3GYLB

Structure of prostasin at 1.3 angstroms resolution in complex with a calcium ion.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Active site conformational changes of prostasin provide a new mechanism of protease regulation by divalent cations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gylB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gylB01
1W10U 3CENA 2P3TB 3QO6A 3VFEA 5C1UA 4Y6DA 3Q77A 2EA3A 3KNXA 3ZYDA 3V7TA 1JOUB 1O2YA 1MKXH 5EGMA 2AYWA 1O5GH 2BQ7B 2ZDVH 3UNRA 2UWPA 1MCTA 5HM9A 3I29A 1JBUH 1MD7A 5T6DA 1HJ8A 1UO6A 3UUZA 4B2CA 1AWFH 1QRZA 4HFPB 1IQIA 3RM2H 1LVYA 1GMCG 1ARCA 3GOVB 4AN7A 2ZU4A 2GMTB 1LDTT 5A0AE 1F0RA 3GDVA 5E2OA 1FY1A 3KF2A 1V2TT 1OXGA 1BBRH 1FY3A 3MI4A 3ODFA 4MTBA 1YP9A 1QQ4A 1TBQH 1TONA 1GBAA 2KAIA 3GICB 3SU2A 1DWDH 5C5NA 3M5OA 5CHAC 2VINA 2WPLS 5DP9A 1KXBA 3VGCC 2SGFE 5F8XA 1ZHRA 3MH5A 3C27B 1VJ9U 2ULLA 5EW1H 1O5CB 2A4OA 3U1JB 1RGQA 5C5OA 1TGBA 1TMTH 8LPRA 3TGIE 4AFUA 1ETRH 1BTPA 1PQAA 1GBHA 2ZEBA 1TGCA 2XCFA 3EQ0H 1F5LA 1TAWA 1EJNA 1RIWB 2OC0A 2OC7A 1D3TB 4NIYA 1OS8A 1AVGH 1P8VC 3MNCA 4ZMAH 3R0FA 4O97A 5E0HA 3KL6A 4CREA 1UMAH 1GWAA 2PGQB 2JH5D 2FLBH 3ZZ9A 2PUQH 1NFWA 1XUFA 4IBLH 4DGJA 4IW4E 2RG3A 1GHZA 1Y5UT 4ZHAA 1C1OA 1AGJA 3MO3A 1ZMNA 1O2IA 1GHXH 2DE8A 3TPIZ 3GDUA 5FHTA 2BXUH 3FP8E 1C4U2 1BRAA 3MNSA 4ABEA 3STJA 1HV7A 2FOAA 1MTSA 1P3CA 1KTTB 4ZUHA 1EX3A 3ESTA 2CHAB 4D9QA 4HZHA 1AB9C 4Y8ZA 5C20A 4E06H 2DUCA 2FOCA 4X1NU 3E0NB 2ANKH 3VB6A 1QB6A 1P9SA 1ZRKA 2PSXA 2XC5A 2AIQA 2XBYA 1GBMA 1DDJA 2EC9H 2GX4A 1E35B 1GJ4H 4MPVA 3RDZA 1SGFA 5F8TA 4OS6A 2O8WA 2JH6D 2BDHA 2QXGA 1F5KU 3EDXB 3UREA 4KGAA 3ATIA 2ZP0H 3GCTG 1GL1A 1P04A 2W5EA 1GG6C 3SU3A 3DUXH 4FU8A 2J38A 4X0WU 2VVVA 1C5NH 3LGUA 1UVOA 3BTQE 3MHWU 1QGFA 3KHVA 1Z6EA 1CHGA 4X8UH 1V6DA 3PLPA 2ANYA 1MBQA 4UONA 3C1KA 3K2UA 4AB9A 4X6PA 2F9UA 2FS8A 1AVXA 1MD8A 3Q76A 5I46H 1PPBH 1O3OA 2ZPQA 4K60A 4DT7B 4BTUB 5FCKA 1SQOA 4KTCA 1NT1A 1OYQA 1V2VT 1IOEA 2Z9LA 3A80A 1QIXB 3EE0B 1ZPBA 3RU4D 4UFGH 2SGQE 3ATKA 1TNGA 2OD3B 1MKWH 3SV8A 5AF9H 5ESBA 5B6OA 1O5BB 1T7CA 2ZU1A 3A89A 1LQEA 2V3OH 2ZFTA 1QL7A 2QF3A 1V2JT 1F2SE 4AB8A 4MNXA 1RS0A 5DP8A 4UEHH 2C4FH 1O3CA 4CRGA 1CA8B 3RXEA 1TNHA 5ABWA 1QHRB 1FAXA 1EAUA 4IGDA 1DXWA 2G00A 7ESTE 2BMGB 1C5TA 1EZQA 3RU4T 1UVTH 1E38B 1SBWA 1ELEE 5FX5A 5HM2A 2UUKB 3RLYH 3BF6H 1QBVH 3SW2B 1K1OA 2A1DB 2PWXA 1KIGH 2EI6A 3P8GA 1NU7B 1MAYA 2IJOB 2Y81A 1G32B 4X1SU 1ZJKA 1QNJA 2A5IA 1GMHF 1GHBG 2TGTA 2HGTH 3SOSA 4JZIA 1A3BH 1K9OE 1YPLH 1PFXC 1YPHE 2SGPE 2ZDMA 1W14U 2FX6A 1BB0B 4X6MA 1DSUA 1ZHMA 3P8FA 4A5TS 1LHFH 1ELVA 1C2JA 1G9IE 4K1EA 5FAHA 4UD9H 5JDUB 1G37A 4GCHF 3IG6B 4TPYA 1J8AA 2UUFB 4BNRA 2O9QA 1K21H 4ZH8A 8GCHG 1HJ9A 1GI0A 4ABJA 3BEFB 1FLEE 1G3EA 3FVFB 2PW8H 5EQQA 1MTWA 2BD4A 1GI8B 3B23B 3MU4A 5GCHG 4ISNA 3LT3A 4X2VA 1ZR0A 3LGVA 2P94A 1EAIA 6ESTA 3RXMA 4ZAEA 2XWAA 2WPKS 5IDKA 4Y71A 1OP0A 1CA0C 2ZTZA 1P05A 2AMQA 3ZVEA 5HYOA 5JB9S 3F6UH 3OY5U 4A1TA 1Q31A 5FX6A 2C3SA 3SJ8A 3TVJB 1HYLA 1SGQE 4BAOB 3QX5H 2V0BA 3MO6A 3NUMA 3M5MA 5GJ4B 3BTGE 1V2KT 1IQJA 2FPZA 3UOPA 3OY6U 3TK5A 1P9UA 4KP0A 3VB4A 3ZV8A 1FXYA 4B1TA 1F7ZA 1Y3WA 1LKBA 9ESTA 1SG8B 1UCYK 1T8NA 4ZHMU 3NKKA 3SNAA 1Z8JB 1C1QA 2FS9A 2D2DA 4WJG2 3RXPA 1DXPA 1MQ6A 1ZSJA 1PJPA 3IITA 3RXGA 4CBNA 1W0ZU 3V3MA 1NRNH 1ZHPA 1ZYOA 1CGJE 1OP2A 2UWOA 3QTOH 3SNCA 2YNAA 2O8LA 3ATWA 4INLA 4NA7A 1K1IA 4CR9A 1YCPM 3RXKA 2G4TA 1ACBE 1DWEH 2B7DH 5J4QA 1ZTKA 1QBNA 1NN6A 2ZU5A 4BAHB 3RMLH 2QXJA 2QXHA 3SHCH 1N6YA 3BTTE 1Y3YA 4JYUH 3SI4H 2HPQH 3S0NA 3ZVBA 1NZQH 3MYWA 3A8BA 4Y8XA 3TNTA 3KQBA 1VR1H 1FQ3A 1MAXA 2C8XB 3BTME 3TITA 5JBTA 4O3TA 3SNDA 5GPIB 4MPUA 1O2SA 2UWLA 2ANMH 1E36B 4K5ZA 1ZRBA 2FWWA 4BANB 3SJOA 1GHWH 4B2AA 3D62A 2Z9JA 4BAQB 1V2ST 1O32A 1LKAA 1OSSA 2VIOA 2PHBA 4FUGA 2C8ZB 2FOFA 3QUMP 1G2LA 2NU3E 4DIHH 5CE1A 1GMCF 2SNWA 4NWLA 1VGCB 1GVKB 1AWHB 2QAAA 1OWEA 1AQ7A 4YOGA 1BTYA 5GXPA 1E37B 1AI8H 2BVSH 1EPTB 1W0YH 7LPRA 1XUKA 4K8YA 2M5TA 1GI7B 1YPEH 2F9OA 2NU1E 2A2QH 2WPIS 1IQMA 4LXBH 5EOKA 3BIUH 1C1SA 2STAE 2JETB 3URCA 2GCHF 5T6GA 3UNQA 1HCGA 1GI9B 3A88A 4DCDA 2DE9A 5FPTA 5BPEA 2R3UA 4GUXA 1BJUA 1YLCA 2V6NA 1WUNH 1GGDB 2ZU3A 1KLTA 1C1NA 1LVMA 2GV6A 1WOFA 1EASA 1CT4E 3MH6A 4RN6A 3SORA 2BD8A 4B74A 3P95A 3PO1C 1EZSC 4WMDA 4ABDA 3BG4B 5AFZH 1WU1A 1Y3XA 2ESTE 2OXSA 2ZC9H 4GHTA 3VXFH 3TNSA 4CBOA 1PPGE 2G5NA 1Z6JH 1HAGE 1P2IA 2CJIA 4MPXA 2FLRH 2TGPZ 2GMTC 3A87A 4BXSA 1TX6A 2PFEA 1BRUP 2ZWLH 2ZHDA 2SGAA 2AERH 3SNEA 2PV9B 1GCTB 3NZIA 3HKJB 1HDTH 4DURA 1LPGB 3MH7A 3UY9A 1INCA 4PROA 2NU2E 2HRVA 4JMYA 4X8VH 3RM0H 1O31A 4AX9H 2XC4A 1O5FH 2ZPSA 4VGCB 5JPMH 1DICA 5C3NA 2Y82A 4AFSA 1BCUH 2VGCC 4Y10E 1T8LA 1AFEH 1KYNA 2GD4B 3QZRA 5EU8A 3AAVA 2TGAA 1TGNA 4Z6AH 2Q6DA 2Z3CA 1DT2A 4OS7A 4A7IB 3T2NA 1LCYA 3D65E 1XXFA 1VJAU 4FUFA 3U69H 2P8OC 2BX3A 4WXIA 4LK4A 1O5DH 3E16B 1OKXA 5A8YA 1GBTA 2BY6X 1GI5A 3VB5A 4CH2B 4B76A 1LHEH 1VZQH 3RLWH 1SB1H 4FUJA 4X1PU 4B71A 2JH0D 3ZZBA 4ABFA 1ZGIA 3HGPA 5A0CA 2VWMA 3SJ9A 1BTWA 1THRH 1GJCB 1F0UA 1DFPA 2XW9A 1H9LB 1B0FA 1O3KA 2AH4X 3ZZAA 1UK2A 1EZXC 3NXPA 2XRCA 2G55A 3T62A 1XUHA 1QR3E 3RMMH 1F0SA 1AZ8A 3Q00A 3UQOA 1G36A 1FIZA 1O38A 4LOYH 3ZZ3A 1IQHA 1YPMH 3M5LA 6CHAB 1QJ6B 2H5CA 1O3JA 3LGWA 4X2WA 1V2QT 2VVCA 1UTKA 3T5FH 5C67A 1L4ZA 1GJ8B 1LVBA 2Q6GA 3DD2H 3F68H 2BLQA 1GVZA 1BMMH 2BQ6B 4X8SH 2OQUA 1O2HA 3MU5A 1K1JA 3NK8A 2R0KA 3DFLA 3EA7A 1DOJA 3E90B 3SJIA 2F91A 1PPCE 1SOZA 2R2MB 4A1XA 2GTBA 1W3CA 3PWCA 2PLXA 3A7WA 1K1PA 3O8RA 1J15A 2ZHFH 3A85A 1GJAB 1HLTH 2CXVA 1ZSKA 1BITA 1ZGVA 2Z6BD 1CSOE 1G3CA 1EPTA 2WPJS 2Y7ZA 1ZJDA 5E2PA 4WMEA 4WVPE 4XBDA 2RA3A 1XKAC 1ID5H 2BLVA 1P2OA 1L1JA 1DWBH 1HBTH 4ISOA 3PTNA 4AFZA 5EW2H 1EP6A 3KCGH 2A4QA 3L6PA 4BOHA 2WUBA 2FODA 3SGBE 4Y7BA 1IQGA 1O3DA 1ABIH 3GY7A 1Z8RA 1ZPCA 3ENSB 3TK6A 4JCNA 1ESAA 1O3IA 1C5VA 2OC8A 5LPEA 4CRDA 3ZV9A 3T29A 4Y79A 2NU0E 1XXDA 1AMHA 2GCTC 3ZVDA 1GHBF 1TNLA 3UR9A 3PLKA 1UHBB 5AVDA 1C5WB 5LGOA 1TPPA 3M7UA 4E05H 2PUXB 4LZ1H 3DA9B 4ISHH 4IC6A 3RP2A 3KGPA 3SBKA 1TWXB 1FN6A 3Q3XA 1HXEH 4I7YH 2QV1A 5JBBS 4CHAB 1ELBA 4AYVB 3ZVFA 5HXFA 3P17H 1QB9A 1YC0A 3GCHC 1HAXB 1SLWB 1JIMA 8GCHF 2BVRH 5FBIA 1NROH 2ZPRA 4BAKB 1BOQA 4I8LA 1G3DA 2OQ5A 4U32A 3A7XA 2UUYA 1EOLA 3LGYA 1C9PA 3SV9A 2VIWA 4D7GA 1EP5A 3UWJH 1T32A 1Y5AT 3NCLA 3O8DA 3E6PH 3RXUA 1O3HA 1GPZA 1EXFA 4I8JA 3RXCA 5DG6A 2BY5X 5L2YH 1AZZA 2Y5GA 2BZAA 3M5NA 1FUJA 1EAXA 4TWYA 1P11E 3GCNA 5IYTA 3TK9A 4I8GA 4Q2KA 1XVMA 1O34A 2ODYB 1RRKA 1OOKB 5JYIA 4J1YA 2VU8E 1HJAB 1W13U 4H6TA 4FXGH 4ABAA 1CT2E 3E1XB 3KN2A 4GLYA 1YYY1 1XM1A 3MH4A 1O2OA 1S6FA 1ZZZA 1AIXH 1O5AB 3SGQE 4MNYA 4Z0KA 3RC6A 1TB6H 1VITG 2BDBA 1Z8IB 2H6MA 1BTHH 2FZZA 3F9EA 1SHHB 1YPJH 4NFFA 2XBXA 1C5QA 2GT7A 3ZVAA 1PYTD 5DP4A 1GJ6A 1IQLA 2ZFPH 4D7FA 3QZQA 2FO9A 4YOJA 1FIWA 3VPKA 4HGCA 3I77A 5T3HA 1UCYH 2ZGXH 1VITH 3RXIA 1BMLA 4FUIA 1V2OT 1ANDA 2D26C 2CGAA 2CV3A 1FY8E 4OGXA 4YT7H 3UPEA 1GJ7B 4MDSA 1YPHC 4GVUA 1A5IA 1AVWA 1F0TA 1UVPA 2B5TB 3BN9A 2SGDE 4M7GA 1PQ7A 3RXSA 4BXWA 2XWBI 1W7XH 2CMYA 5DKMA 3K9XB 3PMHB 1OP8A 1QA0A 4Q7XA 1GMDG 4WY3A 1P57B 2ZGJA 1O2MA 4UFEH 1UTMA 3GCOA 1TRNA 3O8BA 3GY6A 1PPZA 2Z9KA 4ABHA 3NPSA 1O2QA 3WY8A 1OWDA 4CR5A 4NG9H 4UFFH 2AGGX 1O2JA 2BD3A 1EKBB 2QXIA 3QN7A 4JZDH 2Q1JA 3RXQA 2Z9IA 1E0FD 2BY8X 2A0QB 1V3XA 1Z1IA 3LPRA 2C8YB 2A5KA 1GI2A 4OS5A 1AUJA 2QCYA 1P2NA 2QGRA 2XNIA 2I6QA 1BTXA 1D9IA 3SU5A 3MFJA 4TYDA 3S7KB 4ASHA 1NRRH 2GT8A 4XOJA 5DPAA 2W3KA 4KTSA 1U6QA 1EJMA 2ZF0H 1IHTH 5GIBA 1AE8H 2BDIA 4X1QU 1YPGH 1NC6A 1H9HE 1MZAA 1P06A 1SHYA 2QN5T 2ZCLP 2YNBA 3GYMA 2Z7FE 1A46H 3KQCA 3W95A 3EA9A 2A45B 3SU4A 1GHAG 5DP6A 5DO4H 2VVUA 4U30A 4UFDH 1YKTA 2QF0A 1UHBA 3V12A 1E34B 1P10A 1GBLA 1RXPA 4FUDA 4ZROA 1H8DH 3N7OA 2VNTA 1G2MA 1BRCE 2ZDKA 2OCVB 3ATMA 2PTCE 2XYAA 1G30B 4Y11E 1TA2A 3TLOA 1TIOA 2YOLA 3FP6E 4Q7YA 4ESTE 4Y76A 3OU0A 1HPGA 1YPKH 3ZZ4A 1OWHA 3GDSA 4A92A 2JETC 1P2JA 4JK6A 3FAOA 3TH3H 2P93A 2XBVA 4D8NA 4NA9H 4U01A 1ZPZA 1UTJA 2GZ7A 4FVDA 2XC0A 2P3FH 3SQHE 4FUEA 4J2YB 1GGDC 3ZZ7A 1J16A 4HI3A 7GCHG 4WWYA 1GI6A 3UWIA 1BBRK 3PV4A 1CBWB 2ZCKP 1C5MD 3BG4C 5EXMA 5FPSA 3T25A 5K7RA 2FM2A 1P0SH 1O2NA 2AMDA 1C5LH 1TOMH 1KY9A 4NIVA 1QURH 2BHGA 2FX4A 3ELAH 4NA8A 2C90B 4BAMB 2BB4A 3VXEH 2TIOA 1PQ5A 3ZVCA 1OPHB 1K1MA 1GCTC 1QFKH 2G5VA 1HAIH 4AGKA 3E91A 5A8ZA 3ZZDA 4YLQH 4I8HA 4WMFA 1EJAA 2BDYA 2H5DA 4RKJB 1TNJA 3GISB 2FTMA 3E0PB 1AFQC 1BQYA 1AB9B 2AS9A 1ELCA 3W94A 4GAWA 4NFEA 1V2LT 4VGCC 1BTUA 1P01A 1Z1JA 1JWTA 2FP7B 4DJZB 4F49A 2EI7A 6GCHG 1K22H 2OINA 4ZXYH 1XX9A 1ETTH 1KSNA 4THNH 2ZDLA 5FPYA 3LONA 3PMAB 4ABGA 5H4IB 3EGKH 1KXCA 2Y80A 1LHDH 2ZU2A 4MQAA 4AG1A 5LPRA 1DY9A 1P2MA 1A5HA 1UTNA 2D8WA 1S0RA 3U1IB 4AG2A 1L1GA 1QA7A 1D4PB 4B2BA 3B9FH 4FUCA 2GKVE 2ZA5A 3FZDA 1QRWA 4R8TB 1VCWA 1S5SA 4R0IA 2A7HA 2A4GA 1EZUC 1MCVA 1WQVH 1O0DH 4NGAH 3ZZ8A 1D3DB 4MPWA 3QGNB 1FJSA 4WH8A 1SLVB 5LPFA 1S84A 1WTHD 2HPPH 1A5GH 3FP7E 1J14A 5C1YA 5PTPA 1RTLA 2ZZUH 4ISIH 1DVAH 1ZMJA 1G3BA 1O2ZA 4D76A 3KEEA 1TLDA 2A31A 1C2FA 3T27A 1WQSA 3NWUA 3VEQB 1KLJH 3P6ZB 3SHAH 2BY9X 1GL0E 3M3TA 1DUAA 3SO3A 1CU1A 1DPOA 1HUTH 3M3SA 2GZ9A 3MU8A 1MMJN 2BYAX 3A7ZA 3UTUH 2ZQ2A 1BMAA 2BD2A 1C4V2 1BDAA 2PSYA 4ISLA 1H1BA 2J34A 3M61U 1O2KA 3EAJA 1SC8U 2HWLB 4D9RA 3A7YA 1AE5A 2A5AA 3PMBB 4F4OC 1SFQB 2OP9A 5CMXH 4SGBE 4AOQA 3QGJA 1K28D 4Y7AA 3SV7A 3LOXA 5AFYH 3M7QA 1V2UT 1C1PA 1S85A 1MKWK 1EB1H 1V2RT 3B8JA 1THPB 1K1LA 2IN2A 1AUTC 2WPMS 3LJJA 1JIRA 1H8IH 2FIRH 1DLKB 1TYNA 3V13A 1HFDA 1MZDA 1O5EH 4WH6A 2VIPA 1HAYB 1A0JA 1LHCH 2QYIA 7KMEH 3HK3B 4TWWA 4GPGA 3GY3A 2BLWA 1UVSH 5F6MA 2BQWB 1N1LA 3JZ2B 1H4WA 1GBKA 1IQEA 4ZKRU 5JBCS 1GCDA 2F3CE 1EATA 4KTUA 3O8CA 1FPHH 5F03A 1NRSH 1TE0A 2ZGBH 3SN8A 3RUOA 1O2WA 1GDUA 3U8RH 1BIOA 3S9BA 4DIIH 2WUCA 1TNIA 4XBCA 3RMOH 5DK1A 5EPYA 3TJVA 5DGJA 2ODPA 1NO9H 2WINI 4NZLA 4XSKU 3U98H 2R0LA 4K1SA 5BRRE 2G8TA 1CO7E 4INKA 5A09A 4Q80A 1CA0B 2ZIQH 1O3LA 1CHOG 3CS0A 2VJ1A 1RD3B 4K1TA 1T8MA 3H5CB 2O8TA 1WAYB 1RIWC 5TCAA 1GDQA 2J9NA 2ASUB 4WXVA 4YO9A 1A0LA 1A7SA 3AW0A 3CS7A 1KLIH 1TRYA 2PR3A 2WPHS 3QTVH 1EUFA 1HJAC 4IMQA 4BTIB 1UTQA 2ZQ1A 1J17T 4X2XA 1T4UH 1UTLM 2HLCA 1C2DA 1C2EA 4SGAE 1DS2E 1QL8A 3A86A 4E7RG 2ZTXA 3SUFA 1BBRE 1GMDF 1GBDA 2FEQH 3GCTF 3GYLB 2Q6FA 2C93B 2HNTF 3PYHA 1IAUA 3LH3A 5EQRA 4ZHLU 1TBRH 1O2PA 2CHAC 1MBMA 2G81E 2CF8H 1DANH 1Y59T 1XMNB 1GVLA 4XFQA 4YM9A 1S6HA 1TGSZ 2PTNA 3ZYEA 3MNXA 3TJOA 1UK4A 2VB0A 3RXVA 1HNEE 2PKSB 4NCYA 4ZKSU 1TQ0B 3UFAA 2FI3E 8ESTE 2H2ZA 1QL9A 4X6NA 2BOKA 1FN8A 1GBCA 3MOCA 1NFYA 1ELFA 1GBBA 4HTCH 1B5GH 1FZZA 3PLBA 1ZOMA 1KXDA 2FTLE 2J2UA 1L2EA 5GDSH 4Y0YE 1GJDB 1XVOA 1N6XA 1B0EA 1LTOA 1DX5M 4ABBA 1SGIB 1VCPA 2FXRA 3TGKE 2ZCHP 4K69A 3JZ1B 1GI1A 1BT7A 4NSYA 5L30H 5JBAS 1FV9A 1C2LA 1DY8A 1EOJA 2ZFQH 2R2WU 1FMGA 1L4DA 1GHAF 2C8WB 2J92A 1SQAA 3EYDA 1SGPE 1MTNB 1DM4B 2J4IA 3DFJA 2GDEH 2O8UA 4Y8YA 1F5RA 2ANWA 3U8TH 3URDA 4XBBA 1BJVA 1N8OB 1THSH 4DVAU 4FUBA 1BTZA 3F1SB 2ZFRH 1FNIA 3D23A 3SV2H 1TGTA 3TJNA 1TOCB 1DSTA 3PWBA 1V2MT 3A8DA 1SGFG 1W2KH 4MLFB 4I32A 2BVXH 3SNBA 1W11U 2VH6A 3KIDU 4BTTB 1SGTA 2P16A 1FY5A 1RTFB 5E0GA 4JZ1A 2EEKA 3PO1B 1HAVB 1X7AC 4Y0ZE 4KELA 2JKHA 1QCPA 2O8MA 1SSXA 7GCHF 1ZLRA 3PB1E 2WYJA 2TRMA 1O39A 1LVOA 2I6SA 1PPHE 1NPMA 1Q3XA 3SQEE 1YCPK 1SOTA 3TIUA 4FU9A 1HAZB 2ZDNA 2G4UA 2TPIZ 2FI5E 3HKIB 2A4RA 4UDWH 1NFXA 3MU1A 1C1MA 2GCHG 3CP7A 1SGYE 3BTDE 2RA0A 1TA6A 5GCHF 3H7OA 3K6ZA 1Y8TA 2HNTE 2FOMB 2ODQA 3S69A 3T26A 4OGYA 3ODDA 2W3IA 1AHTH 4A1VA 2ZO3H 4WF8A 2QC2A 1K1NA 2VGCB 3SI3H 3M35A 2ZG0H 1C1WH 1P2KA 1OWJA 1TRMA 4U2WA 1MTVA 4K8BA 4DOQA 1Q2WA 2BZ6H 2B0FA 2OLGA 3BTHE 3F9FA 2BDGA 3LIWA 3RXAA 1CBWC 6GCHF 1DUEA 5FCRA 3SUGA 2P8OB 1VCQA 1KTSB 2QY0B 2THFB 3LDXH 1A3EH 1C5ZB 2P95A 5GWZA 2AIPA 3SV6A 2AFQB 2V3HH 4GSOA 2ZDAH 3A7TA 3Q3KA 4YOIA 1F92A 5G4BA 4YT6H 1C5YB 3OYPA 2GZ8A 1CVWH 3QDZB 3M36A 2R3YA 4XDEA 1C1UH 9LPRA 3HPTB 3SUEA 3TH4H 2GVFA 1C2KA 3DHKH 3A8CA 1LQDB 1SR5C 3TJUA 2GP9B 1HAPH 2B8OH 1NFUA 4TY7A 4YTAA 1NU9A 1SL3A 3GY5A 1LO6A 1QTFA 1JRSA 1L1NA 1XUIA 4INHA 1W8BH 1O36A 3LC5A 2STBE 1O3BA 2H9TH 2TGDA 2F83A 3QK1A 3A82A 5EPNA 1V2WT 2Y5FA 1HIAB 2LNCA 3AVZA 3AW1A 2XCNA 1W7GH 2OTVA 1DLEA 5DP3A 2A32A 3A7VA 3PTBA 2ZGCA 5L6NH 1ZSLA 1P02A 3BTFE 1YBWA 4QT8C 4AFQA 3MO9A 1HGTH 1O37A 2BD9A 2BLOA 3GY2A 4TY6A 1C2IA 1T8OA 1O3PB 1PYTC 3RXDA 3RXOA 1QB1A 1Z8GA 1JMOH 2G52A 1BHXF 1RTKA 4X1RU 4IC5A 1D3QB 1BA8B 3E3TA 3E8LA 1TMBH 2W7UA 2BDAA 3M3VA 2ALPA 2FOEA 4IMZA 2VIVA 1QJ1B 5DP5A 2OBOA 1ZTJA 4CRBA 5SGAE 1JXPA 1O2TA 2RCEA 3K65B 4NIWA 3P92A 5EODA 1TPAE 5A0BA 1TMUH 1HAVA 3ZZ6A 4O3UA 2GCTB 3U9AH 3GY4A 1FPCH 3AAUA 1KDQB 1C1RA 1HRTH 4B73A 5A8XA 2FOBA 2W7SA 1GHVH 4E7NA 5ESTE 3A84A 1A0HB 5JB8S 1C1VH 3RXLA 2BM2A 1CE5A 1VGCC 1TX8A 1MKXK 5C1XA 3UNSA 1A1RA 1EPTC 1C2HA 2HVXA 1DITH 3P70B 1YGCH 1C2GA 3RC5A 1C1TA 2WYGA 4X6OA 5CHAB 3U8OH 3RC4A 3GCHB 2FI4E 4DG4A 3VGCB 1OYTH 1P2QA 1PPEE 1FY4A 3K6YA 2BX4A 2WV5A 1ABJH 3PROA 2ZTYA 6LPRA 1A61H 1WSSH 2FMJA 1FDPA 1O3GA 1BMNH 2F9VA 2ZKSA 2PKAB 3TH2H 3VB7A 2FOGA 1TPSA 3SZNA 1MUEB 4AGJA 3FZZA 1AKSB 1C4Y2 1ANEA 4B75A 4DY7B 1CHOF 2BD7A 4CRFA 3BIVH 3IWMA 1UJ1A 1YM0A 2ZNKH 3ITIA 4IS5A 1MH0A 3V0XA 1S82A 3UQVA 3M7TA 4X2YA 1AU8A 1NS3A 4JYVH 4H42U 4X8TH 1ETSH 1XUJA 1ELTA 2XXLA 1OX1A 2BD5A 1XUGA 1CGIE 2CN0H 1O2VA 5T6FA 1V2NT 2K1QA 1AO5A 4K3JA 1C5PA 3SJKA 1SGNE 1UTPA 1AY6H 1MU6B 1QJ7B 3UIRA 1C5UA 5EG4A 3S7HB 1SGRE 1GBFA 2BDCA 1D6WA 1QBOA 1KXEA 1O3FA 2GGVB 2RDLA 1SLXB 3F9GA 1ARBA 3LJOA 5HGGA 1O35A 2OBQA 5DJ7A 1D3PB 1O2RA 2B9LA 1GJBB 2H9HA 1RFNA 4LZ4B 3SU6A 4O9VA 4NZQA 2Y6TA 3LU9B 1HXFH 1P3EA 2D1JA 1TNKA 1NTPA 2GDDA 1EB2A 1PPFE 4CRAA 2IOTA 1EQ9A 1IHSH 2QA9E 1GBIA 1P03A 3ZVGA 5FBEA 5EXNA 5HMAA 3L3TA 2NU4E 1A2CH 5DP7A 4GHQA 2VWOA 1HIAA 1P09A 2BY7X 1GG6B 1SPJA 3A8AA 4IN2A 1QY6A 2ZFFH 2FYQA 2F9BH 1LMWB 3OTJE 1GBJA 1J9CH 3I78A 4RSPA 4YZUA 4I33A 1O2UA 1BZXE 1DE7H 5K0HA 3MTYA 2A7JA 4OS1A 1T31A 2VWNA 1KXFA 4FU7A 1NRQH 4MNWA 1BHXB 3KQEA 3GY8A 6CHAC 2OC1A 5A2MH 1FAKH 3EA8A 1WBGB 4K2YA 3HATH 3SU0A 1PQ8A 2PKSC 4ABIA 1Y3UA 1CGHA 5FXLA 5J4SA 1K2I1 3RXHA 1GJ9B 1O2LA 2GV7A 1KXAA 2ZGHA 1EAWA 1GBEA 1TALA 4MNVA 3LGIA 4OS2A 3AASA 2VIQA 4NSVA 1ZMLA 3A83A 2ZECA 1O3EA 2AMPA 3UR6A 2Z94A 4CH8B 4KKDA 2HALA 2QIQA 1IQFA 1SGDE 2CF9H 1IQNA 1WYKA 4UE7H 4MG3A 1C5XB 3MU0A 1O33A 5EXLA 5L2ZH 2OUAA 3RU4E 1UVUH 1KDQA 3DT0H 2W26A 1SMFE 4I31A 3BTKE 2EI8A 2ZHQH 4ZKOU 2ILNA 5E8EH 5LH8A 3LKWA 4JYTA 4YESB 8KME2 1ESBA 5EQSA 1CQQA 5C2ZA 1NM6A 1WTGH 1D6RA 2SNVA 1LPZB 1MTNC 1V2PT 1W12U 3UOUA 1MTUA 4NIXA 1TX7A 3ZZCA 1N8OC 1O3AA 1QRXA 2SFAA 2UUJB 1JRTA 1YCPH 3BEUA 1S81A 4DW2U 1O2XA 2Z3DA 2VWLA 2Y7XA 2LPRA 1SGCA 2PKAA 4RKOB 1P12E 3QLPH 1SI5H 1IQKA 1ZTLA 5AHGH 4TPIZ 1ANCA 3S9AA 2F9NA 1NY22 1NRPH 2R9PA 3MNBA 1AKSA 2FDAA 3BSQA 1RJXB 4H6SB 4JZFH 1TABE 4H4FA 3SU1A 4MVNA 1ANBA 3OX7U 2V35A 1GI3A 1MQ5A 1SLUB 4CHAC 1GJ5H 1O3NA 1TBZH 3HGNA 3RMNH 1VITF 2H1UA 1WV7H 1ESTA 1B7XB 2KAIB 2P3UB 4XE4A 4AORA 1ELDE 1XKBC 1S0QA 3SGAE 2FYRA 3LH1A 1C5OH 3RXTA 1C9TA 3HK6B 4CRCA 1GMHG 2A7CA 1C5RA 1MU8B 2G51A 1SQTA 4YLUA 1OWKA 3ATLA 3BG8A 5F8ZA 1AD8H 2ZFSA 1AFQB 3D49H 4ZXXH 3Q3YA 3OSYA 1H9IE 1TPOA 3P8NA 2AGEX 1HB0B 3RXRA 3PMJA 3FANA 1Z7KA 4GCHG 2Z3EA 3ZZ5A 3BEIB 3H7TA 2VH0A 5ETXA 1O2GH 4JZEH 2J94A 2Y5HA 3BTEE 1HAHH 3KQDA 2BXTH 2J95A 3TGJE 1SFIA 2FOHA 1ORFA 4JK5A 2IPHA 2XTTB 2A2XH 1ELAA 2ZI2H 1NESE 2ZHEH 1GDNA 4OS4A 1TFXA 1ELGA 3R3GB 3RXBA 3A81A 3RXJA 1HAOH 1BRBE 1O3MA 1YLDA 3MMGA 1UTOA 2SGEE 2TBSA 3LC3A 2FESH 3G01A 1AN1E 2HNTC 3PM3A 3P8OA 3QWCH 1Y3VA 2BOHB 2PGBB 3TU7H 4O03A 1SGEE 2ALVA 3VB3A 4NWKA 1YF4A 1C5SA 3SUDA 3T28A 2P59A 3F9HA 5I25A 2NWNA 4FUHA 2F9PA 2VIDA 1LPKB 1C2MA 1GI4A 1CT0E 4I8KA 2H9EH 4IN1A 2XBWA 1L0ZA 1QQUA 2BTCE 3LGTA 1TQ7B 1LHGH 4AZ2B 4AYYB 1BUIA 1GHYH 3STIA 3M37A 1A4WH 1DWCH 1WCZA 2AEIH 5TJXA 3MWIU 4ZKNU 1M9UA 3FFGA 1Z71A 2WV4A 2HOBA 1UK3A 1S83A 2Z9GA 1OWIA 1SVPA 1O30A 1T4VH 3RXFA 4FVBA 1Y5BT 3BV9B 4Q7ZA 1FONA 2AGIX 3S9CA 5E0JA 3BTWE 2ZHWH 3L33A 1UCYE 5TCCA 4A6LA 1FI8A
chains in the Genus database with same CATH superfamily
1W10U 3CENA 2P3TB 3QO6A 3VFEA 5C1UA 4Y6DA 3Q77A 2EA3A 3KNXA 3ZYDA 3V7TA 1JOUB 1O2YA 1MKXH 5EGMA 2AYWA 1O5GH 2BQ7B 2ZDVH 3UNRA 2UWPA 1MCTA 1YWUA 5HM9A 3I29A 3N99A 1JBUH 1MD7A 5T6DA 1HJ8A 1UO6A 3UUZA 4B2CA 3OTPA 1AWFH 1QRZA 4HFPB 1IQIA 3RM2H 1LVYA 1GMCG 1ARCA 3GOVB 4AN7A 2ZU4A 2GMTB 4OM9A 1LDTT 5A0AE 1F0RA 3GDVA 5E2OA 1FY1A 3KF2A 1V2TT 4TSFD 1OXGA 1BBRH 2KCPA 1FY3A 3MI4A 3ODFA 4MTBA 5HIYA 1YP9A 1QQ4A 1TBQH 1TONA 1GBAA 2KAIA 3GICB 3SU2A 1DWDH 5C5NA 3M5OA 5CHAC 2VINA 4Z1MD 2WPLS 5DP9A 1KXBA 3VGCC 2SGFE 5F8XA 1ZHRA 3MH5A 3C27B 1VJ9U 2ULLA 5EW1H 1O5CB 2A4OA 3U1JB 1RGQA 5C5OA 1TGBA 1TMTH 8LPRA 3TGIE 4AFUA 1ETRH 1BTPA 1PQAA 1GBHA 2ZEBA 1TGCA 2XCFA 3EQ0H 1F5LA 1TAWA 1EJNA 1RIWB 2OC0A 2OC7A 1D3TB 4NIYA 2J5UA 1OS8A 1AVGH 1P8VC 3MNCA 4ZMAH 3R0FA 4O97A 2K8IA 5E0HA 3KL6A 4CREA 1UMAH 1GWAA 2PGQB 2JH5D 2FLBH 3ZZ9A 2PUQH 1NFWA 1XUFA 4IBLH 4DGJA 4IW4E 2RG3A 1GHZA 1Y5UT 4ZHAA 1C1OA 1AGJA 3MO3A 1ZMNA 1O2IA 1GHXH 1SKYE 2DE8A 3EE7A 3TPIZ 4P02A 3GDUA 5FHTA 2BXUH 3FP8E 1C4U2 1BRAA 3MNSA 4ABEA 3STJA 1HV7A 2FOAA 1MTSA 1P3CA 1KTTB 4ZUHA 1EX3A 3ESTA 2CHAB 4D9QA 4HZHA 1AB9C 4Y8ZA 5C20A 4E06H 2DUCA 2FOCA 4X1NU 3E0NB 2ANKH 3VB6A 1QB6A 1P9SA 1ZRKA 2PSXA 2XC5A 2AIQA 2XBYA 1GBMA 1DDJA 2EC9H 2GX4A 1E35B 1GJ4H 4MPVA 3RDZA 1SGFA 5F8TA 4OS6A 2O8WA 2JH6D 2BDHA 2QXGA 1F5KU 3EDXB 3UREA 4KGAA 3ATIA 2ZP0H 3GCTG 1GL1A 1P04A 2W5EA 1GG6C 3SU3A 3DUXH 4FU8A 2QF4A 2J38A 4X0WU 2VVVA 1C5NH 3LGUA 4ACAA 1UVOA 3BTQE 3MHWU 1QGFA 3KHVA 1Z6EA 1CHGA 4X8UH 1V6DA 3PLPA 2ANYA 1MBQA 4UONA 3C1KA 3K2UA 4AB9A 4X6PA 2F9UA 2FS8A 1AVXA 1MD8A 3Q76A 5I46H 1PPBH 5KEDA 1O3OA 2ZPQA 4K60A 4DT7B 4BTUB 5FCKA 1SQOA 4KTCA 1NT1A 1OYQA 1V2VT 1IOEA 2Z9LA 3A80A 1QIXB 3EE0B 1ZPBA 3RU4D 4UFGH 2SGQE 3ATKA 1TNGA 3F0PA 2AHME 2OD3B 1MKWH 3SV8A 5AF9H 4M9FA 5ESBA 3FN8A 5B6OA 1O5BB 1T7CA 2KX4A 2ZU1A 3A89A 1LQEA 2V3OH 2ZFTA 1QL7A 2QF3A 1V2JT 1F2SE 4AB8A 4MNXA 3UAIC 1RS0A 5DP8A 4UEHH 2C4FH 1O3CA 4CRGA 1CA8B 3RXEA 1TNHA 1E1QD 5ABWA 1QHRB 1FAXA 1EAUA 4IGDA 1DXWA 2G00A 7ESTE 2BMGB 1C5TA 1EZQA 3H09A 3RU4T 1UVTH 1E38B 1SBWA 2J98B 1ELEE 5FX5A 5HM2A 2UUKB 5KGOA 3RLYH 3BF6H 1QBVH 3SW2B 1K1OA 2A1DB 2PWXA 1KIGH 2EI6A 3P8GA 1NU7B 1MAYA 2IJOB 2Y81A 1G32B 4X1SU 1ZJKA 1QNJA 2A5IA 1GMHF 1GHBG 2TGTA 2HGTH 3SOSA 3W1EA 4JZIA 1A3BH 1K9OE 1YPLH 1PFXC 1YPHE 2SGPE 1MABB 2ZDMA 1W14U 2FX6A 1NBME 1BB0B 4X6MA 1DSUA 5C94A 1ZHMA 3P8FA 4A5TS 4DT4A 1LHFH 1ELVA 1C2JA 1G9IE 4K1EA 5FAHA 4UD9H 5JDUB 1G37A 4GCHF 3DSPA 3IG6B 4TPYA 1J8AA 2UUFB 4BNRA 2O9QA 1K21H 4ZH8A 8GCHG 1HJ9A 1GI0A 2KM0A 4ABJA 3BEFB 1FLEE 1G3EA 3FVFB 2PW8H 5EQQA 1MTWA 2BD4A 1GI8B 3B23B 3MU4A 5GCHG 4ISNA 3LT3A 4X2VA 1ZR0A 3LGVA 2P94A 1EAIA 6ESTA 3RXMA 4ZAEA 2XWAA 4RI0A 2WPKS 5IDKA 4Y71A 1OP0A 1CA0C 2ZTZA 1P05A 2AMQA 3ZVEA 5HYOA 5JB9S 3F6UH 3OY5U 5DN6D 4A1TA 1Q31A 5FX6A 2C3SA 3SJ8A 3TVJB 1HYLA 1SGQE 4BAOB 3QX5H 2V0BA 3MO6A 3NUMA 1COWD 3M5MA 5GJ4B 3BTGE 1V2KT 1IQJA 2FPZA 3UOPA 3OY6U 3TK5A 1P9UA 4KP0A 3VB4A 3ZV8A 1FXYA 4B1TA 1F7ZA 1Y3WA 1LKBA 9ESTA 1SG8B 1UCYK 1T8NA 4ZHMU 3NKKA 3SNAA 1Z8JB 1C1QA 2FS9A 2D2DA 4WJG2 3RXPA 1DXPA 1MQ6A 1ZSJA 1PJPA 3IITA 3RXGA 4CBNA 1W0ZU 2IPQX 3V3MA 1NRNH 1ZHPA 1ZYOA 1CGJE 1OP2A 2UWOA 3QTOH 3SNCA 2YNAA 2O8LA 3ATWA 4INLA 4NA7A 1K1IA 4CR9A 1YCPM 3RXKA 2G4TA 1ACBE 1DWEH 2B7DH 5J4QA 1ZTKA 2V7QD 1QBNA 1NN6A 2ZU5A 4BAHB 3F3BA 3RMLH 2QXJA 2QXHA 3SHCH 1N6YA 3BTTE 1Y3YA 4JYUH 3SI4H 2HPQH 3S0NA 4ASUD 3ZVBA 1NZQH 3MYWA 3A8BA 4Y8XA 3TNTA 3KQBA 1VR1H 1FQ3A 1MAXA 2C8XB 3BTME 3TITA 5JBTA 4O3TA 3SNDA 5GPIB 4MPUA 1O2SA 2UWLA 2ANMH 1E36B 4K5ZA 1ZRBA 2FWWA 4BANB 3SJOA 1GHWH 5EJLA 4B2AA 3D62A 2Z9JA 4BAQB 1V2ST 1O32A 1LKAA 1OSSA 2VIOA 2JIZD 2PHBA 4FUGA 2C8ZB 2FOFA 3QUMP 1G2LA 2NU3E 1WDIA 5CE1A 4DIHH 1GMCF 2SNWA 4NWLA 1VGCB 1GVKB 4YXWD 1AWHB 2QAAA 1OWEA 1AQ7A 4YOGA 1BTYA 5GXPA 1E37B 1AI8H 2BVSH 1EPTB 1W0YH 7LPRA 1XUKA 4K8YA 2M5TA 1GI7B 1YPEH 2F9OA 2NU1E 2A2QH 2WPIS 1IQMA 4LXBH 5EOKA 2J98A 3BIUH 1C1SA 2STAE 4Q63A 2JETB 3URCA 2GCHF 3OEHD 5T6GA 3UNQA 1HCGA 1GI9B 3A88A 4DCDA 2DE9A 5FPTA 5BPEA 2R3UA 4GUXA 1BJUA 1YLCA 2V6NA 1WUNH 1GGDB 2WHXA 1KLTA 2ZU3A 1C1NA 1LVMA 2GV6A 1WOFA 1EASA 1CT4E 3MH6A 4RN6A 3SORA 2BD8A 4B74A 3P95A 3PO1C 1EZSC 4WMDA 4ABDA 3BG4B 5AFZH 4FETA 1WU1A 1Y3XA 2ESTE 2OXSA 2ZC9H 4GHTA 3VXFH 3TNSA 4CBOA 1PPGE 2G5NA 1Z6JH 1HAGE 1P2IA 2CJIA 4MPXA 2FLRH 2TGPZ 2GMTC 3A87A 4BXSA 1TX6A 2PFEA 1BRUP 5HIZA 2ZWLH 2ZHDA 2SGAA 2AERH 3SNEA 2PV9B 1GCTB 3NZIA 3HKJB 1HDTH 4DURA 1LPGB 3MH7A 3UY9A 1INCA 1W0JD 3GS9A 4PROA 2NU2E 2HRVA 4JMYA 4X8VH 3RM0H 1O31A 4AX9H 3OEED 2XC4A 1O5FH 2ZPSA 4VGCB 5JPMH 1DICA 5C3NA 2Y82A 4AFSA 1BCUH 2VGCC 4Y10E 1T8LA 1AFEH 1KYNA 2GD4B 3QZRA 5EU8A 3AAVA 2TGAA 1TGNA 4Z6AH 2Q6DA 2WV9A 2Z3CA 1DT2A 4OS7A 4A7IB 3T2NA 1LCYA 2GJGA 2KCYA 3D65E 1XXFA 1VJAU 4FUFA 3U69H 2P8OC 2BX3A 4WXIA 4LK4A 1O5DH 3E16B 1OKXA 5A8YA 1GBTA 2BY6X 1GI5A 3VB5A 4CH2B 4B76A 1LHEH 1VZQH 3RLWH 1SB1H 4FUJA 4X1PU 4B71A 2JH0D 3ZZBA 4ABFA 1ZGIA 3HGPA 5A0CA 2VWMA 2YMSC 3SJ9A 1BTWA 1THRH 1GJCB 1F0UA 1DFPA 2XW9A 1H9LB 1B0FA 1O3KA 2AH4X 3ZZAA 1UK2A 1EZXC 3NXPA 2XRCA 2G55A 3T62A 1XUHA 1QR3E 3RMMH 1F0SA 1AZ8A 3Q00A 3UQOA 1G36A 1FIZA 1O38A 4LOYH 3ZZ3A 1IQHA 1YPMH 3M5LA 6CHAB 1QJ6B 2H5CA 1O3JA 3LGWA 4X2WA 1V2QT 2VVCA 1UTKA 3T5FH 5C67A 3FOAA 1L4ZA 1GJ8B 1LVBA 2Q6GA 3DD2H 3F68H 2BLQA 1GVZA 1BMMH 2BQ6B 4X8SH 2OQUA 1O2HA 3MU5A 1K1JA 3NK8A 2R0KA 3DFLA 3EA7A 1DOJA 3E90B 3SJIA 2F91A 1PPCE 1SOZA 2R2MB 4A1XA 2GTBA 1W3CA 3PWCA 2PLXA 3A7WA 1K1PA 3O8RA 1J15A 2ZHFH 3A85A 1GJAB 1HLTH 2CXVA 1ZSKA 1BITA 1ZGVA 2Z6BD 1CSOE 1G3CA 1EPTA 2WPJS 2Y7ZA 1ZJDA 5E2PA 4WMEA 4WVPE 4XBDA 2RA3A 1XKAC 1ID5H 2BLVA 1P2OA 1L1JA 1DWBH 1HBTH 4ISOA 3PTNA 4AFZA 5EW2H 1EP6A 3KCGH 2A4QA 3L6PA 4BOHA 2WUBA 2FODA 1KMHB 3SGBE 4Y7BA 1IQGA 1O3DA 3F2FA 1ABIH 3GY7A 1Z8RA 1ZPCA 3ENSB 3TK6A 4JCNA 1ESAA 1O3IA 1C5VA 2OC8A 5LPEA 4CRDA 3ZV9A 3T29A 4Y79A 2NU0E 1XXDA 1AMHA 2GCTC 3ZVDA 1GHBF 1TNLA 3UR9A 3PLKA 1UHBB 5AVDA 1C5WB 5LGOA 1TPPA 3M7UA 4E05H 2PUXB 4LZ1H 3DA9B 4ISHH 4IC6A 3RP2A 3KGPA 3SBKA 1TWXB 1FN6A 3Q3XA 1HXEH 4I7YH 2QV1A 5JBBS 4CHAB 1ELBA 4AYVB 3ZVFA 5HXFA 3P17H 1QB9A 1YC0A 3GCHC 1HAXB 1SLWB 1JIMA 8GCHF 2BVRH 5FBIA 1NROH 2ZPRA 4BAKB 1BOQA 4I8LA 1G3DA 2OQ5A 4U32A 3KQ5A 3A7XA 2UUYA 1EOLA 3LGYA 1C9PA 2M2AA 3SV9A 2VIWA 4D7GA 1EP5A 3UWJH 1T32A 1Y5AT 3NCLA 3O8DA 3E6PH 3RXUA 1O3HA 1GPZA 1EXFA 1NBMD 4I8JA 3RXCA 5DG6A 2BY5X 4F55A 5L2YH 1AZZA 2Y5GA 2BZAA 3M5NA 1FUJA 1EAXA 4TWYA 1P11E 3GCNA 5IYTA 3TK9A 4I8GA 4Q2KA 1H8HD 1XVMA 1O34A 2ODYB 1RRKA 1OOKB 5JYIA 4J1YA 2VU8E 1HJAB 3PV5A 1W13U 4H6TA 2L74A 4FXGH 4ABAA 1CT2E 3E1XB 4ZCNA 3KN2A 4GLYA 1YYY1 1XM1A 3MH4A 1O2OA 1S6FA 1ZZZA 1AIXH 1O5AB 3SGQE 4MNYA 4Z0KA 3RC6A 3F2HA 1TB6H 1VITG 2BDBA 1Z8IB 4AC9A 2H6MA 1BTHH 2FZZA 3F9EA 1SHHB 1YPJH 4NFFA 2XBXA 1C5QA 2GT7A 3ZVAA 3KYGA 1PYTD 5DP4A 1GJ6A 5F53A 1IQLA 2ZFPH 4D7FA 3QZQA 2FO9A 4YOJA 1FIWA 3VPKA 3FO8D 4HGCA 3I77A 5T3HA 1UCYH 2ZGXH 1VITH 3RXIA 1BMLA 4FUIA 1V2OT 1ANDA 2D26C 2CGAA 2CV3A 1FY8E 4OGXA 2W6JD 4YT7H 1UW7A 3UPEA 1GJ7B 4MDSA 1YPHC 4GVUA 1A5IA 1AVWA 1F0TA 1UVPA 2B5TB 3BN9A 2SGDE 4M7GA 1PQ7A 3RXSA 4BXWA 2XWBI 1W7XH 2CMYA 5DKMA 2EY4C 3K9XB 3PMHB 1OP8A 1QA0A 4Q7XA 1GMDG 4WY3A 1P57B 2ZGJA 1O2MA 4UFEH 1UTMA 2VBCA 3GCOA 3UB0A 1TRNA 3O8BA 3GY6A 1PPZA 2Z9KA 4ABHA 3NPSA 1O2QA 3WY8A 1OWDA 4CR5A 2EQNA 4NG9H 4UFFH 2AGGX 1O2JA 2BD3A 1EKBB 2QXIA 3QN7A 4JZDH 2Q1JA 2KFWA 3RXQA 2Z9IA 1E0FD 2BY8X 2A0QB 1V3XA 1Z1IA 3LPRA 2C8YB 2A5KA 1GI2A 4OS5A 1AUJA 3FKSD 2QCYA 1P2NA 2QGRA 2XNIA 2I6QA 1BTXA 1D9IA 3SU5A 2IJD1 3MFJA 4TYDA 3S7KB 4ASHA 1NRRH 2GT8A 4XOJA 5DPAA 2W3KA 4KTSA 1U6QA 1EJMA 2ZF0H 1IHTH 5GIBA 1AE8H 5T1VA 2BDIA 4X1QU 1YPGH 1NC6A 2LELA 1H9HE 1MZAA 1P06A 1SHYA 2QN5T 2ZCLP 2YNBA 3GYMA 2Z7FE 1A46H 3KQCA 3W95A 3EA9A 2A45B 3SU4A 1GHAG 5DP6A 5DO4H 2VVUA 4U30A 4UFDH 1YKTA 2QF0A 1UHBA 3V12A 1E34B 1P10A 1GBLA 4B6EA 1RXPA 4FUDA 4ZROA 1H8DH 3N7OA 2VNTA 1G2MA 1BRCE 2ZDKA 2OCVB 3ATMA 2CK3D 2PTCE 2XYAA 1G30B 4Y11E 1TA2A 3TLOA 1TIOA 2YOLA 3FP6E 4Q7YA 4ESTE 4Y76A 3OU0A 1HPGA 1YPKH 3ZZ4A 1OWHA 3GDSA 4A92A 2JETC 1P2JA 4JK6A 3FAOA 3TH3H 2P93A 2XBVA 4D8NA 4NA9H 4U01A 1ZPZA 1UTJA 5EJ1A 2GZ7A 4FVDA 2XC0A 2P3FH 3SQHE 4FUEA 4J2YB 1GGDC 3ZZ7A 1J16A 4HI3A 7GCHG 4WWYA 1GI6A 3UWIA 1BBRK 3PV4A 1CBWB 2ZCKP 1C5MD 3BG4C 5EXMA 5FPSA 3T25A 5K7RA 2FM2A 1P0SH 1O2NA 2AMDA 1C5LH 1TOMH 1KY9A 4NIVA 1QURH 2BHGA 2FX4A 3ELAH 4NA8A 2C90B 4BAMB 2BB4A 3VXEH 2TIOA 1PQ5A 3ZVCA 1OPHB 1K1MA 1GCTC 5C0TA 1QFKH 2G5VA 5HKKD 1HAIH 4AGKA 3E91A 5A8ZA 3ZZDA 4YLQH 4I8HA 1K0HA 4WMFA 1EJAA 2BDYA 2H5DA 4RKJB 1TNJA 3GISB 2FTMA 3E0PB 1AFQC 1BQYA 1AB9B 2AS9A 1ELCA 3W94A 4GAWA 4NFEA 1V2LT 4VGCC 1BTUA 1P01A 1Z1JA 1JWTA 2FP7B 4DJZB 4F49A 2EI7A 6GCHG 1K22H 2OINA 4ZXYH 1XX9A 1ETTH 1KSNA 4THNH 2ZDLA 5FPYA 3LONA 3PMAB 4ABGA 5H4IB 3EGKH 1KXCA 2Y80A 1LHDH 2ZU2A 4MQAA 4AG1A 5LPRA 1DY9A 1P2MA 1A5HA 5KECA 2QF5A 1UTNA 2D8WA 1S0RA 3U1IB 4AG2A 1L1GA 1QA7A 3WWBA 1D4PB 4B2BA 3B9FH 4FUCA 2GKVE 2ZA5A 3FZDA 1QRWA 4R8TB 2WPDD 1VCWA 1S5SA 4Q4LA 4R0IA 2A7HA 2A4GA 1EZUC 1MCVA 1WQVH 1O0DH 4NGAH 3ZZ8A 1D3DB 4MPWA 2HLDD 3QGNB 1FJSA 4WH8A 1SLVB 2RDEA 5LPFA 1S84A 1WTHD 2HPPH 1A5GH 3FP7E 1J14A 5C1YA 5PTPA 1RTLA 3DCLA 2ZZUH 4ISIH 1DVAH 1ZMJA 1G3BA 1O2ZA 4D76A 3KEEA 1TLDA 2A31A 1C2FA 3T27A 1WQSA 3NWUA 3VEQB 1KLJH 3P6ZB 3SHAH 2BY9X 3ZIAD 1GL0E 3M3TA 1DUAA 3SO3A 1CU1A 1DPOA 1HUTH 3M3SA 2GZ9A 3MU8A 1MMJN 2BYAX 3A7ZA 3UTUH 2ZQ2A 1BMAA 2BD2A 1C4V2 1BDAA 2PSYA 4ISLA 1H1BA 2J34A 3M61U 1O2KA 3EAJA 1SC8U 2HWLB 4B6FA 4D9RA 3A7YA 1AE5A 2A5AA 3F0OA 3PMBB 4F4OC 1SFQB 2OP9A 5CMXH 4SGBE 4AOQA 3SYJA 3QGJA 1K28D 4Y7AA 3SV7A 3LOXA 5AFYH 3M7QA 1V2UT 1C1PA 1S85A 1MKWK 1EB1H 1V2RT 3B8JA 1THPB 1K1LA 5EIYA 2IN2A 1AUTC 2WPMS 3LJJA 1JIRA 1H8IH 2FIRH 1DLKB 1TYNA 3V13A 1HFDA 1MZDA 1O5EH 4WH6A 2VIPA 1HAYB 1A0JA 1LHCH 2LP6A 2QYIA 3HK3B 7KMEH 4TWWA 4GPGA 3GY3A 2BLWA 1UVSH 5F6MA 2BQWB 1N1LA 3JZ2B 1H4WA 2PP6A 1GBKA 1IQEA 4ZKRU 5JBCS 1GCDA 2F3CE 1EATA 4KTUA 3O8CA 1FPHH 5F03A 1NRSH 1TE0A 2ZGBH 3SN8A 3RUOA 1O2WA 1GDUA 3U8RH 1BIOA 4XRNA 3S9BA 4DIIH 2WUCA 1TNIA 4XBCA 3RMOH 5DK1A 5EPYA 3TJVA 5DGJA 2ODPA 1NO9H 2WINI 4NZLA 4XSKU 3U98H 3N7EA 4FOUC 2R0LA 3PRDA 4K1SA 5BRRE 2G8TA 1CO7E 4INKA 5A09A 4Q80A 1CA0B 2ZIQH 1O3LA 1CHOG 3CS0A 2VJ1A 1RD3B 4K1TA 1T8MA 3H5CB 2O8TA 1WAYB 1RIWC 5TCAA 1GDQA 2J9NA 2ASUB 4WXVA 4YO9A 1A0LA 1A7SA 3AW0A 3CS7A 1KLIH 1TRYA 2PR3A 2WPHS 3QTVH 1EUFA 1HJAC 4IMQA 2KZ4A 1UTQA 4BTIB 2ZQ1A 3CNRA 1J17T 4X2XA 1T4UH 1UTLM 2HLCA 5DSFA 1C2DA 1C2EA 4SGAE 1DS2E 1QL8A 3A86A 4E7RG 2ZTXA 3SUFA 1BBRE 1GMDF 1GBDA 2FEQH 3GCTF 3GYLB 2Q6FA 2C93B 2HNTF 3PYHA 1IAUA 3LH3A 5EQRA 4ZHLU 1TBRH 1O2PA 2CHAC 1MBMA 2G81E 2CF8H 1DANH 1Y59T 1XMNB 4F48B 1GVLA 4XFQA 4YM9A 1S6HA 1TGSZ 2PTNA 3ZYEA 3MNXA 3TJOA 1UK4A 2JJ1D 2VB0A 3RXVA 1HNEE 2PKSB 4NCYA 4ZKSU 1TQ0B 3UFAA 2FI3E 8ESTE 2H2ZA 1QL9A 4X6NA 2BOKA 1FN8A 1GBCA 3MOCA 1NFYA 1ELFA 1GBBA 4HTCH 1B5GH 1FZZA 3PLBA 1ZOMA 1KXDA 2FTLE 2J2UA 1L2EA 5GDSH 4Y0YE 1GJDB 1XVOA 1N6XA 1B0EA 1LTOA 1DX5M 4ABBA 1SGIB 1VCPA 2FXRA 3TGKE 2ZCHP 4K69A 3JZ1B 1VKYA 1GI1A 1BT7A 4NSYA 5L30H 5JBAS 2WSSD 1FV9A 1C2LA 1DY8A 1EOJA 2ZFQH 2R2WU 1FMGA 1L4DA 4RT1A 1GHAF 2C8WB 2J92A 1SQAA 3EYDA 4XD7D 1SGPE 1MTNB 1DM4B 2J4IA 3DFJA 2GDEH 3NRLA 1EFRD 3VG8A 2O8UA 4Y8YA 1F5RA 2ANWA 4P00A 3U8TH 5C0UA 3URDA 4XBBA 1BJVA 1N8OB 1THSH 4DVAU 4FUBA 1BTZA 3F1SB 2ZFRH 1FNIA 3D23A 3SV2H 1TGTA 3TJNA 1TOCB 1DSTA 3PWBA 1V2MT 3A8DA 1SGFG 1W2KH 4MLFB 1YY3A 4I32A 2BVXH 3SNBA 2F43B 1W11U 2VH6A 3KIDU 4BTTB 1SGTA 2P16A 1FY5A 1RTFB 5E0GA 4JZ1A 2EEKA 3PO1B 1HAVB 1X7AC 4Y0ZE 4KELA 2JKHA 1QCPA 2O8MA 1SSXA 7GCHF 1ZLRA 3PB1E 2WYJA 2TRMA 1O39A 1LVOA 2I6SA 1PPHE 1NPMA 1Q3XA 3SQEE 1YCPK 1SOTA 3PRBA 3TIUA 4FU9A 1HAZB 2ZDNA 2G4UA 2TPIZ 2FI5E 3HKIB 2A4RA 4UDWH 1NFXA 1BMFD 3MU1A 5CHBA 1C1MA 2GCHG 3CP7A 1SGYE 3BTDE 2RA0A 1TA6A 5GCHF 3H7OA 3K6ZA 1Y8TA 2HNTE 2FOMB 2ODQA 3S69A 3T26A 4OGYA 3ODDA 2W3IA 1AHTH 4A1VA 2ZO3H 4WF8A 2QC2A 1K1NA 2VGCB 3SI3H 3M35A 2ZG0H 1C1WH 1P2KA 1OWJA 1TRMA 4U2WA 1MTVA 4K8BA 4DOQA 1Q2WA 2BZ6H 2B0FA 5EJZA 2OLGA 3BTHE 3F9FA 2BDGA 3LIWA 3RXAA 1CBWC 6GCHF 1DUEA 5FCRA 3SUGA 2P8OB 2RFKC 1VCQA 1KTSB 2QY0B 2THFB 3LDXH 1A3EH 1C5ZB 2P95A 5GWZA 2AIPA 3SV6A 2AFQB 2V3HH 4GSOA 2ZDAH 3A7TA 3Q3KA 4YOIA 1F92A 5G4BA 4YT6H 1C5YB 3OYPA 2GZ8A 1CVWH 3QDZB 2YMSB 3M36A 2R3YA 4XDEA 1C1UH 9LPRA 3HPTB 3SUEA 3TH4H 2GVFA 1C2KA 3DHKH 2KR7A 3A8CA 1LQDB 5FL7D 1SR5C 3TJUA 2GP9B 3OE7D 1HAPH 2B8OH 1NFUA 4TY7A 4YTAA 1NU9A 1SL3A 3GY5A 1LO6A 1QTFA 1JRSA 1L1NA 1XUIA 4INHA 1W8BH 1O36A 3LC5A 2STBE 1O3BA 2H9TH 2TGDA 2F83A 3QK1A 3A82A 5EPNA 1V2WT 3DSOA 2Y5FA 1HIAB 2LNCA 2KCAA 3AVZA 3AW1A 2XCNA 1W7GH 1YLNA 1DLEA 2OTVA 3AK5A 3KYFA 5DP3A 2A32A 3A7VA 3PTBA 2ZGCA 5L6NH 1ZSLA 1P02A 3BTFE 1YBWA 4QT8C 4AFQA 3MO9A 1HGTH 1O37A 2BD9A 2BLOA 3GY2A 4TY6A 1C2IA 1T8OA 2QE7D 3WW7A 1O3PB 2WZQA 1PYTC 3RXDA 3RXOA 1QB1A 1Z8GA 1JMOH 2G52A 4ACBA 1BHXF 1RTKA 4X1RU 3F2GA 2JJ2D 4IC5A 1D3QB 1BA8B 3E3TA 3E8LA 1TMBH 2W7UA 2BDAA 3M3VA 3PV2A 2ALPA 2FOEA 4IMZA 2VIVA 2W6ID 1QJ1B 5DP5A 2OBOA 1ZTJA 4CRBA 5SGAE 1JXPA 1O2TA 2RCEA 3K65B 4NIWA 3P92A 5EODA 1TPAE 5A0BA 1TMUH 1HAVA 3ZZ6A 4O3UA 2GCTB 3U9AH 3GY4A 1FPCH 3AAUA 1KDQB 1C1RA 3SZEA 1HRTH 4B73A 5A8XA 2FOBA 2W7SA 1GHVH 4E7NA 5ESTE 3A84A 1A0HB 5JB8S 1C1VH 3RXLA 2BM2A 1CE5A 1VGCC 3N7DA 1TX8A 1MKXK 5C1XA 3UNSA 4TT3D 1A1RA 1EPTC 1C2HA 2HVXA 1DITH 3P70B 1YGCH 1C2GA 3RC5A 1C1TA 2WYGA 4X6OA 5CHAB 3U8OH 3RC4A 3GCHB 3DSGA 2FI4E 4DG4A 3VGCB 1OYTH 1P2QA 1PPEE 1FY4A 3K6YA 2BX4A 2WV5A 1ABJH 3PROA 2ZTYA 6LPRA 1A61H 1WSSH 2FMJA 1FDPA 1O3GA 1BMNH 2F9VA 2ZKSA 2PKAB 3TH2H 3VB7A 2FOGA 1TPSA 1WXRA 3SZNA 1MUEB 4AGJA 3FZZA 2K0QA 1AKSB 1C4Y2 1ANEA 4B75A 4DY7B 1CHOF 2BD7A 4CRFA 3BIVH 3IWMA 1UJ1A 1YM0A 2ZNKH 3ITIA 4IS5A 1MH0A 3V0XA 1S82A 3UQVA 3M7TA 4X2YA 1AU8A 1NS3A 4JYVH 4H42U 4X8TH 1ETSH 1XUJA 4I86A 1ELTA 2XXLA 1OX1A 2BD5A 1XUGA 1CGIE 2CN0H 1O2VA 5T6FA 1V2NT 2K1QA 1AO5A 4K3JA 1C5PA 3SJKA 1SGNE 1UTPA 1AY6H 1MU6B 1QJ7B 3UIRA 1C5UA 5EG4A 3S7HB 1SGRE 1GBFA 2BDCA 1D6WA 1QBOA 1KXEA 1O3FA 2GGVB 2RDLA 1SLXB 3F9GA 1ARBA 3LJOA 5HGGA 5IK2D 1O35A 2OBQA 5DJ7A 1D3PB 1O2RA 2B9LA 1GJBB 2H9HA 1RFNA 2XNDD 4LZ4B 3SU6A 4O9VA 4NZQA 2Y6TA 3LU9B 1HXFH 1P3EA 2D1JA 1TNKA 1NTPA 2GDDA 1EB2A 1PPFE 4CRAA 2IOTA 1EQ9A 1IHSH 2QA9E 4HG6A 1GBIA 1P03A 3ZVGA 5FBEA 5EXNA 5HMAA 3L3TA 2NU4E 1A2CH 5DP7A 4GHQA 2VWOA 1HIAA 1P09A 2BY7X 1SQRA 1GG6B 1SPJA 3A8AA 4IN2A 1QY6A 2ZFFH 2FYQA 2F9BH 1LMWB 3OTJE 1GBJA 1J9CH 3I78A 4RSPA 4YZUA 4I33A 1O2UA 1BZXE 1DE7H 5K0HA 3MTYA 2A7JA 4OS1A 1T31A 2VWNA 1KXFA 4FU7A 1NRQH 4MNWA 1BHXB 5CDFE 3KQEA 3GY8A 6CHAC 2OC1A 5A2MH 1FAKH 3EA8A 1WBGB 4K2YA 3HATH 3SU0A 1PQ8A 2PKSC 4ABIA 1Y3UA 1CGHA 5FXLA 5J4SA 1K2I1 3RXHA 1GJ9B 1O2LA 2GV7A 1KXAA 2ZGHA 1EAWA 1GBEA 1TALA 4MNVA 3LGIA 4OS2A 3AASA 2VIQA 4NSVA 1ZMLA 3A83A 2ZECA 1O3EA 2AMPA 3UR6A 2Z94A 4CH8B 2JDID 2HALA 2QIQA 4KKDA 1IQFA 1SGDE 2CF9H 1IQNA 1WYKA 4UE7H 4MG3A 1C5XB 3MU0A 1O33A 5EXLA 5L2ZH 2OUAA 3RU4E 1UVUH 1KDQA 3DT0H 2W26A 1SMFE 4I31A 3BTKE 2EI8A 2ZHQH 4ZKOU 2ILNA 5E8EH 5LH8A 3LKWA 4JYTA 4YESB 8KME2 2F4LA 1ESBA 5EQSA 1CQQA 5C2ZA 1NM6A 1WTGH 1D6RA 2SNVA 1LPZB 1MTNC 1OHHD 1V2PT 1W12U 3UOUA 1MTUA 4NIXA 1TX7A 3ZZCA 1N8OC 1O3AA 1QRXA 2SFAA 2UUJB 1JRTA 1YCPH 3BEUA 1S81A 4DW2U 1O2XA 2Z3DA 2VWLA 2Y7XA 2LPRA 1SGCA 2PKAA 4RKOB 1P12E 3QLPH 1SI5H 1IQKA 1ZTLA 5AHGH 4TPIZ 1ANCA 3S9AA 2F9NA 1NY22 1NRPH 2R9PA 3MNBA 1AKSA 2J97A 2FDAA 3BSQA 1RJXB 5B6LA 4H6SB 4JZFH 1TABE 1QZ8A 4H4FA 3SU1A 4MVNA 1ANBA 2OK5A 3OX7U 2V35A 1GI3A 1MQ5A 1H8ED 1SLUB 4CHAC 1GJ5H 2YMSD 2XOKD 1O3NA 1TBZH 3HGNA 3RMNH 1VITF 2H1UA 1WV7H 1ESTA 1B7XB 2KAIB 2P3UB 4XE4A 4AORA 1ELDE 1XKBC 1S0QA 3SGAE 2FYRA 3LH1A 1C5OH 3RXTA 1C9TA 3HK6B 4CRCA 1GMHG 5GNDA 2A7CA 1C5RA 1MU8B 2G51A 1SQTA 4YLUA 1OWKA 3ATLA 3BG8A 5F8ZA 3WWFA 1AD8H 2ZFSA 1AFQB 3D49H 4ZXXH 1E1RD 3Q3YA 3OSYA 3OAAD 1H9IE 1TPOA 3P8NA 2AGEX 1HB0B 3RXRA 3PMJA 3FANA 1Z7KA 4GCHG 2Z3EA 3ZZ5A 3BEIB 3H7TA 2VH0A 3OFND 5ETXA 1O2GH 4RT0A 4JZEH 1FX0B 2J94A 2Y5HA 3BTEE 1HAHH 3KQDA 2BXTH 2J95A 3TGJE 1SFIA 2FOHA 1ORFA 4JK5A 2IPHA 2XTTB 2A2XH 1ELAA 2ZI2H 1NESE 2ZHEH 1GDNA 4OS4A 1TFXA 1ELGA 3R3GB 3RXBA 1E79D 3A81A 3RXJA 1HAOH 1BRBE 1O3MA 1YLDA 3MMGA 1UTOA 2SGEE 2TBSA 3LC3A 2FESH 3G01A 1AN1E 1S6LA 2L6OA 2HNTC 3PM3A 3P8OA 3QWCH 1Y3VA 2BOHB 2PGBB 3TU7H 4O03A 1SGEE 2ALVA 3VB3A 4NWKA 1YF4A 1C5SA 3SUDA 3T28A 2P59A 3F9HA 5I25A 2NWNA 4FUHA 2F9PA 2VIDA 1LPKB 1C2MA 1GI4A 1CT0E 4I8KA 2H9EH 4IN1A 2XBWA 1L0ZA 1QQUA 2BTCE 3LGTA 1TQ7B 1LHGH 2KCOA 4AZ2B 4AYYB 1BUIA 2HVYB 3MQKC 1GHYH 3STIA 3M37A 1A4WH 1DWCH 1WCZA 2AEIH 5TJXA 3U28C 5C17A 3MWIU 4ZKNU 1M9UA 3FFGA 1Z71A 2WV4A 2HOBA 1UK3A 1S83A 2Z9GA 1OWIA 1SVPA 1O30A 1T4VH 3RXFA 4FVBA 1Y5BT 3BV9B 4Q7ZA 1FONA 2AGIX 3S9CA 2V3MA 5E0JA 1W0KD 3BTWE 2ZHWH 3L33A 1UCYE 5TCCA 4A6LA 1FI8A
chains in the Genus database with same CATH topology
1W10U 3CENA 2P3TB 3QO6A 3VFEA 5C1UA 4Y6DA 3Q77A 2EA3A 3KNXA 3ZYDA 3V7TA 1JOUB 1O2YA 1MKXH 5EGMA 2AYWA 1O5GH 2BQ7B 2ZDVH 3UNRA 2UWPA 1MCTA 5HM9A 3I29A 1JBUH 1MD7A 5T6DA 1HJ8A 1UO6A 3UUZA 4B2CA 1AWFH 1QRZA 4HFPB 1IQIA 3RM2H 1LVYA 1GMCG 1ARCA 3GOVB 4AN7A 2ZU4A 2GMTB 1LDTT 5A0AE 1F0RA 3GDVA 5E2OA 1FY1A 3KF2A 1V2TT 1OXGA 1BBRH 1FY3A 3MI4A 3ODFA 4MTBA 1YP9A 1QQ4A 1TBQH 1TONA 1GBAA 2KAIA 3GICB 3SU2A 1DWDH 5C5NA 3M5OA 5CHAC 2VINA 2WPLS 5DP9A 1KXBA 3VGCC 2SGFE 5F8XA 1ZHRA 3MH5A 3C27B 1VJ9U 2ULLA 5EW1H 1O5CB 2A4OA 3U1JB 1RGQA 5C5OA 1TGBA 1TMTH 8LPRA 3TGIE 4AFUA 1ETRH 1BTPA 1PQAA 1GBHA 2ZEBA 1TGCA 2XCFA 3EQ0H 1F5LA 1TAWA 1EJNA 1RIWB 2OC0A 2OC7A 1D3TB 4NIYA 1OS8A 1AVGH 1P8VC 3MNCA 4ZMAH 3R0FA 4O97A 5E0HA 3KL6A 4CREA 1UMAH 1GWAA 2PGQB 2JH5D 2FLBH 3ZZ9A 2PUQH 1NFWA 1XUFA 4IBLH 4DGJA 4IW4E 2RG3A 1GHZA 1Y5UT 4ZHAA 1C1OA 1AGJA 3MO3A 1ZMNA 1O2IA 1GHXH 2DE8A 3TPIZ 3GDUA 5FHTA 2BXUH 3FP8E 1C4U2 1BRAA 3MNSA 4ABEA 3STJA 1HV7A 2FOAA 1MTSA 1P3CA 1KTTB 4ZUHA 1EX3A 3ESTA 2CHAB 4D9QA 4HZHA 1AB9C 4Y8ZA 5C20A 4E06H 2DUCA 2FOCA 4X1NU 3E0NB 2ANKH 3VB6A 1QB6A 1P9SA 1ZRKA 2PSXA 2XC5A 2AIQA 2XBYA 1GBMA 1DDJA 2EC9H 2GX4A 1E35B 1GJ4H 4MPVA 3RDZA 1SGFA 5F8TA 4OS6A 2O8WA 2JH6D 2BDHA 2QXGA 1F5KU 3EDXB 3UREA 4KGAA 3ATIA 2ZP0H 3GCTG 1GL1A 1P04A 2W5EA 1GG6C 3SU3A 3DUXH 4FU8A 2J38A 4X0WU 2VVVA 1C5NH 3LGUA 1UVOA 3BTQE 3MHWU 1QGFA 3KHVA 1Z6EA 1CHGA 4X8UH 1V6DA 3PLPA 2ANYA 1MBQA 4UONA 3C1KA 3K2UA 4AB9A 4X6PA 2F9UA 2FS8A 1AVXA 1MD8A 3Q76A 5I46H 1PPBH 1O3OA 2ZPQA 4K60A 4DT7B 4BTUB 5FCKA 1SQOA 4KTCA 1NT1A 1OYQA 1V2VT 1IOEA 2Z9LA 3A80A 1QIXB 3EE0B 1ZPBA 3RU4D 4UFGH 2SGQE 3ATKA 1TNGA 2OD3B 1MKWH 3SV8A 5AF9H 5ESBA 5B6OA 1O5BB 1T7CA 2ZU1A 3A89A 1LQEA 2V3OH 2ZFTA 1QL7A 2QF3A 1V2JT 1F2SE 4AB8A 4MNXA 1RS0A 5DP8A 4UEHH 2C4FH 1O3CA 4CRGA 1CA8B 3RXEA 1TNHA 5ABWA 1QHRB 1FAXA 1EAUA 4IGDA 1DXWA 2G00A 7ESTE 2BMGB 1C5TA 1EZQA 3RU4T 1UVTH 1E38B 1SBWA 1ELEE 5FX5A 5HM2A 2UUKB 3RLYH 3BF6H 1QBVH 3SW2B 1K1OA 2A1DB 2PWXA 1KIGH 2EI6A 3P8GA 1NU7B 1MAYA 2IJOB 2Y81A 1G32B 4X1SU 1ZJKA 1QNJA 2A5IA 1GMHF 1GHBG 2TGTA 2HGTH 3SOSA 4JZIA 1A3BH 1K9OE 1YPLH 1PFXC 1YPHE 2SGPE 2ZDMA 1W14U 2FX6A 1BB0B 4X6MA 1DSUA 1ZHMA 3P8FA 4A5TS 1LHFH 1ELVA 1C2JA 1G9IE 4K1EA 5FAHA 4UD9H 5JDUB 1G37A 4GCHF 3IG6B 4TPYA 1J8AA 2UUFB 4BNRA 2O9QA 1K21H 4ZH8A 8GCHG 1HJ9A 1GI0A 4ABJA 3BEFB 1FLEE 1G3EA 3FVFB 2PW8H 5EQQA 1MTWA 2BD4A 1GI8B 3B23B 3MU4A 5GCHG 4ISNA 3LT3A 4X2VA 1ZR0A 3LGVA 2P94A 1EAIA 6ESTA 3RXMA 4ZAEA 2XWAA 2WPKS 5IDKA 4Y71A 1OP0A 1CA0C 2ZTZA 1P05A 2AMQA 3ZVEA 5HYOA 5JB9S 3F6UH 3OY5U 4A1TA 1Q31A 5FX6A 2C3SA 3SJ8A 3TVJB 1HYLA 1SGQE 4BAOB 3QX5H 2V0BA 3MO6A 3NUMA 3M5MA 5GJ4B 3BTGE 1V2KT 1IQJA 2FPZA 3UOPA 3OY6U 3TK5A 1P9UA 4KP0A 3VB4A 3ZV8A 1FXYA 4B1TA 1F7ZA 1Y3WA 1LKBA 9ESTA 1SG8B 1UCYK 1T8NA 4ZHMU 3NKKA 3SNAA 1Z8JB 1C1QA 2FS9A 2D2DA 4WJG2 3RXPA 1DXPA 1MQ6A 1ZSJA 1PJPA 3IITA 3RXGA 4CBNA 1W0ZU 3V3MA 1NRNH 1ZHPA 1ZYOA 1CGJE 1OP2A 2UWOA 3QTOH 3SNCA 2YNAA 2O8LA 3ATWA 4INLA 4NA7A 1K1IA 4CR9A 1YCPM 3RXKA 2G4TA 1ACBE 1DWEH 2B7DH 5J4QA 1ZTKA 1QBNA 1NN6A 2ZU5A 4BAHB 3RMLH 2QXJA 2QXHA 3SHCH 1N6YA 3BTTE 1Y3YA 4JYUH 3SI4H 2HPQH 3S0NA 3ZVBA 1NZQH 3MYWA 3A8BA 4Y8XA 3TNTA 3KQBA 1VR1H 1FQ3A 1MAXA 2C8XB 3BTME 3TITA 5JBTA 4O3TA 3SNDA 5GPIB 4MPUA 1O2SA 2UWLA 2ANMH 1E36B 4K5ZA 1ZRBA 2FWWA 4BANB 3SJOA 1GHWH 4B2AA 3D62A 2Z9JA 4BAQB 1V2ST 1O32A 1LKAA 1OSSA 2VIOA 2PHBA 4FUGA 2C8ZB 2FOFA 3QUMP 1G2LA 2NU3E 4DIHH 5CE1A 1GMCF 2SNWA 4NWLA 1VGCB 1GVKB 1AWHB 2QAAA 1OWEA 1AQ7A 4YOGA 1BTYA 5GXPA 1E37B 1AI8H 2BVSH 1EPTB 1W0YH 7LPRA 1XUKA 4K8YA 2M5TA 1GI7B 1YPEH 2F9OA 2NU1E 2A2QH 2WPIS 1IQMA 4LXBH 5EOKA 3BIUH 1C1SA 2STAE 2JETB 3URCA 2GCHF 5T6GA 3UNQA 1HCGA 1GI9B 3A88A 4DCDA 2DE9A 5FPTA 5BPEA 2R3UA 4GUXA 1BJUA 1YLCA 2V6NA 1WUNH 1GGDB 2ZU3A 1KLTA 1C1NA 1LVMA 2GV6A 1WOFA 1EASA 1CT4E 3MH6A 4RN6A 3SORA 2BD8A 4B74A 3P95A 3PO1C 1EZSC 4WMDA 4ABDA 3BG4B 5AFZH 1WU1A 1Y3XA 2ESTE 2OXSA 2ZC9H 4GHTA 3VXFH 3TNSA 4CBOA 1PPGE 2G5NA 1Z6JH 1HAGE 1P2IA 2CJIA 4MPXA 2FLRH 2TGPZ 2GMTC 3A87A 4BXSA 1TX6A 2PFEA 1BRUP 2ZWLH 2ZHDA 2SGAA 2AERH 3SNEA 2PV9B 1GCTB 3NZIA 3HKJB 1HDTH 4DURA 1LPGB 3MH7A 3UY9A 1INCA 4PROA 2NU2E 2HRVA 4JMYA 4X8VH 3RM0H 1O31A 4AX9H 2XC4A 1O5FH 2ZPSA 4VGCB 5JPMH 1DICA 5C3NA 2Y82A 4AFSA 1BCUH 2VGCC 4Y10E 1T8LA 1AFEH 1KYNA 2GD4B 3QZRA 5EU8A 3AAVA 2TGAA 1TGNA 4Z6AH 2Q6DA 2Z3CA 1DT2A 4OS7A 4A7IB 3T2NA 1LCYA 3D65E 1XXFA 1VJAU 4FUFA 3U69H 2P8OC 2BX3A 4WXIA 4LK4A 1O5DH 3E16B 1OKXA 5A8YA 1GBTA 2BY6X 1GI5A 3VB5A 4CH2B 4B76A 1LHEH 1VZQH 3RLWH 1SB1H 4FUJA 4X1PU 4B71A 2JH0D 3ZZBA 4ABFA 1ZGIA 3HGPA 5A0CA 2VWMA 3SJ9A 1BTWA 1THRH 1GJCB 1F0UA 1DFPA 2XW9A 1H9LB 1B0FA 1O3KA 2AH4X 3ZZAA 1UK2A 1EZXC 3NXPA 2XRCA 2G55A 3T62A 1XUHA 1QR3E 3RMMH 1F0SA 1AZ8A 3Q00A 3UQOA 1G36A 1FIZA 1O38A 4LOYH 3ZZ3A 1IQHA 1YPMH 3M5LA 6CHAB 1QJ6B 2H5CA 1O3JA 3LGWA 4X2WA 1V2QT 2VVCA 1UTKA 3T5FH 5C67A 1L4ZA 1GJ8B 1LVBA 2Q6GA 3DD2H 3F68H 2BLQA 1GVZA 1BMMH 2BQ6B 4X8SH 2OQUA 1O2HA 3MU5A 1K1JA 3NK8A 2R0KA 3DFLA 3EA7A 1DOJA 3E90B 3SJIA 2F91A 1PPCE 1SOZA 2R2MB 4A1XA 2GTBA 1W3CA 3PWCA 2PLXA 3A7WA 1K1PA 3O8RA 1J15A 2ZHFH 3A85A 1GJAB 1HLTH 2CXVA 1ZSKA 1BITA 1ZGVA 2Z6BD 1CSOE 1G3CA 1EPTA 2WPJS 2Y7ZA 1ZJDA 5E2PA 4WMEA 4WVPE 4XBDA 2RA3A 1XKAC 1ID5H 2BLVA 1P2OA 1L1JA 1DWBH 1HBTH 4ISOA 3PTNA 4AFZA 5EW2H 1EP6A 3KCGH 2A4QA 3L6PA 4BOHA 2WUBA 2FODA 3SGBE 4Y7BA 1IQGA 1O3DA 1ABIH 3GY7A 1Z8RA 1ZPCA 3ENSB 3TK6A 4JCNA 1ESAA 1O3IA 1C5VA 2OC8A 5LPEA 4CRDA 3ZV9A 3T29A 4Y79A 2NU0E 1XXDA 1AMHA 2GCTC 3ZVDA 1GHBF 1TNLA 3UR9A 3PLKA 1UHBB 5AVDA 1C5WB 5LGOA 1TPPA 3M7UA 4E05H 2PUXB 4LZ1H 3DA9B 4ISHH 4IC6A 3RP2A 3KGPA 3SBKA 1TWXB 1FN6A 3Q3XA 1HXEH 4I7YH 2QV1A 5JBBS 4CHAB 1ELBA 4AYVB 3ZVFA 5HXFA 3P17H 1QB9A 1YC0A 3GCHC 1HAXB 1SLWB 1JIMA 8GCHF 2BVRH 5FBIA 1NROH 2ZPRA 4BAKB 1BOQA 4I8LA 1G3DA 2OQ5A 4U32A 3A7XA 2UUYA 1EOLA 3LGYA 1C9PA 3SV9A 2VIWA 4D7GA 1EP5A 3UWJH 1T32A 1Y5AT 3NCLA 3O8DA 3E6PH 3RXUA 1O3HA 1GPZA 1EXFA 4I8JA 3RXCA 5DG6A 2BY5X 5L2YH 1AZZA 2Y5GA 2BZAA 3M5NA 1FUJA 1EAXA 4TWYA 1P11E 3GCNA 5IYTA 3TK9A 4I8GA 4Q2KA 1XVMA 1O34A 2ODYB 1RRKA 1OOKB 5JYIA 4J1YA 2VU8E 1HJAB 1W13U 4H6TA 4FXGH 4ABAA 1CT2E 3E1XB 3KN2A 4GLYA 1YYY1 1XM1A 3MH4A 1O2OA 1S6FA 1ZZZA 1AIXH 1O5AB 3SGQE 4MNYA 4Z0KA 3RC6A 1TB6H 1VITG 2BDBA 1Z8IB 2H6MA 1BTHH 2FZZA 3F9EA 1SHHB 1YPJH 4NFFA 2XBXA 1C5QA 2GT7A 3ZVAA 1PYTD 5DP4A 1GJ6A 1IQLA 2ZFPH 4D7FA 3QZQA 2FO9A 4YOJA 1FIWA 3VPKA 4HGCA 3I77A 5T3HA 1UCYH 2ZGXH 1VITH 3RXIA 1BMLA 4FUIA 1V2OT 1ANDA 2D26C 2CGAA 2CV3A 1FY8E 4OGXA 4YT7H 3UPEA 1GJ7B 4MDSA 1YPHC 4GVUA 1A5IA 1AVWA 1F0TA 1UVPA 2B5TB 3BN9A 2SGDE 4M7GA 1PQ7A 3RXSA 4BXWA 2XWBI 1W7XH 2CMYA 5DKMA 3K9XB 3PMHB 1OP8A 1QA0A 4Q7XA 1GMDG 4WY3A 1P57B 2ZGJA 1O2MA 4UFEH 1UTMA 3GCOA 1TRNA 3O8BA 3GY6A 1PPZA 2Z9KA 4ABHA 3NPSA 1O2QA 3WY8A 1OWDA 4CR5A 4NG9H 4UFFH 2AGGX 1O2JA 2BD3A 1EKBB 2QXIA 3QN7A 4JZDH 2Q1JA 3RXQA 2Z9IA 1E0FD 2BY8X 2A0QB 1V3XA 1Z1IA 3LPRA 2C8YB 2A5KA 1GI2A 4OS5A 1AUJA 2QCYA 1P2NA 2QGRA 2XNIA 2I6QA 1BTXA 1D9IA 3SU5A 3MFJA 4TYDA 3S7KB 4ASHA 1NRRH 2GT8A 4XOJA 5DPAA 2W3KA 4KTSA 1U6QA 1EJMA 2ZF0H 1IHTH 5GIBA 1AE8H 2BDIA 4X1QU 1YPGH 1NC6A 1H9HE 1MZAA 1P06A 1SHYA 2QN5T 2ZCLP 2YNBA 3GYMA 2Z7FE 1A46H 3KQCA 3W95A 3EA9A 2A45B 3SU4A 1GHAG 5DP6A 5DO4H 2VVUA 4U30A 4UFDH 1YKTA 2QF0A 1UHBA 3V12A 1E34B 1P10A 1GBLA 1RXPA 4FUDA 4ZROA 1H8DH 3N7OA 2VNTA 1G2MA 1BRCE 2ZDKA 2OCVB 3ATMA 2PTCE 2XYAA 1G30B 4Y11E 1TA2A 3TLOA 1TIOA 2YOLA 3FP6E 4Q7YA 4ESTE 4Y76A 3OU0A 1HPGA 1YPKH 3ZZ4A 1OWHA 3GDSA 4A92A 2JETC 1P2JA 4JK6A 3FAOA 3TH3H 2P93A 2XBVA 4D8NA 4NA9H 4U01A 1ZPZA 1UTJA 2GZ7A 4FVDA 2XC0A 2P3FH 3SQHE 4FUEA 4J2YB 1GGDC 3ZZ7A 1J16A 4HI3A 7GCHG 4WWYA 1GI6A 3UWIA 1BBRK 3PV4A 1CBWB 2ZCKP 1C5MD 3BG4C 5EXMA 5FPSA 3T25A 5K7RA 2FM2A 1P0SH 1O2NA 2AMDA 1C5LH 1TOMH 1KY9A 4NIVA 1QURH 2BHGA 2FX4A 3ELAH 4NA8A 2C90B 4BAMB 2BB4A 3VXEH 2TIOA 1PQ5A 3ZVCA 1OPHB 1K1MA 1GCTC 1QFKH 2G5VA 1HAIH 4AGKA 3E91A 5A8ZA 3ZZDA 4YLQH 4I8HA 4WMFA 1EJAA 2BDYA