3GYWA

Crystal structure of nucleosome assembly protein from plasmodium falciparum at 2.4 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
180
Chain Sequence
LTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMHTEATVIDWYDNKNILRDSFFHFFTSHEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
molecule keywords Nucleosome assembly protein 1, putative
total genus 60
structure length 180
sequence length 247
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gywA02
3HFDA 5DAYA 3FS3A 3GYVA 3GYWA 2E50A
chains in the Genus database with same CATH superfamily
1E2SP 3FVHA 5DMVC 4N7ZA 4FDIA 3HFDA 1AUKA 3P34A 4HCOA 4X9VA 1F34B 3BZIA 2N19A 3KDRA 1E3CP 3C5LA 1E1ZP 1Q4OA 4J7BB 1N2KA 4RCPA 4LKLA 4HY2A 4N7VA 3P37A 4E9CA 2I9XA 5LHZA 3P2WA 2IA9A 4XB0A 3Q1IA 4LKMA 5DNJA 4RS6A 1UMWA 2QZUA 1HDHA 4YYPA 2OGQA 1A87A 2E50A 4H71A 3HIHA 3LM3A 4H5XA 4N9JA 2UV8G 4WHHA 1FSUA 4WHLA 3P2ZA 4E9DA 4CXKA 4O9WA 3GYWA 3P35A 4O6WA 5DAYA 4NKBA 1E33P 3ED4A 3GYVA 4CYRA 4FDJA 4X9RA 5AJ9A 1F32A 4G7NA 4X9WA 2OJXA 5DMSA 4NK7A 4CYSA 1Q4KA 5J19A 3HIKA 3FS3A 2VKZG 4CXUA 1N2LA 3P36A 3HMJG 1P49A 3LXQA 4O56A 2I9ZA 4DFWA 4CXSA 4WHKA 3RQ7A 4E67A 1E2TA 4HABA
chains in the Genus database with same CATH topology
1E2SP 4CXKA 4N7VA 4N7ZA 4FDIA 3GYWA 3HFDA 5DAYA 4NKBA 3FS3A 1E33P 3ED4A 3GYVA 1AUKA 4CYRA 2VKZG 4FDJA 1N2LA 4CXUA 3HMJG 5AJ9A 4G7NA 2QZUA 3KDRA 1E3CP 1P49A 3LXQA 1HDHA 2E50A 1E1ZP 3LM3A 4N9JA 2UV8G 1FSUA 4CXSA 1E2TA 1N2KA 4NK7A 4CYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFD A;  5DAY A;  3FS3 A;  3GYV A;  3GYW A;  2E50 A; 
#chains in the Genus database with same CATH topology
 1E2S P;  3FVH A;  5DMV C;  4N7Z A;  4FDI A;  3HFD A;  1AUK A;  3P34 A;  4HCO A;  4X9V A;  1F34 B;  3BZI A;  2N19 A;  3KDR A;  1E3C P;  3C5L A;  1E1Z P;  1Q4O A;  4J7B B;  1N2K A;  4RCP A;  4LKL A;  4HY2 A;  4N7V A;  3P37 A;  4E9C A;  2I9X A;  5LHZ A;  3P2W A;  2IA9 A;  4XB0 A;  3Q1I A;  4LKM A;  5DNJ A;  4RS6 A;  1UMW A;  2QZU A;  1HDH A;  4YYP A;  2OGQ A;  1A87 A;  2E50 A;  4H71 A;  3HIH A;  3LM3 A;  4H5X A;  4N9J A;  2UV8 G;  4WHH A;  1FSU A;  4WHL A;  3P2Z A;  4E9D A;  4CXK A;  4O9W A;  3GYW A;  3P35 A;  4O6W A;  5DAY A;  4NKB A;  1E33 P;  3ED4 A;  3GYV A;  4CYR A;  4FDJ A;  4X9R A;  5AJ9 A;  1F32 A;  4G7N A;  4X9W A;  2OJX A;  5DMS A;  4NK7 A;  4CYS A;  1Q4K A;  5J19 A;  3HIK A;  3FS3 A;  2VKZ G;  4CXU A;  1N2L A;  3P36 A;  3HMJ G;  1P49 A;  3LXQ A;  4O56 A;  2I9Z A;  4DFW A;  4CXS A;  4WHK A;  3RQ7 A;  4E67 A;  1E2T A;  4HAB A; 
#chains in the Genus database with same CATH homology
 1E2S P;  4CXK A;  4N7V A;  4N7Z A;  4FDI A;  3GYW A;  3HFD A;  5DAY A;  4NKB A;  3FS3 A;  1E33 P;  3ED4 A;  3GYV A;  1AUK A;  4CYR A;  2VKZ G;  4FDJ A;  1N2L A;  4CXU A;  3HMJ G;  5AJ9 A;  4G7N A;  2QZU A;  3KDR A;  1E3C P;  1P49 A;  3LXQ A;  1HDH A;  2E50 A;  1E1Z P;  3LM3 A;  4N9J A;  2UV8 G;  1FSU A;  4CXS A;  1E2T A;  1N2K A;  4NK7 A;  4CYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...