3GZAA

Crystal structure of putative alpha-l-fucosidase (np_812709.1) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
438
structure length
438
Chain Sequence
ELPVPKPHQLKWHEAEMGAVFHYDLHVFDGIRYGQGNNRINPIEDYNIFNPTELNTDQWVQAAKAAGCKFAVLTATHETGFGLWQSDVNPYCLKAVKWRDGKGDIVRDFVNSCRKYGLQPGIYIGIRWNSLLGIHNFKAEGEGAFARNRQAWYKRLCEKMVTELCTRYGDLYMIWFDGGADDPRADGPDVEPIVNKYQPNCLFYHNIDRADFRWGGSETGTVEYPCWSTFPVPCSHHKRIESSIDQLELLKHGDKNGRYWVPAMADTPLRGANGRHEWFWEPDDENNIYPLNTLMDKYEKSVGRNATLILGLTPDPTGLIPAGDAQRLKEMGDEINRRFSSPIARISGQKKSLTLKLGKEQSVNYCIIQENIKNGERIRQYQIEAKVNGKWQTVCKGESVGHKRIEKFEPVEATALRLTVSESIALPDIINFSAYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative alpha-L-fucosidase
publication title Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 140
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1510 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gzaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gzaA01
1BGAA 3ARVA 4BS0A 1E43A 3PN8A 2ZX9A 4TTUA 4UOZA 3AZRA 3VILA 2V3EA 1JG9A 1H4PA 1QI3A 3B9DA 2WMKA 5AC5A 4JKMA 3WD2A 3N18A 3WNLA 1NOWA 5CG0A 2VZTA 1QHPA 1U2YA 3AMKA 2IUZA 3RJYA 2WHJA 4LXFA 2NW0A 3LPFA 1C92A 1PJ9A 3PZ9A 3AIQA 2XWEA 3GXIA 1Q6DA 2ZUNA 3CTTA 2J75A 3PZIA 3PHAA 1OCQA 3THCA 3IK2A 2ZXDA 2FH8A 1M53A 3BC9A 4DWSB 3VDBA 1NWUA 4IUGA 3VINA 2WWDA 2X0YA 3CUIA 5A2CA 3L4XA 2C0HA 2W67A 1OSEA 4OOUA 4Y7EA 5GNYA 2J25A 4QLKA 2F2HA 1EH9A 1DWFM 3SUTA 5CGMA 3NCOA 1IZJA 4KWUA 1TR1A 1H1NA 1FHLA 1QPKA 1QI5A 1B90A 3AIRA 1UH3A 2CKSA 5CSYA 3EMCA 1WZLA 3WUBA 4E8CA 2WVUA 2VI0A 2E4TA 3WBAA 4U5KA 2BXYA 1I75A 1UR1A 4AEEA 2VCCA 4CU7A 2OLHA 1DWGM 1GOQA 4JIEA 2Y4SA 4TVUA 2D2OA 4KMQA 3WKZA 1B2YA 1OM0A 2J47A 4AZIA 4OIFA 1C7TA 1YHTA 1H0IA 4JAWA 3TTOA 5KEZA 1VAHA 1Q6GA 3L4VA 1ZJAA 3VD5A 2J7HA 3FY1A 2CBJA 2GJXB 1X6NA 2YOCA 1OIFA 3WDIA 1QNRA 1CPUA 1GORA 3VIFA 3OBAA 1QI2A 3UR8A 2EPLX 4UQDA 1BSIA 3JUGA 1JF5A 4MB3A 4X0NA 3NUKA 4ATWA 2J74A 1QBAA 1H09A 3ZOAA 4LPCA 2WBKA 2DEPA 3PBGA 3NDYA 3U57A 5JUVA 3ARZA 1QNOA 5E0FA 4CCEA 2XSAA 4MNKA 3BSHA 4HZ8A 4V2XA 2VZSA 3QGVA 2E9BA 5FL1A 3DYPA 3VKKA 4W84A 4JHOA 3A3HA 1B9ZA 2XSBA 3MS8A 1V3IA 4DUWA 2NT1A 3BAIA 5BXTA 4AC1X 5BRQA 1MVYA 3CBWA 2EBNA 3VIKA 1OGGA 1FFQA 5LA1A 1MQPA 1ISXA 4KRTA 3A4WA 3T0DA 1IT0A 3OZPA 4YN5A 2NSXA 2QMKA 1J0YA 2F8QA 3UERA 3AZTA 3PZQA 2WMHA 3FHQA 4P8UA 3LMYA 4HOXA 1HKKA 3CUGA 5TD4A 4XZBA 3QOMA 2OWCA 1JZ7A 3TTYA 2VO5A 1KQYA 1XCXA 4PMOA 4B9YA 3L4UA 4EK7A 1UR0A 1CIUA 3M7SA 1R85A 1FP9A 3WDQA 1WO2A 1US2A 4U3CA 3CZGA 1V08A 4UTFA 4UFMA 2X0HA 1UR2A 1HKJA 2XGBA 2XYLA 5M3WA 3N12A 2FH6A 1UA3A 4LX4A 2VNCA 2XTKA 3W53A 1VFFA 1D3CA 3PZGA 1TFVA 4CUCA 3MV01 3WH5A 4PMDA 2ZXBA 1ZBKA 2XM2A 1E55A 2FGZA 3PZVA 1UR9A 2CHNA 4EANA 1O6IA 1L0PA 3W27A 1SYTA 1UD4A 4PUEA 4UZSA 3NSNA 4JL1A 4UQBA 3F4VA 3VIJA 4CKQA 3CHCA 2BVTA 4DM2A 2D24A 1US3A 3W6LA 1MQQA 1EDGA 1CLVA 4YHGA 1VB9A 1M7XA 3N9KA 3CZ8A 1J9YA 4P7LA 1JDAA 1BGGA 2X1IA 3GH4A 1UZ4A 3VUPA 3WNMA 4MDPA 3L4TA 4RL3A 1QI4A 3SCTA 1GVIA 3AS0A 4ZE4A 8CGTA 4RE3A 1KR1A 3WFZA 2O9TA 3KE0A 2VCAA 1E1EA 3WENA 7TAAA 1C7SA 2PBOA 4HA1A 4WSJA 4F9JA 1AQHA 3AISA 3EYPA 5E70A 1V6XA 4U2ZA 3UG3A 2FGLA 4X9YA 2D23A 3SCSA 4W8BA 3UEQA 4C7GA 4Z2IA 4GZEA 4CVWA 1B3XA 1JL8A 3AMLA 1PBGA 4D1JA 1EIBA 4CN4A 3WF3A 2UWFA 3AS3A 4CD7A 2W61A 1KFWA 4D6GA 3RDKA 2UY3A 2BY1A 3ZR6A 2YJQA 4UOQA 1NP0A 2EO7A 4C7DA 5LA2A 1G0CA 2VURA 1JNDA 2CBIA 2VTFA 4NF7A 1W1VA 1FHDA 2BS9A 4FLOA 2OSXA 5M5DA 2PWHA 4H41A 1ESWA 4D1IA 3ZJ6A 4JFSA 3VMNA 2A3EA 1ZBCA 3TP4A 1J0IA 3NJ3A 2YL6A 4URIA 5AYIA 1J11A 1GOWA 2VVSA 2BFGA 2XVPA 3CMJA 1V0KA 4CGTA 3WMCA 5ECUA 1WZAA 5M03A 5EBAA 3MMDA 2ZE0A 2WZHA 2XVGA 4UQAA 1E3ZA 3PTMA 1J01A 1KBKA 4P8WA 3M07A 3K8KA 4CCDA 1XYFA 2DSWA 4A3YA 1PZ3A 3GNRA 4E8DA 4M82A 4TOQA 3SCUA 1UWRA 1V0LA 5C8BB 1XH0A 2JF6A 2YDRA 3WIJA 4LYPA 1H2JA 3WUGA 4ATDA 3WH9A 4GI9A 1SMAA 5A2BA 3AXXA 3PTQA 2VRJA 4D6CA 2F61A 2GK1A 3AROA 2VQTA 4H7VA 1PX4A 3ZT5A 2Y2WA 2GJRA 4P7OA 3ECQA 1PX3A 3K8LA 2AOSA 3U5UA 4ACZA 1J0HA 4QLLA 1BG4A 3UCQA 3WF0A 1R7AA 5HDRA 3MMWA 3SCVA 2WHKA 3QR3A 4X0VA 4W93A 1M04A 3GNPA 4FLSA 2D0HA 2X8RA 2FHCA 1V6YA 1W2PA 1VBUA 4B15A 1JFHA 3ZJ8A 2G3MA 1NOFA 1LWHA 4YHEA 3W28A 1OD8A 5CLWA 1TCMA 1GVYA 4PMNA 3WF4A 2DDXA 5E6ZA 2WMFA 2CIPA 1CNVA 1VIWA 1WB0A 4AD3A 3WL1A 4K68A 1CGYA 1OIMA 4PYSA 3N13A 1CXHA 1KXHA 5D9NA 4D6FA 4CD6A 1BHGA 1UD5A 4IM4A 5IDIA 3ARPA 4KGLA 4EKJA 1BQCA 2UY2A 1QNSA 2CKRA 2CBVA 4CU6A 4CU8A 3L4ZA 5A8OA 4MAZA 3IJ8A 4AD5A 4JHZA 4M1RA 5I23A 4OUEA 3KL0A 2DSVA 1GZJA 5IXEA 1QNQA 1R8LA 2GFTA 4UCFA 3WEZA 1UA7A 4J3WA 3ZJ7A 4J3SA 1BTCA 3N04A 5LA0A 2WSKA 4S3KA 4UR9A 1HP4A 5DMYA 1GPFA 1GOIA 4PSRA 2CEQA 1XSKA 4WSKA 3DECA 1EGZA 1W91A 1R7OA 4PTWA 2JEQA 3ZT6A 4PMVA 1ZBVA 4WIWA 3UESA 2WNWA 5A8PA 2YDQA 5CPSA 4NI3A 2ZXQA 4BQ4A 5A8MA 1DHKA 3VO0A 3TA9A 4HA4A 1MXDA 2G3IA 2WCGA 4H04A 2WHLA 4AZ5A 1V3LA 3IAPA 1QVBA 4PSPA 4BQ3A 3LPPA 2GDVA 2WLYA 1GOOA 3TONA 1EQPA 1D7FA 4J3VA 2ZUTA 3KZSA 3FAWA 1ISZA 2BXZA 4PMYA 3WQVA 2J7DA 1SFSA 1DWHM 3BMVA 3LPGA 4UFHA 4ATLA 2MANA 3W25A 1WKYA 4U5IA 1JZ2A 5CJ5A 2ZOXA 2D22A 4RE2A 3RMEA 2Q8XA 4AIEA 2J62A 3L4WA 2VZUA 6A3HA 3AHTA 2CESA 3BGAA 3BCDA 3CZEA 2WZIA 3WD4A 2BY0A 1J10A 3U5YA 4U33A 3WH7A 4D6JA 1UH2A 3NIYA 1NWSA 5I6SA 1JNEA 1MW0A 4NZCA 4P7NA 4TXEA 2C8NA 3WQ5A 4NRSA 2Y24A 4AY1A 3CHEA 1EHAA 2WC4A 3WD3A 1XYZA 1OBAA 1BYAA 5FOOA 1E6NA 3S6TA 3BXWA 3WDHA 4ZFMA 2ZUWA 4AZHA 1U33A 4QP0A 1E3XA 2YBUA 2VRKA 4D71A 3GDBA 4AW7A 1HNYA 4MADA 2DIJA 3PZOA 2G3JA 5D8ZA 4TX6A 3WD1A 2DH3A 2WWCA 3KL5A 1H41A 1CENA 5BRPA 2VX7A 1CLXA 1PIGA 3WF2A 4W8AA 2XVKA 1W9XA 5D9OA 5A6SA 4P8XA 4DWSA 4BA0A 5C70A 5C71A 2G4FA 4M81A 1ECEA 2XHYA 2PF0A 1O7AA 3SEPA 1E4IA 1KGXA 3SCOA 4H8HA 6CGTA 3A6OA 2DIEA 1E6QM 1ODUA 1PAMA 4N42A 1W3LA 4U2YA 3GXFA 1CECA 1LL4A 3W81A 4PBGA 3FW6A 3BMWA 2W92A 1HT6A 3UETA 2OSWA 3DHPA 3VNYA 4AEFA 3WQ4A 5FIPA 1WPCA 4QCFA 2PWFA 3SCQA 2DPEA 1NWTA 4W88A 4AD4A 3PZUA 1UKTA 3K8MA 1C93A 2TAAA 3OGVA 1UWIA 1CWYA 4W8LA 2WKGA 4QDMA 1CYGA 1X1NA 1JD9A 3VM5A 1EQCA 1EXPA 1BFNA 3VIOA 1HX0A 3ZIZA 1MFVA 5E09A 4PMUA 3IANA 2PC8A 1NM9A 5CSUA 5DEZA 5ABFB 2JFEX 1HJSA 4WF7A 3WQ8A 1CXFA 4GZIA 2ZIDA 4QCEA 1NOUA 3LPOA 2B31A 3BAJA 4M80A 1CTNA 3ARSA 3K1DA 4AZCB 3BAKA 3CHDA 1TZ7A 3OLGA 1FH7A 4NRRA 1F4HA 3ARQA 2CITA 3TTSA 3ALGA 3EDFA 1CEOA 1JXJA 2W4XA 3SUUA 2JE8A 1GQKA 1C91A 5GNXA 3A4XA 3O2LA 3W0KA 3WUFA 5A2AA 3ARWA 3VGHA 1GOKA 4J27A 1V6VA 4AYSA 2OWWA 2EEXA 3O9NA 3AHXA 1EOMA 3OGRA 1OB0A 1CXLA 4AD2A 3RJXA 2OYKA 2J8FA 4HU0A 3FHAA 2XVLA 1V3HA 1QBBA 1JYXA 5DT7A 4M24A 4AIOA 5DFAA 1CGXA 4UQCA 4EE9A 1H0GA 3VMPA 5BXRA 3RCNA 2Y5EA 3MV11 3OLIA 3WELA 2FHBA 1WP6A 1VENA 2BNJA 5HXMA 1V0MA 2VX4A 1RH9A 2WCAA 4Q7NA 4AZGA 2CBUA 4NSBA 1KBBA 4AD1A 4MNJA 4AZBA 3B9AA 2J7BA 1E72M 1ZJBA 1VFUA 1EHNA 3WEMA 4GINA 1AQ0A 4D72A 2QPUA 1NARA 3EMZA 1U30A 4FLQA 3WY1A 4IISA 4CD5A 4Z2GA 3EDJA 3F5KA 5AYBA 3WQ6A 4DWSC 3J7HA 3O6AA 3SUSA 2E9MA 1GNXA 5FCZA 2DSZA 1JD7A 2D3LA 3D3AA 2V3DA 2WW5A 3AIVA 3RM9A 1G94A 4DWSD 1FFRA 5IHRA 4GO9A 3SCWA 3G6LA 1LJYA 2VUYA 2DQXA 3RIKA 4A3HA 3BLPX 5BXPA 3WQWA 1J0KA 3CIVA 4P7QA 1KB3A 4PTVA 4TVCA 2FDMA 3N17A 5HPCA 4ZEPA 1CGUA 4R27A 7A3HA 1UG6A 3MUY1 3UG5A 2QV4A 2VX6A 2ZICA 2CNCA 1VJSA 2YL5A 4AXNA 3T08A 1H11A 3HMCA 1R87A 3VD9A 3SUVA 2E0PA 4DUVA 1HP5A 1LG2A 1KXTA 3NSMA 3T0AA 4GPNA 3MSDA 1BPLB 1V6UA 4OZOA 3GBDA 4Z2JA 3AICA 2ZXAA 2E8ZA 4KRUA 2RGLA 1AQMA 1OT1A 3GM8A 3OLEA 3NSXA 4J28A 2V5DA 3W37A 3NYDA 3WDJA 5BYWA 3CZLA 1K6AA 1K9FA 5I2UA 1CZ1A 3BLKA 1J18A 1E5NA 3BSGA 3ARYA 1A47A 1MYRA 2WVVA 4P8VA 4RE4A 2WXDM 2QPSA 4JFVA 2D1ZA 1QW8A 1TA3A 4M8UA 4OOZA 3QHNA 3UG4A 1JGIA 2XFYA 4JFTA 4MDOA 3W26A 1OGSA 1UD2A 1UR4A 4U3AA 3E1F1 1KR0A 3AIUA 5D8WA 2YA2A 3W24A 4JFUA 1JYNA 1GQLA 3KWXA 3AHZA 2HVMA 4W5UA 4HMCA 1MQRA 2A3BA 1Q6EA 3MSGA 3ARUA 1M01A 2CYGA 4ZXLA 3W4RA 1TVNA 2EQDA 5D4YA 3CUFA 2ZX8A 1KXVA 3ZT7A 2YKKA 1R86A 1PPIA 1RPKA 1K9EA 2WK2A 1W1YA 1AVAA 3AS2A 1KWGA 2ZX5A 5BCAA 4AWEA 1HKMA 3GXMA 3AHYA 3AXHA 1OINA 1UYQA 2ZWZA 2BY3A 2E3ZA 3VIIA 2E9LA 3M6DA 2GDUA 4ACYA 3OA5A 1E6ZA 1KGWA 4BQ2A 1HJXA 4Z2KA 1B0IA 4F9DA 3W38A 1W3JA 2AMGA 5CZKA 4PRWA 5E6YA 2UY4A 1V03A 1KGUA 4S3JA 1V6WA 3IJ7A 4AIUA 5CLTA 4W5ZA 1XH2A 2D3NA 3GXDA 1H3GA 2DSUA 1JI2A 1E15A 2DGAA 2WAGA 1MXGA 1VFMA 1CXKA 1JZ8A 4HPGA 5I24A 3BAXA 1DP0A 5HOSA 3DYMA 4MNMA 5BXSA 3ALFA 2PWGA 1UQYA 1WDSA 2W63A 3MUZ1 1WAWA 3BAYA 2ZWYA 4QLJA 2VCBA 2JIWA 3VDAA 1ISWA 1IV8A 6TAAA 3AXIA 4LGXA 2CCRA 4W7VA 4L4PA 3VVGA 1CXEA 1HVQA 3VIMA 1JZ5A 4H8VA 3FN9A 1CDGA 3VMOA 4F66A 3AIWA 3T2PA 3I3EA 3SCPA 7CGTA 3HN3A 1VEPA 2YIHA 1OT2A 3AFBA 3ARXA 2W91A 3EMQA 3EDDA 3FNDA 3EDKA 2V3FA 1GQJA 1UUQA 2WMIB 4N0RA 4CD8A 4HPHA 1W3KA 5GNZA 1W1PA 2VT0A 2O92A 4Z2LA 1GHSA 1B30A 1WDRA 1DWAM 1W9VA 3I3DA 4MNLA 2ESCA 2BY2A 4HA3A 1H5VA 2WB5A 1E71M 4CN1A 1VRXA 1YQ2A 1CGWA 1SR0A 4HTYA 1FA2A 3L2LA 1LLOA 1FOBA 1UZ1A 1BYCA 2D0GA 5A6JA 2O9RA 1JYWA 1KCLA 9CGTA 2WPGA 2A3AA 2WVTA 3POCA 2YLAA 3HU7A 2J77A 4JKLA 1V02E 3WL0A 1X6LA 2O9PA 1QOXA 4V27A 3ZMRA 1PEZA 2XGIA 1E6SM 3ZQ9A 1JF6A 3AYRA 3CZJA 4UFIA 2XVNA 5IFPA 1GCYA 2UY5A 1HJUA 1G9HA 1ISYA 5BWFA 4Q22A 5AC4A 2PI6A 3B9EA 3RM4A 3TTQA 4WKAA 5LYRA 1WZMA 3PZMA 5JBEA 4PEEA 4HU8A 2GVYA 3VNZA 1XGZA 2WHMA 5E0CA 2X05A 1G5AA 1V3KA 4F8XA 2EPOA 3VPLA 3PZTA 4M29A 1CXIA 2FHFA 4PUDA 1QHZA 1JFXA 1WDQA 1JZ3A 1HJWA 1XRVA 1F4AA 3VDCA 1KCKA 4HOZA 3K46A 3F5LA 2YL8A 1W9UA 3WDRA 4UFKA 2DT2A 4B9ZA 5A69A 4J3TA 3DHUA 2VL4A 4YPJA 4PMZA 4JZ5A 4JL2A 3KEHA 5JBDA 3GNOA 3GYCA 1N82A 3PZNA 2G8ZA 2G41A 4P7RA 5JIPA 3WH6A 2BV9A 4AD0A 3ZO9A 1QHOA 4B16A 1Q4NX 5EFDA 4OKDA 3AHVA 4D6EA 1K9DA 4HMEA 1C90A 4PMRA 1CGTA 4B3KA 1TUXA 1W3HA 1ITXA 2CXGA 1KQZA 1ZB5A 1TVPA 5JBFA 1D2KA 4OBSA 1B3YA 1GJUA 2W66A 3FXYA 1GUVA 3WNPA 3T0BA 1NWRA 3AMGA 2DSKA 3GZAA 1KXQA 1ZBWA 5DO8A 1H49A 1E1FA 2WKLA 3RM8A 3U7VA 2VX5A 3MUIA 2CETA 1QI0A 4OBRA 1EDTA 1EOKA 4WKFA 3L2MA 4R5EA 5EMYA 1VF8A 3WMBA 3CPUA 3SUWA 2WMGA 3VGBA 3VD7A 3A4AA 1BVNP 1E4LA 1TG7A 3HJEA 2XJ7A 1P6WA 3MMUA 1C8QA 2VR5A 5FL0A 4FMVA 5E9AA 2VOTA 4MPKA 3N1AA 5ABEA 1BAGA 3AI0A 2Z1KA 5ABFA 1MW3A 3D5HA 1Q6FA 5GQBA 2EPKX 8A3HA 3TOPA 1VFOA 2GJXA 4QFUA 4AZCA 4H2CA 4XZWA 1KWKA 1V3JA 2WYSA 5A6LA 1A3HA 1NP2A 4KH2A 1UKQA 1VEOA 2QLYA 3FAXA 3MKKA 4PCTA 1W32A 3GBEA 1EA9C 1XHGA 4M56A 2D20A 3BCFA 4GI6A 4HOWA 1E4MM 5I5RA 2WC3A 1W9DM 1GJWA 3WEOA 1TMQA 3MU7A 2J8GA 5A6AA 2CERA 3WBEA 4UQ9A 1XCWA 3GH7A 4PMQA 4MAVA 1E6PA 3AIEA 1E0VA 1HXJA 2EJ1A 3WF1A 1ODZA 2ZX7A 1VJZA 4TUFA 2C7FA 1EO7A 2VZVA 1ZS2A 1HN1A 1UD8A 1OD0A 1UKSA 3CGTA 3SURA 2X2YA 4WJXA 1JAKA 4ZXOA 4AISA 4UNIA 3ARTA 3OIHA 4C7FA 5FKYA 5F7UA 1JAEA 2QMJA 3S2CA 4PCSA 1UD3A 1UHVA 1DEDA 1E40A 5ABHA 2J78A 3WN6A 1JDDA 1J0JA 4B3LA 2VVNA 2JALA 1WE5A 4BQ5A 5A6BA 4CCCA 2OYLA 1QNPA 3VX0A 1I1WA 5A3HA 1C8YA 4WKHA 2XIBA 2ZUUA 4KGJA 1MFUA 5I78A 4W7UA 3WDPP 4BZYA 2ZUVA 1WDPA 1BYBA 2E8YA 4W7WA 1CGVA 4D6HA 4PTXA 1E6XM 1RP9A 3CZKA 4QAWA 1WNOA 5DF0A 3QHMA 3VD3A 4FK9A 4XUYA 1BLIA 3APGA 2WANA 4D6IA 3AQUA 5HNNA 4DUXA 2AAAA 1PZ2A 1J0ZA 5A95A 2QF8A 4J3XA 4L4OA 2YA0A 4LYQA 3DYOA 1XD1A 3AZSA 2GSJA 1ZL1A 2J7FA 2YLLA 3CH9A 2V38A 1UKPA 1DTUA 3MO4A 3CO4A 3RPMA 1V3MA 1XSIA 4LQ1A 1LG1A 3VGEA 2G3NA 2PWDA 3AIBA 1V02A 1ITCA 4WK9A 3VD4A 3DC0A 1BG9A 1TE1A 2ZX6A 1FH8A 1HJQA 2Y8KA 1OWQA 2IXUA 2J4GA 2OYMA 2XPKA 3CUHA 5A8NA 1CBGA 3RO8A 1SMDA 1B3WA 4MJ2A 3WSUA 3K4DA 2CHOA 3ZM8A 3F5JA 3N15A 4XB3A 3VTRA 1BVZA 4BF7A 4PTMA 1NH6A 2JEPA 1Z32X 2WZEA 5IFTA 2JIEA 1L8NA 1LL6A 2X09A 3L4YA 1PIFA 3G6MA 4JKKA 1BF2A 2WMJA 4UFLA 2VQUA 2ZUSA 2XM1A 1JYVA 4EAMA 3N11A 3II1A 1E5JA 1UR8A 1E6RA 3I3BA 2VRQA 3PTKA 3W82A 2GJPA 3MUAA 1LWJA 1MW1A 1HVXA 3THDA 4GI8A 2YA1A 4CVUA 3UR7A 3VGGA 4GKLA 1HJVA 4WLCA 5I3DA 1E9LA 4W89A 2VMFA 1HF6A 3SCNA 1AMYA 2VZOA 2YDSA 4AZ7A 4FF5A 5CQ1A 2XIIA 2XUCA 3VM7A 1HL8A 1W9PA 2VJXA 2PB1A 1OGBA 2WBGA 1J12A 1DWJM 2WC7A 2J7EA 3WUEA 2DT0A 2WM0A 3VU2A 3ZR5A 4MB1A 4OJYA 2A3CA 4J7RA 4AMCA 3GTNA 2EPNA 4V28A 5A6MA 5I0DA 1XH1A 1NQ6A 4GIAA 2CPUA 4CD4A 5A8QA 2WVVB 1HKIA 1C3FA 1GW1A 2XWDA 1WCGA 1UWQA 4F79A 1TA3B 3U7BA 5GPRA 4U31A 3ZSTA 2EPMX 4W86A 3VIGA 4TVDA 4UFJA 3EBVA 1UWSA 5CXPA 5A6BD 5HPOA 3VGFA 1XC6A 1UD6A 1E4NA 1E0XA 3T09A 1QW9A 5KZ6A 1JXKA 3POHA 1Q6CA 1GQIA 4PMXA 4W85A 3AS1A 2GUYA 4W87A 4PN2A 1C8XA 1MWOA 5A6KA 1E56A 5CGTA 3CHFA 4MJ4A 1B31A 4IPNB 1UWTA 3WNNA 4GXPA 4JCLA 3VX1A 1B3ZA 2BHUA 4DM1A 1G01A 1RD6A 1RP8A 3VIPA 1JDCA 3RILA 1G1YA 3M46A 5FD0A 2QHAA 5CPTA 2HISA 1LQ0A 4Z2HA 1W9BM 4HP5A 4MTVA 1UQZA 3AYSA 1E73M 1ISVA 5I77A 2V5CA 3OB8A 1JIBA 4J3UA 2WMIA 4H8UA 2V3GA 4TTGA 2OSYA 2DT1A 4A4AA 2W5FA 3CMGA 3OGSA 4ZE5A 5ABGA 2GK1B 3AMDA 1I1XA 3IJ9A 2DT3A 3EDEA 3CLWA 5DT5A 1Y7VA 2VC9A 1EDQA 1LL7A 4D6DA 1VBRA 5D9PA 4ACZB 4AZ6A 2Y8VA 4ZENA 2VR4A 5EB8A 4JCMA 2OWXA 3WMSA 2J7CA 1LF1A 1UH4A 3OG2A 3WD0A 2WLZA 3WFLA 3AOFA 5M17A 1DWIM 3SCRA 4MB4A 4JFWA 4TX8A 2BVDA 1BYDA 2JF7A 3A47A 4UQEA 1JI1A 3VOCA 1W2VA 4UOJA 1JZ6A 2W62A 2XG9A 1S46A 1ZU8A 2WSPA 2Z1SA 5D9MA 5EFFA 2A3HA 2WVSA 1PX8A 3BH4A 4GZJA 1WZKA 3OZOA 1B1YA 4HZ7A 2WCSA 5JIWA 2J79A 3IAQA 1XV8A 2XFRA 3WNKA 3W29A 1JZ4A 1VEMA 1FH9A 2EXOA 3SIMA 3QOKA 3ZSSA 3AMCA 1HIZA 1GOMA 3QHOA 2IXVA 4XX6A 5AY7A 1E70M 2O9OA 4ML4A 2NT0A 1GHRA 1UKOA 3W6MA 2J7GA 3WH8A 4GO8A 4CN6A 5IHSA 5A1AA 2D0FA 4XV0A 2BHZA 2RGMA 1B3VA 3ZJKA 2YL9A 4BCEA 3ARRA 1EO5A 3T2QA 1MW2A 2YBTA 3CUJA 5I79A 3VGDA 3VDHA 3NDZA 4GQQA 1XSJA 2E40A 5BROA 1GONA 4E4PA 3B8SA 2DH2A 4UZUA 4FLRA 2XFFA 4HMDA 5CPQA 3AJ7A 1W1TA 4LYRA 5HBFA 2PWEA 3T2OA 2BHYA 1UOKA 3OLDA 1M03A 1HL9A 2BVYA 5A94A 3MANA 3KL3A 1IZKA 1V0NA 4MB5A 3VIHA 1E0WA 3K4AA 3WNOA 1FP8A 2PBGA 4E2OA 3BAWA 1K9TA 1UWUA 4IPLA 2ZUMA 4HZ6A 3GH5A 4GQRA 1XD0A
chains in the Genus database with same CATH superfamily
1BGAA 3ARVA 4QX2A 1CR7A 3MVIA 1E43A 3PN8A 3H7YA 2WNVC 3IIAA 3JZEA 4TTUA 4AYUA 5I0SA 1LLWA 2POZA 3MY9A 4KS0A 1Q8VA 1BRLB 1PB0A 1RVF3 5AFBA 2HEYF 1Q45A 3HPAA 4M3CA 4A6OA 4YZ5A 3LV5A 3AXEA 3N18A 2GGEA 3G1VA 5C8CC 1NOWA 4JXCA 4DJEA 3TYJA 1U2YA 4FTEA 2WHJA 4XCAA 4S1FA 1T0OA 5A7WA 2NW0A 2NV9A 3LPFA 4IGQA 3VNDA 3SC7X 2QZ3A 4LB3A 4DXXA 2BUKA 3KHBA 2IXLA 4JRLA 3OBEA 3IIVA 2J75A 4LUYA 2EXIA 5C4WB 1P6BA 1ZENA 2ZTJA 4O54A 3W23A 1D4M2 3MC5A 2Y6JA 3THCA 3POFA 3IK2A 1ZJHA 1AD4A 2R072 2ZXDA 1M53A 5EMUA 4KWJA 3ZR4A 1MS9A 3BC9A 2VEGA 4C6IA 3VINA 3GNNA 2A1YA 2WWDA 1JCJA 4I90A 4JQ1A 3CJIA 4Y3OA 2QPXA 5FY7A 3A22A 3QXBA 1HRV2 2C0HA 3ZXFA 2YXXA 3WP4A 3S6DA 5IM51 1TJ0A 1LBFA 4N9IA 3FA3A 1R47A 5CSSA 3AALA 5CGMA 1YHFA 3SADA 3MIFA 3KRSA 1TR1A 3IDBB 5CEWA 2JB8A 1QI5A 1YTEA 3AIRA 2B45X 1R092 5EA9A 4JTIA 2P3EA 3IUDA 1U5IA 5EYXA 1C5IA 4FAGA 3RRAA 5IVCA 1WZLA 3WUBA 4E8CA 1POQA 4QGNA 1RZMA 4NXSA 1EYBA 3W7GA 5A3OA 3MZNA 1F3XA 1FPN1 4PR4A 3AKSA 4U5KA 1I75A 1UO9A 4CU7A 4DNYA 3U8GA 3JXSA 2JKBA 4TVUA 1ULEA 2NV2A 3NEHA 2JDHA 4UTTA 5K4ZA 1MZEA 4W65A 3G24A 1YHTA 5AZ1A 1GGOA 3PUEA 3V3WA 4PRTA 5BPXA 3K3NA 4QB2A 1IG3A 2EICA 1QXRA 5HNRA 2W08A 3B02A 1X6NA 4MX3A 1IPKA 1CPUA 4HIBA 3VIFA 1JPKA 2YGLA 2ZE3A 3A23A 2HXUA 3P6LA 1GKBA 1PS9A 1QI2A 2UBPC 2HNEA 3OBRA 3J4UH 3BOLA 3O0WA 3CK5A 1UOJA 3JQWA 4GJIA 2GP5A 1OFPA 1LHOA 2D5FA 4DEQA 1PWLA 3JVAA 4MB3A 4X0NA 3RF9A 1QBAA 3ATYA 4LPCA 1LRNA 1UCXA 4ZSTA 3EPNA 4K38A 1KFKA 1LEMA 3F4CA 3SZ8A 3HAGA 1BEUA 2H90A 2QGHA 2YGYA 1SBEA 2WJZA 1YX1A 3R6SA 4JICA 4MNKA 4HZ8A 4UWMA 3BL3A 4YWSA 3DYPA 4V1XA 3L67A 4CTEA 5HBAA 1P6CA 4UT5A 5BXTA 2DFBA 3AO0A 3FDKA 4FIQA 1OX5A 4ZTYA 1XPWA 3VBHA 4BDVB 2P1BA 1FFQA 4QS6A 5LA1A 2WOQA 2V5KA 4KRTA 4DZ5A 5C54A 5IDZA 3AYTA 1OVDA 4XKYA 2SLIA 1XYNA 3SIZA 3NQ7A 2EAAA 3ZFGA 1IEIA 2F8QA 3E12A 1DJIA 3UERA 3AZTA 3KMHA 2JKEA 2VU9A 3ZVXA 2WMHA 4XAEA 2YCLB 2EIEA 1G7UA 2TSYA 4HOXA 2RDTA 1HKKA 3WFAA 1JI6A 1GBGA 2HBUA 2PHUA 1IG0A 1JZ7A 2VO5A 2ZGPA 1O3RA 4B9YA 3GVVA 3BCWA 1CIUA 1RBOB 3KT7A 3WDQA 1LU1A 1WO2A 5CGQA 3EEZA 5F1VA 1E51A 3BGGA 1ONAA 2DBNA 3CZGA 3POJA 4UTFA 4UFMA 3NFUA 3CKHA 3GZTB 1HKJA 1UR2A 2QCFA 5HMFA 5DDJ2 5F39A 2Z28A 1UA3A 4U4MA 4XAGA 3ZDSA 3DERA 3MHGA 2RDXA 2DJXA 2XTKA 2QUNA 4Q4Y3 2J9ZA 4CUCA 3RR4A 3WJSA 4W9TA 1VP5A 2D6PA 3WH5A 2GDQA 5CZTA 2BB0A 1JVNA 4S2BA 4LBQB 1FDJA 3IGSA 3I7DA 4Y96A 1KTNA 3PJUA 2J1SA 2XM2A 1E55A 1XIMA 2Z26A 1LOFC 3B0PA 4XSMA 4R53A 4B2DA 2GPTA 1IXNA 4IFKA 1GJPA 1GP5A 1QJU3 5G4HC 1XJBA 3HVDA 4NQ1A 2P88A 1UR9A 4RE0A 3NXLA 1KC7A 4EANA 1J1LA 4R88A 1W2TA 1O6IA 3DC8A 1L0PA 1HRI1 3M6YA 2Q30A 1XKYA 2FGBA 1POV3 4PUEA 1WCSA 3C2FA 2R14A 1IZ3A 1AVBA 2RS33 5H6HA 5D2WA 3AKTA 1PIIA 4OMDA 5A32A 3C0LA 3QFEA 1LP6A 1MEC2 4PE8A 2NQ9A 1DGRN 1O91A 3R0RA 1AYN3 4URAA 3G1FA 1A5CA 5KTLA 1VB9A 1WXYA 5CAKA 1BLZA 1TWZA 3QACA 1J9YA 4BMEA 3R1ZA 1JDAA 4I0AA 3GH4A 3WQBA 2GMEA 1WXJA 3AX4A 3L4TA 4RL3A 1L7LA 3AS0A 1W6MA 1H1ZA 5HV4A 1PGL1 4AC7C 4OVEA 3WFZA 4DLFA 1ZX5A 1JOJA 1ZAJA 2VCAA 3KE0A 4LT5A 2VM8A 3WENA 3FS2A 5DCBA 1QHDA 2FMDA 3HB9A 2UZ9A 3AISA 3E2SA 4MZ8A 3PNUA 1XQNA 3UG3A 3OO2A 5L19A 3ZYGA 1G9AA 3TJXA 3FKRA 2VVDA 3DHFA 1BZWA 1RVF2 3WUCA 4W8BA 3N35A 3HNBM 3GHSA 1Z3NA 1S0BA 3N9LA 4GZEA 2PAKA 4ORIA 5D2TA 2NP0A 1W8UA 1EKOA 4YM2A 3AMLA 3KVLA 3KOXA 3R2GA 5FPUA 4TQTA 3EX6A 4D1JA 2HYXA 3VBOA 1EIBA 5I3GA 3WF3A 1V6JA 3VBUC 1W8GA 4UAPA 3SH4A 4HN0A 3M0LA 3RDKA 1ALYA 3WMLA 3AKPA 2BY1A 1LOGA 3W7OA 1OEPA 1CJPA 1IS5A 2FQIA 3GG1A 1ZNNA 4HNOA 5FZLA 3AP4A 5LA2A 3H2FA 3U2OA 3LIHA 3SR7A 3GD6A 3WLTA 2VTFA 4NF7A 1W1VA 1FHDA 4AWUA 2FMYA 3HFYA 2I2SA 3N7MA 5H1WA 1RUE3 4QHBA 3ZJ6A 4A35A 3UJRA 4JFSA 3AC0A 3PPHA 2WJSA 1VYSX 4YZ2A 4ZO8A 2A3EA 3TP4A 1J0IA 2OEMA 1RHI1 4TMBA 1LENA 4LA3A 5AYIA 4UQBA 4IGPA 4S2CA 2BFGA 5D33A 1V0KA 3W2JA 4CGTA 3URQA 1OFOA 2L9LA 2ZDRA 5ECUA 1WZAA 3WG3A 5M03A 3AP9A 5DUXA 3LDBA 2ZE0A 3APBA 3TIMA 3NV3A 3NQGA 1XXNA 3K8KA 1XYFA 2X2GA 1LGCA 3HR9A 3HJRA 3MIEA 1B9BA 3AK0A 1YXWA 3LY0A 4O53A 4REQB 3WIJA 5B7YA 4LYPA 2VGBA 2PEVA 2D3RA 2VNRA 1WLTA 1LOAA 5A2BA 3M0ZA 5GZDA 4XUPA 1W54A 1JUHA 1HUVA 1AH0A 4O1DA 1U5ZA 4FNPA 4GY0A 3WBWA 1ZVFA 4WM7C 3ST7A 1PX3A 3GDLA 4EX4A 3ACIA 1OMIA 4UXDA 1BG4A 1YQCA 2ZA2A 1R7AA 3A9BA 3LG3A 3LEMA 1DXIA 2BP6A 2BDQA 2CLLA 4DPQA 3FMGA 5GALA 2QQJA 3P8IA 3AKRA 1W3IA 1JFHA 4JTCA 2VZRA 4NROA 4FX6M 5DBUA 3W28A 1OD8A 1GVYA 4KCTA 1AR93 5E6ZA 5GM0A 5H8MA 1O59A 4AHQA 3WYZA 4O12A 3SHRA 3LD8A 2JJ6A 4BEUA 4QT6A 4D6FA 4S39A 4OULA 1UD5A 4IM4A 3GBWA 3LEPA 1S1AA 1H2LA 5LHFA 4LK6A 3HV9A 3ARPA 4KGLA 3RVHA 1LECA 3E02A 2YDEA 1Z41A 4CU8A 1N3QA 1REFA 2Y5JA 4FP3A 3KT1A 3M3OA 5CYYA 1GG0A 3N9QA 1XYAA 3M5XA 3KL0A 3WZ0E 1ZBA1 3V35A 4ZTXA 3REQB 1C1FA 2WWUA 4FOJA 3UJQA 3UL2A 4QEHA 5L7OB 3SN1A 4FHAA 1QPNA 3N04A 4J3SA 2WSKA 5BNOC 1PVC3 1LOBA 4GISA 5CB7A 4CCMA 4J2MA 1GOIA 1O95A 3K4ZA 1XSKA 4PTWA 1R7OA 1H60A 3VBSB 4JIIX 4BR1A 4ORFA 1KEXA 1SEFA 3PMSA 4XQ4A 2QQ6A 3TR9A 3NKGA 1CAWA 1DJZA 2CXEA 3GDRA 5FWEA 2FCUA 3STEA 3EXTA 3B9NA 4K7YA 4WGHA 1F35A 1UZ0A 1JTZX 4XCBA 1Z78A 1O5QA 4BI6A 1UPMB 3IWZA 3J7NA 4EZHA 3ANYA 3LXCA 4H04A 3W7HA 3EA3A 3N4MA 3U75A 1YQ6A 1RXGA 4NUBA 4G1NA 2RS51 2PCEA 3FYPA 3AMMA 3UFYA 1BJQA 2FQPA 1RUH3 3ES4A 2C24A 1A5SA 3OZYA 2DVFA 1GOOA 2ZZ1A 4LCSA 4DJDC 1RUF3 3VZKA 1D7FA 2ZUTA 3KZSA 3C0SA 3FAWA 3E0LA 5EHDA 4LRTA 3R94A 4FOWA 4PMYA 2Q3OA 3T81A 5LNVA 3M8LA 4S3EA 3UZ5A 2XH7A 3HGJA 3DN5A 3G1AA 2O7QA 2O7SA 4ATLA 2MANA 2VD8A 4EF8A 3MFAA 3GFXA 4XZ9A 3C2YA 2Y7FA 4MYXA 2DU0A 1SFYA 2W0UA 4UR8A 2XIOA 5LHEA 3TYDA 2VZUA 4S23A 3AHTA 6A3HA 2CESA 3BGAA 2KM2A 2RS32 3EWXA 3BCDA 2VOXA 1WMDA 4HL0A 1TWIA 3MHUA 1J10A 4OMCA 3W87A 2YPIA 4PFMA 4R34A 3NG3A 4D6JA 3O1UA 1UH2A 3TAOA 4ZOCA 1AYN2 5I6SA 1Q3EA 1JNEA 3QQWA 3BVCA 2C8NA 4H6RA 1FUYA 1CAXA 2VNGA 1SM9A 5F8PA 4CQ8A 2Y0OA 1OBAA 4K40A 3RITA 1BYAA 5FOOA 1OX6A 5D8AA 3Q4DA 3B0VC 4FXRA 1E3XA 1UOBA 1U5XA 2YBUA 4D71A 4GHRA 3O8AA 1V51A 2VOWA 1OQFA 4W6YA 2BBFA 5FCCA 4UTHA 2DJLA 1MNSA 3KL5A 1DQXA 1H41A 3S7EA 5BRPA 3PSWA 1DBTA 4O9GA 2QKFA 4HKOA 4GQ7A 4HZFA 4TN7A 1TV2A 3COTA 4IXXA 1O66A 2PDJA 4P8XA 5FZ1A 2CLPA 3PUDA 3W22A 5F5AA 4AK3A 5C70A 5JI9A 1JHNA 1F15A 3H70A 3NZPA 3NM1A 1EJXC 4LK7A 3WVJA 4HVRA 4XW3A 2FFCA 4Y5TA 2XDVA 3T3YA 5JI7A 2DVBA 5FI8A 2YW3A 4AXOA 1ZFJA 3A4UA 3PBVA 4G8TA 3GZEA 4HSHA 3I65A 4N7IA 2QTWB 1DGWA 3XISA 3W59A 1PAMA 3UK9A 1BEV3 1AX0A 5LK7B 2PGFA 4U2YA 5JDBA 3IJLA 3K13A 2HBVA 4JTQA 1CECA 3R4IA 2IC1A 4ZXKA 2RE9A 4GH4C 1BVP1 2W92A 1MR5A 3H9AA 3QMRA 1RUE2 2DU2A 2RDQA 5C5UA 4AEFA 2JEMA 3J26N 3WQ4A 4LLOA 1WPCA 5ISLA 1OX4A 1VBB3 4XE9A 3H7VA 5FBZA 5FYTA 5LW9A 1CPMA 1H2KA 3DBPA 1XISA 2QJHA 3SCQA 2QCEA 3IACA 4O13A 5I06A 3TJ4A 2QAPA 3UG8A 3K8MA 5LXXA 5FAGA 4ZODA 4A3ZA 2TAAA 3TWIA 1I45A 1FMD3 1UWIA 3W70A 2FMNA 4ONUA 1OLME 1X1NA 4F2BA 4AEJA 3ISIX 3FK4A 2WSUA 4DXVA 1EQCA 4B5TA 5K0UB 3M0MA 1DQWA 3E2QA 4DO4A 2JG9A 1MMFA 1N8FA 3ZIZA 1MFVA 3V75A 2HK1A 1NF7A 2WNEA 4LO6B 5DEZA 2Z79A 4C1NA 5FZHA 2E6FA 4JR5A 1CXFA 1CT5A 2WJEA 4GZIA 4PB5A 2IKIA 1C1LA 1NOUA 2CZEA 2OQ7A 4W6XA 4AZCB 4XF4A 4CEXC 1DU3D 4JYFA 1FH7A 3GXNA 4LO7A 1A5UA 2CDOA 4ZB2A 3K48A 1XSRA 2O1QA 3GWQA 1VC4A 1X7IA 1PZ8A 3EDFA 3GK0A 2HWC1 3SUUA 5EL1A 3RNSA 1VP6A 5GNXA 3A4XA 4G56A 4CXXA 5HI0A 4NAOA 3CO8A 3VGHA 3U2ZA 4CNPA 1XIBA 1ZBE1 4XAZA 4H2AA 2ZPXA 2QDRA 4KU7A 1NSJA 2YUEA 1RK5A 4ZR8A 3TKFA 3S0CA 3RYSA 4JX4A 4IV3A 4OLLA 1F31A 2JIJA 4GXMA 1W99A 4AD2A 4IEQA 4GQGA 4J1XA 2J8FA 1WGPA 4O65A 3GZUC 3G0SA 1H7PA 5EMMA 1IR1A 2ORXA 3GTFA 5APAA 1PV8A 3PJXA 4EACA 3TQ0A 4BYYA 2G3FA 2ZA3A 3CB8A 5FF2A 4D6RA 3KDOA 2GJLA 2O14A 3PP7A 4HPXA 3CBNA 1DG6A 1YI7A 3UPMA 4AIOA 3WQGA 1R9XA 1CAVA 1YCIA 3ZPYA 4CSWA 1E9IA 3KB5A 2A6ZA 1JODA 3PM6A 4NE9A 3O3RA 5EYYA 5J5RA 4LALA 5F5QA 3L0NA 4HETA 6ENLA 4KIEA 3UYIA 2FHBA 1WV2A 4FX8A 1SLBA 2BOFX 3BLLA 1RH9A 3V4BA 4HU4A 4AZGA 2SFPA 4L64A 4US5A 2QAFA 3DKJA 2Y34A 2PZNA 5EP9A 3O16A 1G7VA 4X3ZA 3HZ3A 5CFCA 2QYGA 2G4JA 2DUZA 1KRMA 3CL7A 1AQ0A 5GKAC 2QPUA 5C4WC 2HBTA 3NO3A 5FJIA 3VZJA 1NARA 4Q8WA 1HO1A 3WY1A 4IISA 4Q4OA 2QS8A 4QXHA 4DJEC 1Z7AA 4UMAA 1HV0A 2PDWA 4ORMA 4QE5A 3F5KA 1Z7S1 3J7HA 5E5CA 2ICSA 1W9FA 1ODNA 1A8DA 2PS2A 3D3AA 1JD7A 3PNAA 1K45A 2D44A 4RNHA 2WW5A 3AIVA 3WW1A 1L6GA 1T6MA 1OOPB 1X97A 1RUH2 1YJKA 1LJYA 1RUF2 2DQXA 4JCKA 2VMHA 1WMFA 5LCWL 2ZGQA 3LFMA 4H7MA 2RFGA 3TOJA 1AR61 1FKWA 1ICQA 3N17A 5HPCA 3RZGA 1CGUA 1S3TC 1ME9A 2DDUA 3UG5A 2VC6A 1N1YA 3E0WA 2XINA 3JD71 4RDVA 5F1UA 4DMIA 2DZBA 4P5UA 2GVJA 2OO6A 4LTAA 2FCTA 4RQPB 5BUVA 4OHWA 4L56A 2VGFA 4QD2A 3I3QA 2XFWA 2PHDA 3SUVA 3ZLFA 2ET1A 2E0PA 1EP3A 2XONA 4DUVA 4EF9A 1HP5A 4COWA 3N2TA 4IE4A 2HPIA 1GWJA 3VCCA 3ZLHA 3LYEA 3WZ1A 4S3GA 3PS7A 1BPLB 1TQ5A 5FZ9A 4CDUB 3GBDA 1CX4A 2ZXAA 2ZACA 5IAXA 1ZAIA 1TE1B 2CZVA 3STGA 7ODCA 3PUIA 1DLCA 4MFDA 1BVWA 4IE7A 2DV9A 2GNMA 2AMXA 2RGLA 2IZWA 3DXUA 4Q4X3 1ONEA 3EPMA 5FEZA 4MWAB 3FEMA 3OF1A 4WOQA 2YR1A 1W6PB 2V5DA 3W37A 5A3MA 1SZGA 3ILRA 4KFOA 4OHXA 3VUSA 3ZXLA 2PDNA 3W1MA 1W90A 4HXCA 1CZ1A 1TJPA 1RUI3 3ATZA 4CCZA 3TE9A 3VKNA 2PU0A 4KFPA 2PRMA 1MYRA 5H8PA 3UA3A 1NZCA 2GGHA 2QZRA 2WXDM 3V36A 2QPSA 1V70A 1J3QA 2D1ZA 3MGUA 1TA3A 5BNNB 3MYOA 3QHNA 1OD3A 5K7JA 3I2GA 3FCPA 4XBSA 2Z4FA 1OGSA 1UD2A 1G86A 1UR4A 3WLUA 4OUSA 1KR0A 2WFF1 2YA2A 1R38A 1FWWA 1DL3A 2IFRA 2X7VA 3WG4A 3AZVA 1O60A 1BEV2 3G77A 2BVVA 2HVMA 5KINA 1MQRA 1K8YA 5KHIA 5A8GA 4OQVA 4LBNA 1VAMA 2J1UA 3SXWA 4BISA 4ZBCA 1Q6EA 1RD5A 1CWPA 2NVDA 1T6BX 3MSGA 1RC6A 1M01A 5E88A 3FDGA 3DFHA 3GKAA 3M47A 4P9XA 1VBB2 5D4YA 3VBHC 3CUFA 3B40A 3GHUA 1KXVA 4V1YA 5FACA 1PPIA 3BZJA 3O06A 3DXIA 4OE7A 1A5OC 4CQBA 3AS2A 1G9DA 4I6KA 1P8JA 4FPSA 1S0IA 3HM7A 4AWEA 3B4YA 3E49A 3GXMA 4A8IA 4A42A 3AXHA 1FMD2 4BHYA 4DQWA 1PO11 4HHPA 4O1AA 5T9CE 1UD1A 2GDUA 4FS9A 3BLOA 4MG2A 4ACYA 4FOUA 4U10A 1YNYA 3AZYA 3OA5A 2VVEA 3W7CA 4W4QA 4QM8A 3STPA 1CI1A 1EJSC 1R1A2 2AMGA 5CZKA 4QM1A 4LPLA 1MNZA 5E6YA 2OZTA 2D98A 3VDDB 4O7XA 1QQP3 4E4ZA 4PL1A 1NAEA 1S2UA 1TVLA 4JC1A 9RUBA 1VMFA 4YMZA 5IAVA 2CLIA 2FDSA 4D8ZA 2DVAA 2BVBA 1PO21 1E15A 1MPXA 4K21A 3SSJA 3G3MA 4IHCA 1UW8A 3BAXA 2WSYA 2NPIA 4OQ9A 4AIBA 5BXSA 2XJVA 3K75B 4GVIA 2QQOA 3PB0A 3B0XA 3MUZ1 1UPPA 5BOFA 2ZWYA 4QLJA 2O55A 2D73A 1UQXA 2ZMNA 1N7KA 1PZ1A 5BYNA 2Y1HA 4E3TA 2WZR1 2B42B 3T1GA 1HXS3 3AP6A 4ISQA 3BLIA 4GBDA 3VVGA 1HVQA 3SCGA 4L0PA 1A3KA 4BI5A 3LHWA 4AVFA 3I3EA 1HW5A 1J79A 2VULA 1VEPA 3L9CA 3ARXA 4BF5A 4WZFA 3EB2A 1MDRA 3LBOA 4LBLA 4MXWB 4YVXA 3WQEA 2WMIB 5F2IA 4QGMA 5G4EA 3MIBA 4CD8A 1W3KA 4HHMA 3ETQA 5GNZA 1EYEA 4HA0A 2VT0A 1VBD3 3QW3A 1VHCA 3DHDA 1V0AA 1NQKA 2VVFA 2BU9A 1A5AA 1HX6A 1PK6B 2QQNA 1REQB 5EY5A 3KT4A 2P5BA 2DW6A 2ESCA 3HQXA 2BY2A 3GF6A 4L7ZA 5KC5A 1NEYA 4HA3A 5DLCA 3LXBA 1H5VA 1PIV1 4DIQA 5HWMA 3ON7A 4CN1A 1ZP3A 1QEXA 4EN7B 4NNCA 1SR0A 5T54A 1IS6A 3NZ1A 2V81A 1FWAC 1FA2A 5E16A 3ZFFC 1IR2A 1FOBA 2Y6GA 1BYCA 1UZ1A 5XINA 2O9RA 1TTQA 4J40A 1QJFA 3RN6A 3APYA 3K51A 1PGW1 5DQPA 1J58A 2NUXA 3T0TA 4QEEA 3V18A 2HWD1 3POCA 2JXAA 2R0FA 2YLAA 2WZ8A 3HU7A 3WL0A 4FNSA 1X6LA 2JX9A 2E25A 1XINA 1RUC3 2A21A 4FNUA 3ZMRA 1AYM1 2OVUA 4PBPA 2XGIA 4OT7A 2ZX3A 3UU0A 1M65A 1JF6A 3TXZA 1VBE3 3GC2A 4AF0B 3CZJA 1XG3A 2XVNA 4JX6A 3ICJA 1YNPA 1N2VA 4CZSA 5FFOC 4QPIB 4Q8MA 4K37A 3TTQA 5LYRA 1WZMA 5JBEA 2A6VA 2ZX2A 4K20A 3M5YA 3T8QA 3K30A 2MEV1 3KTCA 3C2OA 1XGZA 1NY1A 2GDFA 1G5AA 2BERA 3VPLA 1H9PA 3PZTA 3FA4A 1H1MA 5EMLA 2W9XA 1CXIA 2YU2A 2XLGA 1EC9A 2FHFA 3UZYA 1Q6RA 4XF0A 4YLWA 3O6CA 3O0XA 2VP8A 1JZ3A 4O0ZA 4HOZA 1F4AA 4NHMA 3VZOA 2Q1ZB 1W9UA 4FZIA 5D1IA 4UFKA 4C0BA 4E2GA 2D69A 3R8GA 1XBXA 1XF0A 2RJGA 2VL4A 3DHUA 4F83A 4PMZA 5T5JA 1Y5WA 1NFGA 3KEHA 4EXBA 4XABA 1ASJ1 2G8ZA 4Q33A 2G41A 3SY5A 2XBO1 4QB1A 4AD0A 4YTTA 5DCEA 7TIMA 5JOYA 4Q4X2 4RW3A 1XIDA 1DQ0A 3A0KA 3R79A 3BUVA 1C90A 4LO8A 2QUUA 1OFQA 2D93A 2NXIA 4JYEA 1WOBA 1ZB5A 4TO8A 1TVPA 3DKQA 2A73B 2JGQA 3JZUA 5JBFA 4HPJA 1XQKA 3PPCA 4OHYA 1B3YA 1GJUA 1UX7A 4HSOA 3GXUA 3T0BA 3H8UA 5B2GB 4YNIA 3AMGA 3W1XA 2EG8A 4BIOA 3CIXA 5DO8A 1H49A 3NJVA 5U4NA 4EWEA 5C9XA 1E1FA 1WW6A 3THUA 2J1VA 3U7VA 2XZ9A 4OU1A 1VFTA 3EX1A 2FFIA 4DINB 4I8YA 1EDTA 1A0DA 1F6YA 1VLIA 5HR6A 3OW1A 3V0TA 2VE1A 5FESA 4WKFA 5LA9A 2A79A 4F0HA 1LYXA 2P0OA 4Q6JA 3M0VA 4EN0A 3VGBA 5B7ZA 3HQUA 2HS6A 1C8QA 3PIGA 5L7OC 2VR5A 3EKGA 2VOTA 4FO9A 2R91A 3D46A 1YLLA 3N1AA 4NAEB 2WO2A 5ABFA 3D5HA 4E2BA 2JDYA 1YEWA 3DG3A 2NLRA 3N14A 1RITA 2HXTA 2X41A 1DJXA 3TOPA 1NU5A 3NSTA 4GIRA 3HPNA 1KTCA 2VFFA 8XIAA 3I2IA 4BQWA 3OA3A 3SECA 4PFHA 5A1FA 3VC6A 1TNRA 2E26A 5IW0A 1UKQA 4RZ5A 4AHYA 3F03K 1P4CA 1W05A 4PCTA 3UKVA 4OECA 1AXKA 1ND3B 1CCWB 1W2UA 1KCZA 4LE4A 1XHGA 2XXZA 1F3WA 3U1XA 4FPOB 2GC0A 5G05L 2VC5A 4GUFA 3LK6A 4HGXA 5GZGA 1YNAA 5A7QA 4DPNA 3MU7A 4Y24A 4COYA 2CERA 1N3OA 2YB4A 3R58A 1QQP2 1EYWA 2YFOA 3QV8A 4MAVA 4PMQA 2ZRWA 3MSYA 3AIEA 5FPAA 3BQ5A 3WK2A 1E0VA 4LWWA 4YVSA 1HXJA 3MLLA 1OFEA 3ITLA 4I0WB 3VZMA 1JCLA 4K2SA 4GACA 4H01A 4ASTA 2PP1A 1VJZA 1EGMA 4XZUG 1JMUB 4TUFA 3GUGA 4NL1A 2XWBB 3Q45A 1EO7A 1TX0A 1XE7A 5FXVA 3TC3A 1TTIA 3WDVA 5AVHA 4DBEA 4PLOA 5FPLA 3NOEA 4YCOA 4KWSA 5HNUA 4HKLA 3N19B 1ADOA 4B4HA 1WLDA 4GVGA 4B92A 3G1XA 1ZRCA 2E6VA 2H8XA 1XU1A 4ZY9A 4HCHA 3UGFA 1JAEA 2QMJA 3S2CA 5LBBA 2DFCA 4EWDA 3IT8A 4B90A 4LOTA 4GZ9A 1LU2A 3BGJA 3UJOA 4GE8A 4ET7A 5ABHA 4TU1A 1SW7A 4H9TA 2JD4A 2NUYA 3WN6A 4J1WA 2PGRA 2Y6ZA 4IPJA 1UOGA 2Y6FA 1IF2A 2PAMA 3TEWA 4KBXA 4LOSA 1W8ZA 3FYOA 1W0MA 4BQ5A 5KXEA 5TAOA 4AI9A 2ACQA 2GC1A 3VX0A 4M7TA 2P3YA 4WD0A 2H3DA 5KXBA 3ZDVA 5SWUA 2ZUUA 4OVXA 1CESA 3TEVA 4JTAA 1EAH1 1HQLA 2YGMA 4AVBA 8RUCA 2ZUVA 2OT0A 4NHKA 4Y1XA 3AZZA 1WDPA 4EXQA 3WX5A 5D38A 4AE2A 3H22A 4W7WA 4D6HA 2QJNA 3GFYA 1H1AA 4PCNA 4LBQA 4XEZA 4WJEA 2OKTA 1E5SA 4QAWA 4RHV1 4N90A 2E33A 1OH4A 2HWF1 3VKOA 1S1PA 3ALQA 2IPWA 3LTYA 3RYKA 4HPNA 2A6XA 4GB33 3OJGA 3GCXA 3EHKA 2QVNA 3TNOA 2WO7A 4XUYA 3NL5A 4DYJA 4GYPA 5I03A 3QKEA 2VHLA 5I0RA 3OYXA 4A3QA 3APGA 4X2PA 3EJKA 3QZ6A 1ZRIA 3WOGA 1WBFA 1LUCB 4CNNA 3UXAA 1EA0A 4CDWA 2ORZA 3WQFA 4COVA 1VBA1 3U48A 3DYOA 3KVBA 1ALDA 5LIYX 3MJYA 2J7FA 3CH9A 4RZ4A 1JPHA 4PDWB 1DTUA 1U22A 4XTDA 1UU6A 1GSLA 3M1HA 3RPMA 5PTDA 1XSIA 2WJFA 1LG1A 4GQ0A 4Q4PA 1X1ZA 4UI9L 1V02A 1ITCA 3LUTA 3H42B 2QT3A 3DZ1A 4N9CA 1BMV1 3IS4A 2C1HA 3VL9A 4NX0A 5K0UC 4LUTA 5FYHA 4BA6A 4RR4A 2Y8KA 1QKQA 2GU9A 2IXUA 4HQVA 2OYMA 2ZABA 3ZXEA 3BURA 5CEHA 5DG1A 1SMDA 1B3WA 2PTWA 4GWEA 4ML9A 2A7AA 4N53B 5T55A 4N9EA 5G4WA 4JQAA 4BF7A 4PTMA 5IFTA 1UAIA 3W5MA 2AREA 4XFGA 5IT6A 1TME3 1PIFA 3WLSA 3M16A 4F0LA 1YADA 4NJIA 1JYVA 4ZQNA 4GY7A 2C3ZA 2AL2B 3I3BA 4Y9PA 2I56A 3QMTA 3MIDA 6ALDA 2GJPA 4YTSA 1Q8QA 4JTGA 4M3CE 1K03A 2CU5A 3THDA 3VKAA 1NDWA 1J4EA 2R8WA 2YA1A 3VGGA 2BTVC 4GKLA 3W74A 5I3DA 5TBOA 1D4M1 1KFBA 1XUUA 2PDMA 3K2OA 1HF6A 2ZADA 5T52A 2R071 4XURA 1HZYA 2VZOA 1AMYA 4C5YA 1FV3A 1DJYA 4AZ7A 4WRHA 4AHPA 5CQ1A 1YFUA 2NN8A 4X61A 5D03A 2VJXA 4UBGA 3N4EA 3IPVA 4YW4A 1OGBA 2JG8A 3SQOA 1J12A 1R081 4DOUA 5JZGB 2PD9A 2WC7A 3WUEA 4Q0VA 4FOQA 1PXGA 3WW3A 5KBFA 4AY7A 5DANA 2JBMA 2VUCA 3M0XA 3GHNA 4OJYA 3W20A 1Z89A 1NF0A 4CYDA 5F2SA 1R091 2AR6A 4RDZA 2A7PA 3GDMA 4J7RA 1N55A 3KM8A 4AMCA 1ODMA 1W8WA 2D3SA 1F7BA 4PBEA 1C9WA 3GTNA 3PB2A 4X2RA 3R0KA 3ABQA 4V28A 1XH1A 3GO2A 1DJHA 2QW5A 4REQA 2P3KA 3BK0A 4CD4A 1X7NA 5DN1A 5CVRA 4BXFA 4MSSA 3KLSA 4LR4A 2XWDA 1WCGA 4Q4MA 4F79A 3C56A 5GPRA 4M3CF 1AR72 1CIWA 1UZDA 4W86A 3KCYA 2GUUA 1UWSA 3ZSKA 5EJ3A 5DUUA 3CC1A 1VYPX 5HPOA 3VGFA 5JH1A 5M1TA 1E0XA 2PFWA 1WDDA 5KZ6A 4N6FA 1JXKA 1JCXA 4JTJA 4PMXA 2PHTA 4IQLA 4K6AA 4INFA 1W8TA 5GJNA 3BB6A 4PN2A 3B01A 3AMPA 3VOGA 1OOPC 1MWOA 1RPXA 4QHRA 1TMF2 3AJYA 1WBJA 4ZU5A 3UKNA 3NWKA 2NWRA 1COV2 4IPNB 5E89A 1UWTA 3G0UA 4GXPA 3UA4A 5EFUA 4MH0E 1UY0A 3WG6A 3LEKA 1B3ZA 4DM1A 4CEWB 3ITQA 1RD6A 3THPA 1RP8A 1XX1A 1FKXA 4C6EA 4Z1YA 5FD0A 2QHAA 4Y5Z0 2J27A 3LA7A 1V6LA 5D04C 5FY9A 3TYEA 1RBAA 4FCAA 1POV0 1YE6A 1LQ0A 4HMNA 1JYTA 5H9RA 1W9BM 4P5HA 3I7RA 3AYSA 1HQTA 3K3OA 1R2TA 1FOD2 4D2JA 4LBJA 1ISVA 5C9AB 3ROUA 5I77A 3OJBA 2XGZA 1JIBA 2JE7A 2QDDA 1KLZA 1MUCA 1RY8A 2Z6JA 3A12A 3JQXA 5U7SA 3U4SA 2OSYA 3LI0A 2DT1A 4H7LA 4A4AA 4QDSA 3NPVA 2VPVA 4CDUC 4Z1CA 2DBIA 2H9AB 5BNKA 1BYHA 2IS7A 1Z0HA 4ZE5A 1VS1A 3ONCA 2JICA 1X1OA 3J8F2 2GK1B 3AMDA 3IJ9A 2DT3A 1OC1A 1Y43B 1QWKA 4LF2A 4FFIA 3EDEA 4IERA 3T44A 2YB7A 3WQ0A 5FP8A 1Y7VA 3LTSA 1QUMA 3VBSA 1EDQA 1LL7A 4MWAC 3E5UA 3W58A 5K2ZA 5DAVA 1UASA 2DUQA 1IQDC 4C0HA 2VFDA 2GVLA 1VZWA 2Y8VA 3WLOA 3CNAA 2VR4A 5EB8A 2FVKA 5H9PA 3FLRA 1GWLA 2J7CA 1LF1A 2Q71A 1KFLA 3BCJA 3ITTA 1MEHA 3KBSA 2DVGA 6XIAA 4ATEA 4HYVA 2WLZA 3PUHA 4DPPA 2YB1A 3SCRA 1XNCA 1DWIM 3GJAA 4WDUA 2ZKMX 4Q8VA 3C61A 4JFWA 1XQLA 4N2YA 2BVDA 2OZ0A 3LM7A 4XD6A 3POWA 1H7XA 4NVPA 2INEA 4UOJA 3LHVA 3T78A 2YDAA 1W3NA 2W62A 3G1DA 5FK8A 3G1YA 2B4GA 3MDPA 2WSPA 1U1UA 5D9MA 3O15A 3AMNA 3HG2A 1HDKA 2A3HA 4BF9A 4GB32 3BIEA 1P5BA 1TZZA 1FWRA 1D7PM 1A0EA 1ND2B 1PX8A 3BH4A 3UCCA 3CZUA 3MI8A 3ITCA 3O1TA 4Z1BA 4X6QB 2XFRA 4XIKA 1JZ4A 5HINA 3NQBA 1VEMA 1FH9A 2X5IB 1DYOA 3QOKA 3SIMA 1GOMA 4F0RA 3I2FA 3QHOA 5FO8B 4XHBA 4V33A 3NPWA 1FWCC 4YVWC 2ZC8A 4ML4A 6REQB 5F6KA 1MUMA 2CLFA 4JD4A 4O18A 1UKOA 1BWVA 2PMQA 4GRSA 2GH8A 1DJWA 3W6MA 2GSYA 2G9ZA 2J7GA 1VBC3 5LEJA 2NQLA 3PAOA 5IHSA 5A1AA 3XIMA 1UBPC 2NQJA 4R9XA 1B35A 2BHZA 4IX0A 3W7EA 1HTIA 4MPQA 5HXVA 2YL9A 4M0HA 4PQQA 3KWSA 3ARRA 3I2KA 2ERFA 2K9ZA 3MHZA 3GHMA 3T2QA 4DXRA 1CGPA 3CUJA 6XIMA 5I79A 3S47A 3B8DA 3N36A 4XF1A 2WUHA 3M4FA 3P5ZA 2CDPA 3ZFEB 3C2UA 2OGJA 1DHPA 3BYWA 1RVF1 1PKNA 4F0MA 4UZUA 5FMCA 4GVHA 1QNYA 1TME2 1G4TA 1W1TA 1C8M3 3T2OA 2BHYA 1IQAA 3IDEA 1XW8A 1E1CB 4MOAA 5C0QA 3GKFA 1HL9A 4C1XA 1S5WA 3MANA 1IZKA 3O6YX 2PHXA 4MB5A 5IK4A 4E4DX 1O1HA 3WNOA 4JHTA 5F6LB 1YDVA 3OPTA 2FJUB 4FNQA 3KF5A 4C91A 4YHGA 2W1WA 1FX5A 4IE5A 3EB7A 2DUXA 3W6YA 3W7PA 3LCFA 4A8NA 5T26A 4UOZA 1RUJ3 3NO1A 3MTWA 3VILA 4RPPA 2IPGA 2V3EA 4NJHA 4FEZA 4JKMA 2GNTA 3UY7A 1W6NA 3WNLA 2VZTA 2E9QA 3IMMA 3WLLA 3UZXA 3KVAA 1QHPA 4QPWA 4UW3A 4I9TA 1DVJA 1C92A 4CUBA 3LBCA 3YPIA 3EEGA 3QQ1A 2XWEA 5DUVA 2WLQA 1NDVA 4A21A 1I9RA 1H50A 1DORA 1G4SA 4NU7A 5FXXA 1YPXA 4FXGB 3MWAA 1L7QA 2FH8A 5FY0A 4NJJA 2WWJA 4ENLA 1K5JA 3VDBA 1GPWA 3MPGA 4IUGA 4LBRA 1S0JA 4YG0A 2AYHA 2W67A 1ENXA 1REDA 4RL7A 1W5NA 3UPBA 4L61A 4OOUA 3UGGA 5J7MA 1YBQA 3M64A 1DWFM 1W3VA 3DGBA 4LXLA 4KWUA 3NCOA 2DF7A 2KXLA 4XAYA 4DZHA 4CQDA 1FHLA 2XIMA 4MGYE 4QPYA 3O07A 1R3RA 3GU9A 3WJXA 1RIRA 1FY6A 5A3TA 4DI8A 4XUTA 2VMCA 1EY2A 4ES4A 1OPMA 3PDQA 4COZA 5IWFA 3H2NA 1BSLA 2ZCGA 4IFOA 4XKMA 2YG0A 3WBAA 1MRQA 3NAPA 2VFGA 3CAVA 4AEEA 1UN1A 2VCCA 3AL5A 1GOQA 2Y4SA 1OQEA 4N43B 2D2OA 2IXHA 1ULPA 4XIAA 3NQ2A 3CHXA 5A7NA 3UWUA 5IVEA 3RCMA 2YZ5A 3M0KA 4OIFA 4QPIC 3BJFA 4O0QA 3DG7A 2ISVA 4JRAA 3DIPA 3KGZA 3MCOA 2ATSA 3VD5A 3NNGA 1RL3A 1W28A 4LLFA 3CDZB 3R4DB 3W73A 2YOCA 4GKXA 3R4UA 4F2TA 4JIQA 1LGBA 4BZ4A 3DFPA 4M4RA 3RMYA 4KL1A 3UR8A 1RUSA 4FF7A 1TYGA 4D94A 4B3NA 1JF5A 5HJXA 3NUKA 4ATWA 5C3SA 2J74A 3ZOAA 3LB9A 4N9HA 2WBKA 3DPRB 2Y38A 3NDYA 1W9WA 3BOPA 2W79A 3U57A 1M7OA 3LNPA 1SR9A 2I57A 2XSAA 1XYBA 3BSHA 3KLLA 4GKTA 4JTNA 5JCTA 1Q2SA 3A24A 3A3HA 1B9ZA 4GLEA 2BNNA 3BAIA 4AC1X 1K3UA 5BRQA 1FCVA 1MVYA 3CBWA 5JU6A 1NY72 4WM8A 1LT7A 2WZPP 4DBWA 4LO4B 4F4RA 2A7NA 5SV8A 2R062 1MQPA 3C8FA 4AVNA 2VENA 5HCBA 4YN5A 2NSXA 4C6LA 1Q7ZA 2VEPA 3A5FA 4DY3A 3ZWSA 5C2GA 1LHVA 2GVEA 3PZQA 2VWTA 4H7ZA 4XIOA 2PC4A 3FHQA 2VGGA 5JSOA 2XB6C 3LMYA 1A50A 1LRHA 1SGJA 5TD4A 4XZBA 3URNA 4D7SA 3I2JA 4OFCA 1AXZA 1Q8SA 5CISA 4G9SB 1SPQA 1XCXA 4WXYA 3NQHA 1G6NA 5LATA 4H7CA 2IUWA 4BJHA 2EIGA 1UR0A 2ZQ0A 4I3PA 5AKQA 3S46A 5KZEA 1ZA4A 2WLPA 1Q8JA 2HPMA 2XLFA 3WLIA 3TV8A 2O56A 4U3CA 2BX7A 3GG0A 1V08A 4RQPA 1MQTC 1IIGA 2XGBA 3P60A 1C29A 4QX8A 4JTEA 4MUZA 3AL6A 1NA1B 3QQ0A 1B57A 4LX4A 3ZVHB 2WWSA 4DYEA 2VNCA 5FKCA 3VFLA 3W53A 4UTIA 2O0TA 1A80A 3PZGA 3RLGA 4XDQA 4LEFA 4ZL1A 2QR6A 1DJQA 5CPMA 4Q4V1 2ZXBA 1ZBKA 2X42A 3MZHA 1OT5A 2Y8UA 3H54A 5JH2A 4IIBA 5HUPA 2GN3A 4PF5A 1R3SA 1APNA 1ICPA 5CCZA 4YVVA 4XF9A 2I5QA 3WXPA 2C5DA 5FPXA 2HEVF 1SYTA 4YSFA 1AH4A 1UD4A 1W6PA 5AC93 3QKZA 5F1RA 1YYNA 4UW5A 4ZQRA 1GP6A 9XIMA 3LA4A 4ZA0A 3NQAA 4A2RA 1I8JA 3CHCA 3DI0A 2BVTA 1WCKA 1KV5A 1US3A 4DM2A 4C6KA 3RYPA 1EDGA 1MQQA 3C7FA 3FBMA 3VI2A 1K12A 1TVGA 5JR7B 3NVDA 1M7XA 2DUOA 1I5ZA 4R3UA 4WHBA 2INZA 3PR2A 4H6EA 4YNGA 3RX3A 3TN3A 4TWTA 3DEMA 1CZVA 4GD4A 4QJ4B 5FYUA 3PJYA 3ZXDA 4P2VA 7TAAA 3CL1A 2PBOA 4QNEA 1DLLA 2Z00A 4BFAA 3RWNA 2NV1A 3B06A 3VBFB 4IMCA 4F9JA 1AQHA 1QJY3 1DJNA 1AJ0A 5GLVA 4U2ZA 3S4TA 1AX1A 2PDPA 4GFIA 4JTFA 4O19A 2QUTA 1VYRA 1DE6A 1R9ZA 3A4JA 4L6OA 1RUJ2 2VECA 1P0DA 5CPNA 3TB0A 4OV4A 3WP6A 1JRCA 2CZDA 4CDXB 4C7GA 1FAYA 2ETEA 2R1LA 3DKWA 4CVWA 4WR3A 3TMQA 1F3EA 5DXYA 4AQTA 5AYZA 4BKNA 1E0TA 5EIYB 3QYQA 4NZ1A 4AVTA 4ZS2A 4V2WA 2ISSA 3CUXA 3E5XA 4CN4A 5LZ6A 4CD7A 2RDRA 2FB3A 4LIVA 5CKSA 2POTA 2G9FA 1Q7MA 2HEWF 5DY2A 4H9VA 1OUXA 5ABJB 1NP0A 1C5HA 3IJ6A 2HTMA 2J1AA 1MRAA 4LVGA 2CBIA 3OHIA 3WX7A 5CKMA 5J1XA 4FLOA 4YW6A 4KQNA 1PGSA 2OSXA 1JJKA 4Z17A 5K9YA 4LQRA 2R1MA 3TYZA 5M5DA 2PU1A 4H41A 4CXYA 1ESWA 4F7ZA 1U1JA 2QZ2A 2OXNA 5DRIA 2R82A 3ZN5A 3VDDA 3VNJA 4WOZA 5D21A 3MW3A 4KCWA 4MZYA 1DYPA 3NJ3A 4URIA 4IQPA 2R043 3TYCA 1GOWA 2RM23 3BW2A 2XVPA 4FVVA 3CMJA 2BW8A 3MI3A 3JB8A 1JUIA 3RPTA 2ISWA 4OCTA 4DY1A 2Q8OA 3DEQA 3O63A 4I7WA 3L5MA 3HGSA 2RMU3 3QH6A 4MGQA 3IVUA 3ZS4A 3KTSA 4LUMA 5JOZA 1E3ZA 2VEIA 3PTMA 1J01A 1KBKA 2OTDA 2DSWA 2VNVA 4B7EA 1PZ3A 3GNRA 4JTDA 1OA3A 4PDWC 3F1QA 1F9KA 4N7QA 1H5YA 4M6QA 1POJA 1H2JA 3S8HA 4AFBA 4B5XA 4GI9A 4XBNA 1OADA 4TXWA 3PTQA 2VRJA 3H4WA 2VZPA 3AROA 1HQNA 2VQTA 1LEDA 4RXFA 2Y2WA 1V6MA 1AUYA 4P7OA 2Z1BA 3NOYA 3EOUA 1VFHA 3U5UA 4P9LA 4DXKA 4MXWA 4QLLA 5DBTA 1Q8PA 2CSGA 1C9DA 4N53C 4Q26A 5HDRA 2RUSA 5JMOA 2K2SA 1R3VA 3GNPA 4FLSA 2D0HA 2PPGA 2OU4A 2Q8EA 1TWWA 1PMIA 4H4IA 1VBUA 3LTPA 1NCQC 1XLEA 3RLHA 1PK6A 4Y90A 3L5LA 1TCMA 5CLWA 1X50A 4PMNA 1VRH2 2DDXA 1WB0A 5IK7A 3UWQA 4B2DD 2Z29A 1OIMA 4K68A 2J9XA 4XZHA 3IRDA 3TQPA 3LE0A 1KD0A 3DX5A 2ZS6B 5ACA2 4CD6A 1GUIA 4WJ8A 3EXSA 5FZOA 3RPQA 1PYFA 1OY0A 3ZVIA 3FFZA 3B0UX 2WZMA 4BLJA 2PGWA 3L4ZA 5A8OA 4AD5A 4M1RA 2D6OX 3N34A 2YC2A 1RMU3 4NPMA 1BQGA 4K7JA 1XNBA 5CAZA 2GFTA 4B3ZA 3WEZA 4AEKA 1QJZA 1FV2A 2B0MA 5JZGC 4J3WA 1J93A 5FJUA 3ZJ7A 1R46A 1QOQA 4UR9A 2DZTA 1GPFA 2FDGA 4BE3A 1TSIA 4WSKA 2O8QA 3S83A 2JEQA 3ZT6A 1FYUA 2CAUA 2VUAA 2WNWA 5A8PA 4PRRA 2XH0A 1GZ1A 4BQ4A 5A8MA 4GCAA 1DHKA 1AFSA 3WCSA 2I07B 3F95A 4Z08A 2J6XA 1AHSA 2G3IA 4DAIA 3ACFA 2WCGA 1ZREA 3FIGA 5DMNA 4AZ5A 1JOPA 4N8MA 3LGDA 4QKFA 3O0FA 3VOJA 3IB3A 4BMBA 4BQ3A 4IMDA 2HNHA 3QCWA 3WQOA 3B03A 1IT8A 3ZYJB 3G1SA 3IIIA 4A29A 3CPRA 3UR5A 3HPZA 1ISZA 3BW4A 2D2GA 3O14A 1VB4A 2ZVIA 1BXNA 3LPGA 5T5LA 2AEYA 2VBBA 4IIHA 1SVDA 3TX9A 3T1LA 4U5IA 4LC8A 1JZ2A 3NDOA 3CH0A 3Q58A 3GR7A 5CJ5A 4RE2A 3P0XA 2Q8XA 4AIEA 2J62A 2VMGA 3L4WA 3B00A 1H1IA 3PIJA 3CZEA 3DGRA 3S2MA 4XFAA 1XNDA 4QE4A 5LSMA 4LB4A 4U33A 3WH7A 2XL9A 3UYCA 2FBEA 5JPNB 1JPDX 4L6DA 4M6VA 1MW0A 4P7NA 4TXEA 5LGZA 3PUAA 2Y24A 4AY1A 1XIJA 3CHEA 1EHAA 3ZXJA 4K8FA 2R49A 4TLGA 1FWEC 1XYZA 2VUNA 1E6NA 3S6TA 5FF7A 2XUEA 3FLTA 2BVWA 4QXBA 4ZFMA 2DVXA 4AZHA 4ADSA 5C9AC 5F2WA 4QP0A 1KM1A 2R9RA 1QJY2 2GVGA 4AW7A 2R6QA 3NV2A 4MADA 4CRQA 2Q6ZA 2DIJA 3PZOA 2G3JA 3K77A 4BU2A 4G4FA 3N73A 3CJXA 1DPMA 1WKEA 4RNIA 3S0MA 2GYIA 5HCAA 3IIZA 3WF2A 2XVKA 1W9XA 3HQOA 5D9OA 5A6SA 3V1HA 4DWSA 4XK2A 1X8MA 1H8TB 3WW4A 1RTVA 1WW4A 2V5YA 1UYXA 4GALA 4M81A 3M1ZA 1G6CA 3VNKA 1O7AA 3SEPA 1E4IA 1KGXA 2IWGB 3GS6A 1GYKA 1H1YA 1S0CA 4IG2A 3N9NA 4BIFA 1MEWA 4LTSA 1ND3A 4FQZA 1X38A 3GXFA 3O1VA 2RV9A 1NLSA 1W6QA 5HQMA 2V67A 2C26A 3DHPA 1R1A1 1QJX2 4QCFA 2V9DA 1I0DA 4C5ZA 3WP5A 1XLFA 3P81A 3ES1A 3H53A 4KWLA 1NWTA 1F73A 1YLVA 4W88A 4JGDA 1UKTA 1JCTA 3HO8A 1LLZA 5FYYA 3OGVA 2VQ0A 4F8AA 4JGYB 4FSAA 2VXNA 3C4UA 4MVAA 3PWAA 1CYGA 3VV1A 1JD9A 1OVPA 2X5IC 2RMU2 2PDKA 3OGGA 3IEBA 4MZ1A 4OI2A 4KRZA 4FPFA 4K1ZA 3KF3A 1HX0A 5D2VA 3M3EA 3THQA 2P8CA 5E09A 4JTLA 4PMUA 4GX8A 2C14A 1NE4A 3VKBA 1OURA 2PC8A 1XICA 5EPAA 3H12A 1NM9A 3ONBA 1HJSA 1XBZA 4WF7A 1W5OA 1S3HA 3NJXA 4L1XA 1OZQA 2ZIDA 3LSEA 1S2AA 4FXFA 3S1VA 4NN0A 4M80A 1CTNA 4AYGA 3ARSA 2A5HA 2CHHA 5LBCA 5FY1A 5A33B 3BAKA 2EVXA 4RS5B 3GVWA 3GW3A 5ENLA 3MF6A 3PSVA 4L80A 1K4GA 2CITA 3O1RA 3ZIWA 1NXMA 1QPOA 2FZ9A 3GAKA 3H55A 1CEOA 1JXJA 1MZ6A 2W4XA 3N29A 1FPN3 1J5TA 1GQKA 1F5JA 5D02A 4HNCA 4NHLA 5T3NA 4JGZB 5CBBA 1VPXA 2R1KA 1Q7QA 2NMOA 3ES8A 5BOOA 1BBT1 5A6YA 1V6VA 4HSJA 4E9KA 2HV5A 3AHXA 1CZSA 4K3UA 2VXJA 4ADTA 4M0NA 5EWSA 3BI3A 2XH2A 4HU3A 2C0ZA 2OYKA 1F6PA 5C6CA 4HU0A 4ZOBA 3FHAA 4DJFA 4LNYA 1SPPB 1LOEA 3LXAA 3PG8A 1QBBA 4P9YA 4MGTA 3GZ3A 2OYZA 3DFNA 4L4LA 4CCOA 1S5TA 3FC0A 1JYCA 4N4PA 3LKJA 5DT7A 4IUOA 4YFZA 5MKGB 1TJ2A 1UPSA 2PDUA 4UNKA 1DOSA 4TV6A 5BXRA 2WL1A 1TQXA 1FWIC 2DFAA 3JW7A 1GANA 3MV11 3H24A 3AYAA 4LHNA 3OLIA 3WELA 1WP6A 4AU0A 2CLOA 5JSRA 4HKPA 4IFRA 5AC8A 2VC7A 1QRQA 3ITVA 1K5MC 2CBUA 4QPGB 4I01A 4Q29A 2OX0A 1LOQA 1OZMA 4MNJA 2Q8LA 2YFUA 4FXSA 4TMCA 2ZEYA 2JQXA 3GLCA 3B9AA 2J7BA 2LUWA 4LV4A 3R4SA 1JS9A 1EFZA 3P5BA 4UXAA 4X8NA 3ZYRA 1M4WA 1N8IA 3GW0A 4GINA 4RZBA 2WIIB 4D72A 2YZRA 5BNPA 4F40A 2J9YA 1JQVA 4CD5A 4H55A 4QU1A 3I59B 1TB3A 1MZ5A 2WNUA 1DJGA 2V8ZA 5IVYA 3EDJA 2NQZA 1EWEA 3M5ZA 1GNXA 2RR11 2D3LA 5DQ0A 3RM9A 4CDQA 4R4XA 3PULA 1G94A 2BOGX 5T91A 3TSBA 8TIMA 5BRBA 2WKKA 3I6TA 2E67A 1NCRB 1UMIA 2Z7KA 1PE1A 2G4IA 3Q67A 2EXKA 5BXPA 3D47A 1WLCA 2ARXA 1J0KA 2EIBA 3OVRA 2FDMA 4RDYA 2NMNA 4DB5A 3R11A 4R27A 3H4GA 2QV4A 5FDBA 2ZICA 4OZXA 3PF3A 3V5FA 3FL7A 3CAQA 4ERIA 3GFZA 2ZGRA 3GXTA 4AXNA 1LZOA 3H3UA 4G6CA 5LY2A 5HMEA 4YTQA 1LODA 1E0UA 2X7WA 2WN2A 4N43C 1JN2P 4M51A 1QW7A 1ULDA 2F6BA 2QQMA 3KUMA 5FF0A 1H63A 3VBRA 3QZEA 2PZ0A 3NSMA 3T0AA 1W56A 2REQA 3G7DA 5I3JA 2VCMA 1V6UA 2VBDA 4M6PA 1ECQA 1GR3A 3ZLIA 3VKMA 4S2GA 4K8RB 4HK8A 3MO7A 5FZ8A 2UU8A 1F3TA 1P1MA 1AQMA 3GM8A 1RB8G 1V6KA 1EZ2A 5A3LA 1KFCA 4G7FA 2CYFA 2VMEA 2VDIA 3BV7A 3UF9A 1Y5VA 3DPRC 4J28A 4NAMA 1GVEA 1AW1A 3VN4A 3E97A 1K9FA 1UP3A 3VC5A 4UW4A 1A6CA 1GLHA 1SLCA 3PVFA 3ARYA 3ZXGA 3SJ3A 1RCQA 1VFSA 5JIUA 3U0HA 4XBJA 4Z8BA 3OTRA 3H2OA 3ABXA 4OOZA 3LCXA 2INFA 3UG4A 1NLRA 3ID7A 4JFTA 3W26A 1S1RA 4GUGA 3U4XA 2HS8A 3NWRA 2EALA 3RLUA 3AIUA 2H6BA 5D8WA 3OIXA 3HMJG 5BNOB 3KWXA 1ZRDA 3AHZA 3IN9A 1SSDA 4W5UA 1W17A 2E1DA 3FGCB 3I2DA 3MW2A 2PLV1 1D3GA 3LZ5A 4O8RA 1S5NA 4PCFA 1ULCA 2A3BA 1J96A 2B7OA 1KS5A 1IEQA 4OGZA 3U14A 2CYGA 3W4RA 2CGNA 3M0IA 1TVNA 4CEWA 1OFNA 1KA9F 4GJYA 1R86A 1RPKA 4NVTA 1QQP1 5FZ3A 1W1YA 3VKFC 4QQUA 4E2SA 5KITA 2P34A 4S3AA 4Z2WA 3RYRA 2PE4A 1JDEA 1UYQA 4L9ZA 4K36A 3SY1A 2E3ZA 2AGSA 1GZWB 4Y33A 3VIIA 1SSGA 3NW4A 2B7YA 3GNXA 1NA1C 1POKA 4L9YA 4AVOA 1PWMA 4Q32A 3UZJA 3H21A 2R1DA 4IETA 1FDYA 4XILA 1XLBA 1HFBA 1KGWA 5F4SA 3OOQA 2PLKA 1L7RA 4AFMA 1I6NA 1QT1A 4F9DA 4PUNA 4US5D 1NAL1 1E9ZB 2RS13 2OW4A 3ITXA 5FMDA 3P0WA 5FXZA 4EOUA 3FJ4A 5J48A 2PLMA 3W9ZA 4S3JA 1V6WA 3HG4A 2ZEXA 3GXDA 1H3GA 2YCEA 2DSUA 3CJPA 1HJGA 5F3IA 4AXKA 2JECA 1AK5A 5L9BA 2F17A 5FPBA 5BV6A 1AR83 1CLKA 2GOKA 4IQEA 3DF0A 1CZTA 3WUDA 4DEVA 2DGAA 3C0JA 1UY3A 1MXGA 1XLMA 4HPGA 3NO5A 3W2MA 2VZ3A 3BLDA 4MNMA 4Q0PA 2VMIA 1ZY9A 2BOIA 2E77A 4X22A 1JR1A 3AJZA 1TPH1 5FZ0A 2NXGA 3VDAA 2JIWA 3RXZA 4E6MA 3Q8CA 1IV8A 3AXIA 1NVMA 4F0SA 4DZIA 2Q4SA 4IEYA 4XYXA 4L4PA 4HNVA 4Y1YA 1CXEA 1VPQA 1JZ5A 3TNBA 3FN9A 3IIOA 4YZ4A 4Z92B 1CDGA 5AECA 1XU2A 1ND2A 2AKMA 4F66A 3AIWA 3SCPA 3TZFA 4XDPA 4YW2A 4N7UA 3M3QA 4YRDA 1GNHA 4AFCA 3EDKA 2V3FA 2VFHA 1GOFA 2WO1A 3I8TA 4HPHA 1H62A 4YS1A 4E4FA 1MS0A 2Y62A 4UIOA 4CP9B 4QJ5B 2PDQA 1Y3TA 2D6KA 2YPJA 1GHSA 2XJPA 1W39A 4NJ4A 1KM4A 5XIAA 6REQA 2NZ9A 1W6OB 3U4AA 1DWAM 1W9VA 3WLNA 3H6OA 1WKFA 3QOPA 3BDKA 4Y2WA 4XAPA 3WQPA 4Y9AA 4YARA 2WB5A 2E28A 4GH4B 1L6YA 2ZZ5A 1OCJA 4AH7A 1DGRA 3POYA 2WPBA 4AQ2A 4BWLC 2VD7A 5ABJC 4HTYA