3GZAA

Crystal structure of putative alpha-l-fucosidase (np_812709.1) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
438
structure length
438
Chain Sequence
b'ELPVPKPHQLKWHEAEMGAVFHYDLHVFDGIRYGQGNNRINPIEDYNIFNPTELNTDQWVQAAKAAGCKFAVLTATHETGFGLWQSDVNPYCLKAVKWRDGKGDIVRDFVNSCRKYGLQPGIYIGIRWNSLLGIHNFKAEGEGAFARNRQAWYKRLCEKMVTELCTRYGDLYMIWFDGGADDPRADGPDVEPIVNKYQPNCLFYHNIDRADFRWGGSETGTVEYPCWSTFPVPCSHHKRIESSIDQLELLKHGDKNGRYWVPAMADTPLRGANGRHEWFWEPDDENNIYPLNTLMDKYEKSVGRNATLILGLTPDPTGLIPAGDAQRLKEMGDEINRRFSSPIARISGQKKSLTLKLGKEQSVNYCIIQENIKNGERIRQYQIEAKVNGKWQTVCKGESVGHKRIEKFEPVEATALRLTVSESIALPDIINFSAYSVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative alpha-L-fucosidase
publication title Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 140
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1510 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gzaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gzaA01
3UG4A 3VGHA 1HJXA 2Y5EA 2YIHA 4AD2A 3KL3A 4PMDA 3FAWA 3B8SA 1FH8A 4R27A 4S3KA 1ZJAA 4GI9A 3MSGA 1BYBA 4OJYA 2ZE0A 5D4YA 2X8RA 4OOUA 1BVNP 2RGMA 4N0RA 1XCWA 2WC4A 1JAEA 5CSUA 1M53A 2BY3A 3A4WA 5CGTA 4PTWA 1C3FA 4H2CA 4UNIA 5BCAA 3WMCA 4J3XA 5I0DA 1W9XA 4JAWA 3CLWA 4UFKA 3W0KA 3MUIA 5CLTA 4KRTA 4JHOA 1ESWA 3CZKA 5I5RA 5IXEA 3RM9A 5HPCA 3VGDA 4KH2A 2WVVB 1P6WA 1M04A 1GQJA 3II1A 1SMAA 5AYBA 4PYSA 4AW7A 2VCBA 3A4AA 4R5EA 4DWSA 2O92A 4Q22A 1FOBA 1R85A 1JZ4A 2ZOXA 1V02A 2J8GA 1VBRA 1C7SA 2J7EA 2O9PA 3ARUA 4BZYA 2EXOA 2ZUMA 2EPOA 2WVSA 1UD8A 3ZT6A 5JBFA 4IM4A 1D3CA 1VBUA 2UWFA 1FHLA 2VX4A 5FCZA 3QOMA 1CGXA 1G1YA 3MKKA 4P8WA 3ZMRA 1TCMA 5F7UA 5JIPA 1UA3A 1X6NA 5FL1A 7CGTA 3CMJA 5CQ1A 2VL4A 5LA2A 3CUFA 1PEZA 2E9MA 5M03A 2VVSA 2WBGA 3AROA 3MSDA 1GOKA 2UY2A 3VGEA 1CXFA 3WNOA 4HPHA 1E6PA 3T08A 1UKTA 2ESCA 4MB4A 1V02E 4J3WA 5DO8A 4AWEA 2V3FA 3WNNA 2J47A 1E1FA 3NYDA 3O6AA 3VGFA 1W3KA 1CLVA 4CUCA 3WH6A 2XSBA 4B16A 1AQ0A 1ITXA 1WZKA 3MUY1 4TTGA 5E0CA 1BVZA 3IAPA 3WUEA 1PAMA 1KWGA 3AZSA 4KMQA 3VX0A 3WY1A 1CGYA 3T2PA 1KXVA 2WB5A 1E4NA 2WHKA 1KWKA 3EDFA 3GDBA 3BAYA 4U2YA 4HMCA 1BG9A 3WFZA 3NSNA 1GCYA 1QPKA 2TAAA 2YL6A 1OSEA 4PSPA 3G6MA 4FLRA 4A4AA 5EBAA 1W9UA 3T2QA 4Z2KA 4AIEA 2HVMA 5AC5A 5IFTA 5EMYA 1JYVA 4Z2HA 3HN3A 1VF8A 1VFUA 3ZR6A 1YQ2A 3EMZA 4U5KA 1TA3B 4D6JA 4XZBA 1HKIA 3APGA 2CBJA 4AZCA 4AC1X 4UQ9A 3ARXA 4UOZA 1VFOA 3PTMA 3T0AA 1UYQA 2ZX5A 5DEZA 1MXDA 5C8BB 4C7DA 3L4VA 3CUHA 1L0PA 1KQYA 2JEQA 5I79A 1BF2A 2VVNA 2D22A 3SCQA 4CN6A 1DEDA 4AZ6A 3GNPA 1JXJA 4GO8A 1FP9A 1ODZA 2DSVA 3WEMA 1LQ0A 3ZM8A 3N04A 3ZSTA 2WBKA 2D23A 4CU7A 3ZT5A 4AYSA 5D8ZA 1DWAM 2FHFA 2ZX7A 1X1NA 1E15A 2WNWA 1KCKA 1JFHA 2JF7A 1B3YA 1J0YA 1Q6EA 3FHQA 1I75A 2OWCA 5BROA 3PZ9A 2A3CA 4CCDA 1ZBVA 4FLSA 2W91A 3CMGA 3W27A 2IXUA 1B2YA 1J0KA 4BQ3A 1RH9A 3GNOA 2WSPA 2D0GA 4AD3A 5FIPA 3ARSA 1W91A 3ARYA 1UD2A 4P8VA 2VR4A 2BHUA 3CUJA 3EDJA 4PMOA 1UWTA 2J74A 3QOKA 4UQAA 1V3MA 1QI3A 2WKLA 1DWGM 1MFVA 8A3HA 3QGVA 1MW1A 2W62A 3L2MA 1QBAA 4WF7A 2XG9A 5ABEA 1XH2A 3WSUA 1H41A 4B3KA 3LPFA 4EKJA 1XC6A 2XUCA 3MMDA 5JUVA 1E0XA 3RM8A 4CCCA 5M17A 2XSAA 1KB3A 1C92A 3AS3A 4M1RA 1HVXA 3WMBA 3K4AA 1UWQA 1LL7A 4AIUA 3RILA 3PZMA 2MANA 1LL6A 3GH5A 1QNRA 1B1YA 2JF6A 1GVIA 3CH9A 3N12A 4MPKA 4UR9A 1UWIA 2Q8XA 3W26A 5A6LA 2J4GA 1F4AA 2ZUVA 3QHNA 4UTFA 3WF1A 2C0HA 3CPUA 1UUQA 4E8CA 1JZ7A 3GXMA 4PMZA 1PIGA 4F9DA 2J7CA 2XJ7A 2VURA 1EHNA 1JZ6A 3W28A 3BLKA 1WZAA 3BMWA 5E9AA 1LWJA 3ZR5A 4MB3A 2WMIB 4Y7EA 4EANA 3BCDA 4CD8A 3AMKA 1JAKA 1QI5A 4OKDA 2OSXA 3RMEA 3S6TA 3VD5A 3WH5A 1JXKA 3M07A 1OIFA 1J0ZA 3SCRA 1K9FA 2V3EA 3CHEA 1TA3A 1EDGA 1FA2A 4AMCA 3AXIA 3WH7A 2C8NA 2CBVA 1B31A 1UWUA 4E2OA 3T2OA 1CYGA 4D6FA 5CZKA 3OZPA 3VDBA 3ZJ8A 4UOQA 2ZICA 2WANA 3W53A 3CHDA 3ZSSA 1W3JA 4LX4A 2VOTA 1HP5A 3AIVA 4RE2A 4WKFA 2CETA 1ITCA 3WQVA 2CKSA 1E40A 1IZJA 4WKHA 2W5FA 4H8HA 4EE9A 1YHTA 3G6LA 4XUYA 2JE8A 4H8VA 1G0CA 1PZ3A 5CJ5A 4UOJA 4D72A 3NCOA 3ZIZA 4UFHA 4M24A 2D2OA 8CGTA 1WO2A 2VQTA 2WC3A 2G3MA 1UQYA 5BRPA 3WN6A 4F66A 3F5KA 4WKAA 1R87A 2O9TA 1JIBA 1NARA 4D6GA 4C7FA 3AHTA 4GI6A 1V0LA 4MNMA 3VILA 1W32A 3BSHA 2BXYA 2CYGA 1R7OA 1CGVA 4AXNA 1H1NA 3TTQA 1W9DM 1GPFA 1ZB5A 3VOCA 4EK7A 2Y8VA 2GUYA 2G3JA 1NOWA 2OWXA 7A3HA 1PX4A 2BY0A 3QHMA 5AYIA 2W67A 2PWDA 2VZOA 3AMCA 1UD6A 4PTXA 3WH9A 1HJSA 4JL2A 5CPTA 2GDUA 4WIWA 2E9LA 3ARWA 2OWWA 3WQWA 1BTCA 2FH6A 3B9AA 2DSZA 3AIQA 1US2A 3L2LA 3NIYA 2WM0A 3VIHA 4D6HA 2J7HA 1E6SM 3VINA 2BVTA 4IPNB 3AS0A 3F4VA 4FK9A 1JF5A 1WP6A 1G5AA 1GNXA 2WYSA 1JL8A 3GBDA 5CLWA 1JFXA 1OGGA 3AMLA 2AMGA 4BQ2A 5A94A 3THDA 3AIBA 1NP0A 2VNCA 5A3HA 1VRXA 3AHVA 3W38A 4L4PA 5LA0A 4KGJA 2FH8A 3WF3A 5ABFB 1W9VA 2WKGA 2FDMA 4TX8A 3VIOA 4JL1A 5A2CA 4PEEA 2NW0A 3VD9A 3VIPA 2WMHA 4W85A 1J9YA 3WDRA 3GZAA 1BGGA 2D0FA 2XIIA 2A3EA 3KZSA 1DHKA 3WIJA 4BQ5A 4PMYA 1OINA 2DH3A 3GH7A 4HOWA 1BHGA 1G01A 1E6ZA 2YKKA 4Z2JA 1MQRA 2J25A 2J7DA 5JBDA 1J11A 4J3VA 2VO5A 1L8NA 1GOOA 2G4FA 3U7BA 1UWSA 3VDCA 1CGUA 1QI4A 1HVQA 3W82A 4FLOA 1UHVA 3UESA 1LLOA 2DEPA 2Y8KA 5A6MA 1GJWA 1Q6FA 3I3DA 3VMOA 4Z2GA 5BXSA 3VIFA 1E9LA 5DT7A 4M56A 5GNXA 3VNZA 1XYZA 4P7RA 3PZIA 2VJXA 2GVYA 1H0GA 2VR5A 3AICA 1JD7A 1QI0A 1OWQA 1E72M 5JBEA 4B9YA 5ABGA 3FY1A 5HPOA 3AHZA 1B90A 4DM1A 1EH9A 4DWSC 4UZSA 2E3ZA 4ATDA 2DDXA 3ARRA 4ACZA 3W29A 4MNKA 2WHLA 3W81A 1ISYA 4AZIA 5KEZA 3SUUA 4AD5A 4JKMA 3EMQA 2WXDM 2XGBA 2WHJA 4RE4A 5E70A 4M8UA 4ZXOA 1V6VA 2OYLA 3UR8A 5JIWA 2JALA 5DF0A 2ZXDA 4NRRA 5A8MA 1R86A 1MW3A 1GOQA 4J28A 4P8XA 2ZWYA 1NWRA 2EPKX 1QNOA 4QCEA 2YA2A 2Z1SA 3SUSA 2ZIDA 1V0KA 1EOMA 2VCCA 4QCFA 4XX6A 4OIFA 3IAQA 4HTYA 2VZVA 2IUZA 1JDCA 1F4HA 3MMWA 2ZUUA 4W93A 5DT5A 3SUTA 2J7GA 1WZMA 3WNLA 4QLLA 3PBGA 2J7FA 4LGXA 2C7FA 4JFVA 4OUEA 6CGTA 4JCLA 1V3HA 3SCUA 2ZXAA 4X9YA 1JGIA 5IHSA 3WDPP 5IDIA 1BGAA 1LL4A 4GO9A 4J27A 4PTMA 4HU0A 4EAMA 2YDSA 4MNLA 1XGZA 4W8AA 4JFUA 3BAJA 5FKYA 4CD7A 1ODUA 3GXDA 3BAIA 2DGAA 1GUVA 4UFLA 4AD4A 1CXIA 1J10A 2XVLA 2UY4A 2W63A 4JFTA 3LPOA 4HMDA 4HP5A 5D9PA 1FH7A 3K46A 3UG5A 2QPSA 1XH0A 3KEHA 2DIEA 3LMYA 1M7XA 1B3VA 3WF2A 1E55A 2VRJA 1VEOA 5A95A 2XVKA 4OOZA 4E4PA 1KR0A 1LG1A 4CU8A 4M81A 1E6QM 1R8LA 2AOSA 3PZQA 1VJSA 3CTTA 4MJ2A 3VDHA 4ATWA 3DHUA 4LQ1A 5CPQA 1W1YA 1PBGA 1PZ2A 1H4PA 2CIPA 1UKOA 3AFBA 4YPJA 2YA0A 3DECA 5GPRA 3BAKA 3I3BA 1CWYA 4XV0A 1W2VA 4D6IA 3HMCA 1GHSA 1XSKA 3ZJKA 5A2BA 2WC7A 1V03A 4HOXA 5AY7A 2BFGA 3ZO9A 4U5IA 1OT2A 4UQBA 4GKLA 3RPMA 2WMGA 4TVCA 3LPPA 1GONA 3EDEA 4PMXA 3VDAA 3A47A 2GK1B 4A3HA 4BS0A 3DYOA 1TR1A 2G3IA 1DWIM 1WDRA 2VZUA 1XYFA 4CD6A 1SFSA 4MDPA 1QNQA 3PN8A 1BG4A 4L4OA 2WW5A 2YL5A 4JKLA 1XD1A 3MUAA 2NT1A 3WF0A 4U2ZA 3OGVA 3F5JA 4TXEA 1LG2A 3N18A 4GZEA 3TONA 1C8XA 2WVVA 1MWOA 5LA1A 2NSXA 1UD3A 3WH8A 1V08A 1MYRA 4PRWA 1JF6A 3POCA 4P7QA 2PWFA 3A4XA 3CZEA 1CGTA 2VRQA 4PBGA 1AQHA 1VEPA 1EGZA 2D1ZA 2CITA 5I78A 4QP0A 5E6YA 1OBAA 2WSKA 2GDVA 2WLYA 3SCWA 1JDDA 2WCAA 3NDYA 3VPLA 4UFMA 5C71A 1MW2A 3SCOA 1W2PA 1HJVA 4ZXLA 4MB1A 2JIEA 3W6MA 2HISA 3AMDA 4JZ5A 4M29A 2Y4SA 3M6DA 1ISZA 4JIEA 3A6OA 4AZGA 1VIWA 3AIWA 1GQKA 5I3DA 1HJQA 3ECQA 3K4DA 1NOUA 3SURA 2EO7A 1W9PA 4GZJA 1KBBA 1OGSA 4CVUA 2D3NA 2W61A 3WL0A 1UOKA 1W9BM 3WNPA 3WDIA 4ZFMA 4J7RA 4UQCA 2DSWA 4QAWA 3ARPA 2YJQA 2J8FA 5FL0A 1NWUA 4GZIA 3BAWA 2J62A 5KZ6A 1KGWA 1JYXA 1C93A 1V0NA 4PMRA 2YLAA 4AZ7A 4RL3A 2XVNA 4QFUA 2CBIA 1S46A 4D1IA 1PIFA 2VX6A 1SYTA 3VX1A 3AOFA 4HA1A 3TTSA 3WUFA 1WZLA 3PZVA 3GBEA 4ZENA 4D6DA 2PC8A 5CPSA 3RJYA 2VCAA 3CUIA 4UZUA 1WE5A 4MDOA 3ZJ6A 1DWFM 1QW8A 2ZX6A 4OBRA 1OB0A 2RGLA 1OIMA 1G94A 4MAZA 3NSMA 1B0IA 3MS8A 4W5ZA 1NOFA 5D9OA 3VIIA 3AQUA 4MB5A 3SCTA 1HKJA 2DT2A 3MUZ1 4ATLA 2WMJA 1W1TA 4XB3A 5HNNA 2V5DA 1CEOA 1ISWA 3QR3A 1MW0A 1UR8A 4W86A 3SIMA 1XHGA 1HJUA 1W1VA 1E3XA 1QVBA 1JZ3A 3L4XA 1EOKA 3VIKA 1HX0A 3CHCA 4AD0A 1OT1A 1X6LA 1XV8A 5EFDA 1KBKA 5TD4A 2VZTA 1W1PA 5FD0A 4HZ7A 1W3HA 1Q4NX 3VD3A 2WWCA 1E6RA 2EJ1A 1JZ5A 1H5VA 1NP2A 1QOXA 3MV11 4CN1A 5A2AA 1PX8A 4W89A 3WUGA 1MXGA 4OBSA 4AISA 1JDAA 1UR0A 5BXPA 2XHYA 3BAXA 1E1EA 1GZJA 3PZOA 3PTQA 4PUEA 3D3AA 3B9DA 2XM1A 4QLKA 3GXIA 1GQLA 2OYMA 5GNZA 1B3XA 2GK1A 4WSKA 1E43A 1XSJA 1J18A 3WL1A 1CXHA 4PCSA 1NWTA 2BNJA 4TVUA 4A3YA 3NSXA 2XGIA 2O9RA 2JEPA 4NF7A 3POHA 2FGZA 2A3AA 2BVYA 4M82A 3UG3A 5BYWA 1U2YA 4H8UA 4YHGA 1Q6DA 1V3KA 3SCVA 3D5HA 2PB1A 1UKSA 3KL5A 3PZTA 2NT0A 2YBTA 3O2LA 1V3JA 2GJPA 1E4IA 1OCQA 4U3CA 3N9KA 1FP8A 3VUPA 1J01A 2WMFA 2WMKA 3LPGA 2ZUSA 3BCFA 4GQQA 1V0MA 3E1F1 4JFWA 1CXKA 2DPEA 2G3NA 3ZJ7A 4P7OA 5M5DA 6A3HA 1KXHA 3EBVA 4AY1A 1V6UA 4MAVA 4D71A 3WQ8A 3M7SA 9CGTA 3AIEA 3K8KA 1Y7VA 1IT0A 2X2YA 1TE1A 3WQ5A 1EIBA 5A8PA 3L4WA 1E3ZA 1VFMA 1E4LA 4HU8A 1UZ1A 3VIGA 3L4YA 4HMEA 1PPIA 4W5UA 4PSRA 3OG2A 1K9DA 1VENA 4J3UA 3CZJA 1B3ZA 1TMQA 1E56A 4GPNA 5HOSA 1BPLB 1CENA 1LJYA 3VKKA 1UG6A 4JHZA 1XH1A 1VFFA 1Q6CA 5DMYA 1EO7A 2OSYA 3OBAA 1NM9A 2VZSA 2CERA 1HL9A 2PF0A 1H11A 1LWHA 4B15A 3GXFA 3HU7A 1ECEA 4HA4A 1QHPA 3WD0A 3KE0A 2YBUA 3AISA 3PTKA 3F5LA 4W7VA 1E5NA 3RDKA 2V5CA 4K68A 3CGTA 5BWFA 2XFFA 2WMIA 4TTUA 1AMYA 3BXWA 1WCGA 1OM0A 3IJ7A 1IZKA 3GYCA 3OA5A 1HF6A 3T0BA 1WDPA 5FOOA 1GHRA 3DC0A 3IANA 2CPUA 3EDDA 3KL0A 2VX5A 3OLGA 4LPCA 3WENA 1CZ1A 1N82A 2WWDA 5I24A 3WD4A 1RP8A 3VGGA 3TTYA 4MJ4A 1DTUA 1TVNA 2PI6A 2DT1A 2X09A 4D6CA 2X0YA 1E6XM 4WJXA 1HKKA 4BA0A 3MU7A 1J0IA 1WB0A 3AIUA 1ZL1A 1U33A 3U5YA 4FMVA 1E71M 1FHDA 4JCMA 4E8DA 2WCSA 1QNSA 4W8BA 3CIVA 4ZEPA 1ZU8A 5IFPA 1KGUA 3AJ7A 4HPGA 3UETA 4ACYA 5A6JA 2CEQA 2F61A 4AZCB 1J0JA 5BXTA 3AHYA 3M46A 2DQXA 2Z1KA 1VAHA 2V3GA 4U33A 1NWSA 2CHOA 2XFYA 4Z2IA 1HJWA 4X0NA 2PWEA 1JNEA 4NRSA 1I1WA 3CHFA 5A8OA 1FH9A 1UZ4A 2YDQA 5D8WA 1JYWA 4XZWA 4CN4A 2E9BA 1U30A 2EPLX 4W87A 2XVPA 4H7VA 3K8LA 4P7NA 4W7UA 5DFAA 3WQ4A 1J0HA 1FFRA 1NQ6A 3NDZA 3WMSA 4UFJA 1WAWA 3CUGA 2VX7A 3AYRA 2WPGA 1D7FA 3KWXA 1KGXA 1UKQA 4U31A 5I2UA 1MQQA 1CBGA 4CD4A 1JZ2A 1E4MM 2FHCA 1UKPA 2JFEX 2E40A 1Q6GA 3K1DA 5CG0A 3FN9A 3SUWA 2QMJA 2XTKA 4NSBA 3VTRA 1EXPA 2J77A 4S3JA 3WDQA 2VI0A 1JZ8A 1J12A 1GOWA 1VB9A 3WD3A 3ZOAA 2OLHA 3GH4A 3OLEA 2Y24A 2WZEA 1E70M 3PZGA 4GI8A 1QHOA 1M01A 4GQRA 2E8ZA 1HL8A 2BHZA 4HOZA 3RJXA 1E6NA 4PN2A 1BYDA 3BSGA 1E0WA 1WKYA 2J75A 2X05A 2J79A 2VQUA 2CESA 3AYSA 1EA9C 3CBWA 1H09A 4QLJA 3CZLA 5A6AA 5EB8A 1UR4A 1H0IA 4BF7A 4UCFA 3UCQA 2QPUA 5ABFA 3GNRA 4LYQA 1R7AA 3W24A 2AAAA 3BMVA 1G9HA 1CIUA 4RE3A 2BS9A 1GQIA 1TVPA 4UFIA 4ZE4A 3AIRA 3W25A 3AZTA 1WDQA 4DUWA 2PWHA 3VMNA 5HXMA 3AI0A 1KXQA 4P7LA 4W7WA 2ZXBA 1VEMA 1TG7A 1Z32X 3VIJA 1B3WA 4DM2A 3WDJA 3TP4A 1KCLA 3N17A 2YL8A 4KRUA 3I3EA 2YDRA 1ISXA 3W6LA 3W4RA 4TUFA 3TA9A 4W8LA 2EPMX 3SCPA 1CNVA 2DH2A 1UH3A 2GJRA 2QF8A 3THCA 5A6SA 3AS1A 4GXPA 1O7AA 4JKKA 3UERA 5E0FA 5E09A 2DT3A 1M03A 1UA7A 3OB8A 2DSKA 2GFTA 1GOIA 5I6SA 2DT0A 2CCRA 3AHXA 4UQEA 3OZOA 1RD6A 5HDRA 1QHZA 3MMUA 1US3A 2J78A 2XIBA 3ARQA 3WKZA 3PHAA 1UH4A 2F8QA 5A8NA 2CBUA 1TZ7A 2DSUA 3ARZA 3WUBA 1IV8A 2QLYA 4IPLA 1CTNA 4BQ4A 3L4TA 3S2CA 3WD1A 1H49A 1CXEA 5BXRA 4WK9A 4PMQA 4AEEA 3WBEA 1A3HA 3VVGA 3T0DA 2ZUNA 1XD0A 1V3IA 2WCGA 1UH2A 2G41A 5ECUA 4ML4A 1I1XA 1UR1A 4P8UA 3N15A 3JUGA 1OGBA 4DUVA 1JG9A 1O6IA 3AXXA 1C90A 1EQPA 1XRVA 4ZE5A 1HNYA 1V6WA 3FXYA 1B9ZA 3WBAA 4D1JA 5A6BD 3NUKA 5IHRA 2EPNA 4MTVA 4CKQA 4TOQA 5E6ZA 1K6AA 3EDKA 4WLCA 3WDHA 3U57A 3HJEA 1GOMA 2X0HA 1HIZA 4FLQA 3FAXA 3UR7A 3ALGA 3VMPA 3RIKA 2BY2A 3MANA 2GJXB 3A3HA 1HXJA 1OD0A 1JI2A 2A3BA 1ZBCA 3U7VA 1CLXA 3VIMA 3AS2A 2UY5A 1TUXA 3QHOA 3J7HA 1JD9A 3BGAA 3OGRA 1C7TA 1SR0A 3TTOA 3VGBA 4IUGA 1C91A 3VNYA 4AD1A 3OGSA 4GIAA 4YHEA 4PCTA 4V2XA 1XCXA 3VU2A 2PBGA 1QW9A 2WVTA 2EQDA 1BQCA 1E5JA 1QI2A 3ALFA 2XM2A 1H3GA 1HT6A 5I77A 2QV4A 3AXHA 2ZX9A 3VD7A 2ZWZA 5CSYA 5ABHA 3WF4A 3OLIA 4C7GA 2BHYA 1CGWA 4J3SA 1C8QA 2WLZA 2BV9A 1UWRA 3L4ZA 4OZOA 4B3LA 1KQZA 3OIHA 3GM8A 3IJ8A 3IK2A 4TVDA 4DWSD 4CGTA 1KXTA 3GTNA 3BLPX 2QMKA 1GJUA 4FF5A 2IXVA 2BY1A 4TX6A 2VUYA 3IJ9A 1UQZA 1MQPA 1EDQA 2D3LA 3OLDA 5D9NA 4BCEA 3RM4A 2OYKA 2WZIA 3VM7A 2YL9A 4H04A 5AC4A 1C8YA 1LF1A 4F79A 4N42A 4M80A 1WPCA 2JIWA 3K8MA 6TAAA 1OD8A 4YN5A 5CGMA 3W37A 4H41A 5M3WA 3EMCA 2J7BA 2D20A 4V28A 1TFVA 4AZBA 1CECA 1HN1A 1MFUA 3FW6A 1HP4A 1ZJBA 1A47A 4PTVA 4D6EA 1WNOA 5C70A 2O9OA 2CHNA 1BAGA 1MVYA 4F8XA 4MNJA 1JYNA 2DIJA 2XFRA 3PZUA 5A69A 2VC9A 2FGLA 1V6YA 2CXGA 4CVWA 1UD5A 1ZBKA 1WDSA 1BSIA 2XWDA 2YLLA 1EO5A 4AZ5A 4F9JA 4NI3A 1ZS2A 4UQDA 4W88A 4KWUA 3WFLA 5EFFA 2QHAA 3DYPA 3FNDA 4AEFA 2ZUTA 3ZT7A 5A6KA 3ARTA 1EHAA 2WVUA 3ZQ9A 1RPKA 4QDMA 2Y2WA 5I23A 3WD2A 1CXLA 1W3LA 3N13A 4AZHA 7TAAA 4ACZB 2VMFA 3PZNA 3SCNA 5HBFA 2F2HA 1V3LA 4U3AA 1QBBA 2ZUWA 2E8YA 3DHPA 1AQMA 2EBNA 2GJXA 4B9ZA 2E4TA 1ISVA 3TOPA 3WELA 4HZ6A 2WHMA 3CZGA 1SMDA 1PX3A 3AZRA 1HKMA 4W84A 3WEOA 4DWSB 3CO4A 1E0VA 4CU6A 2EEXA 3SUVA 3N1AA 1BYAA 2WZHA 4URIA 1V6XA 2XWEA 2GSJA 3WEZA 3RCNA 1DP0A 1RP9A 2W4XA 4PUDA 2ZXQA 2PBOA 3O9NA 3SEPA 4CCEA 4DUXA 2G8ZA 2WK2A 2PWGA 3VO0A 1CDGA 3N11A 5CXPA 1K9EA 4LYRA 4GINA 4HZ8A 4HA3A 3T09A 1BYCA 2A3HA 1D2KA 5A8QA 1GW1A 4KGLA 1JNDA 1GORA 5A1AA 1E73M 4PMUA 3SCSA 1PJ9A 1UD4A 3MV01 3ARVA 2YOCA 1EDTA 1XSIA 2UY3A 4V27A 2YA1A 5GNYA 3BH4A 4Z2LA 1DWJM 3WQ6A 3AMGA 3VM5A 1H2JA 3VD4A 5D9MA 2BXZA 4IISA 3WNKA 3MO4A 4Q7NA 2CNCA 2D0HA 4PMNA 5GQBA 1JI1A 2B31A 4X0VA 2D24A 2XVGA 2XYLA 1DWHM 1CPUA 2VTFA 4JFSA 1KR1A 4MADA 1VJZA 1KFWA 2VT0A 2W92A 3CZ8A 4LYPA 5LYRA 4J3TA 5A6BA 3EYPA 1AVAA 3RO8A 2X1IA 1QNPA 1B30A 2FHBA 2CKRA 3FHAA 1EQCA 4AIOA 1BFNA 3WNMA 3DYMA 2XPKA 1UR2A 3UEQA 1UR9A 4LXFA 2E0PA 3B9EA 1GVYA 2OSWA 3BC9A 2VRKA 3NJ3A 2ZX8A 5BRQA 1ZBWA 4WSJA 1BLIA 3L4UA 3U5UA 2V3DA 2WAGA 4NZCA 1NH6A 4PMVA 1K9TA 1FFQA 2W66A 4CD5A 2V38A 2BVDA
chains in the Genus database with same CATH superfamily
4OHVA 1ZREA 3C0QA 4M6UA 1SHWB 5B4NA 2V9DA 3FAWA 2VNRA 4J6GA 4L92A 1M3UA 2QNEA 1COV2 4Z1BA 3MYXA 3ILRA 1AH4A 2D5FA 2QYGA 4P5YA 4Y9NA 3UNDA 3V35A 2X8RA 4OOUA 1GZWA 3W7NA 4O1EA 3KTSA 1UL9A 2D93A 4S3BA 5HQLA 2P3JA 5H6HA 1AYM3 3LXBA 4CP9B 1BXBA 3W1NA 3H7YA 4IQPA 2VUAA 1FKWA 2OW4A 5CGTA 1RSCA 1Y4WA 5LW9A 5AYXA 1RUJ1 2EIEA 1TZOA 4JN7A 1VMJA 1GNYA 3WG2A 1R1A3 2OZ0A 1ADDA 1IPKA 1OEPA 4K8GA 3W0KA 4KBBA 4LQRA 2HV5A 2HWE1 2QV5A 3NZ1A 1XIHA 5CPOA 3GIPA 4JC1A 3S9YA 4KRTA 3IK4A 1ESWA 1SMVA 2QQUA 1UWWA 3VGDA 4KH2A 4A3UA 4N7QA 5DMNA 1CX1A 1QNWA 1WMEA 5CAKA 4V15A 4BK9A 3H8OA 4RA0A 4LBRA 4L9XA 4CNSA 3PUQA 1VALA 4DWSA 1F6KA 1IKPA 3MJMA 1UUMA 1OLMA 3CASA 4XZNX 2O92A 3OHMB 3PJQA 3O6YX 5A7WB 2ETEA 4NY2A 1GWLA 1V02A 3VZYA 1C7SA 2J7EA 3E97A 3HEIA 4IV3B 5D30A 5A70A 3VAVA 1HV1A 3J7MA 4SLIA 1LCOA 2X1UA 1QK0A 1IF2A 3LU2A 4JIIX 5CG8A 1IXPA 4NE9A 1XWYA 3OODA 5L9FA 2VX4A 2R8WA 3A3WA 3QOMA 4NI8A 3AFKA 4RW5A 4O61A 2HBVA 5D04C 4COYA 1NX9A 1W8FA 5FK8A 4UNKA 3SISA 1GWJA 5HCFA 2PDFA 5I03A 3V36A 5FAJA 5FXZA 5FL1A 3CMJA 4MUPA 4CEYC 2RJLA 3JCIA 5FYTA 2WOQA 3LB0A 3IPVA 3ZPYA 3KHCA 1QO2A 2C5DA 1KM2A 3CUFA 3LHVA 4ZR8A 5M03A 1KM3A 3B00A 3AROA 3MSDA 2UY2A 3VOJA 3E12A 3IARA 1AJZA 1CXFA 3L0KA 4HPHA 1E6PA 4RL7A 2HVOA 4MB4A 3M0JA 2DVDA 3N3HA 3QD6A 2HXUA 5HJXA 3PWIA 4LXLA 5FZIA 2GAUA 1SJCA 4ZODA 1TZZA 1DV7A 3TMQA 3DGTA 3CU7A 3RYKA 1E1FA 5CSRA 4XISA 4C5ZA 1W3KA 1DJXA 3C2EA 4LAZA 4QGCA 4F0HA 1OKOA 4GRSA 3H2FA 4IXLA 3H7UA 2W1QA 3WH6A 4KF1A 4CEYA 2VC7A 2WR9A 1W04A 5FMOS 2P88A 3VFLA 2QCDA 4MGTA 4PLOA 4FSAA 2RMU2 3QV9A 1BVZA 1ECQA 4R4ZA 2AKMA 3KBWA 2LLEA 5FYCA 2J1AA 4A7KA 4UW5A 3IAPA 1XKYA 4K40A 4KMQA 4XJWA 2D6PA 1CGYA 1XS2A 1QJZA 2I14A 2C6QA 4PCRA 3C86A 1BG9A 5HANA 1F3XA 4JTEA 3NSNA 1FWAC 2HBXA 1QPKA 3NNTA 5CNAA 4GMP1 1PK6B 3HAGA 5FBJA 1TPEA 4PSPA 2BWAA 1Z6KA 2VC6A 4N9BA 4BA6A 1W9UA 1AR63 4H83A 2WLQA 4AE2A 3AKPA 2K2SA 3NV3A 5EMYA 3HN3A 4PHZA 5SV8A 5FMBA 4AQ2A 4A8NA 1VFUA 5FO7B 2AEYA 3FLRA 1YQ2A 3OEAA 1Q65A 3LHTA 4U5KA 1TA3B 2CZ5A 5FF3A 4QPIC 2PFHA 4KI5M 2QNKA 2WZR1 2A7NA 3UYIA 4G5DA 2BGSA 1BXNA 4D9PA 2WQDA 3T0AA 2DVGA 4LUYA 4WY0B 4HJFA 3PFRA 3GC2A 4C6QA 5C9ZA 1IWBA 3CLPA 2CLLA 4JX6A 1YQ6A 4DNHA 4NOTA 4A41A 1JPHA 2FCTA 3UR2A 4C60A 5I79A 2VVNA 1LOGA 1ME9A 3UJ2A 4CN6A 4BIOA 1PM4A 4AZ6A 5J09A 4XW3A 4QPIA 3OBKA 3BN6A 1F05A 1ODZA 4E2GA 5A6ZA 3P74A 3WEMA 3LEPA 3PJTA 4GH3A 4X9SA 4N9HA 3WQCA 3N04A 3O5SA 4KGGA 2G9ZA 4GJ1A 1M7PA 1OA4A 1DIOA 5C5TA 4KEMA 4LSBA 1ZZ7A 1LECA 1U5VA 5D8ZA 4N4PA 2VEKA 1E15A 4IPJA 2QCSB 3W3OA 4WOZA 2ZKNA 1DFQA 2E32A 3BICA 1I75A 3S5YA 4PI0A 5KR7A 2OWCA 4QISA 3PZ9A 2DUAA 3HBLA 3KUMA 3TN93 4CCDA 1ZBVA 4FLSA 4G9PA 1BF6A 1HXS2 3W27A 2DYCA 4NN0A 1B35C 3HIFA 4XFBA 5FO8B 1K8CA 1W0NA 2BXVA 4IG2B 3AXEA 5BNQA 2OPJA 4AFDA 5T26A 1ND3C 4IIEA 3WW3A 3PJXA 1AH0A 3UQNA 4LE3A 2D0GA 3OBEA 5H9RA 3XISA 2IXHA 1NY1A 3WZ0E 1PO21 2UBPC 4ZVJA 1H4HA 3R0RA 2LM3A 2HTMA 1UN1A 2IVIB 1IGOA 2V73A 4XZLX 1JOPA 3ZS4A 1MZEA 3GUWA 4IESA 1R3TA 1B35A 4ZQNA 5T3NA 4JPGA 5BNNB 4WF7A 1OURA 5M0TA 3AKTA 3FV9A 3W7JA 1H41A 1ND3A 1XC6A 2XJRA 5J7MA 4A44A 2DJXA 3MMDA 4IGHA 4E2BA 2VULA 5IRPA 2PZ0A 3S5ZA 1FWSA 1C92A 1LROA 2P8CA 3ORJA 4LBSA 4QXKA 1WXYA 3VHNA 2Y8UA 1NLQA 4YNGA 4LRTA 1H8TB 2WABA 3I68A 5FY5A 4FPFA 1NZCA 4BYYA 3N6QA 4NL1A 2XGXA 3M7AA 4I01A 3UA3A 3SADA 1VBE3 4ZSTA 1LL6A 4RHV2 5F1VA 4C6KA 5DDJ1 4GQ0A 4UR9A 3H1YA 1Q8PA 4H7LA 2VCMA 2J4GA 3TWAA 1CAWB 4L9BA 3RWNA 2GVEA 2Q01A 1RY0A 2Y85A 3C2VA 1CJPA 4XKMA 1AVBA 2VMIA 5JPNB 4AB4A 4UTFA 4QQ2A 2R1LA 2C0HA 1KFLA 2OOFA 3OHIA 4A29A 1D0GA 3FJ4A 2GUBA 1SJAA 5H8UA 3VKLA 2BOFX 4H4IA 2VURA 4EX4A 3W28A 4QQUA 5K9YA 1O4YA 1WZAA 1HRV2 4IEXA 1RVKA 4A6SA 5KXEA 4Y7EA 2Y61A 4EANA 5CC7A 1XLLA 4CD8A 2F17A 1JAKA 1DJYA 4OKDA 1AXKA 1JXKA 2PRMA 2GU9A 3ZXGA 4WUIA 2QJMA 3GZUC 1Q2SA 3ZSEA 4BB3A 3IPWA 1K9FA 4RDZA 1YE6A 1POQA 4AMCA 1QPNA 2TYSA 5D03A 3WHTA 2DBIA 5LK5A 3NMBA 5EXOA 4E2OA 4YW3A 3T2OA 1A34A 3OZPA 4R88A 3VDBA 4LK7A 5A6QA 1XQNA 2WANA 3W53A 4I3GA 4GLEA 1ZVFA 3AU2A 1EP0A 3B4YA 2FZ9A 3L66A 1H60A 1VYSX 1VB4A 1ITCA 3E2SA 1Q85A 1TPVA 4ONUA 2Q8ZA 4L6HA 1TJ0A 1IZJA 3UYJA 4ZHNA 1BMV2 3PULA 1DBNA 4FAMA 2QUNA 3NL6A 6TIMA 4QX7A 3MO7A 3RDIA 4LEQA 3N4EA 5FEWA 5I06A 2JE8A 5CJ5A 4NNAA 1PGW1 4HBNA 2HWC1 4HCHA 3W87A 1G86A 5JH1A 1P7TA 4D72A 1RK6A 3MIEA 4KH9A 1UP0A 8CGTA 3R11A 4EOUA 2QCEA 3REQA 5CBJA 2J9XA 3T8QA 3OJBA 4LOTA 4XAGA 3B05A 3W1LA 2YROA 2PLKA 1V6IA 1V0LA 5K3VA 4BEQA 3S47A 2BXYA 2HWD2 1CPMA 5C8WA 4O1CA 5F3GA 3ZYGA 4HNNA 1FT9A 3D46A 1PMIA 1ZB5A 1EAH3 5FBZA 5LIKX 4IGMA 4XJAA 1ZTVA 4MF4A 3QSTA 3R94A 1D7KA 4Y2WA 3K2OA 1XQLA 3ZLIA 4HPJA 2OEKA 2AL2A 3MHFA 2ZC1A 4ZPIA 4I7WA 4HQVA 1UD6A 3DEMA 4QU1A 1RLDA 4Q5OA 2A85A 5CPTA 3RLGA 1VBE1 2GDUA 3B01A 1P0DA 3GD6A 5BNPA 1K8XA 2OWWA 3WQWA 2QUMA 1BRLA 1TPB1 4YM1A 2PGFA 3B9AA 3AIQA 4CCOA 4QR6A 3ITLA 3L2LA 4MHRA 3KRZA 1LLZA 1UJPA 3QKZA 2J7HA 2NX1A 3SSJA 3VINA 3M0LA 5D1IA 4IPNB 2FFCA 3UNPA 1ZCCA 3I8TA 1JF5A 4JTDA 1WP6A 4DVOA 2C18A 2VEMA 2C14A 1PDZA 3EOSA 2WYSA 2XL7A 4W6XA 3GBDA 3LNMA 4LUSB 3M44A 3SFWA 3VYLA 5IK8A 3WINE 5A94A 3TH6A 3T1MA 3THDA 5F5QA 4RGKA 5A3HA 4HA0A 4LCQA 4FALA 1W1A1 1XNAA 1MQTB 5JOYA 1I6NA 1AZ2A 4L4PA 4B3ZA 5C2CA 1MR5A 2PDPA 4ML9A 5ABFB 2V0TA 5KXBA 2FDMA 1H7XA 4TX8A 3POFA 3G3DA 3F4CA 2CYFA 3N2MA 1E9ZB 4HK7A 3G1SA 5EMUA 3VLBB 4LEFA 4XZIA 5IYYA 2HK0A 5GJNA 4GH4B 5TSWA 1UQXA 5LHFA 2A1XA 2XJUA 1UC5A 3SQSA 4QSHA 3BV4A 3W85A 1TZ9A 3TMLA 4PMYA 3MZHA 2DH3A 4HOWA 1T41A 1S0FA 1J1LA 2R061 4Z2JA 1MQRA 2J7DA 3W71A 3BJSA 1WD4A 1WMXA 1QI4A 5ERLA 3AKQA 3KOYA 2HS6A 1XG3A 4GFIA 3O1TA 2B8MA 4ZO8A 4ZU4A 2DEPA 2E31A 5HNTA 2Y8KA 5A6MA 2R0HA 4Z2GA 3TW7A 4O54A 3VB9A 5AHMA 2ATSA 1N3QA 1XYZA 1CD3G 3I7SA 2GVYA 1WLCA 3NZQA 2P37A 4IEUA 3AICA 4AYUA 1JD7A 1DQ4A 1QEXA 4AI0A 5IJRA 3RFRA 4KU8A 4B9YA 4EAYA 2VBDA 1PKYA 3UWUA 2P50A 5KWRA 4UZSA 4HSLA 3LWCA 4ATDA 3R89A 4W6YA 2DDXA 4US5D 1Y0EA 2MPFA 3PWAA 4G9SB 3U2EA 4HN8A 3W29A 1JUBA 1EAH1 4DBSA 1F5JA 3HQXA 3RGBA 3EEGA 4MWAA 3E6EA 2HYKA 2FHRA 4ZONA 2ZGQA 1AUSL 4M0XA 1OHFA 5FPAA 3HV8A 2WXDM 5LSMA 2XGBA 4M8UA 3ZYHA 3TUUA 4XVHA 1LRTA 1V6VA 4ZXOA 2OYLA 1OOPB 2DZUA 2TMDA 1NXD1 1SO3A 1P6BA 4BQXA 5A8MA 1R86A 1TMLA 4LJ3A 1LBMA 4J28A 2GC2A 3GTHA 1Q6OA 4P8XA 3SIZA 2ZWYA 3HG4A 5T8GA 1NWRA 5F2WA 1S2EA 2Z1SA 1JHJA 4LJHA 3SUSA 1ND2B 2VCCA 4I5XA 3W70A 4QCFA 1GVEA 5K0UC 2HWF2 3R7MA 2VZVA 3AM2A 4IIBA 1JDCA 4K9SA 1ENRA 2RJ2A 4N43B 3F95A 2ZRUA 3SUTA 4MYAA 1IEIA 2DFCA 4LKFA 1H63A 1K5JA 3IUIA 1FY6A 2D6MA 2J7FA 3I4EA 4LGXA 2C7FA 1TIMA 4JCLA 4I9JA 2QQIA 4AF9A 5IHSA 3WDPP 5F3CA 4AMAA 1PXGA 2YCLB 5FFOC 5IDIA 1LL4A 4GO9A 4PTMA 4O12A 4YGBA 3S6PA 2GUUA 1BEV2 1XGZA 4W8AA 1TV7A 2RM23 1OCNA 2CZEA 3FMGA 1GYNA 1IWPA 1YMYA 1JU3A 5AYZA 5FKYA 3LBCA 3RZHA 2PTWA 2ZGKA 4Z2WA 5C3QA 3BAIA 4PRRA 2ZTNA 3DGBA 4Z1AA 4UI9L 2ALRA 4UFLA 3TZNA 1TTJA 1J10A 3DG7A 1N1TA 3MCOA 1DXEA 4TQTA 3NYZA 3KM8A 4HMDA 4UTTC 1LKNA 2RG4A 1WOBA 2PA6A 4FAHA 3S6OA 3OZYA 3NKTA 3VOFA 2UWCA 5J5DA 2PDQA 3VZOA 1IWAA 1AX0A 1LRHA 1QCWA 4I6KA 1PTGA 1M7XA 2RDTA 4L65A 5JR7B 1UPPA 4ZO9A 3W2JA 1W5QA 2FPVA 4OOZA 1K6WA 4LBLA 4E4PA 1W6OB 1KR0A 2NV1A 4XK2A 1TO3A 3W21A 3WCRA 2P0OA 3MWAA 1WD3A 1RUH3 3MW3A 2AOSA 4WZHA 4WEVX 3TCEA 1VJSA 3CTTA 5KXCA 3VDHA 5J5RA 1KFEA 4OV4A 3A7QA 3M1HA 4O53A 5ACA3 2H8XA 2BOEX 4CCNA 1U1JA 4D8AA 1W5OA 3R8GA 3CU2A 1WLDA 5CGQA 1PZ2A 4BE3A 2HK1A 4G7EA 1T96A 5GPRA 1WXJA 4XV0A 5LXXA 1RBOB 1W2VA 4Q4Y2 1HX6A 2DU0A 1SZFA 4P9WA 3FA5A 3R12A 7PTDA 5LB6A 1V03A 1JBCA 3WR0A 1ULDA 2X7VA 1S3HA 2IXKA 4FOWA 1FBAA 4TXWA 2XKPA 1PZ1A 4QXCA 1BYHA 3PC0A 1OQDA 1GEHA 2O7QA 2PMWB 3JB8A 1YI7A 2DVAA 1GONA 4HZMA 3SO7A 3B06A 1W2AX 3VDAA 2H9AB 4CEXC 4CSWA 2VZUA 1FTXA 3EMRA 2CU0A 1RMU3 1HFBA 1SFSA 4IP5A 2YBSA 3PN8A 2PDWA 3RRXA 1HKDA 5LBFA 1DORA 4ORFA 1ONXA 3GDKA 5C0QA 3EWDA 5FZKA 2HCVA 1Q7ZA 2OTDA 2Y6JA 1W06A 3F5JA 4JY8A 4NZ3A 3N18A 4GZEA 1KGYA 3ES7A 5CZTA 2P1BA 1LEMA 4E3TA 1Q6LA 3PPCA 4FCAA 4AHWA 3IIAA 3WH8A 4Z8BA 3EB7A 1V08A 4LVAA 3W1MA 4KIRA 2PWFA 1XM3A 1RY8A 1RUF3 1TWSA 5JXIA 4R7JA 2BZNA 4LBNA 1VEPA 1O3SA 2CITA 3GU2A 4QP0A 4QWNA 5I78A 4A3XA 3QACA 1RJ7A 2W68A 1JDDA 5G04L 4JXCA 5C71A 5T5JA 4KFPA 3C61A 5A1LA 2RM21 3MA8A 3OZMA 1V51A 1OBNA 3AMDA 2Q1FA 5T50A 4M29A 2Y4SA 1ISZA 3GS6A 4JIEA 4AZGA 3FBYA 5EJ3A 5EP9A 3PJYA 1GQKA 4F7ZA 1IS5A 3OEBA 3E0IA 4LBQA 1KBBA 3T4WA 4CVUA 1VRBA 3USUA 2BU9A 3BGGA 1YQCA 2FMYA 1UOKA 1W9BM 1O4TA 3CM4A 1YPXA 4XFCA 4J7RA 5J1XA 4RXGA 4B91A 1VE0A 3RX4A 3ARPA 3H7VA 1CZVA 1WDDA 1J58A 1O7FA 5FL0A 4S1FA 5ABJB 3GAYA 1UU4A 4DO4A 1JYXA 4JN6A 1GYMA 2ZVIA 3QMTA 2R1BA 1OHLA 4IGPA 2NQZA 1KDMA 4D1IA 3EGJA 3C6CA 7ENLA 3N7MA 3TTSA 1WZLA 5ACA1 2O1QA 5DG2A 3S8HA 4K3ZA 4ZENA 3SQOA 4M3CF 5L9RA 1SW7A 3EJKA 1DWFM 3JD73 3ETPA 1UB3A 5CEWA 1OB0A 4YIWA 2RDRA 3V75A 1FMD1 2OXBA 3QYSA 3VN4A 2Q8EA 3WLJA 1F5ZA 3W2MA 2RS52 1NY71 4TU1A 1BKSA 1PDYA 3VIIA 3SCTA 4GZ9A 4E9KA 3H6OA 1LOLA 3TW6A 3IV3A 4DB5A 4PL1A 2V5DA 4CQ9A 1ISWA 2I56A 3H21A 1MW0A 4W86A 1I2PA 3FWEA 3YPIA 2I5QA 3SIMA 1HJUA 3LLFA 5AC8A 2XLFA 3TNOA 3L4XA 1LB2A 4KWVA 3G8EA 3H50A 3CHCA 4UC5A 1OT1A 1RUC1 3LZZA 3KCLA 1JDFA 4Q27A 2OGJA 2OVUA 1W1PA 4HZ7A 3M5ZA 3CAWA 1TELA 5D33A 3EX3A 1Q4NX 3DFPA 4EV0A 1PB0A 4RKAA 5H2ZA 4XF9A 4K3UA 1F15A 2REQA 1H5VA 3EPOA 1O5LA 1GMMA 4W89A 3M3QA 4ADSA 2FZ1A 2Z24A 1GYLA 1OZMA 5LA9A 1UR0A 1RVGA 1G9AA 2JDAA 1NJJA 1XLGA 1OFRA 1L6GA 5BXPA 3PZOA 4HU4A 3LV6A 1PGL2 1EXBA 3QFEA 1VKFA 3PMSA 4LUTA 3CBNA 4QLKA 2V2HA 3V5FA 3GXIA 4JTAA 5GNZA 2GK1A 3WK2A 1E43A 1J18A 3OYXA 1O5RA 3NV4A 3H2EA 1XYMA 1NWTA 2BBFA 2BNJA 1YWKA 1SLTA 3TVAA 2Q8OA 3WV6A 2POZA 5FPUA 1W8HA 2QIIA 4MJZA 4OVXA 4NU7A 3NSXA 3UJRA 5JVLA 2HPMA 1JTZX 1UU5A 2FZNA 2JEPA 3PVOA 4NF7A 3R05A 3BI3A 4IWWA 4DZGA 4S39A 1BXHA 2RVAA 1NDVA 1DTNA 3UKTA 4XD5A 3KBVA 3PUAA 2D2HA 3INPA 3N14A 3VHPA 3ZFFB 2X5IB 3R43A 4YHGA 2G19A 1KLYA 3ITXA 4OUIA 3SCVA 4LY4A 2EXHA 1RUI2 4IW3A 2Y7GA 2GZXA 2PHUA 5AYYA 3W7OA 3BCWA 2QDHA 3MKCA 2OVLA 3O2LA 4HN0A 2GJPA 1OCQA 4QTGA 2Y7FA 5CC3A 1G4TA 3ZPOA 1SUXA 5REQA 1IPSA 1J01A 3EO6A 3KLSA 1W8UA 4CDWA 5JOWA 1K1DA 1T8QA 4QNEA 1H1MA 4JQ1A 3QR0A 4QQ3A 3DGRA 4P7OA 1W9WA 1YIFA 4Q4PA 2R073 3KT7A 3SITA 5M5DA 5T5LA 4DRRA 2R16A 6A3HA 1OF4A 3D47A 4AWDA 3AZXA 3DFQA 4GJIA 3WDVA 1MZ6A 3BQ6A 1QJY2 5H8MA 4M7SA 2W2IA 1MNSA 3B04A 3GX9A 3WQ8A 3IIOA 4AUBA 3M7SA 9CGTA 3VZMA 4K7VA 5HXVA 5FYVA 1H61A 5DCBA 4GAZA 1NT0A 3VKMA 1U0AA 5KMYA 1TE1A 1C29A 4O28A 1OI6A 2HDJA 2ZZ1A 5A8PA 1STMA 1RJPA 1E3ZA 2VP8A 3WLHA 1OUSA 4IPIA 2V68A 5AC91 3NPVA 1PPIA 3KAOA 3GU9A 2GP3A 4YWAA 2YC2A 4EN6B 3HG3A 3VNDA 5A6YA 4NIIA 1B3ZA 5HATA 1G9CA 4YVSC 1V4YA 4GPNA 1JYTA 2R1MA 1KD0A 1CAUB 1FOD2 1UUOA 5FJJA 3I6RA 4M1BA 7REQA 1LBLA 1UOJA 1EO7A 3X29B 1Q8AA 1DOSA 1NM9A 2QQNA 4FP3A 2G5WA 3N2OA 4Q8NA 4ADUA 4F2BA 4ORIA 3IWZA 1LWHA 1SEFA 2JJ6A 3EZ4A 4HA4A 3NOEA 3PUIA 1LQ2A 4GYFA 3KE0A 3AISA 3PTKA 4YVSA 4B5VA 4S3DA 2DF7A 1JCYA 3F5LA 5AHLA 3VKDA 1XF0A 3WJYA 1JEZA 4GMEA 1E5NA 4RZ5A 5EMJA 3SFKA 2F84A 1V93A 1J8VA 4GYKA 4XQWA 1EWDA 5A7PA 5A3OA 4CEWA 3CV7A 3PJUA 3MI8A 1VHCA 3CJIC 4H3WA 2XFFA 4CUBA 1A80A 2ZC8A 2A0NA 1IZKA 1NTHA 3GYCA 4PA8A 4O52A 1GHRA 3GHRA 3DC0A 4DZAA 4FTEA 3VDDB 3KL0A 2J1EA 4ZB2A 3CIXA 5LBEA 1MZRA 3EBRA 2WWDA 4XUPA 3OIXA 1RJRA 3AALA 4AFMA 4KQ7A 6REQA 3UK9A 1JS9A 3S1WA 4D6CA 2X0YA 1E6XM 2VHLA 2J7MA 1QOTA 4WHBA 4BA0A 3CJIA 2KZHA 3MU7A 5A3UA 3GWQA 4S2FA 1Z48A 5IK4A 1SU5A 2PHFA 1J0IA 1O3QA 3UPMA 1I8JA 4B5UA 1ZNNA 5FJOA 4H9TA 5C8CB 4C6BA 4FMVA 4RX0A 4UF0B 3K1GA 4B7EA 3WW1A 4E8DA 2WCSA 3M5VA 4C5YA 1VBB1 4N7UA 1W31A 3TOJA 1QATA 3GUGA 1M9HA 5G4WA 4Z1CA 2OLSA 1Q63A 1EUUA 2QJHA 4MFEA 1KGUA 4BEUA 4ZQCA 1KLZA 1URXA 4HPXA 3WK0A 1DYKA 2FJUB 3KFTA 3U75A 4A8RA 2J22A 5JZGC 4AZCB 2R071 1J0JA 3PJWA 1AG1O 4AYGA 2BRTA 4X8PA 2Z1KA 3GBGA 1A78A 2O7SA 1HJWA 1XNKA 3LCXA 4PI2A 1REQA 3CHFA 4IMFA 1LDCA 2BP1A 4TZDA 4NIAA 3M4FA 4NVPA 3RI8A 1IT8A 1I2NA 1T7LA 4G2DA 4CN4A 1I0DA 1U30A 1UIKA 2PF8A 2J24A 2EPLX 4NJKA 3G1HA 4W87A 4H7VA 3WQ4A 4AG4A 1J0HA 2WKKA 1FFRA 3CWNA 3WMSA 4XMIA 4DINB 1R9XA 5JZGA 1RB8G 2FB3A 5C7GA 3AYRA 2X0SA 3ST7A 1RYYA 1D7FA 1AL22 3NV2A 2X53S 5KHHA 5CZ0A 4YM0A 3E0WA 3WJWA 4JHTA 3EX2A 2ZGUA 2VXNA 1YNAA 2WSVA 3KXQA 3BOFA 4FTBA 1J79A 3LB9A 2E40A 3UZWA 2NQLA 3DAQA 1VRH2 4KCWA 1DQWA 1SPPA 3MIDA 3VTRA 3FJ6A 2CLIA 3BKZA 3SJNA 1RUD2 3RXZA 3UWYA 1QT1A 1VB2A 5IWFA 3OLEA 2BQPA 1ZBA3 4HNCA 1W5MA 1KBLA 3KVBA 3JS3A 1I5PA 4GQRA 1HL8A 2BHZA 1DJHA 1OADA 7ODCA 3EWZA 2NQJA 5DY2A 3C2YA 1KDKA 3RJXA 4XJZA 3BSGA 1E0WA 1I1EA 2X05A 2CLFA 4J35A 1E1CB 2VYOA 3QSRA 2A2IA 3NO3A 3OQEA 1EV12 1H09A 5E9XA 2XGZA 4HYRA 1UPSA 3C3NA 4E8GA 2UY9A 2W08A 1R9ZA 1FV3A 2XKOA 3CPRA 1PWMA 4QHOA 4IQJA 4JD4A 3N9QA 4RGAA 4ZTXA 4LBMA 1CIUA 1P48A 4RE3A 1HB1A 2WFF2 4FIRA 2VTXA 3M0YA 4UFIA 4ZE4A 1TCDA 4XAZA 4DUWA 1NU5A 2YXGA 3MVTA 1CZTA 4G4FA 4GQ7A 2B7NA 1KXQA 2A6ZA 2WZPP 4AHYA 3W7LA 4KWJA 4LPLA 5LBCA 4FOUA 3WDJA 3TP4A 2VGGA 1SO4A 2YL8A 4DPNA 1HUVA 3W6LA 3I59A 1VLIA 4JOMA 2F7FA 1F35A 2QF8A 3H8UA 1PZ7A 4F0SA 3GZTB 4IICA 2YC4A 1RCOB 4IEVA 3UERA 3PU3A 2F6KA 3GB6A 5IVBA 2QQPA 1E5HA 1M03A 4IQEA 4KIEA 4JIRA 1W9TA 1GOIA 3UGGA 5I6SA 2NXHA 2ARBA 5KXDA 1XIFA 2C1IA 5J36A 2IUWA 3MMUA 4XCBA 4EACA 1US3A 2J78A 3ARQA 3IRSA 3PHAA 3MHZA 1UH4A 1XYLA 2PCQA 1BWLA 5A8NA 1MEC3 3HGOA 2CBUA 4V33A 2VPVA 4ZY9A 2YCJA 2ZGRA 2RR13 4P9LA 3WD1A 2JD9A 2VFGA 4I8YA 3WBEA 2FZMA 1V3IA 5L7OB 5TNVA 2W1SA 2DCJA 2WCGA 2BNNA 2VBBA 5ECUA 5KITA 1AR73 1W3TA 3VL8A 5IK7A 1I1XA 3V5CA 2BNMA 3IDEA 1ST8A 4IGQA 1OC1A 3FVDA 1AHSA 4TV6A 4BI5A 3N15A 1M65A 3H24A 1OGBA 3CYJA 1JYIA 1W6MA 4REQB 3WBAA 3M5YA 3GCXA 2P8BA 2ZX3A 2O4QA 2R94A 4L61A 4WD0A 4XCAA 4TOQA 4RW3A 2QAFA 1VAMA 3TZFA 3R8HA 5E6ZA 1K6AA 3ITCA 3OA3A 4QDSA 1TWIA 4PL2A 4YRDA 3R6SA 1GOMA 2W0XA 1H0BA 2WNOA 2X0HA 4KWSA 2R91A 1D8CA 3C8FA 4LHKA 4LC8A 3GC4A 2NLYA 4ZOBA 3RIKA 3MY9A 5LNSA 2HXTA 4MHBA 2PEVA 2F9RA 3IRDA 4Q8QA 2ZHKA 3OYZA 4JVAA 2VUCA 5FY0A 3N73A 4FXFA 3PNAA 1FX5A 3H9AA 4FEZA 3ACGA 2J13A 3U7VA 2IWGB 1MS0A 5CZJA 3QZ6A 5L6UA 4LB3A 1WQ5A 2Q02A 2HWGA 2WS92 2AEZA 2D98A 4FSJA 2ZGSA 3UZZA 1TREA 4Y5Z0 3PUDA 4L97A 3VGBA 2KR2A 1SO5A 2CY6A 4IUGA 3T1LA 2J9YA 2A1YA 4AD1A 3ITYA 2ISSA 4GIAA 4PCTA 4KS0A 1XCXA 2FBEA 1QW9A 2EG6A 2WVTA 1W8OA 1BQCA 2F6UA 4IGOA 4XD6A 2WLPA 2OJPA 1ENUA 5KSWA 4RR4A 3KOWA 2ZX9A 3VD7A 1AYM2 4QPGA 2ZWZA 4XD4A 4GB31 2VW0A 4H6RA 4XKYB 2GOKA 4OWGA 2WC2A 2BHYA 3UKVA 4J3SA 4WV8A 1C8QA 1GNHA 2WLZA 1I3HA 1MUMA 3I2DA 2OO6A 1UWRA 3SCHA 4HHLA 1R1A2 3L4ZA 3RNDA 3FEQA 5JSOA 2WNEA 2NLIA 4J5NA 1J5TA 4GA9A 1A50A 4GJZA 1AH3A 1KXTA 3GTNA 3NAPC 5D05A 1AK5A 1WCSA 4FF5A 3RZGA 2QXWA 2E53A 1I4NA 3KDNA 1CW2A 4EWAA 3IJ9A 5D9NA 3HPNA 4BCEA 1MEC1 3RM4A 2WKJA 3GDRA 2GP5A 2B42B 1LHOA 5DXXA 3W9AA 1C8YA 2D44A 1UAIA 5EWSA 3ETQA 1LF1A 2LROA 4N42A 3APBA 2FYMA 4IEPA 4RFRB 1WPCA 4JQAA 4XTMA 3DERA 4GNVA 2ZEWA 4YN5A 3NAPA 4GVFA 2ZZ7A 1J6PA 2XQRA 4ZZ8A 1QMLA 2XDVA 3NM1A 1AR71 2VUNA 2WO7A 3EMCA 2V2CA 5FACA 4H1ZA 4AZBA 3M41A 5A80A 5T52A 5I09A 3O05A 4D6EA 1YIXA 2JE7A 4J1OA 3M6YA 2ATMA 2O9OA 2VUDA 4GALA 1IQDC 9XIAA 2R14A 4F8XA 2G9GA 4MNJA 3N7KA 5I00A 4YTTA 1QQP1 3RITA 1KV8A 2VC9A 1V6YA 2DUZA 1ZP4A 4KU7A 1V6OA 1ZBKA 3VI2A 4COUA 2QEZA 1S55A 5FPZA 2QAPA 3OVQA 3HNBM 4N2YA 4PUJA 4UTWA 4PUMA 1ZS2A 2Z42A 5FWEA 4W88A 4GUGA 3G7DA 1EJVC 2QHAA 4JX0A 3NNGA 4O13A 4ZU5A 1TJ2A 5A6KA 1UX7A 4NAFA 5HCAA 1IR1A 5LCWL 1UIPA 1HO4A 4BKNA 2QVSB 8XIAA 2Y2WA 5HAOA 1CXLA 3CV1A 3WDYA 5F1UA 3F2CA 3N13A 4FX8A 2ARAA 1REDA 5FYIA 4ZOEA 2QJJA 1UCWA 4PF5A 3DHPA 4ADTA 3KP0A 2WV8A 2EBNA 1H9PA 1ISVA 5HULA 1NE4A 3TSMA 2WHMA 2NXGA 1E5RA 3QOPA 1NIUA 2CGNA 4LVFA 3W2LA 5GLTA 4DWSB 1YJKA 5D37A 1TPWA 3SUVA 3N34A 4HJWA 4H8NA 2WZHA 1AR62 1V6XA 1NE6A 1TV4A 1HO1A 4IEQA 2GSJA 2YFOA 2X42A 2OZJA 1R093 4GWEA 3IDCB 2WNUC 1UY2A 1XPYA 3U4FA 4PUDA 2X8KA 3DN5A 3O9NA 5TF0A 1EUAA 3R5EA 3F4NA 3WQPA 2W79A 4ZZ9A 3S1XA 3N4FA 3UCDA 2GL5A 1EZWA 3KOXA 2PUZA 2QBXA 2NQ9A 5A33A 1Z0HA 3S4TA 2X40A 1ZX5A 1W2UA 1I60A 2DVXA 1JRCA 5FOJB 4X61A 1O5QA 2HJIA 3OVPA 1L2QA 3RF9A 5A1AA 2WNUA 3I6EA 4BF9A 4ZSUA 2Z4FA 3IPVB 3SCSA 4Y5TA 1JMUB 1W3IA 2YOCA 1YPIA 5C9UA 2O8OA 3CL6A 5I0RA 1NA1A 4GC3A 3CT7A 3BH4A 1KM4A 3ZSJA 3WQ6A 4GIQA 3VD4A 5D9MA 4LE4A 2D43A 5T9BG 3BYWA 3MO4A 2ZMLA 1W28A 2R6OA 2CNCA 2Q30A 2BDRA 4ONVA 4RN5A 4PMNA 3QH2A 2WN3A 2HBUA 4JDOA 3P1IA 4A42A 2B31A 3LSEA 4OLLA 1R38A 2V72A 2TNFA 1CPUA 1SZGA 2JG9C 2FDSA 3L68A 4JFSA 3PY2A 1KR1A 1VJZA 3P2VA 2W92A 1KFWA 4LO4B 5JVVA 5BNOC 4RV3A 3S9ZA 3CZ8A 3BOPA 3KF3A 5JI7A 1WLWA 3C2OA 4XZUG 1HKVA 5CFDA 4Q8UA 4AX6A 3TN92 4ZTYA 4CP0A 3SH5A 1H2MA 3BPZA 1BFNA 1J5SA 3SY8A 1UR9A 1XUZA 1EC9A 2E0PA 3OBTA 4HXCA 3USZA 2XHNA 4NZFA 1GVYA 3ZFEC 1A5SA 2GN3A 3GBFA 1LUCA 4TR9A 3NJ3A 1VH7A 3T9PA 3JBG3 3DX5A 5BNOA 3RRDA 4C65A 1BLIA 1HQWA 1QDOA 1SJDA 3RX2A 4Q8VA 2DCTA 4PMVA 1K9TA 4CD5A 3MDWA 4CP1A 3W7CA 5FAXA 4M0HA 3J8F3 4JX4A 2WO3A 2GN7A 4YTUA 3EKGA 2Y5EA 2A75A 4NRMA 2YIHA 3LFMA 1XG4A 1FDJA 4B92A 3B8SA 4HU3A 4S3KA 2J6VA 4GI9A 5JH2A 3KRUA 4O15A 2PP3A 4NZ1A 5FQ0B 3UY7A 4AFBA 4QAIA 1GOGA 3W2KA 1FWJC 4ZOAA 4N0RA 1MEWA 2D7FA 4HNTA 1S5NA 1XJBA 2OLAA 1XKJA 5C7HA 2AQVA 4P9XA 1EFZA 5CAZA 4Q4X2 4LTAA 3WMCA 5FZAA 4JAWA 4IV1C 3OGJA 4UFKA 4DN1A 1LWIA 3O6DA 2YW3A 3MUIA 2NV9A 5CLTA 1ADOA 2Q4SA 2PAEA 4HPNA 2WQ4A 1OYBA 3NQGA 1FQ0A 5C9AA 4EPKA 1J83A 3RM9A 5HPCA 1MS5A 2BOIA 1M04A 1GQJA 4XVDA 2WL1A 5A3TA 3T78A 2HEVF 2I9EA 4LHNA 1QJU3 2VCBA 3A4AA 4QKFA 3VZJA 1VHNA 2JBMA 4H9MA 4LO8A 1B4EA 4Q22A 2JK2A 1BVVA 1UMHA 4DHGA 4LAMA 4IV1A 4BF5A 1IIHA 4Q4SA 3B93A 3I54A 1JZ4A 2ZOXA 4XHXA 1FWDC 4WM7C 1R46A 1VBRA 2J8GA 3CAVA 4K36A 3ARUA 1XLFA 3HG2A 2EXOA 2EPOA 4K2SA 4ATEA 5A3PA 4NJHA 4LHSA 1J2WA 4CCMA 3S9IA 1N1SA 4XIAA 4HK8A 1OC6A 4GACA 5JBFA 2BERA 4QQLA 3KS5A 3LI0A 3M9YA 4IMDA 1ULCA 4I30A 1XGEA 1EPVA 1GP4A 2D97A 1RCXB 1SACA 5FCZA 1CGXA 3UZYA 2LS6A 3GJBA 4Y22A 4V1XA 1G1YA 3MKKA 2X2GA 2ZZ3A 2EAAA 3ZMRA 2OFJA 1PVC3 4ES4A 3TN5A 3VBRC 1UA3A 2VDIA 2AH2A 2DUQA 5DELA 4WM7A 2B9VA 3E3HA 3VBUB 3DENA 3EB3A 3T42A 1PEZA 4UTKA 1GQGA 1OLME 4N4QA 4N9DA 2OQ6A 2RDUA 1KM5A 4X6RB 1W6TA 1I9RA 2XZ9A 4P2VA 1V02E 4J3WA 4Y3OA 4N9EA 2AMXA 2BOJA 3SN4A 2A3YA 1SBDA 3O6AA 3ATGA 4GY7A 3PG8A 1ELSA 3TYAA 3HQNA 2E51A 4B16A 1CGPA 3BDKA 5BOFA 1WZKA 2WZTA 4CCKA 1W9SA 4TTGA 1JYCA 1T6GC 4GX9A 2XXZA 3WQ1A 4DJFA 2FB2A 3WUEA 1PAMA 1KWGA 3VX0A 5FDBA 1W0OA 3J8F1 2C16A 2L5HA 1KXVA 4C8DA 1A0EA 2BOGX 3EDFA 5F2GA 3GDBA 2YZ5A 3FZ3A 3P5ZA 3PUOA 5BMWA 1EAH2 3KZPA 2ZCWA 2YL6A 1YNQA 4ASLA 3OJGA 3T4HB 2NVAA 5EBAA 2WQZC 3BTYA 1WZXA 4ZQOA 3J9SA 3ZSKA 5FJIA 2YHJA 5AC5A 1ADSA 3ALQA 1FCUA 1XLJA 5I3KA 2H0BA 4O1DA 5FMDA 1OSGA 3AC0A 4D6JA 1DQ5A 3APGA 3UJEA 2XL9A 4RNIA 1WUVA 4JTUA 4Q4W3 4Q8LA 5EHDA 2NZLA 2E67A 4COWA 3V0AA 4GFSA 4AHQA 1FWBC 2WRAA 5FZOA 4FPJA 4PBEA 3W7DA 1K03A 3TLQA 2ZX5A 3RG0A 1JCJA 1Z7S3 1H62A 1D0HA 1MXDA 5G1YA 4C7DA 1BWKA 1WCKA 1KQYA 3U0ZA 3POSA 2JEQA 5K9XA 4FP2A 1NCQC 2BFUS 1DDLA 2PGRA 1RBAA 4E4UA 4H19A 5L9BA 3SCQA 4NILA 2VOMA 2JDKA 3I4KA 1DEDA 3MBFA 4HVRA 2PLMA 2W3JA 3GNPA 3UWZA 4BIFA 3CC1A 2E7FA 4MUVA 5DN2A 1TMF3 1CI1A 3RZZA 1FP9A 5FYMA 4DXKA 1C8M2 3IGSA 4YVWC 4Z0JA 1ONEA 3PANA 6PTDA 1WGPA 3M0IA 4GHRA 5H1WA 3ZM8A 4CNTA 2GMPA 2WBKA 5F37A 1US0A 2A71A 1GZGA 1LTEA 4CU7A 1P7TB 4IE0A 1IZ3A 5CFCA 3AWNA 2VEFA 5FO9B 3O1VA 1NCQA 2CXEA 1GKBA 5LIYX 4Y9MA 4BQYA 3REQB 4UBPC 2WNWA 3ZXLA 2Z26A 2CZFA 2JF7A 2ACUA 5CPLA 3FHQA 3CWHA 1XC4A 2A3CA 2Z2SB 4NPLA 3SGGA 1EJSC 1VBD1 3LDKA 3CMGA 4YVWA 4WDUA 4XAYA 4QPWA 3I2KA 3H2MA 2YZ4A 4K8RB 4OE7A 2AZ5A 4Q26A 4BQ3A 4NZ5A 1E5IA 3I6TA 2JDHA 1RVF1 1V6KA 3KLLA 4A21A 3WZ1A 4XFAA 2ZX0A 1U12A 4EN9B 2OX4A 1TME3 1ZNPA 3ARYA 1UD2A 2VR4A 1O5XA 2BHUA 1XL9A 1G9BA 2B4KA 3QOKA 1BBT1 3VC5A 3POWA 1N2VA 4L8QA 2E33A 4M6PA 3M7WA 1UW9A 4PZVA 1QDSA 2AL2B 1QI3A 1DWGM 4C6EA 1L6WA 3OYWA 3QW3A 1H6XA 2UZ9A 5AOUA 1KFXL 5BNPB 2ADEA 3FX3A 2B46X 1XH2A 3WSUA 4YW2A 3AP9A 4B3KA 2YW4A 3E02A 4Y4RA 2VQ0A 3CV2A 2XUCA 2P53A 5A7NA 2PGEA 3B8IA 5M17A 3NO8A 3W1PA 1EJUC 2H90A 3ZOIA 4H55A 2CLEA 3W83A 2V81A 2ZA9A 3ILFA 2AYHA 1HVXA 3WMBA 5DG1A 3S0MA 1G6CA 2E25A 1UWQA 1WW5A 3PIGA 3A4JA 1LL7A 4AIUA 3BVJA 3LSCA 1HQLA 5F4XA 3RILA 2PQSA 3GQYA 3PZMA 4FR6A 3STPA 3S5OA 4ZGYA 4RJEA 3CH9A 3N12A 3GU1A 1ENQA 5JSRA 3W75A 3O0KA 5DXDA 3MPGA 3QHNA 3QQWA 2V4AA 4Y96A 1YXCA 1UUQA 4FIQA 4B4HA 1TX0A 5DUXA 1JZ7A 3F7JA 3FBMA 4FPHA 4Q2FA 5L19A 2J7CA 1EHNA 3BLKA 5CISA 4JTHA 4JGZC 3LEKA 3BMWA 5E9AA 5J96B 3WT3A 3ZYFA 3W86A 4U36A 4AVOA 5EYYA 3AMKA 4BK4A 2MEV1 2ZVRA 1R0MA 3RMEA 2WZMA 3S6TA 2QCCA 1A0CA 1ZZMA 5FXXA 1VPYA 4CQCA 1OIFA 2Q3OA 5KC5A 3NG3A 1X97A 5LIUX 2XSXA 3CQIA 1VFSA 2RS32 4JN8A 5CBIA 1ZHAA 2YBVA 1KV5A 2ZKMX 2CAVA 4MGQA 3C3UA 1QFEA 2WNZA 4DXRA 4QJ1A 1MVEA 1B31A 4JGZA 3BOWA 4AEMA 1UWUA 1FPN3 5IK5A 1BSLA 3ZJ8A 1WKEA 4FPLA 4PDWC 1JCMP 4L9YA 4MUZA 2G3FA 2OG9A 3QR1A 3M2MA 3LGDA 3CHDA 4WDXA 3ACFA 4HCDA 3AIVA 3S0CA 1R083 2VD9A 2ZEYA 3BZGA 3L12A 3LQCA 1QY4A 4MG2A 3WMLA 5CA6A 3XIMA 1PNGA 4HETA 1YXDA 2W5FA 3LCPA 4Q8KA 1KCXA 4I90A 3G3MA 4HLTA 3MDUA 4W4ZA 4OI4A 3UU0A 3WUCA 1VBC3 1RALA 1YHTA 3G6LA 3MI2A 4L7ZA 4NAMA 4XUYA 4H8VA 1PKMA 5I3GA 1PZ3A 1SDWA 4M00A 1WLTA 4PDWA 4Z0SA 1WYIA 4DZIA 3VKFC 2ZRZA 3Q94A 3ZIZA 4UFHA 1LQAA 3K30A 4POCA 3UZJA 2VQTA 1WO2A 3Q8AA 4E4DX 4LS2A 4MWAB 1UQYA 3CB8A 5BRPA 2WNVC 1PIV3 4F66A 3VBHB 4WKAA 1R87A 1RUH2 4RXFA 2ISDA 4IIGA 5HJLA 6XIAA 2B5HA 3AHTA 4IF2A 4MNMA 1KS5A 4B90A 5ACA2 1ZRIA 2FTPA 1VMFA 1UYXA 2ZZQA 3JZEA 4JTOA 4DO7A 1OYAA 2NZ9A 1TE6A 2HEYF 5FPLA 3M8LA 3GHNA 3O12A 3S1UA 1PX4A 2BY0A 3QHMA 5ENLA 1A5BA 5AYIA 4E4FA 2WNVA 1ZZBA 1ZQ5A 2ZRVA 4HSHA 1REEA 2OCZA 4XUQA 2XN2A 3NZPA 1LOAA 3UVIA 1HJSA 2BLEA 1X82A 1GVFA 3KS6A 4WIWA 2E9LA 2VVDA 3ARWA 2E9QA 2DSZA 3RPDA 3U0HA 3NIYA 3TXVA 3VBOB 4JNMA 1JQXA 3WP5A 4TX9A 1WA6X 2Q6ZA 3MW2A 4G7FA 4PLNA 4HB7A 3VK5A 1K45A 2VGIA 5E1RA 2NQ5A 1RMU2 4FPGA 5JXQA 1KFCA 3U78A 3SGZA 6ENLA 3OPTA 1F07A 5DCEA 2TSYA 5CLWA 1JFXA 3KBJA 3TQVA 1MS8A 3WNXA 2DUPA 1RXOB 4LYKA 4JQRA 3VE9A 4PLMA 1NP0A 4IH3A 2GH8A 2YFNA 5FEPA 3NRUA 2AENA 3W38A 2FH8A 4A2SA 2P5BA 3C8XA 4Q6JA 1PO11 2WKGA 3L5LA 2B81A 1KJRA 4LEJA 1RUF2 4JL1A 3LOIA 4PEEA 1K7EA 3IGHX 3KMHA 2GMMA 4GG9A 3U4XA 4CNOA 1WOAA 1G4EA 2ZTKA 3C7FA 2MHFA 5C2XA 1LGCA 1J9YA 4Y1VA 3E74A 5LNUA 4BXSV 2FPTA 3N6JA 1BGGA 5FF0A 4AGGA 1RUG1 2D0FA 2XIIA 1QAPA 1DHKA 3IJDA 1FHVA 1X8EA 1OINA 3RJ2X 1S0CA 2YKKA 4Y5SA 4NROA 1CN1A 3A23A 5DY3A 2SBAA 5FZLA 1ZCOA 3W01A 2B7YA 3RZKA 3CO8A 3FYOA 4NXKA 4J3VA 2XOMA 4XFGA 1GOOA 4H9UA 1X7NA 4DS0A 1HVQA 4CDXC 3D8CA 1YBQA 3W82A 5APAA 4DY5A 1G8WA 3UESA 3SZ8A 3PDQA 1LLOA 2INEA 2VEGA 3KS7A 1W6NA 4A05A 3I3DA 5BXSA 4HL0A 3VIFA 2XBO2 5DT7A 2RFGA 4IFOA 3TROA 3KV4A 2FDFA 3P0XA 3PZIA 2UV8G 2PU0A 3OD0A 2ZFAA 5EPDA 1TX2A 3HFTA 1QHDA 4S3CA 1E72M 2GVJA 4CDXA 2R1PA 1LAJA 1XIGA 2YB4A 2ZS6B 3OGGA 5IAXA 3JD72 4DAFA 4XC9A 3HB9A 2J27A 1JJKA 1D4M3 1Z8AA 3M1ZA 4MNKA 2K0GA 3HBKA 5A6XA 1BK1A 3DN7A 3ZYJB 1ISYA 4AZIA 4W50A 5EJ1B 1OH3A 5DMLA 4QM8A 5U7SA 3EMQA 3O0VA 2KX9A 5E70A 1LOEA 4OMCA 4XZMX 4MLJA 1VJ2A 2BFUL 3CL7A 3WYZA 1JQVA 3POEA 2R6QA 5C4WA 1WKFA 3UR8A 1VBA3 3KVJA 2P2KA 3IIZA 3SW6A 5FYZA 1PKLA 2ISWA 1GOQA 3VNLA 1AX1A 1LOSA 4QGNA 4O8AA 5AN7A 3ZIWA 4OUMA 5LY1A 4QCEA 4HPKA 1DIDA 2NLRA 1EOMA 4XXAA 1G67A 2EIDA 3C8NA 1F8MA 3GHUA 3OF1A 4WXYA 4DEQA 4FOQA 2XHKA 2IUZA 1S5VA 3QM3A 3QV7A 1P0EA 1F4HA 1IEQA 3MMWA 5EY5A 2NMNA 1ONWA 4LOCA 4JGYC 3QN3A 1K3UA 1HRI1 4DUOA 3TYJA 3O1MA 1NDWA 4AGVA 4QBXA 5DT5A 1B5TA 2GDQA 1OFSA 1WKDA 3HG5A 4MWAE 4GYPC 4AH7A 3W59A 3N3MA 3WLKX 1J3RA 4QLLA 3UA4A 3PBGA 2BGQA 4LKDA 4OUEA 4JFVA 1UY3A 4R7WA 1OYCA 5F6KA 2P6CA 2ZABA 4PUWA 1XX1A 4JY9A 4XPVA 3T2TA 1XDLA 3DFNA 5KINA 2WT0A 2XH2A 5EA9A 3VZXA 1ME7A 3AX4A 1S5WA 1S0IA 2Y6FA 1MDLA 1A53A 1QWKA 5HI0A 4LALA 3KBNA 3TYZA 3V0TA 4D6QA 3MCMA 4L9ZA 3TAKA 3PB2A 4GYPA 4XTIA 2Y1HA 1RV8A 4AD4A 1I9CB 4FX6M 1NAEA 4BXFA 1XBZA 4JFTA 2HE5A 2ZE3A 5D9PA 4QG8A 3UZ5A 2QPSA 4YZ4A 1DHPA 4IFKB 3EXTA 2ZRWA 3LRMA 2AR6A 5CG9A 1ALDA 2F38A 4MX3A 5CCZA 3WVJA 1OG0A 1UOBA 1O59A 1VEOA 3B02A 4I6VA 4O57A 1EJTC 1C9WA 4BQWA 4AEDB 4CU8A 1LG1A 4I9TA 1R8LA 1B57A 3DEQA 4QQHA 1TVGA 4MJ2A 4YWSA 5A32A 1C3HA 1ZBE1 3SY1A 1ZP3A 4HHPA 1ASJ3 3N35A 4QB6A 4LQ1A 2DURA 4AVFA 5CPQA 2WJFA 3QLQA 3I7QA 1LRNA 1PBGA 4K39A 5HNRA 1UY4A 4JCKA 1S0EA 4DNMA 3PSVA 5LNRA 4YPJA 1UKOA 5FZGA 2YA0A 2WPBA 1IZCA 4UBGA 3AFBA 4JTGA 3BAKA 3I3BA 1CWYA 3K2GA 3CAQA 4XETA 1ZLPA 3GDLA 4JIHA 2REQB 3SRFA 1XSKA 4ARXA 4EP8C 5D02A 3LCFA 3ZMNA 2ZAAA 3SRDA 1HJFA 2BFGA 2R82A 1DU3D 1XYNA 3ZO9A 1Q8JA 5J37A 4GKLA 1RBLA 2ZX2A 3KD4A 3RSJA 5CEHA 4TVCA 1IT7A 3LM3A 1V9U3 3LPPA 4Q4V3 4PMXA 1PHMA 3ZYRA 3J26N 3MUCA 1VBA1 2GK1B 4CP9A 3DG3A 1V0AA 2G3IA 5I7GA 1WDRA 3R4SA 3ZN6B 4CD6A 1QNQA 3EOLA 1KTCA 5EV7A 1BG4A 3DKLA 1HQTA 2Y60A 4DLFA 4JKLA 3URAA 3WF0A 3VUOA 4U2ZA 3UG8A 4IV3C 1EP1A 2FCVA 3KGLA 1LG2A 1H4GA 3LGEA 1MWOA 3B9NA 2K46A 4H2HA 3AYEA 1GKQA 3T8LA 5KHGA 1GZTA 4L0PA 4FOJA 3C0SA 4PRWA 5C9XA 2AC1A 3A5VA 4ZB0A 2Z1VA 3A4XA 1HDKA 1CGTA 4F0LA 4Z1YA 1AQHA 3PG9A 2Q8DA 2HROA 4AWUA 2QUVA 1X7IA 2HPIA 2GDVA 3WCSA 2GGEA 2WLYA 3NV1A 2WCAA 1EPXA 1QWGA 4IV3A 4UFMA 5FY4A 4CDWB 3CIWA 3H8XA 1W2PA 4PBFA 4Q8PA 1M68A 3EXRA 3VKBA 4HK6A 2HISA 1HW5A 1S39A 4JZ5A 5DMMA 4LK6A 3A6OA 4Y26A 1AQFA 2Q8CA 3AIWA 5L36A 1TJPA 4NIDA 4ZFCA 1F76A 5LNWA 1J4EA 3ECQA 1GP5A 2W3ZA 4DAIA 3RLUA 2CLHA 1OGSA 4CNUA 4IDZA 2D3NA 2W61A 3NQEA 3WL0A 2QW5A 4XVEA 4DPQA 3WY6A 4DF0A 3SAZA 4ZFMA 1OUXA 4UQCA 3ITGA 2DSWA 5JIAA 1K7XA 1UMLA 1CB7B 3CL8A 1JULA 1MI3A 4JDNA 3M0HA 5IT6A 2NQYA 1RQBA 2BVBA 2G4IA 4GZIA 1UXZA 4WY0F 3QTGA 1XBYA 2PODA 5DZFA 4Z82A 1P1XA 4CEUC 3VC6A 3UXKA 1X96A 1ULPA 2XVNA 2FZBA 1DKWA 4OUSA 2E7QA 2BX7A 1PIFA 3BU0A 1DYOA 3URNA 3VX1A 3AOFA 1MSSA 4HA1A 1ASJ1 3LQGA 1KBIA 5DBUA 2PC8A 3ZJ6A 4BOWA 1WE5A 5FUNA 4PUKA 1PK6C 7REQB 1QW8A 5KZMA 5A3MA 2WZ8A 1T6BX 1QJWA 2I9UA 1RK5A 4FNSA 4OBRA 3H2CA 3QPEA 1RQEA 1OIMA 5FJKA 4AIBA 1I2OA 4CUAA 4UMAA 1B0IA 2YUEA 1LU1A 4GY1A 1SQ4A 4BWLC 1HKJA 2DT2A 3MUZ1 7XIMA 5GLVA 4OU1A 5DAWA 3BJTA 4UMBA 3KSCA 1ZZ9A 4GWJA 1CEOA 1D9EA 3GXTA 7TIMA 1KS4A 2CLMA 4Z08A 3WQBA 4D6RA 2XUMA 3WLUA 1XHGA 2QQKA 2VFFA 1AYN2 4HT1T 3VIKA 1EOKA 4MY9A 1PV8A 4CEWB 1SBEA 5FJTA 2EAKA 2F6XA 3TSBA 2BBAA 3P6BA 3GK0A 1W5NA 4K38A 1TVLA 4GISA 5TD4A 4D3WA 1IS4A 2HKXA 1YYAA 4L4LA 4CRQA 5F3EA 2X1SA 4XDOA 4BWLA 4XSMA 2EJ1A 1NP2A 4GCAA 1Q66A 2JIGA 3TYBA 5BZAA 4OBSA 1JDAA 2VD8A 2QFEA 1ZRCA 1EPWA 3LCWA 1K3IA 4LV4A 4B3NA 1ZBA2 1MS9A 5E1QA 3S42A 3DPRB 2XHYA 3BAXA 5FZ9A 3B9DA 2OX1A 1AR93 2OYMA 4XBQA 5I91A 3E0LA 5EMMA 5FZ0A 4HT3A 3B69A 1YO8A 3B03A 3CHVA 3WUDA 4W4QA 5F5AA 2VENA 1MRAA 4PCSA 2XINA 5FESA 5FLJA 2P3ZA 1J2BA 2YFUA 4A3YA 1P43A 2NX9A 3ME3A 3GW3A 3FCPA 1MS1A 2A3AA 5FTTC 3GG7A 1JU4A 3KQRA 1EPZA 4RV8A 3UGHA 5HV0A 3BUVA 5KETA 1RPXA 1Q6DA 3BV7A 4IL2A 1ZAIA 5FP4A 2FMOA 1POV0 4NJIA 3N9LA 1ALYA 2F4PA 5ANNA 4IXXA 2Z2UA 1YDOA 2QJVA 2XPJA 4U3CA 5T5PA 1REQB 3V0UA 1MZFA 2E6FA 4Q4KA 4JRAA 4O18A 4LH8A 1Z44A 3POBA 2WMFA 2UWBA 4KEZA 2IMRA 2VBPA 3VABA 4FPEA 3UWEA 4INFA 4A45A 2QJGA 4IGSA 4IG2A 5BNNC 3E1F1 4JFWA 5CKNA 1OQFA 2DPEA 5A3NA 2G3NA 1OX4B 3ZJ7A 3H12A 1RZMA 2DORA 4ZOCA 4NQ1A 1EJ7L 4KL1A 1COV1 2DU1A 1KRIA 1J96A 4QNWA 1YDYA 1R64A 2GNDA 1R2SA 4RQPB 1V6UA 1EX5A 5DUUA 1H8TC 3K8KA 3JUUA 4L6DA 3P3PA 2V09A 1Y7VA 1RUJ3 1V77A 4KERA 1SPPB 4ZKTB 1IXOA 2X2YA 3IDAA 2Z5WA 2Q3RA 3NAVA 4R3UA 5BNNA 4JRLA 3MCNA 3L4WA 4RUBA 4DI9A 2HWE3 3UY8A 2XJPA 1VC4A 1QDCA 1E4LA 2A6LA 4HU8A 1UZ1A 4KQNA 1TWZA 2DY3A 3RUBL 1JUIA 4QS5A 1UPMB 1BK0A 1K9DA 2RR12 1VENA 2CZDA 2XN0A 4XF3A 1TWDA 3CZJA 5JPMB 5CYYA 1SFNA 4YTSA 1BPLB 1LJYA 1FAYA 1A4LA 2J8TA 3VKKA 1H8TA 4YZ2A 1AZ1A 1UG6A 4LUIA 1DIKA 3CEPA 4I7VA 4HGXA 4LO7A 3UZXA 4FVVA 3MIBA 5DMYA 4XZ9A 5FXVA 1S1RA 2OZ3A 1FNZA 2PYTA 4E6MA 2ID4A 2OSYA 4IETA 4R85A 2QQLA 3DKWA 1Y8BA 1CAWA 5J98B 3KRSA 2PHXA 1PSCA 2PLV2 2PF0A 3GXFA 2D3RA 4WM8A 1QPQA 1UYYA 3U10A 3W7KA 3P80A 2HSAA 4DB7A 4AF0A 3LLDA 1R3WA