3GYWA

Crystal structure of nucleosome assembly protein from plasmodium falciparum at 2.4 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
247
structure length
180
Chain Sequence
LTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMHTEATVIDWYDNKNILRDSFFHFFTSHEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1, putative
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 60
structure length 180
sequence length 247
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gywA02
3GYVA 2E50A 3GYWA 5DAYA 3HFDA 3FS3A
chains in the Genus database with same CATH superfamily
4WHLA 2VKZG 4E67A 4X9WA 4NKBA 2I9ZA 4NK7A 1P49A 4E9DA 3HIKA 1E2TA 4HABA 2QZUA 1A87A 3GYVA 4LKMA 4RS6A 4YYPA 1E2SP 4N9JA 1F34B 4H71A 3KDRA 1UMWA 4RCPA 5DMVC 5LHZA 5AJ9A 3HMJG 3RQ7A 1N2LA 2OGQA 2N19A 3LM3A 3P2WA 3GYWA 3P37A 4CXUA 5DNJA 2UV8G 4O9WA 4X9RA 5DMSA 3HFDA 4WHHA 3Q1IA 4O6WA 3P2ZA 4FDJA 2OJXA 3FS3A 4HCOA 3P36A 4CYSA 4CXSA 4WHKA 4N7VA 4J7BB 1F32A 1E33P 4E9CA 3BZIA 2I9XA 1E3CP 2E50A 1N2KA 5DAYA 4HY2A 1AUKA 3LXQA 4LKLA 4N7ZA 4FDIA 5J19A 1FSUA 1Q4KA 4H5XA 1HDHA 4O56A 4X9VA 1Q4OA 2IA9A 4G7NA 4CXKA 3P35A 3FVHA 3P34A 3C5LA 1E1ZP 3HIHA 4CYRA 4XB0A 3ED4A 4DFWA
chains in the Genus database with same CATH topology
2VKZG 1E2SP 1FSUA 4FDJA 4N9JA 3FS3A 4NKBA 3KDRA 4CYSA 4CXSA 4NK7A 1HDHA 1P49A 4N7VA 5AJ9A 3HMJG 1E33P 1N2LA 1E3CP 4G7NA 1E2TA 2E50A 2QZUA 3LM3A 3GYWA 1N2KA 5DAYA 4CXUA 4CXKA 1AUKA 3GYVA 2UV8G 1E1ZP 4CYRA 3LXQA 4N7ZA 3HFDA 3ED4A 4FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYV A;  2E50 A;  3GYW A;  5DAY A;  3HFD A;  3FS3 A; 
#chains in the Genus database with same CATH topology
 4WHL A;  2VKZ G;  4E67 A;  4X9W A;  4NKB A;  2I9Z A;  4NK7 A;  1P49 A;  4E9D A;  3HIK A;  1E2T A;  4HAB A;  2QZU A;  1A87 A;  3GYV A;  4LKM A;  4RS6 A;  4YYP A;  1E2S P;  4N9J A;  1F34 B;  4H71 A;  3KDR A;  1UMW A;  4RCP A;  5DMV C;  5LHZ A;  5AJ9 A;  3HMJ G;  3RQ7 A;  1N2L A;  2OGQ A;  2N19 A;  3LM3 A;  3P2W A;  3GYW A;  3P37 A;  4CXU A;  5DNJ A;  2UV8 G;  4O9W A;  4X9R A;  5DMS A;  3HFD A;  4WHH A;  3Q1I A;  4O6W A;  3P2Z A;  4FDJ A;  2OJX A;  3FS3 A;  4HCO A;  3P36 A;  4CYS A;  4CXS A;  4WHK A;  4N7V A;  4J7B B;  1F32 A;  1E33 P;  4E9C A;  3BZI A;  2I9X A;  1E3C P;  2E50 A;  1N2K A;  5DAY A;  4HY2 A;  1AUK A;  3LXQ A;  4LKL A;  4N7Z A;  4FDI A;  5J19 A;  1FSU A;  1Q4K A;  4H5X A;  1HDH A;  4O56 A;  4X9V A;  1Q4O A;  2IA9 A;  4G7N A;  4CXK A;  3P35 A;  3FVH A;  3P34 A;  3C5L A;  1E1Z P;  3HIH A;  4CYR A;  4XB0 A;  3ED4 A;  4DFW A; 
#chains in the Genus database with same CATH homology
 2VKZ G;  1E2S P;  1FSU A;  4FDJ A;  4N9J A;  3FS3 A;  4NKB A;  3KDR A;  4CYS A;  4CXS A;  4NK7 A;  1HDH A;  1P49 A;  4N7V A;  5AJ9 A;  3HMJ G;  1E33 P;  1N2L A;  1E3C P;  4G7N A;  1E2T A;  2E50 A;  2QZU A;  3LM3 A;  3GYW A;  1N2K A;  5DAY A;  4CXU A;  4CXK A;  1AUK A;  3GYV A;  2UV8 G;  1E1Z P;  4CYR A;  3LXQ A;  4N7Z A;  3HFD A;  3ED4 A;  4FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...