3GYWA

Crystal structure of nucleosome assembly protein from plasmodium falciparum at 2.4 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
180
Chain Sequence
LTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMHTEATVIDWYDNKNILRDSFFHFFTSHEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1, putative
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 60
structure length 180
sequence length 247
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gywA02
3GYWA 5DAYA 2E50A 3HFDA 3GYVA 3FS3A
chains in the Genus database with same CATH superfamily
1E33P 3LM3A 4E9CA 4G7NA 4E9DA 3KDRA 3HIKA 4XB0A 1E2SP 4E67A 4N7ZA 4CYRA 3P35A 5DMVC 1FSUA 2E50A 2IA9A 4HY2A 1P49A 4H5XA 3ED4A 1A87A 1E1ZP 3LXQA 2I9ZA 3HIHA 4NKBA 2N19A 4WHLA 1E3CP 4X9RA 3FVHA 4FDJA 4N7VA 3BZIA 4X9WA 4O9WA 3P36A 3P2WA 1F34B 4CXKA 1UMWA 4FDIA 4N9JA 5AJ9A 1Q4OA 3HFDA 3C5LA 4DFWA 5J19A 4RS6A 4O6WA 4NK7A 2UV8G 3FS3A 4X9VA 5DAYA 4WHHA 2QZUA 4H71A 5DMSA 4O56A 3HMJG 3GYWA 4RCPA 1HDHA 1N2LA 4HABA 3P37A 3Q1IA 4J7BB 3RQ7A 2I9XA 3P2ZA 4LKLA 1N2KA 1E2TA 2OJXA 2OGQA 4HCOA 1AUKA 3GYVA 5DNJA 1Q4KA 4CXSA 4CYSA 4CXUA 5LHZA 4YYPA 2VKZG 3P34A 4WHKA 1F32A 4LKMA
chains in the Genus database with same CATH topology
1E1ZP 4NK7A 3LXQA 1E33P 3LM3A 4NKBA 2UV8G 4G7NA 1E2TA 3KDRA 3FS3A 1E3CP 5DAYA 2QZUA 4FDJA 4N7VA 1AUKA 3GYVA 3HMJG 4CXSA 4CYSA 3GYWA 4CXUA 1HDHA 1N2LA 4CXKA 1E2SP 4FDIA 4N9JA 4N7ZA 4CYRA 5AJ9A 1FSUA 2E50A 3HFDA 2VKZG 1P49A 3ED4A 1N2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYW A;  5DAY A;  2E50 A;  3HFD A;  3GYV A;  3FS3 A; 
#chains in the Genus database with same CATH topology
 1E33 P;  3LM3 A;  4E9C A;  4G7N A;  4E9D A;  3KDR A;  3HIK A;  4XB0 A;  1E2S P;  4E67 A;  4N7Z A;  4CYR A;  3P35 A;  5DMV C;  1FSU A;  2E50 A;  2IA9 A;  4HY2 A;  1P49 A;  4H5X A;  3ED4 A;  1A87 A;  1E1Z P;  3LXQ A;  2I9Z A;  3HIH A;  4NKB A;  2N19 A;  4WHL A;  1E3C P;  4X9R A;  3FVH A;  4FDJ A;  4N7V A;  3BZI A;  4X9W A;  4O9W A;  3P36 A;  3P2W A;  1F34 B;  4CXK A;  1UMW A;  4FDI A;  4N9J A;  5AJ9 A;  1Q4O A;  3HFD A;  3C5L A;  4DFW A;  5J19 A;  4RS6 A;  4O6W A;  4NK7 A;  2UV8 G;  3FS3 A;  4X9V A;  5DAY A;  4WHH A;  2QZU A;  4H71 A;  5DMS A;  4O56 A;  3HMJ G;  3GYW A;  4RCP A;  1HDH A;  1N2L A;  4HAB A;  3P37 A;  3Q1I A;  4J7B B;  3RQ7 A;  2I9X A;  3P2Z A;  4LKL A;  1N2K A;  1E2T A;  2OJX A;  2OGQ A;  4HCO A;  1AUK A;  3GYV A;  5DNJ A;  1Q4K A;  4CXS A;  4CYS A;  4CXU A;  5LHZ A;  4YYP A;  2VKZ G;  3P34 A;  4WHK A;  1F32 A;  4LKM A; 
#chains in the Genus database with same CATH homology
 1E1Z P;  4NK7 A;  3LXQ A;  1E33 P;  3LM3 A;  4NKB A;  2UV8 G;  4G7N A;  1E2T A;  3KDR A;  3FS3 A;  1E3C P;  5DAY A;  2QZU A;  4FDJ A;  4N7V A;  1AUK A;  3GYV A;  3HMJ G;  4CXS A;  4CYS A;  3GYW A;  4CXU A;  1HDH A;  1N2L A;  4CXK A;  1E2S P;  4FDI A;  4N9J A;  4N7Z A;  4CYR A;  5AJ9 A;  1FSU A;  2E50 A;  3HFD A;  2VKZ G;  1P49 A;  3ED4 A;  1N2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...