HWGA 4GLEA 1ME8A 5ABEA 1NWSA 3L4VA 1AUSL 4P61A 5XINA 3L21A 1NJJA 4S3DA 5AHFA 5TQLA 1R2SA 1W3JA 3BCJA 3GVGA 3SCUA 2PB1A 3GXFA 1EX1A 3SSZA 2QCFA 2ANUA 5B7ZA 1CW2A 1G4TA 1CLVA 1MSSA 2F6XA 4WY0A 1E51A 1ZFJA 1PDYA 3CIXA 3BPWA 1JFXA 3URQA 2Q3OA 1KFWA 4J3TA 2E8YA 1ME9A 3MANA 3R8GA 4AYGA 2J7HA 3Q58A 1WDSA 2V5BA 3UG5A 2Z29A 2H8ZA 2JKEA 5HINA 3QW4B 4LAMA 1QOXA 3B8TA 3UVAA 2WO5A 1LL4A 4R7JA 2OELA 3AIVA 2QXWA 2QYGA 3DX5A 2D3NA 1XBZA 2OB3A 3QPZA 4YHGA 2OYLA 3S6TA 2XVNA 2CBIA 3E5BA 2X7WA 5KEZA 5DO8A 2UY5A 4KCVA 3EDJA 4Z08A 1E4IA 7PTDA 1CB2A 4UIOA 3CK5A 3DYOA 4XIMA 3LSBA 3B3DA 4KFNA 4J3VA 2D0FA 1R3QA 1UG6A 1PWMA 3KTXA 2G4FA 3T44A 3MMTA 3LHYA 2BOEX 1E4MM 1E71M 5T91A 2R9RA 3W4RA 5DRIA 5KZ6A 1SSDA 5E5CA 4QDPA 1EX5A 3ES8A 1EDTA 4P8XA 3FSTA 1TPVA 3W1QA 1RD6A 1Q6FA 2VURA 1Q6DA 1U22A 3WUGA 3QJAA 2VDIA 1YIXA 3KVMA 3WEMA 4C5ZA 4AF0B 4IQDA 1YX1A 3ZXWA 2BY1A 3GDTA 5CPNA 2WPBA 5HMSA 1HVXA 1Z3NA 4N2YA 4WOQA 2BWGA 2IUZA 3TXZA 4KKXA 4Q8VA 3CPRA 4PYSA 4ZBCA 1A47A 1OY0A 1B1YA 4KETA 1SJCA 1ISVA 2GVEA 1EJTC 1XSKA 2DIJA 4Q8OA 3EXRA 1DOSA 1GZGA 2C8NA 1H0IA 3CQHA 4UUIA 2IKJA 3N19B 5D2VA 3WNOA 3R43A 4L56A 4HTBA 3QV7A 2J7EA 3VGHA 4F3HA 4M7SA 3QYSA 3INPA 3W2JA 1PCWA 3I7SA 1MW1A 1U5VA 4AZCA 4F9JA 1GPWA 4D8LA 4MPKA 4MDOA 5DXXA 3WMBA 3WLSA 1NOUA 1JYWA 4J1OA 1N2VA 4ZQOA 3I4KA 1JJKA 3M5VA 4PRTA 2DT0A 1VCVA 4IGNA 3HF3A 1RJPA 4XZWA 3QC0A 1OYBA 3O7UA 1ZP4A 2DZUA 3ISIX 3KDOA 2XPKA 3RU6A 3OVQA 3E1F1 5AN7A 1TJ1A 3TYZA 3A47A 3GS6A 3RAOA 4UMCA 3AJXA 1AL8A 1OF8A 3RJXA 3FEMA 2YFNA 3DH7A 2O9PA 2RJHA 4DZ5A 2PAJA 4LCQA 1VH7A 2O7QA 2VVNA 1IZJA 3I6EA 3P60A 3ANYA 3C2FA 3AIEA 3QKZA 4FNPA 4DUVA 3BLEA 2IW0A 4M1BA 4F0MA 2E7FA 4ACZA 4E2OA 1NFPA 1UQYA 3GO2A 3IEBA 5DY3A 5LIYX 1AQFA 1TTIA 1QO2A 2HBXA 2NSXA 1UR0A 3CT7A 3V18A 3MT1A 4I7VA 3BXWA 2X1RA 1XWYA 3HQOA 1GONA 2WMIA 2PUZA 1L6FA 1BQCA 1D8WA 4L9YA 1J8VA 1G9HA 4KWVA 1UBPC 3AZTA 3ZO9A 3MCMA 3CYJA 3CZKA 1JCLA 1GCYA 4W88A 3WJSA 2WSQA 2QCEA 3LZ3A 4YMZA 7TAAA 2BB0A 3EEZA 1M65A 4WK9A 4GO8A 3CTLA 4MWAE 1KLYA 4UFHA 2GGHA 4RZ6A 4K1GA 4AX7A 4HPHA 4CD4A 5M2FX 1OM0A 1GVOA 1XBYA 1OF6A 4MFEA 2C18A 3S42A 1VFFA 4JICA 1B2YA 2EF9A 2VC7A 5FEPA 5G5IA 2GJXB 3C2VA 1V0MA 1F6KA 4NG3A 1QBBA 3S1GA 1TELA 3UWWA 1WX0A 3EYPA 4XD4A 3WD1A 3LBOA 4GHRA 1W9PA 2OLSA 1AQMA 2E5DA 4ZENA 3CEPA 3RLGA 2DSVA 4NP7A 4GOAA 4V33A 4EPDC 1NF7A 1TRIA 3C8NA 4K2SA 3N6HA 2FYMA 4AVOA 1ENUA 3QZAA 1SR9A 1UASA 2Q6ZA 1IT8A 4FIQA 2J9XA 1FWJC 5A8MA 3SGUA 1EXPA 1EP3A 5G2HA 2VUYA 4N7QA 4L9XA 4B5WA 2OCZA 4NZ5A 1QPRA 1SSGA 2I5QA 4HBKA 1US2A 2POZA 1TMLA 2BHUA 2PDWA 2BHZA 4ENLA 3QC3A 1NQ6A 6XIAA 4LC6A 1FWNA 1IIHA 1XD1A 3TSBA 3W23A 4C6MA 3TMLA 3I7RA 2WANA 1PB0A 4UQDA 4MLRA 4DN1A 4AWUA 3ABOA 2CWNA 3MTWA 3C2OA 3HV9A 2W67A 4Z2JA 2FZBA 4LH8A 2BFGA 1JPHA 4U4MA 5JH2A 4MOZA 1DIDA 4DVOA 1E9LA 3M44A 1ZAJA 2PDLA 2VX5A 1M7PA 1GOOA 1KRBC 1W2PA 5E0CA 4ICMA 2W62A 1K4GA 1HG3A 4HPGA 4PMYA 4J27A 4RPQA 5AC8A 3WLNA 1XM3A 4DHGA 3NEVA 3VIMA 3GNXA 5D05A 4QR6A 4YCPA 2FPVA 5LIUX 1EDQA 1HX0A 4MB4A 3AOFA 5I09A 1UZ4A 5AC6A 2H9AA 2XUCA 3OIHA 1HZYA 3HG2A 5LYRA 5JVLA 2DSKA 4H3DA 3L0GA 4B15A 3OVGA 4UTLA 3EWBX 4IF2A 3TW6A 3NA8A 3UZYA 4R27A 3PM6A 4CN4A 4TX6A 3MUIA 1WXZA 3LHZA 1OSEA 4PL1A 1R3SA 1PS9A 5C6MA 3TTEA 2PD5A 1AODA 2CESA 2ESCA 4QM1A 5AY7A 5CJMA 2Q02A 4GQBA 3GM8A 3RILA 4LAOA 4JAWA 2UY2A 2IQ0A 1H1ZA 1ZU8A 1FOBA 3CHDA 3AZRA 2XVPA 2QR6A 4C6FA 5CLTA 1EC8A 1NAL1 1ZZMA 3GG1A 3LSCA 4MHBA 2OGJA 3WDRA 4AX6A 3AIUA 4JFWA 2J79A 1V0NA 5T8GA 3AISA 2NVAA 5DMNA 2IMRA 4GG9A 1JI1A 2O92A 3QTPA 4B5TA 4BJHA 1EGVA 3MDUA 3RXZA 2FQIA 3B9NA 1LLOA 1Q2SA 2EPHA 3AHVA 1R0MA 1OX5A 3B06A 4UOZA 4X60A 1E40A 1YPIA 4LAKA 4W89A 3WLJA 1TQJA 2PEVA 2BS9A 1AQ0A 3DFSA 3RLHA 2QULA 4RE2A 4ZB0A 4ECLA 4B90A 5CBJA 1DTNA 3VKDA 1WDRA 1GW9A 4UTMA 4OZOA 3SQSA 1J0KA 1YW1A 1CIUA 4JL2A 3WFZA 4GINA 4GE8A 5CG7A 4P7OA 2OX4A 5RUBA 3E74A 2Z6IA 2PDMA 5T9BG 3GXIA 3UBPC 3STPA 1KV5A 4IMAA 2WSYA 4K36A 3TLQA 1RBOB 2OVLA 3ANUA 4WSJA 4O28A 2Z27A 2QCHA 1ODZA 3OJGA 2PC4A 3NZ1A 4K8HA 3NPXA 3VD3A 1KD0A 3DHUA 3PF3A 4Z2LA 4H9VA 1ZBVA 1K8YA 4HHMA 3EX4A 3LXAA 3B0XA 2MNRA 3UCDA 1ICQA 1K03A 4W8AA 3NAVA 4Z17A 3ITCA 5F4XA 2BMBA 5DQPA 2OXNA 4YVPA 4JTQA 5T9CE 5AYIA 3E0VA 4WHBA 3WF2A 3UPWA 4W85A 4NSBA 4CCDA 5AYXA 4PCTA 4NZ4A 3PZVA 2XDFA 2MANA 1LBFA 4C7GA 3F5KA 8XIAA 5AC7A 1XJBA 4B92A 4S3BA 5H6HA 3Q45A 3CO4A 3EKLA 1X96A 3NQ2A 3K4AA 1EP1A 2NV2A 1D3CA 1HKKA 3EX6A 1LWIA 3VKJA 2ZE3A 3KL3A 3A12A 5A8GA 4HNOA 1K70A 3ARXA 4DJEC 2C19A 3CMFA 9XIAA 4IZGA 1I1WA 4XX6A 2FB3A 1YDNA 3DFNA 5A3HA 3VD9A 4WEVX 1FRBA 1KFLA 3E02A 2E6AA 2NT0A 1J5SA 1GHSA 3S3GA 3MHGA 2PDKA 4AIEA 3S47A 3GW0A 4ZE4A 1CECA 1ECEA 2ALDA 2VKZG 5JH1A 2AAAA 2NQLA 1LWHA 4UFJA 5H8PA 5I07A 2WNQA 4MGGA 4ZQNA 3VD4A 4XWUA 1GKPA 4GYFA 3I3DA 1MEIA 5C55A 2DT2A 1A50A 5FJOA 1EQCA 3GKFA 1QO5A 3PFRA 1RCXB 2BSLA 1CGYA 3ZJ6A 4J3SA 1J0YA 3OO2A 2A79A 3OVRA 1P0NA 3M41A 3QLDA 1AD1A 2I5GA 5FF3A 4JYEA 3THUA 5D37A 3OHMB 2HJPA 3ARTA 4YYCA 3V7PA 3E2VA 4PZVA 3A23A 3TNOA 1F07A 5E0FA 4PA8A 4YTUA 2VCCA 3LDVA 3M0HA 1XW8A 2W4XA 1PUDA 1AD4A 2YW3A 4D71A 1DWIM 5L9FA 2FDMA 1YADA 4LUTB 1GKQA 2PLMA 4JN6A 1R8LA 3VPLA 4HYRA 3UZZA 3L4WA 4BF9A 3FDGA 4F0KA 3GTHA 5G1MA 3LA4A 3L5AA 4I7WA 4FAMA 3VOIA 1JRCA 2ZZ5A 2H3DA 2EPKX 4D1IA 3PB0A 2ZZ3A 1VQTA 4MUZA 1XLKA 3LEPA 2CLKA 4JYFA 2CBJA 4AYSA 5FJUA 1UC5A 1NY1A 4W8BA 2PC8A 1VBRA 4KRUA 2XZ9A 2FZDA 1G67A 2DP3A 3QY8A 4WX2A 4IPIA 2ZUVA 5GPRA 3DUGA 3PPFA 3D3FA 3GK0A 3WLRA 4LQ1A 3APTA 3VGDA 2J4GA 4PTDA 4Z2GA 5D8WA 1ZNNA 1GOQA 1OC5A 1GG1A 4JTFA 4LANA 4BQ3A 4AD4A 2ZUUA 1NDYA 4NX0A 5LNWA 1ISZA 1WDPA 2IQTA 3P67A 2R94A 3VKBA 1KFKA 1E73M 1XDLA 4JKLA 3PUEA 2OMAA 4JKKA 3TMQA 5CC7A 2A85A 1EA9C 1IGSA 3ECQA 5CC3A 3PK7A 4AHOA 5BYWA 1ZL1A 5LXXA 3PBYA 1W1VA 3IWPA 1UD8A 4WGHA 3UJEA 4LRSA 2WMKA 4GUFA 3AYSA 5D9NA 3PHAA 2QKFA 4DZHA 2JFEX 1GW1A 3MMUA 2GJRA 4DZIA 2V0TA 1V6TA 4QG9A 5IFTA 1M01A 3R13A 3OLEA 2HE5A 1K7XA 1TREA 4CN1A 1V51A 3MA8A 3IJ7A 1FCQA 3NEHA 4H4IA 3B97A 2OZ3A 2I5IA 1FHDA 5CPQA 2E5BA 3CO8A 5HAOA 5B7YA 2GJXA 3G1VA 4F79A 2PDIA 4MNKA 4ZOBA 3XINA 5EYWA 3NQEA 1R2TA 3LS9A 1M53A 4QG8A 4P2VA 3TFCA 4IJBA 4F0SA 3WK1A 6CGTA 4Q32A 3LCIA 2KAUC 2PRMA 1U83A 4S23A 1EF3A 2PDYA 5MHBA 1DJGA 5DT5A 3C5QA 2HISA 3V4BA 3T0AA 4XKYB 1FCVA 4FXFA 1S5MA 1CXIA 2BXYA 4LNYA 3RO8A 3PUGA 5K4ZA 4O15A 1NIUA 2Y6ZA 1CTNA 1O68A 3KBNA 3UCQA 5HA7A 3FA3A 4LBRA 3NQBA 2R6OA 1IYXA 3K4WA 5F2GA 1V5XA 3TWAA 3W1PA 4ZOEA 3O6DA 2FGLA 4FB7A 4ZZ9A 6ENLA 1H62A 3W07A 3WDPP 4GJJA 1TRDA 2PDBA 3W7KA 3VYLA 1H60A 1K7EA 1X8FA 1SJAA 4KRTA 4DY1A 1R9YA 2E67A 3D46A 4KS0A 5I24A 1YBQB 2C16A 4KFPA 1F3WA 3W53A 3BDKA 4CVWA 1CB7B 1JAKA 4S2BA 3MUAA 4M7TA 4H41A 1J5TA 4IQLA 2PTZA 4MY8A 4HJWA 4W84A 3BAJA 2ZC1A 1RCQA 1TIMA 4GD0A 3VC6A 1PV8A 1AW5A 1ML1A 1JCJA 3T40A 3OQEA 3TCSA 4C6PA 1GORA 3HTWA 1UKQA 1H7NA 5ABGA 4FOUA 4WDWA 1AJ2A 2DPEA 1DJIA 1W9XA 2X1UA 4QCEA 3DXIA 1X38A 2J9YA 5K9XA 1TQXA 3OG3A 3K13A 4E8CA 1C9WA 3M5YA 4D6HA 1XRTA 2QNEA 4QAWA 5F1UA 3NQAA 4O17A 4AMCA 4ZR8A 2HS8A 1S5TA 4GRSA 1Q6GA 5A8QA 3TYUA 1P5BA 1GT8A 1QW9A 4IMGA 3UG8A 4QIUA 2GDQA 3ITOA 3RU8X 2NV1A 3WNKA 2GQ9A 3BG3A 1R3VA 5A6KA 3UYIA 1SVDA 4P5UA 3IJQA 1FXPA 4B5VA 3PUDA 1IR1A 3N4AA 4AY7A 2D0HA 2FHBA 3IGUA 4HU8A 4L64A 4LY4A 4H9XA 1TV5A 2X09A 4EANA 4KF1A 1Q45A 3LQLA 4LX4A 5CZKA 4YWSA 4F8XA 1M7JA 2YA0A 3GQYA 1UZHA 2OQLA 1S3TC 4WY0B 3PZGA 1E15A 2HE8A 3WQ5A 3THDA 3WQGA 2CBUA 4JL1A 2Z25A 1ZQ5A 3K1DA 2X7VA 4EP8C 3BSMA 3MP4A 3MVIA 1TIWA 3IV3A 5A6LA 4ZVJA 1HUVA 2FZNA 2OKOA 1ECQA 5FJJA 5A6AA 4RK8A 2FJKA 1DVJA 1Q6OA 5HOSA 2XTKA 1WZKA 1YDOA 4C91A 3DIPA 3TN3A 3UF9A 3U2CA 2AL2A 4OUEA 1MRAA 1XCXA 4DBSA 4IIDA 1SO5A 2XVLA 3G8RA 1TV8A 4S2CA 4BWLC 2BGNE 3DHFA 4GXPA 4ATDA 1MYRA 1LG2A 4UTIA 1OYAA 3WH7A 4O10A 1V79A 3IV8A 1A5OC 1GPFA 3FJ6A 2WKJA 4NYUA 4H9ZA 1ZJAA 4K8GA 5DMMA 3P6LA 3MV01 4AWEA 5HJLA 3L2LA 4MTVA 2CXGA 3PBWA 6ALDA 1LOLA 4PSRA 1H7WA 3HPXA 3E2QA 3EKZA 3ZS4A 4LVAA 4DM1A 4EOUA 1UW9A 1E0VA 3TTQA 5DX7A 5CPLA 1LBLA 3E2SA 3LTPA 2Z1XA 1NM9A 2NV9A 4F0HA 1DP0A 2PGEA 3LLXA 5FEWA 4RDWA 4LRTA 5CJ5A 1UWTA 2CXEA 3FVDA 4LVDA 1VB9A 3F2BA 3REQA 3TYDA 4NZJA 2B0MA 1JVNA 4FX8A 4PCFA 4UOQA 7CGTA 2YXGA 4H2CA 3K1GA 2X0HA 3NVTA 3CL8A 1GYMA 1IWBA 2Z6JA 5FACA 2B7NA 2GK1A 1POJA 2AL2B 3B40A 3NYZA 1PAMA 2BOGX 4PFHA 4HP5A 2VZVA 2OYMA 4QTGA 4AC7C 2HV5A 1VFMA 4WCJA 2WVVB 3FCPA 2JIEA 5GNZA 1VP5A 3TC7A 3FLUA 2E4TA 1B3VA 4UR7A 4HA3A 5AHNA 1U30A 3G6MA 1C90A 3HPSA 2QCDA 4GQRA 2W27A 3N4EA 2HVMA 3W1XA 2C1HA 1CGWA 4JCLA 3ID7A 3T9PA 1X1ZA 2VT0A 5KZEA 3WK3A 1WZLA 1JRBA 3NQCA 2O9RA 1OVDA 4GXWA 1MRQA 3PJXA 1F5ZA 3WBYA 3GU2A 3QZEA 4GPNA 2BASA 2P53A 2QJHA 4L1GA 4P8VA 2WZMA 4IPNB 3SUVA 1BF6A 3SGGA 3DEQA 2PTWA 3WK2A 1V7AA 1HL9A 1HP5A 3FJ4A 1PX4A 1GEQA 4O16A 4QNWA 4MIMA 2VOTA 4GABA 3RPDA 2F6UA 4GUHA 3STGA 3NO5A 4LYQA 4E4UA 2OO0A 2ZZ7A 3BH4A 4UNKA 3SR7A 4OE7A 4J3WA 4O11A 4S3FA 2R14A 1W1YA 2VEFA 5JBFA 1P0BA 1EJ7L 1XLLA 5EU9A 2V5DA 1C7SA 3ME3A 1H11A 1SO6A 1A3WA 2O56A 4UTFA 4HK6A 2PDQA 3HG3A 4Q33A 5U7SA 2ZXAA 3USZA 4S3KA 4TR9A 1XIGA 3OEXA 4JTSA 1RPXA 1ONWA 2V30A 4P8WA 3O1NA 1AK5A 4PMZA 4NJJA 3LENA 2VGGA 3WQOA 3MWCA 1XLFA 3MS8A 3P5ZA 5I78A 3ENLA 9XIMA 4PC8A 3V75A 1LRNA 3UWZA 1YTKA 3F4WA 2W63A 5I2UA 2WMGA 3W6YA 1YPFA 4R5EA 1R3RA 2WCAA 4FF7A 5MKGB 4AC1X 4OOZA 5CSYA 2DZXA 3KE0A 3R0DA 3FSUA 2V3EA 1XGEA 4M24A 3T07A 1MI3A 3DFTA 2SFPA 3B8UA 4YVVA 4QITA 3HJZA 3DDMA 3KX6A 3COTA 1V93A 3OU8A 4ZCWA 6TAAA 5KMYA 3ICJA 1YTDA 4PCPA 4F0LA 1WBJA 5AVNA 4IL2A 3B04A 1FFQA 1XQLA 2CLFA 3LQGA 1XLDA 1XLHA 3NYDA 4CQ9A 5K9DA 4AVNA 2FKPA 3H2FA 2YBTA 3AMGA 3HOJA 4MJ2A 3PBUA 1E9ZB 3FW6A 4CQ8A 2GQAA 4TVCA 2C0HA 4KGJA 4CVUA 4CCZA 4BEUA 2HRWA 3DENA 1E0WA 3AHTA 3CUZA 2E25A 2FVLA 4AVFA 3K2GA 1HNYA 3VNKA 5C54A 5IBXA 5E9XA 4O57A 3QQ0A 1R86A 6TIMA 1Z44A 1S5VA 3VNDA 3QZ6A 2BGQA 3G6LA 3HGRA 1LRTA 1XGDA 1N55A 3MSDA 3FGCA 2X0SA 3PULA 1UB3A 4JNMA 2HPIA 1FH9A 2X1SA 1YHTA 3HMJG 4K68A 4PE8A 4IX0A 1XIMA 4MDPA 1OK6A 4QQ3A 3WF4A 1Q65A 1J79A 1MQRA 4OECA 1VRDA 2X1IA 4NT0A 4MJMA 3SBFA 4EXQA 3TOYA 4IICA 3DFQA 4PUUA 4A2SA 1AMKA 3BLLA 1XUZA 3UZJA 4M6QA 3AZSA 3EWWA 3EWUA 4RZBA 4LS1A 2YSWA 4D6DA 3CAWA 4C6JA 5H2ZA 2B7OA 2ATSA 4JOMA 3KXQA 3P8IA 3CU2A 2TAAA 4C6BA 4LNCA 3PS7A 4AD3A 3FOKA 4PMRA 4QCFA 1EZ2A 2FDSA 4NY2A 3E49A 3QR0A 4GNVA 3T7VA 4CD7A 5EGRA 2OPJA 1JULA 2YCJA 3WQWA 1ESWA 5C7VA 3N9SA 4PMUA 3GZ3A 3W3OA 1PCKA 1MUWA 4HA1A 1AA1B 4XAPA 2YDAA 2WWCA 2YKKA 3D47A 1PE1A 2WHJA 3FYPA 5IDZA 1B9ZA 4U5IA 2JF7A 3QBUA 2GJNA 3WL1A 4Z1YA 1KXQA 2RAGA 4UQEA 4IPLA 1ONEA 2OT1A 3ABRA 4WKHA 4AIBA 4IMFA 1NQKA 1J0ZA 1XR2A 2W91A 3SW6A 4BFAA 3UY8A 3GU1A 3SCRA 1YLVA 3MSRA 5DELA 3NOYA 2O0TA 5HJYA 5A1AA 3WQPA 1DJWA 4B3LA 2ZWZA 2E40A 2XFRA 3CQIA 3CZJA 1AQHA 1M3UA 1KFJA 1RLCL 1Q6QA 3FS2A 3ZZ1A 4XD6A 4D8AA 1E6PA 3VNZA 2IXVA 4GI6A 2Z1KA 1QMLA 3GKAA 1G0CA 3W74A 1WV2A 1XUUA 3N12A 1VBJA 1ADDA 2QCMA 1PSCA 1EO7A 3H70A 2DVUA 3NNTA 4U5KA 1KM2A 1RQBA 1SFJA 1WNOA 3FA5A 3NQ6A 1TWIA 3SCTA 2QJMA 5KZMA 5KTLA 3PSWA 4MAVA 1W0MA 1JDCA 4UTUA 1D3HA 1A5KC 4FLRA 4DWSB 2QDGA 1JUEA 1DEDA 3FV9A 3K4DA 2PRHA 1SR0A 4JNZA 3WQ8A 3VGBA 1J2WA 3U6WA 4IMDA 2X16A 3B9AA 4Y9NA 2E9MA 3ARZA 5ABHA 4HYWA 1H50A 1MUMA 1DIOA 2EHHA 3VU2A 1W1ZA 1EUNA 4Y8FA 3IIVA 2FTYA 3U7BA 1BYAA 3SCWA 2YL9A 3A21A 1QCWA 3M43A 3UG4A 5T26A 4K8EA 2PWUA 3O06A 3TJIA 1WPCA 3BAXA 3R10A 1MDLA 2QV5A 3GE7A 4O0ZA 2DZPA 4D6FA 1OFQA 1FDZA 3URBA 3W2NA 4PTMA 3WBWA 3IIXA 4UCFA 4G6CA 3WUFA 4QJ3B 2VEKA 3RPMA 3LD5A 2CHNA 3UP8A 3G0SA 5EMUA 2G8ZA 5CSSA 2ZX7A 3MKVA 3PAJA 3VDAA 2YYUA 4AHQA 1BRLA 4GNJA 2ZICA 4MADA 3M0XA 1A4LA 5GJNA 4BS0A 5A95A 4NNCA 2DUZA 4LW7A 1JZ8A 2ZC8A 4C1NA 4AZIA 4Q6JA 3VD7A 3OP2A 4PULA 4QEHA 2A0NA 4DRSA 4Q8WA 3OG2A 3HGOA 4HNCA 4PODA 2E09A 2A3CA 1QOQA 4W5UA 2VQUA 2I9UA 4EF8A 4QJ5B 2ZX6A 2XGZA 1PTGA 2WV8A 3W2UA 3NO3A 3P93A 4HK7A 1W5PA 2BOFX 1W37A 3MHUA 1JPMA 4Q4KA 1GVEA 3GW3A 4X0VA 4ES4A 4XTDA 2VFDA 3H4WA 4JTRA 4UQAA 1CGUA 1YMYA 3G3DA 3GDKA 3WK0A 3IIZA 1G4SA 3RX3A 3TH6A 3PBGA 4ZXOA 4RCXA 1R7AA 3LGEA 1V6VA 1F6YA 2P8CA 4FR6A 3TONA 5ABFB 1MFVA 3R7MA 2PS2A 1A5UA 2YCEA 1WXYA 3FIGA 4GIYA 3BJSA 3BW2A 1VLIA 1PXGA 3F4CA 3QTGA 1IWAA 2HDJA 4JQ3A 3KBJA 2CNCA 1NDVA 2QJGA 2QCLA 3GTXA 3T05A 1P1XA 2ZYFA 1QAPA 1LBMA 4M8UA 3PP7A 3RCMA 2PCEA 4PUMA 1V3JA 3VIIA 1R46A 1V0LA 2X41A 4NAEA 4QRNA 5C2GA 3OODA 2IKIA 4WDUA 4ADSA 1RJRA 3LUTA 1F6PA 3LV5A 2VR2A 2A7RA 3PJUA 4M56A 3SCQA 4JQ2A 4E6MA 4W8LA 1WOAA 2VELA 1R9ZA 3GXMA 4P7LA 1XP3A 3S2MA 4HNVA 4X0NA 2OR2A 2QV4A 2ZA3A 3KLLA 1KCXA 4ZFMA 2D24A 2CKSA 4LEQA 1OFRA 2O7SA 4US5D 1F8IA 1UJPA 3OLGA 1NOWA 4U10A 3O63A 4X22A 1E6SM 4PUJA 4A29A 3BO9A 3UEQA 3B0YA 3VVGA 1K6AA 3GC2A 4HMNA 2FJUB 1SUXA 2XWEA 3M7WA 2UV8G 1MUCA 5D02A 2GOKA 4MVAA 2J77A 3VIHA 5ABTA 1F73A 3L9CA 2H9AB 4FHAA 2EO7A 1HW6A 1VD6A 3N3TA 3KDNA 3R5EA 4GZEA 4EPBC 1KM3A 1C8QA 5EKYA 1YXDA 1HTIA 1R7OA 1ZTVA 3LHUA 1OFDA 5LSMA 1J4EA 2JALA 2ZCGA 1L2QA 2YOCA 3WLLA 1PZ0A 3GH4A 2VGBA 2TODA 3R89A 3MY9A 1GVYA 5HULA 1LUCB 1W91A 1KM5A 2VCAA 2V9DA 2G3MA 3W9ZA 2GUUA 1SO3A 2EJ1A 5AYYA 3LK6A 4ZA0A 1TV3A 2GWNA 3ITGA 2QW5A 1JNEA 3STFA 3WO8A 3F2CA 1EJSC 5CGTA 5E70A 1S5WA 2XH7A 4KWUA 1F3EA 3GNNA 1DHKA 3UERA 4FNRA 1GOIA 4M6UA 4IIEA 3KHJA 1YXYA 5FAJA 5LKYA 1GHRA 4ROPA 1J6PA 2NUXA 1KBKA 5JBEA 1TA3B 4AZ6A 3ZOAA 1FWCC 1FH7A 2J27A 3QOMA 1IEVA 2ZVRA 1YE4A 3T42A 3N9KA 3N18A 4EXBA 4GIEA 2G3NA 3U4FA 1KBLA 2XH4A 4FLSA 3MYOA 3P74A 2OZ8A 2CLHA 3SJ3A 3WQ6A 2CCRA 1G6CA 4UZSA 2GVGA 3TYAA 5BCAA 3SQLA 1PL9A 3PR2A 4Z1BA 4I3GA 1F61A 4CNNA 3QXBA 1VCGA 4CLMA 4CQBA 3C3UA 1XFBA 3TC6A 1JD7A 2DJXA 3WBEA 1HL2A 3SM0A 3VCCA 5XIAA 2GUYA 1GOWA 4JDBA 4WJEA 1Q13A 3W25A 4UTHA 4CGTA 3RLVA 2CHRA 4JHOA 4ERIA 2VEMA 3DHPA 1S5NA 4CD8A 1PIIA 1XDJA 2OEJA 4NJGA 1MZRA 1RAKA 1E1CB 3NSXA 3KFTA 3WH8A 2WXDM 4QJ1A 3U2OA 1M03A 1ZLPA 1SZEA 4YU1A 5G1YA 3KOZA 3MKCA 1UQZA 8A3HA 4YTRA 3K30A 3S1WA 1O94A 3V3WA 5IOBA 2KX9A 3GUWA 4DLMA 4PTVA 4OFCA 2YBVA 1EP2A 1FWDC 1TCMA 2ZADA 4IPJA 1KB3A 5EBUA 5GNXA 1VPQA 3CPGA 2WW5A 4PMDA 3THQA 2QHAA 2INZA 2VOMA 2FZMA 4GUJA 1GQKA 4E0CA 2G96A 1OYCA 1P43A 3GIQA 5JUVA 1S3HA 4IMEA 2E77A 1TSIA 1PWLA 4Q4SA 1HGYA 5BXTA 3C61A 4IT1A 1V02E 3SUTA 3KCLA 2NT1A 2WSPA 3LXCA 1IXOA 1KXHA 1UH4A 2INEA 1P7TA 6REQA 4O14A 4REQB 1XLJA 3FKRA 3P5YA 3UNDA 5D2XA 3QFEA 3NJ3A 3BMVA 3GFZA 4HA4A 4JX6A 2HZGA 3LPGA 5CJNA 1XL9A 1YXCA 4E2VA 4MKSA 1B3ZA 3LZ5A 1KTNA 3GVWA 4Q8TA 2OWWA 1FDYA 5I3KA 2ZZ2A 1X1OA 3HBLA 3RX2A 3G24A 2I7GA 4JFSA 3T0DA 1CXKA 3VOGA 4WUIA 3TFXA 3LM3A 1CZ1A 2E68A 3R1ZA 4PMXA 2HMCA 2R91A 3NUKA 3VIPA 2BVDA 3H12A 4IGHA 2GOUA 1E5NA 3GVVA 4NU7A 1SM9A 1UWQA 2XSXA 3T0TA 1E6QM 4Z1AA 1QBAA 4BQ4A 1JUBA 2V5KA 2BXZA 2Q01A 2OOFA 3GXNA 4XSMA 1KQYA 3VFCA 2CETA 1KA9F 3AU2A 3V0SA 4AZBA 2J6XA 3BV4A 4EK7A 1H0GA 3WD3A 4B2DD 4GQ0A 2F7FA 4AXKA 4RR4A 3V5OA 4X9YA 3TNBA 4L4PA 1FWFC 1QVBA 4NZCA 4HU4A 4XISA 5FCZA 3AXHA 1CLKA 1TX0A 2DT3A 1Q4WA 1AL7A 5EY5A 5A8OA 1ZJIA 1JAEA 1TMHA 2VI0A 1LL6A 2V2DA 1EA0A 2AGTA 5A6JA 3G5EA 4ASTA 3ZR4A 1VIZA 2B31A 1IHIA 2JKAA 3MZNA 1SW3A 3N4FA 5AKQA 3QV6A 2ZRUA 1QT1A 2A7PA 3O05A 4Q4OA 1EDGA 4C6OA 2P1FA 3QMTA 3BQ6A 3EWYA 2J8FA 1U1JA 1HP4A 2NQJA 4LPCA 4IHCA 4XZMX 2BP1A 1LDCA 1O5RA 1RALA 3RDKA 3QMRA 1UPMB 4M3PA 2Q8ZA 3K8LA 1Z8AA 4YTSA 1R38A 5I3JA 4GK8A 3RHGA 4C6CA 4IXHA 4IOTA 2QUUA 2V82A 3SB0A 2HEJA 4PUKA 2X2GA 2XN0A 3CAKA 3NPWA 1OFEA 4DJED 1CXHA 2RDTA 4KH2A 2XIOA 2B81A 4RE3A 1K9FA 3V1PA 5DT7A 2AOSA 3NOEA 3MCNA 3WNNA 3DFYA 3F2DA 4QSFA 1GQLA 1BSIA 1R9XA 2VC6A 2CBVA 2QT3A 3WLKX 2R1MA 2VX7A 4WZHA 4H19A 1XPGA 3W37A 2J88A 4NF7A 3S83A 3XIMA 4B3KA 2ZXQA 4GISA 1ZPTA 1N7KA 4ZO9A 3TN6A 3CAVA 1HJSA 3QMSA 1EKOA 5M03A 1DXFA 1C8YA 2D20A 3HV8A 4PTWA 2JF6A 4ATLA 4HZMA 3MB9A 1WDDA 5EMJA 3UPBA 3WLTA 1XIHA 2ADAA 2QCGA 1WUFA 1O60A 3KOYA 2ON3A 2WB5A 1HKMA 3EWDA 4ZOAA 3QR1A 5DRCA 2PWHA 3QPEA 1V6YA 3PG8A 2E5CA 4ONVA 3PPHA 4C6NA 2PTXA 1LQAA 2WVVA 3UESA 2YZRA 2YLAA 2EG7A 3ITLA 1W9UA 3R25A 2WQDA 1JCYA 2ZUSA 4MB1A 3IIOA 1WE5A 1XYZA 4UTTC 1QWGA 3M0MA 1RR2A 1EJXC 1SJBA 3VX0A 4BZYA 1GKRA 3GNPA 2P8BA 2VUNA 2Y5EA 1VYPX 4TO8A 4PMVA 3KBVA 1H7XA 3FJNA 5A2CA 3ZVHB 1WB0A 2A3BA 1XF0A 4UTKA 5F2LA 1H4PA 2OLHA 3UJSA 1C8XA 4U28A 1V6XA 5E6ZA 2W61A 1T40A 3PWGA 4PRWA 4IFKB 3WYZA 3ZQ9A 1OK4A 3VD5A 4IISA 5ECVA 1R2RA 5CC5A 3BAWA 2A21A 3BW4A 1M9HA 1EEXA 1GQIA 3TQPA 4DWSD 1B9BA 3WEZA 1TTQA 4ORMA 3EB2A 4UTJA 2HXUA 1BKSA 5CPMA 1P1MA 3NQVA 3KL5A 2E1WA 3HIJA 4RZ5A 2QJIA 1EJRC 3EB4A 4PCSA 1E0XA 1GYLA 1D2KA 3LM7A 4F2UA 3OVPA 4H9UA 5I77A 3M0YA 4CNTA 3SRFA 3S2JA 5CGMA 1UMYA 2Y5JA 4QNEA 5G4EA 3EA3A 4GFSA 2PBGA 1FTXA 5H8MA 3U4AA 2Y7EA 1AH3A 2DIEA 1F4AA 4JXCA 4EAYA 1XSIA 2Y88A 4HYVA 5AOUA 1UR9A 4R7WA 4UQCA 4MB5A 4GC4A 4A8NA 3PWIA 3FAWA 1JYNA 3URNA 3S5YA 1FKWA 3LI0A 4HVXA 3B03A 4FLQA 3NPVA 1E43A 1HIZA 1R3WA 3MW7A 3LG3A 3VKCA 4GY7A 1SYTA 4JIQA 4K39A 1FQ0A 2CYGA 1NDWA 4JZ5A 1HJQA 4KEMA 4LV4A 3KP1A 2BG5A 1DTUA 3FHQA 1NELA 3W27A 3VDBA 2CEQA 1GVRA 3ZR6A 3PN8A 3OZOA 3UXAA 3BGAA 4FIRA 3DBPA 4H6KA 4M6VA 2P3EA 1LF1A 2WMHA 2EPLX 3I65A 1LP6A 1WZMA 3H8AA 3H2CA 1AJZA 2BDQA 3WLQA 2PGFA 7ODCA 3GC4A 3F7JA 2A3HA 5H8UA 2FFCA 3BARA 4DPPA 3ONCA 4IIFA 3KL0A 5GQBA 2ZRYA 1E0UA 3OA5A 3W85A 3LPPA 1HT6A 3LYEA 5TIMA 2V68A 3CIWA 4PFMA 4LS2A 3NIYA 3FXGA 3WN6A 2GSEA 4WOZA 4Q7NA 2PE4A 1UKSA 1P6CA 3BLDA 3S2CA 3S0CA 4N6FA 2YLLA 3IUDA 1CLXA 1I2QA 1FWHC 3PC0A 2VL4A 2P88A 4GUIA 3FDKA 2YGYA 3R58A 2O4QA 2WQPA 2ZBTA 4W7UA 2I1OA 3C2EA 1XBXA 4A8IA 1E1EA 1LLZA 3TXVA 5FJPA 3W72A 1FHUA 4XVDA 3IRDA 4NHVA 3ZLHA 2PDGA 2Y2WA 5F7UA 5JIPA 1CNVA 3G0UA 1W6TA 4Z0SA 3Q67A 3T4WA 3NZRA 5DCBA 3EXSA 4NZ3A 4OTKA 1YKWA 5I3FA 5LNRA 1EWDA 3DI1A 4NI8A 4J4KA 4LUJA 2JGQA 2ODOA 2WNNA 1KR0A 3IS4A 3CZLA 1PZ3A 3W81A 4YJ5A 4HMCA 4H8VA 1RH9A 3MC5A 3UT0A 4OWGA 1EOMA 3VILA 4A3QA 2NWSA 1BTCA 3SY1A 1RD5A 1SU5A 3WKZA 3VM7A 5HNUA 1VBGA 4B3ZA 3MBFA 5D2WA 3W28A 4EAMA 3REQB 3SI9A 3CUIA 1U1HA 3N11A 4DF0A 2Z7KA 4AF0A 1C9DA 4Z2IA 3QLLA 3RN6A 3NCOA 2WJFA 3EA1A 3GH5A 1HL8A 1OHLA 4RNFA 1QPNA 2G37A 3BE7A 1OD8A 5HR7A 4US5A 3RYSA 3APYA 1S46A 1BQGA 1V03A 1TVPA 1QHPA 2I56A 1DJQA 1VIWA 2V67A 4ICCX 4AZGA 1Y7VA 1JZ4A 2Y7DA 4MYAA 4PRRA 3VINA 1H2JA 5CCZA 2NUWA 1P7TB 1TV2A 1U5JA 3WQCA 3OGRA 4NI3A 3AMCA 1JQVA 4QG6A 1OIFA 4G7FA 3DFOA 1S2UA 3W1AA 2PDFA 4WVXA 3FX4A 5FL0A 2ACRA 3EMCA 3NL3A 3G1HA 1N8FA 1ITXA 4AU0A 3E0IA 5A94A 3GIPA 4KT2A 4V1YA 1S1RA 3GDMA 1HO4A 4EWJA 3GC5A 2ZRWA 1PEZA 4GYPA 4A8LA 1A5NC 3PJWA 1VFLA 1W5MA 2EPNA 3WQ4A 4TQTA 4JIRA 1TPH1 5DXYA 3W7NA 4BI5A 3FA4A 1EH9A 4TXEA 4H8NA 3WLMA 3DC8A 4J2MA 1UWRA 1JYVA 3OZPA 1O5KA 2QAFA 2VEPA 2ZVIA 5AHEA 4GH1A 5CPTA 1DE6A 2F61A 2R1LA 1J11A 3U8GA 3H22A 1BVWA 1BWVA 1XDMA 1NVMA 3EAUA 1GTHA 3NTYA 2WOQA 1EL3A 1J10A 3L4UA 4DJDA 1RLDA 4EWND 3BAIA 3NL2A 1TUXA 3U5YA 1B31A 3O2LA 1A5SA 1VR6A 1EGZA 2CKRA 3N1AA 3GNDA 1TV4A 4S38A 4GQQA 4XUYA 4FA3A 3MUXA 2VDHA 3HFTA 3W87A 3AYTA 1DJXA 1TWDA 2XU2A 4CU8A 3G1YA 2CU0A 3Q94A 3WLHA 3G77A 2GSHA 4U33A 4PN2A 4DXKA 5DLCA 3H4XA 3HPAA 3ITTA 3TOPA 4JPGA 5CQ1A 3GTIA 3IRSA 5BRQA 3WQEA 4UFIA 3H4GA 3M5ZA 3E6EA 1Q66A 2QPXA 3CYVA 2ZX8A 3NSMA 3M6DA 3W7QA 3S8HA 1OX4B 2I16A 2FH6A 4A3HA 3GSMA 5I3DA 2EPMX 5C7HA 3EZ4A 1DE5A 1SMDA 4AZ7A 2WVTA 3VCNA 1A3XA 1FWTA 3BZJA 3TYEA 4TX8A 4QAIA 2P50A 3M0KA 2WM1A 3GZAA 2Q8XA 2VDGA 2Y7GA 2DW6A 3GD6A 1IXPA 3M16A 4OBSA 4U2YA 1NU5A 1XLCA 2DIKA 2OKTA 3TVAA 3L2IA 3T6CA 2ATMA 4OVXA 3G18A 5D4YA 3OGVA 2ZDSA 2JKPA 3B8VA 4YTTA 3TU9A 2PTYA 4WSHA 1X7FA 1KTBA 2DQXA 1EGMA 2QAPA 1HKJA 3N13A 4GMEA 5EBAA 3AS0A 3BCDA 3NQGA 5IXEA 1HO1A 2HVOA 5HNNA 4RL3A 3WEOA 3MI2A 3S5SA 2WAGA 2ZUMA 3I10A 3IANA 2XIIA 2H90A 3TN5A 3UXLA 4XV0A 4FP1A 4MUPA 4LUYA 2JQXA 2XVKA 1Q6EA 1XH2A 4JN7A 3MZ2A 4R88A 1XKJA 3A4AA 1RUSA 2D69A 3Q37A 2ISVA 2J7FA 3LRKA 4LV9A 3WG6A 5J8LA 3R8RA 4O12A 1EB3A 3BJTA 1MZHA 3HA1A 2B7PA 4AEOA 4MF4A 2NX3A 1T99A 4AD0A 3DG3A 4JTKA 4P7QA 3DI0A 3LPFA 2GFTA 2IPFA 4HD5A 1T6MA 8XIMA 2ZFAA 2VENA 2ZQ0A 4WDXA 4X3ZA 3FK4A 4FPSA 3T78A 1H3GA 1NFBA 1G4EA 4UXDA 3NWRA 1ZENA 1QI3A 3IGSA 3UGVA 3QGAC 3EOOA 1UZDA 3TDFA 5DFAA 4PL2A 5CEWA 4FLOA 1QU4A 4LU0A 4M80A 1OIMA 5E0KA 5AYZA 3M64A 4NJIA 2DZTA 3TAKA 3MJYA 4L61A 2G95A 2VCBA 2XHYA 3W76A 3IJ9A 1E3XA 4W7WA 3NGFA 1Q6LA 1MO0A 4HNLA 2V3GA 1UWIA 1ZUAX 3UJRA 3BAKA 3GFYA 4XZ9A 3NGJA 1LYXA 3W29A 4GZJA 3BVJA 5D30A 4GZIA 1ICPA 2J9ZA 1QPOA 2YCIX 1F74A 1CWYA 1RV8A 1RK5A 4Q4QA 4IQJA 4O8RA 1VC4A 4J3UA 1SQ7A 4M81A 8TIMA 1SFSA 7A3HA 4AG0A 2R8WA 2ACQA 2A2IA 1VCFA 4WRHA 3KCOA 2ZTKA 3OYZA 1MNSA 3N6QA 4C6QA 3B9OA 4L5ZA 2NXGA 2GDVA 3O8AA 3E5PA 1XIIA 1Z69A 4W4QA 3K5XA 2FGZA 4N02A 5BROA 5AECA 2VWTA 3WQDA 2NSOA 3AIBA 1QOPA 5I79A 4PEKA 4L4MA 1HVQA 4Q8NA 1QTWA 4C1LA 2AQOA 4TU1A 4KRZA 1BAGA 4MKNA 3LOTA 4AWSA 3LNMA 1VFTA 2WJDA 2BV9A 4IWWA 4H9TA 2VFHA 4AZHA 2BLEA 5HMFA 4MB3A 1UMLA 3EWCA 3VDHA 5BNKA 2G3FA 3KWXA 1PIFA 3OLDA 5FEXA 4H7ZA 3T8LA 3RMEA 1ZBWA 2TMDA 4DM2A 1UD5A 1KM1A 1BFNA 3LBCA 4QX4A 5CLWA 2V8ZA 3HPFA 4DNHA 4DO4A 3WBAA 4RKAA 3D0CA 3ERPA 4JN8A 2WBGA 2IXUA 2Q71A 4TIMA 1XCWA 3UWVA 3WSUA 4ZL1A 1ONRA 1NP2A 3QY6A 4LF2A 3KVLA 4YL2A 2PP1A 1IZKA 3W7LA 3WLOA 3MYPA 1UA3A 3KEHA 1H7OA 1Q7MA 3RR4A 3JRKA 1YEYA 2PMQA 4I5UA 1DQWA 3I7QA 1FA2A 3CV7A 6PTDA 4GC3A 2OEMA 2OZTA 3AHYA 3BLFA 5G4HC 2ZRZA 2VHLA 3N34A 3VX1A 4W9TA 1G7VA 1QDSA 4ZQRA 3PPGA 1A5LC 1OCQA 1HKIA 2GUBA 2AQVA 3N2MA 2XSBA 4GXMA 1MW2A 1LORA 1GG0A 1VLWA 1H7PA 2YR1A 1PTDA 3BJFA 1Y65A 2XM1A 4JTUA 2XGBA 2D2JA 1IXNA 4FX6M 3KP0A 3W70A 1TA3A 3AYVA 3GAKA 1UR1A 3IUHA 1SZNA 2OQHA 1QFEA 3GB6A 4NZFA 3GDBA 4QXIA 4KFOA 4REQA 4DJFA 3EOSA 1L6GA 2QPSA 1WOBA 4TMCA 4AISA 4AAJA 4GIRA 5A6BA 3CUJA 1I1XA