3GZAA

Crystal structure of putative alpha-l-fucosidase (np_812709.1) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
438
structure length
438
Chain Sequence
ELPVPKPHQLKWHEAEMGAVFHYDLHVFDGIRYGQGNNRINPIEDYNIFNPTELNTDQWVQAAKAAGCKFAVLTATHETGFGLWQSDVNPYCLKAVKWRDGKGDIVRDFVNSCRKYGLQPGIYIGIRWNSLLGIHNFKAEGEGAFARNRQAWYKRLCEKMVTELCTRYGDLYMIWFDGGADDPRADGPDVEPIVNKYQPNCLFYHNIDRADFRWGGSETGTVEYPCWSTFPVPCSHHKRIESSIDQLELLKHGDKNGRYWVPAMADTPLRGANGRHEWFWEPDDENNIYPLNTLMDKYEKSVGRNATLILGLTPDPTGLIPAGDAQRLKEMGDEINRRFSSPIARISGQKKSLTLKLGKEQSVNYCIIQENIKNGERIRQYQIEAKVNGKWQTVCKGESVGHKRIEKFEPVEATALRLTVSESIALPDIINFSAYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords putative alpha-L-fucosidase
total genus 140
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1510 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gzaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gzaA01
3AHVA 1G1YA 1TE1A 4PMVA 4GQRA 4QCFA 4MDPA 1CDGA 4PTVA 2BHZA 1GORA 3AFBA 3WF0A 2EPMX 3ZSSA 2WMKA 3IANA 2J7BA 4MNLA 3PHAA 1EOMA 3WD3A 3VDAA 2O9RA 4KWUA 1VFFA 4W88A 1V3HA 1R8LA 3UETA 3CBWA 1AQHA 4JFVA 2W62A 1UHVA 1TZ7A 3OG2A 3BAXA 2WMIB 2VNCA 2EQDA 4GI8A 1PX4A 2DIJA 1MFVA 2X0YA 3KZSA 4DWSC 1XGZA 3SCVA 5A6AA 1OINA 1WAWA 1JL8A 4V28A 2VQTA 3L4WA 4ACZA 4B9YA 2NT0A 4MB1A 4CN6A 5I3DA 5I78A 3PZOA 1E3ZA 1JAKA 3O9NA 4KMQA 1HKKA 1PAMA 2WMHA 3VKKA 4DWSD 3CHCA 5A6JA 2J7FA 1QNPA 3VM7A 1V0MA 2G3IA 3VTRA 4EANA 2D0GA 2J7GA 1XCXA 1NWRA 4L4OA 4MADA 4E8CA 4U3CA 5CXPA 4AMCA 4AD0A 1JDDA 2YA2A 3WD4A 1K6AA 2EO7A 4AZCB 2W66A 2RGMA 1GNXA 1V6XA 5M03A 3TTQA 4EKJA 4EE9A 1CXIA 3SCNA 3CTTA 1KBKA 1WZLA 2O92A 1LL4A 5M17A 1BQCA 3WMCA 3VD5A 1SFSA 2CETA 2V3EA 4Z2IA 3UCQA 1E6QM 1XSIA 2ZXDA 5IXEA 2DT3A 3CZLA 4IUGA 3T09A 3IAPA 3W53A 3ZJ6A 1J9YA 2JFEX 4OBSA 1UD8A 2D20A 2UY2A 1ZBKA 1BFNA 3VGEA 3QHMA 4J7RA 1H5VA 4ACZB 1E5JA 2XVKA 3CZGA 1C91A 2WW5A 4W8BA 5A8PA 3MV11 4JZ5A 1GQKA 1TR1A 1V6UA 2GJXB 2XTKA 1NOUA 1JI2A 1KCKA 4PCTA 3WF2A 3TP4A 3OLDA 1CNVA 1PBGA 3F5KA 3WBEA 2BY1A 1UZ1A 2W61A 1SMDA 2EPLX 4R5EA 1XYZA 2XPKA 5DT5A 4RE3A 1JXJA 3B8SA 1E6XM 4MJ4A 1LL6A 3L4UA 4MB4A 2ZE0A 3ECQA 4LQ1A 4JIEA 3GH4A 4DM2A 2XSBA 3BAKA 3IAQA 3ALFA 2NT1A 4AEFA 4AEEA 4M81A 1V3MA 4HZ7A 3AOFA 2HISA 2DH3A 3VMNA 1WE5A 3WF4A 2WK2A 3TOPA 4W84A 1FH7A 1EH9A 1EHAA 2WYSA 2EXOA 3CHEA 1PX8A 4UQAA 4CD4A 5A6BA 5DMYA 2XWDA 3I3BA 2G3JA 5FL0A 1W9PA 1J18A 2WVVB 7CGTA 5M5DA 4GI9A 3ARRA 1YHTA 4JFUA 4J3VA 3AI0A 1E56A 3WH7A 4GXPA 1W9DM 2DSUA 4N0RA 4V2XA 1PEZA 3APGA 3L4ZA 3SCQA 3SIMA 3BSHA 5BXTA 1R86A 4QLJA 3W37A 1WP6A 1TMQA 4GZJA 2WHJA 4UQCA 1R7OA 3PZMA 3LMYA 2ZX9A 3AZSA 2YKKA 3GH5A 1ZB5A 1ITCA 2J7HA 3CH9A 2ZIDA 1KGXA 4H8VA 4MAVA 3RILA 4HOXA 4D1IA 3AMGA 1QI0A 1OIFA 1JYNA 1E6SM 3AIVA 5A6KA 4CN4A 2FHFA 9CGTA 1PZ2A 4WSKA 3QR3A 1QPKA 2FGZA 4IISA 1OIMA 4JL2A 3L4TA 3AIBA 4UZSA 5A95A 3U5YA 3OGVA 1RH9A 1PJ9A 4LPCA 3THDA 4MJ2A 1EXPA 1GUVA 1MQRA 2ZOXA 1WZMA 4NSBA 2VZOA 3M7SA 3SCSA 1SR0A 4JHOA 4TUFA 2WNWA 2D3LA 4ATLA 4F9JA 3MANA 4S3JA 4WKFA 1OSEA 1UD6A 3MKKA 4MB3A 5CPQA 3FN9A 1J0IA 1UA3A 3ARWA 2VURA 1Z32X 2PWGA 2YLLA 4FLQA 1EO7A 3SUWA 1Q6EA 3GXFA 1A47A 1BAGA 4CD8A 2W63A 3WEOA 1OT1A 1E4IA 3CZEA 2IUZA 4URIA 2PWFA 2PBOA 2AMGA 3ARQA 4CVUA 1OT2A 3ZJ7A 2VCCA 2UY4A 3CGTA 2VX5A 2FGLA 3UR8A 4AZBA 3EMCA 1IZKA 3GBEA 2JF7A 1JDCA 1X6LA 2E8YA 4U5IA 4D6CA 1MQPA 4PUDA 5EFFA 3OGSA 4BQ5A 1ZS2A 4CD5A 1JGIA 1V0NA 4TXEA 3SUUA 1QI2A 2WB5A 5I24A 1QHPA 4DUVA 3AZTA 3ZMRA 2WSKA 1JXKA 1E55A 1HN1A 2Z1SA 4CCEA 4PMYA 4D71A 4UQ9A 3EBVA 2BVDA 4A4AA 2X2YA 1GJUA 5KZ6A 3UG5A 1HP4A 1E4LA 1JDAA 3D5HA 2ZX5A 1K9TA 5BWFA 3VD3A 2WZIA 4AZHA 1TA3B 5KEZA 4PMRA 4AISA 5I23A 1K9EA 4HMDA 2GFTA 3VDBA 1V6VA 4OOUA 3S2CA 5I6SA 1J11A 4BQ4A 1GHSA 3LPPA 4CN1A 4F66A 3ZR5A 5A8QA 1UKPA 3II1A 3WD2A 3WFZA 4TOQA 3VMPA 3LPGA 1H09A 1KWGA 1MYRA 3ARXA 1EIBA 4P8UA 1NM9A 1OM0A 2ESCA 1B31A 1LJYA 3VGFA 2WMIA 3MSGA 2OYMA 1R87A 3AHYA 3ZR6A 4P8XA 2G41A 5CPSA 3BSGA 4U2YA 3QOKA 3PZIA 2V5DA 3WNPA 5I5RA 2WHKA 2XSAA 2XVLA 2XIIA 1NWTA 1G9HA 1Q6FA 3PZUA 3N13A 2XVNA 4JCMA 1E9LA 5E0FA 1UH3A 3EDJA 2UY5A 2XJ7A 1UWQA 1XH2A 4FK9A 5FKYA 5AC5A 3SEPA 4NI3A 5EFDA 4PYSA 3AIQA 4UFHA 1VBRA 1CLXA 3M6DA 2C8NA 5A8NA 3ZO9A 1CXLA 1ZU8A 2CKRA 1XC6A 4H7VA 5ECUA 1E6ZA 3RCNA 4PMDA 4LX4A 4XUYA 2X8RA 3WSUA 4D6EA 1FFQA 2BVYA 1MVYA 5AC4A 1J01A 2Y8KA 1H49A 5FOOA 4E4PA 1CGVA 2YDSA 1I1XA 3W6MA 4GIAA 5DEZA 2CNCA 1ISVA 1UQYA 1GQJA 5CGTA 1EDTA 2NW0A 3VIGA 1ZJBA 3W38A 1UKSA 2B31A 1XCWA 2WCGA 3BMWA 2GJRA 1ISWA 4GZIA 5FL1A 1BYBA 1UQZA 4AWEA 1UWSA 4AD3A 2PWHA 1JF6A 3CUGA 3AMDA 4PMOA 1XSJA 3QOMA 4RE2A 1JYWA 1CIUA 5D4YA 2XHYA 5FD0A 4CU8A 2VO5A 1HJVA 3PZGA 1JNDA 5CSUA 2DSZA 4PRWA 1I1WA 1H0IA 3A6OA 1K9FA 4LYPA 5HBFA 1CYGA 4AIEA 1H11A 5CQ1A 4PEEA 4UZUA 1US3A 4W7VA 6TAAA 1KXQA 5GNZA 2WVVA 4QLKA 3WN6A 2CBIA 1C8XA 3M07A 4ATWA 1KWKA 1J0ZA 1E4MM 3RM9A 1BG4A 4QAWA 1DWGM 3VD7A 3VIMA 2BXZA 1C3FA 4B16A 2CKSA 1ZJAA 2DT0A 4MDOA 4YHEA 4F9DA 4BZYA 2QF8A 5JBEA 3GM8A 4XZWA 4HOZA 5BYWA 3M46A 1DWIM 3ZQ9A 3MU7A 2Z1KA 1JD7A 1OGBA 3VVGA 1UD4A 1ZBVA 3BCDA 3RJYA 3FY1A 2BY2A 3B9DA 6CGTA 2JE8A 2XGBA 1UKQA 3VD9A 4U33A 2ZUWA 1XD0A 1GOOA 1JAEA 1AQMA 1HIZA 2YOCA 2XVGA 3TA9A 4KRUA 2BV9A 4PMXA 3WD1A 1VBUA 3LPOA 5A69A 5IFPA 2VRQA 1UD2A 4UQBA 2X05A 4F79A 3PTKA 1CEOA 3GDBA 1S46A 1UKOA 2C0HA 3SURA 3DHUA 3E1F1 1UH2A 3FAXA 3WMBA 2UY3A 4IPLA 4TVUA 4TTGA 2VZTA 1BPLB 1QI3A 1HT6A 2WHLA 4PSRA 3WENA 1FP8A 1NOFA 5C8BB 4CU7A 2CHNA 4Z2JA 1NWUA 1WDPA 1FP9A 1UD5A 4H8UA 4UOJA 3GBDA 3NCOA 4UFKA 3AQUA 1GOQA 1PIGA 3WH6A 2VRKA 4AZCA 4JAWA 4AZ5A 4P7OA 1QBAA 5EB8A 3AS0A 1CXKA 3IJ9A 3FAWA 2E3ZA 1R7AA 2PBGA 4E8DA 3GXDA 1XV8A 3UEQA 4U2ZA 1QNRA 3K46A 2EPNA 2QV4A 3RJXA 1B1YA 3NSMA 1GCYA 1EOKA 1WZKA 1VJSA 1HX0A 1GQIA 1UR8A 2J47A 3L2MA 1DWHM 1V3KA 2CEQA 3ARTA 4HP5A 1HJWA 3RM8A 3WH8A 5LA0A 1ISYA 4W7WA 3ZM8A 1ZL1A 4HZ8A 3GNRA 2G8ZA 3SUTA 3WQ8A 2OYKA 3EDFA 3B9EA 3PZNA 3VILA 1J0HA 1DWJM 3NIYA 2YDQA 5E70A 4J3XA 1V03A 3VIIA 3KWXA 1UWUA 2Q8XA 1U33A 4RL3A 4BQ3A 1ODZA 3AZRA 3N15A 4M56A 3K8MA 1I75A 1D3CA 4JKLA 2X09A 4HU0A 4CGTA 2GDUA 3W27A 2VTFA 1CLVA 4QP0A 5E09A 1E43A 5CJ5A 1BTCA 1LF1A 5CLTA 1B30A 2BXYA 3U57A 1DHKA 2CYGA 3LPFA 3UG3A 3WELA 2D0FA 4HOWA 1VB9A 3IJ8A 4AW7A 3N04A 1RD6A 4M1RA 3CPUA 7A3HA 5E9AA 2WLYA 2VUYA 2G4FA 3VDHA 4ACYA 2WKGA 1B9ZA 3EYPA 3DHPA 1LWHA 3EDKA 2WKLA 4W8LA 2DIEA 1GJWA 1J12A 1A3HA 3VIFA 1QI5A 4V27A 5JBFA 1KQYA 1UH4A 1E6RA 3ZT6A 2GUYA 5BXSA 1QHZA 1VFOA 2YL9A 5CG0A 1M53A 1JZ2A 4JCLA 2WBKA 4MNKA 1HVXA 1WPCA 3DC0A 4ZENA 3N12A 2J4GA 1XH0A 3O6AA 3WFLA 1CGWA 2J74A 3CHDA 1EDGA 3PZTA 3WF3A 2O9PA 1M01A 4CD6A 2WAGA 1GPFA 2YBUA 4HA1A 3AHZA 3BLPX 2EJ1A 5CSYA 4TX8A 3AIEA 3GXMA 4RE4A 3WDIA 2CCRA 4U3AA 2D22A 3NSXA 3WUBA 4YHGA 4UFMA 4PMZA 2J7EA 1J10A 4NRRA 1N82A 3MUIA 5A1AA 1VJZA 3CZ8A 1Y7VA 1L8NA 5HPOA 2A3CA 1H41A 3W4RA 3POHA 1IV8A 4CVWA 2ZWYA 2CPUA 1E71M 5AYBA 2JEQA 3MUY1 3OLGA 3VX0A 3AMKA 4PTXA 1JZ6A 3W24A 3WQ5A 4HMEA 1UOKA 3RO8A 3WDJA 3MUAA 2WZHA 4BF7A 4R27A 1UG6A 4AYSA 1E4NA 3W28A 3K1DA 4AZGA 4AD5A 1UD3A 4A3YA 1OB0A 3T2QA 3VIPA 1QOXA 1TCMA 2ZUUA 4AD1A 3A47A 5JIPA 2F8QA 2WMGA 1BYDA 3WQ4A 1M04A 2OLHA 1IT0A 3CZJA 2PB1A 1E6NA 4MNMA 3TTOA 3PZ9A 4XV0A 3OZOA 3AICA 4H8HA 3VU2A 4N42A 5A8MA 1PZ3A 4LXFA 1F4AA 1JZ8A 1Q6CA 1W3KA 1ISZA 1XH1A 2D0HA 1IZJA 1JYXA 4ZFMA 1E5NA 4FLSA 3VM5A 2WMFA 1U30A 4MNJA 1CWYA 1E73M 1GHRA 4E2OA 3AISA 4TTUA 3GTNA 2X0HA 5BXPA 2GJPA 1W9UA 2VCAA 1VAHA 1B90A 2V5CA 2ZUVA 1ODUA 2OSWA 2VT0A 1EA9C 2VOTA 2VL4A 1QNSA 4XZBA 1L0PA 3L2LA 3WUFA 3PBGA 1VEMA 1TVPA 1ECEA 3VMOA 2YA0A 1HP5A 3OBAA 4HPGA 3A4XA 2E40A 2QMKA 1YQ2A 1TVNA 1P6WA 1UR0A 2VZUA 2DQXA 1M03A 1AQ0A 1E1FA 1ESWA 4KGJA 2PF0A 2DPEA 4F8XA 3PN8A 2YL5A 1CPUA 3AS3A 1ZBCA 1G5AA 4D6DA 5FCZA 5CZKA 2QHAA 1VRXA 2J77A 4GINA 4PTWA 4D6GA 4AIUA 1VF8A 1NARA 2FHBA 4WK9A 4JFSA 1O6IA 3CIVA 1WNOA 3AYSA 1CGYA 3WNOA 1B3XA 3AXIA 1UWRA 3CMGA 3RM4A 2YJQA 3NYDA 2XVPA 1QI4A 1V08A 1XRVA 4AD2A 2BS9A 2DDXA 3AIUA 3N18A 2XGIA 2YDRA 4CCCA 2ZXAA 3OB8A 4UFIA 4ZE4A 3W0KA 1KQZA 2VMFA 4ZE5A 1AMYA 1M7XA 1NOWA 3F5JA 4W87A 5A2CA 1H2JA 2W92A 4DUWA 1GOMA 2OYLA 4UFJA 4QCEA 3SCRA 1C90A 2G3MA 3NUKA 3WDHA 4MTVA 3BAYA 5A8OA 1O7AA 2J7CA 2AAAA 5F7UA 2WWCA 1FH8A 4L4PA 1VFUA 2E9MA 3OZPA 1C92A 1KFWA 3RMEA 1E72M 3AROA 1OGGA 1OWQA 5ABEA 3SCUA 2WWDA 1EO5A 4OJYA 5BRPA 2CXGA 2PWDA 3FHQA 4AZ7A 1BGAA 4QFUA 5A6SA 1D7FA 3MS8A 3AMLA 3T0DA 5TD4A 1HF6A 5A94A 1EQPA 2CESA 3OA5A 5A2BA 2DSKA 5E6ZA 4CKQA 5LA1A 5D9MA 4A3HA 3ZT5A 1JNEA 4AZIA 1KGWA 1W1PA 2FHCA 1C7SA 4OUEA 1R85A 4W5UA 2E8ZA 2V3GA 4FLRA 3W82A 2F2HA 1XSKA 4YPJA 2YIHA 2Y24A 5GNXA 3WD0A 4TVDA 3B9AA 5LYRA 5GNYA 3GZAA 4FMVA 3NJ3A 2DEPA 2J7DA 4PCSA 3G6LA 1UWIA 3CUIA 4NRSA 3BAIA 5D9OA 3WNKA 1LG2A 3G6MA 1W3HA 2Y4SA 3EMZA 3A4AA 4ZEPA 1VENA 1KB3A 1BYAA 3WKZA 1G01A 1UR4A 1CTNA 1WO2A 5BXRA 5I0DA 2W91A 2WVSA 1LQ0A 1W91A 1B0IA 3NDZA 3BCFA 3VINA 2OWXA 1QW9A 2JIWA 3F4VA 1H4PA 4FLOA 3K8LA 3HJEA 3HN3A 1HJQA 2HVMA 1HXJA 2JEPA 2WBGA 1F4HA 1Q6DA 4K68A 2UWFA 1DP0A 2WC4A 3U7VA 3BLKA 2VVNA 3BMVA 3ALGA 4TVCA 1UYQA 1OBAA 1UKTA 4CUCA 3ZIZA 4WJXA 3UERA 3AHTA 3AXXA 1VEPA 2XG9A 3NDYA 1OD0A 1QNOA 4WKHA 3PZVA 4NZCA 3AS1A 1UWTA 5ABHA 1JF5A 3KL5A 1FFRA 1E3XA 3SCWA 1MXGA 2V3FA 2ZXQA 4X0NA 4PUEA 1NWSA 3MO4A 3WUGA 2WVTA 3UESA 5EBAA 4XX6A 3GNPA 1HKJA 5EMYA 3T0BA 3K4AA 4GO8A 3N17A 4UFLA 5CLWA 4HTYA 2OWWA 3AJ7A 4H04A 4JFTA 1V6YA 4GI6A 1G0CA 2W5FA 3EDDA 3WF1A 2D2OA 2VZSA 4GPNA 4UQEA 4Z2HA 2WC7A 2J25A 1MW2A 3W29A 3I3DA 2D3NA 4LYQA 3S6TA 4Q22A 2TAAA 1E40A 4J3WA 4W86A 2YBTA 1PIFA 2BVTA 4W93A 3T0AA 5GQBA 1JFHA 4UOZA 1JZ3A 2MANA 5GPRA 1PPIA 4OOZA 2J79A 3KL3A 2J78A 1HJUA 4CU6A 2EPOA 2CIPA 1DTUA 4J27A 1XYFA 2QMJA 5DF0A 1E0WA 3OIHA 2ZX6A 4J3SA 1H3GA 5D8WA 1BGGA 5HOSA 5A3HA 4GZEA 1MW1A 2Y5EA 1LLOA 5D8ZA 2PC8A 1V3LA 3VGGA 5HDRA 4AIOA 1V02E 3WDRA 1OD8A 4HPHA 3QHNA 1BSIA 1Q4NX 2E9LA 3PTMA 2ZUSA 2WANA 5AY7A 1RP9A 2XFRA 2VX6A 4KH2A 3FXYA 2FH6A 3AS2A 3KL0A 3VO0A 3FW6A 5JUVA 4C7GA 4D6HA 1US2A 5LA2A 5M3WA 3WL1A 1GONA 1KBBA 3CUFA 3EDEA 3WEMA 1FA2A 4J28A 1W2VA 4PMNA 4U5KA 2GVYA 3AIWA 1HKMA 4JFWA 2RGLA 2GK1A 1KXHA 3BC9A 4BA0A 3BGAA 1QVBA 3ARYA 4C7DA 2GDVA 3O2LA 3L4YA 2VCBA 1GOKA 4WKAA 4AZ6A 4B3KA 4P7NA 1X6NA 1B2YA 1JG9A 1GVYA 3AXHA 3WNMA 1WCGA 3W26A 1X1NA 4D6JA 1UUQA 5ABFB 2WMJA 3ARPA 3WL0A 3OLEA 2DT1A 1QHOA 4PMQA 2A3AA 2WVUA 3RPMA 3W6LA 3ZOAA 1SMAA 4U31A 5E0CA 5CPTA 3CO4A 3WQVA 3THCA 1TA3A 6A3HA 2J8FA 1HJSA 5IDIA 3D3AA 1XHGA 3SCPA 1BLIA 4PTMA 3TTYA 2DT2A 1U2YA 2FDMA 1W1VA 2WLZA 3A4WA 1E1EA 1GW1A 5A6LA 5E6YA 4YN5A 3VNYA 2DSWA 1BVZA 1HKIA 1QBBA 4UOQA 1E15A 2VX4A 1Q6GA 2G3NA 5DFAA 1FH9A 1CZ1A 3VGHA 3AYRA 1CXHA 1DWFM 3VGBA 3BH4A 3WIJA 1OGSA 1J0KA 2JALA 1DEDA 4X0VA 3WQ6A 2YL8A 2ZUNA 2J75A 1JI1A 2E0PA 4JKMA 4HZ6A 2YLAA 1RPKA 1B3YA 2DH2A 4IPNB 2VZVA 2BY0A 5A6BD 4FF5A 1UA7A 1KR1A 5FIPA 4MB5A 1ISXA 1ZBWA 2WXDM 4KRTA 3POCA 1VIWA 3BXWA 1MW3A 4B15A 3WUEA 2O9OA 4B3LA 2D1ZA 4KGLA 3UR7A 1WDSA 2D23A 3VNZA 1GOIA 4OBRA 2W4XA 1FOBA 3K4DA 3MV01 4Z2KA 4WSJA 2WPGA 5IFTA 5I2UA 2V38A 3CUHA 4M24A 4UNIA 1MXDA 3WNNA 4BQ2A 1CGTA 1C93A 2PI6A 1VFMA 1JFXA 1OCQA 3CMJA 3DECA 8CGTA 3F5LA 5AYIA 2PWEA 4BS0A 1LL7A 3ZT7A 4DWSB 3WDPP 4WLCA 1CGUA 2XM2A 4LGXA 2WC3A 4UR9A 2VC9A 1FHLA 4W5ZA 1QW8A 3SCTA 1W2PA 4HA3A 2V3DA 3NSNA 3ARZA 4UTFA 1NQ6A 2E9BA 1E0VA 1KCLA 3VUPA 1JD9A 3MSDA 3AHXA 1E0XA 3EMQA 3DYPA 1W3JA 3IJ7A 4Q7NA 3T2PA 3JUGA 4EK7A 1LG1A 2WZEA 4P7LA 4M82A 4Z2GA 2ZUTA 3VD4A 4M80A 1MQQA 2ZICA 4NF7A 2QPSA 4HU8A 2OSYA 1D2KA 1XD1A 3A3HA 1EGZA 1J0YA 3HU7A 5HPCA 4J3UA 4GKLA 1C8QA 1UR2A 4GQQA 3SUVA 3RDKA 4W89A 5ABFA 4OZOA 4Y7EA 3TONA 2NSXA 1H0GA 2CHOA 2AOSA 5A6MA 1JZ5A 3OGRA 2J8GA 1NH6A 3N9KA 3T08A 1DWAM 4GO9A 1BG9A 4P8WA 1MFUA 2ZWZA 4PMUA 3AIRA 1UR9A 2D24A 2WM0A 4B9ZA 2A3EA 1HJXA 2VR4A 1ITXA 3HMCA 2VR5A 3GXIA 2EBNA 3N1AA 1E70M 5D9NA 2VQUA 4HMCA 1TUXA 4D6FA 4P7QA 4QDMA 3FNDA 2EPKX 4MAZA 4S3KA 2VJXA 3L4XA 1GVIA 4P7RA 3ARUA 2BY3A 2OSXA 1FHDA 3VIHA 3MMUA 3J7HA 1J0JA 5DO8A 3IK2A 5JIWA 1BHGA 2YL6A 3OLIA 4QLLA 1UZ4A 5I79A 3WQWA 1V0KA 2GJXA 1V3IA 1HL8A 3WMSA 3ZJKA 3GYCA 2BFGA 4W7UA 4EAMA 1UR1A 4H2CA 3W25A 2F61A 4XB3A 5C71A 3WDQA 3T2OA 4Z2LA 1W32A 3BAJA 4J3TA 1QNQA 3VIJA 1JIBA 4W8AA 2BHYA 2Y2WA 3DYOA 3CZKA 2QLYA 1HNYA 1HVQA 4HA4A 3CUJA 3DYMA 1B3WA 5D9PA 3WBAA 1BVNP 5DT7A 5IHSA 3N11A 3WH9A 3GNOA 2JF6A 3PTQA 3QHOA 3WEZA 3VOCA 1EHNA 4TX6A 3SUSA 2A3HA 4WIWA 2O9TA 1V3JA 2BNJA 4P8VA 1B3VA 2VI0A 4AXNA 4DM1A 1C7TA 1KR0A 2ZUMA 5BROA 1V02A 2X1IA 4D6IA 4ZXOA 4M8UA 3CLWA 2VRJA 3ARVA 1W9XA 3BAWA 1BYCA 3TTSA 2DGAA 1CENA 3PZQA 2XFYA 2YA1A 4DUXA 4MPKA 4UQDA 2CBJA 3QGVA 1W1YA 2E4TA 1WDQA 2GK1B 4JKKA 5BCAA 2ZX7A 2IXUA 7TAAA 1GQLA 4AD4A 1C8YA 1PX3A 1AVAA 4M29A 4OIFA 1W1TA 2XUCA 4D72A 1VEOA 3MMWA 5IHRA 1HL9A 2WCAA 3L4VA 3VIKA 3W81A 3RIKA 5CGMA 5C70A 1NP0A 2C7FA 4ZXLA 1MWOA 1V6WA 2A3BA 4PBGA 3U5UA 4CCDA 1K9DA 4C7FA 4JHZA 2OWCA 1V0LA 3VPLA 1JZ4A 2EEXA 2XM1A 2VVSA 4ATDA 1CXEA 5I77A 1LWJA 2BHUA 1KXVA 1W9VA 3ARSA 2ZX8A 3I3EA 3CHFA 3VDCA 5BRQA 1TFVA 3ZSTA 2CBUA 4IM4A 2CBVA 4OKDA 5A2AA 1CBGA 1RP8A 1B3ZA 1SYTA 1WDRA 3WNLA 3WH5A 4W85A 1EDQA 1CGXA 4JL1A 3VX1A 3VIOA 1G94A 2CITA 2WSPA 4D1JA 2IXVA 3MMDA 2CERA 2WCSA 4UCFA 3MUZ1 1TG7A 4AC1X 2J62A 5HXMA 1KGUA 4WF7A 3SCOA 1JYVA 2GSJA 3GH7A 3ZJ8A 2QPUA 3KEHA 4BCEA 1MW0A 1JZ7A 4CD7A 2DSVA 1GOWA 5ABGA 2W67A 3AMCA 1WB0A 2WHMA 4X9YA 2Y8VA 8A3HA 4PN2A 4H41A 3KE0A 4AY1A 1GZJA 2XIBA 5JBDA 2XWEA 1W3LA 1W9BM 5HNNA 2JIEA 1NP2A 2FH8A 1BF2A 3K8KA 1E6PA 1WZAA 3U7BA 4DWSA 2VX7A 4LYRA 3FHAA 1EQCA 1CXFA 3WY1A 3VGDA 1KXTA 3UG4A 2XYLA 2ZXBA 4ML4A 1CECA 4PSPA 1H1NA 2XFFA 1WKYA
chains in the Genus database with same CATH superfamily
1OYCA 4I7VA 3OUIA 1TE1A 4GQRA 3FFZA 3G1XA 5FP7A 4MDPA 4R7JA 3IIXA 4QB1A 1GORA 1ZBA3 3OBEA 2DURA 1I0DA 1XRSA 5A7OA 3C8NA 4C6BA 4IQJA 5JXIA 4LEJA 2RAGA 2XGXA 4DO7A 3PHAA 4PF5A 1OX5A 3MF6A 3NJZA 4LV9A 4K40A 4DS0A 4GNJA 1V3HA 4KL1A 2NQZA 1QQP2 3UETA 3M0YA 3ZKUA 1AQHA 4JFVA 5HMDA 4EQVA 3VBOC 3BAXA 2WMIB 3E9AA 1JPMA 2WQZC 1YKWA 3ILNA 2O7QA 1RCOB 1XRUA 1R091 3SCVA 4V28A 2VQTA 3JVAA 3L4WA 3MMTA 2NT0A 5I78A 3SECA 1N7KA 4KMQA 4RDVA 1O60A 4XIOA 2PURA 1UX7A 5A6JA 4DJFA 4H19A 1XNCA 4IFKB 3VM7A 2G3IA 2F6UA 1FOD2 4EANA 4MV2A 5DG2A 4YW3A 2WZTA 4B5WA 2JICA 5CYYA 3HPZA 2YYTA 4KCVA 4DBWA 3O1RA 2WINB 4E8CA 1KM1A 1KGYA 1SR9A 1EV13 4H7CA 1HKVA 5I3GA 2D93A 4AZZA 4F0KA 1PK6C 3QQ1A 2W66A 4L9YA 1O5LA 2RGMA 2VDGA 1GNXA 1CAVA 4EKJA 2ENRA 4G2DA 4EE9A 5JMCA 3SCNA 2EIGA 1CN1A 1JCXA 4A8NA 2WZR2 1LL4A 2MHFA 3BWWA 2JG8A 2Z24A 1PVNA 3CLPA 1PGL1 3WW3A 1H0BA 2P37A 5BMWA 4FOWA 3U11A 3HV8A 4B5NA 4Z2IA 2PGWA 4BLJA 3RWNA 1IZCA 1Z6KA 4Y4YA 1JXNA 1XSIA 2G3FA 2DT3A 4ZHNA 3CZLA 3T09A 3VZZA 2HS8A 1EAH3 4AVVA 2D20A 5AOUA 5FY9A 2NX1A 2Y0OA 1OCJA 4K8HA 3VGEA 3QHMA 3N9MA 1XNBA 3DDMA 2X40A 2P5NA 2X5IC 5BW6A 4ISQA 2R91A 1EP0A 4AHWA 1W0MA 2R1PA 3Q8EA 2JKPA 2Z1BA 4Z0SA 3MV11 4HK7A 1TR1A 3GXPA 1S5VA 1Z48A 1NOUA 1KCKA 4PCTA 1NA1B 5FYBA 2BVWA 2DZUA 1CNVA 3QZ6A 3G1SA 4O4WA 4FPKA 2QQ6A 2AGSA 1JUBA 3DX5A 4KWOA 1O5UA 2VC6A 3HBKA 1SMDA 5FJJA 3K1GA 1RR2A 1BEV3 3UJEA 3SY5A 3B8SA 3ITXA 3NZQA 1UCXA 1G9BA 5GZFA 4JIEA 3GH4A 1BF6A 3U4FA 4C6IA 3KT4A 4AEEA 4KWLA 1V3MA 2HISA 4LBKA 4Z2WA 4B5UA 3THUA 1FWAC 5IWFA 3GTXA 3TOPA 2NPIA 3K77A 1R9XA 1OF3A 1ULOA 3W7MA 1OG0A 2GN3A 2WYSA 4FPSA 4QKBA 3EQEA 4XJAA 3E74A 4H6QA 5DMYA 5F2IA 2XWDA 3I3BA 1OH4A 3G1DA 3CU2A 5FL0A 1J18A 5FO9B 1XB9A 1KFXL 4M0NA 4YVSB 4JFUA 5C0QA 3M8LA 4QJ4B 4J3VA 4DLFA 5KHJA 2ACUA 4JQTA 3WH7A 4PA8A 1UMZA 2PGRA 3KDNA 4WOQA 7REQB 4FXKB 3UK9A 5HMSA 4N6EA 4HANA 1OOPC 1TCDA 3WQ0A 1F9CA 3R4UA 3RR4A 1ND3B 3SIMA 3QQWA 4KFNA 4A2SA 1N3PA 4XXPA 1R86A 1W8UA 3MTWA 2YZ5A 2HWC2 2QFEA 1V4YA 1ENQA 2WHJA 2B8MA 4CDXC 2ZCWA 4HXCA 2IXLA 1R7OA 2RDTA 1WD3A 2XIQA 2YKKA 4Q8WA 1YPXA 2Q1MA 3LDBA 1JRBA 4K8EA 5L7OC 4H8VA 3RILA 2MNGA 2E32A 3AMGA 1QI0A 1LHNA 4S3DA 4LLOA 1DZRA 3M0LA 4P9IA 3QPZA 3VFCA 4AFAA 1IT8A 4BEUA 3HG3A 3GC4A 5GVJA 3SRKA 2Z2UA 4FNRA 9CGTA 3WQGA 2RM21 3QR3A 1JUKA 3GJAA 1SSDA 3B0XA 2QTWB 3DBNA 3FFSA 5I3JA 3AIBA 3KV6A 3CT7A 1D2QA 2PZ0A 5A95A 1YEWA 1TV2A 4JN6A 3GDTA 4TO8A 3OGVA 2PGEA 3OYXA 3LTYA 1ND2A 1EPVA 1EXPA 2AEYA 1J5TA 3QBUA 1IEIA 1RIRA 5BY5A 5H8MA 1H1AA 1WZMA 4NJJA 3IUDA 1E1CB 1TNFA 3N9OA 2EG6A 4JHOA 3NOYA 1PIV2 5FP8A 4ATLA 1WW6A 3TJIA 2DUQA 2QQWA 4LUTA 3K2OA 3MZHA 3BLDA 1ONWA 3HN1A 1F3WA 5EQUA 5F2MA 4XG1A 3U9IA 3PY2A 2QQMA 1R64A 3C0SA 1J0IA 4AAXA 1N8WA 3UJ2A 3MI2A 3W59A 4RZBA 3B0VC 2B9VA 1XINA 2ZTKA 1F61A 4QEHA 3KBNA 3IIZA 3GXFA 1S1RA 3C0JA 5T9CE 4AGVA 4N9CA 4O10A 4RQPB 3OA3A 2W63A 1UZYA 3C6CA 1EYBA 2J1SA 2ET1A 2OZJA 4DEQA 3P80A 3UGVA 4M6QA 1HL2A 1Z41A 2H8XA 4FT8A 2FQPA 4XDOA 4GA9A 3H22A 1LB2A 1JJKA 1IIHA 1K70A 5LZ6A 2Y70A 2VCCA 2BGOA 2BZDA 3W7PA 2FGLA 1MRAA 1PKNA 1HB3A 1XE7A 1Q3NA 2K2SA 3NQFA 1CT5A 4QU1A 3DFHA 3GBEA 4GYKA 2QVNA 2EAWA 3WP5A 3IJDA 2E8YA 2XWJB 2ZDSA 2OKXA 1O59A 1AJ0A 3ZS4A 3W3OA 3U0ZA 1OI6A 1JGIA 1KRAC 3UGHA 2PP1A 3KBJA 5CFDC 2KXLA 4UMAA 3UXIA 4M3CB 1VBC2 2PDWA 1EP2A 4ZZ8A 3K4ZA 3RR1A 4KW2A 3K3OA 3UF9A 5SV5A 1LGCA 1Y9GA 3SDOA 1E55A 1W8OA 4D71A 3W72A 2MPFA 3M1ZA 2YMZA 4QJ3B 4A4AA 4HNNA 4H3DA 5FYIA 3B05A 1JQVA 2YY1A 2J66A 2RKXA 3DU0A 1HP4A 1QJY2 5L7OB 1WLWA 1J1LA 4UTKA 1NXMA 4KBBA 3H2OA 1XIDA 1XYCA 3NNFA 3BE7A 4HSNA 1K9TA 2C71A 5DAWA 5LW9A 1PHMA 3V1HA 1UO9A 4C8DA 5KEZA 4W9TA 3UWEA 4PMRA 5FF4A 1J8VA 5ABTA 4XZPA 4UF0A 5IK7A 1VS1A 5A3UA 4IXLA 3HNYM 3H50A 3VDBA 1LNSA 1D3GA 2QZ2A 4WV8A 5HCAA 1XDLA 4BOWA 4N6FA 5I0UA 5CFCB 4CN1A 3NKGA 2CU0A 4R3UA 4WSHA 4JYDA 1GVEA 4YL2A 3KRUA 2JGYA 3I4EA 4TOQA 3VMPA 4LKSA 1EIBA 3QRHA 3FX4A 4DINB 3T3YA 1EJRC 1CZSA 2OUJA 4MOZA 1LJYA 4BK5A 2WMIA 1LGNA 2OGYA 5A1FA 2OYMA 2YB1A 3N4FA 3M7AA 3OEXA 3MCMA 5G1YA 4GWNA 1SJBA 4RN5A 5FOBB 4FNSA 5H9QA 2V6AA 1SU5A 1F15A 2CSGA 3PZIA 3ZXFA 3WNPA 2W52A 3CK5A 3I54A 3ONCA 4Q1PA 4ZXKA 4JTRA 1NDZA 5CG7A 4WXYA 4XFHA 1D4M1 2G95A 1G9HA 3PZUA 1E9LA 5E0FA 1RQHA 1WCQA 5FP4A 4HT3A 3P60A 4CQCA 2UY5A 1JTZX 4O12A 1UWQA 1RUE2 1UYZA 1QEXA 2ZA1A 3SEPA 3PK7A 1QWRA 3W83A 1HW6A 5EFDA 2Q8ZA 1GANA 3AIQA 4COWA 2DVTA 3FEMA 4UW6A 2VZPA 2BP1A 3ERPA 3M6DA 1ZBA1 4ZQCA 2GNDA 2Q8EA 2QJHA 4MWAD 5DDJ3 5A8NA 3ZO9A 4P2VA 1MEHA 1XC6A 4BHPA 3L5LA 4UR8A 1XGEA 2GGJA 1C5IA 5AHIA 4FQZA 3RCNA 2GMEA 3W74A 2ORZA 1U1HA 3PJXA 2HWC3 3AM2A 4L9XA 1LOBA 5K4XA 3E38A 3WLLA 2X8RA 3QY7A 5AYZA 3U2ZA 2VOWA 2R16A 2NQLA 5D30A 5GJNA 5H8UA 3TN5A 3USUB 2YDSA 4YYCA 2OIIA 1CLKA 1XWYA 3EX6A 4ATEA 3AZWA 2UY8A 1YNQA 1ISVA 4CEYC 2E09A 1EDTA 2NW0A 1ZJBA 1RINA 2WCGA 2VWSA 4YJ5A 1LEMA 1D7PM 1ISWA 1BYBA 5A6TC 1RUI1 3T1LA 2FVMA 3LM7A 4WDTA 4AGRA 2XDFA 4ADSA 1RUNA 4AD3A 4MGGA 1OBNA 2GN7A 1DJGA 2YXXA 1XSJA 2Z1XA 4JTDA 7ENLA 2CLKA 2Z4FA 1J96A 2XPJA 1CIUA 1T5AA 3T4HB 1O66A 4CU8A 3ZVHB 3DAQA 4Q4QA 1HJVA 5BOOA 4IG2B 1EJXC 4Q4Y2 1KTNA 2BWCA 3DKWA 4PLMA 5DQ0A 4DIQA 3N9NA 2R49A 5IW0A 1H0IA 5HBFA 1CYGA 2QDGA 2DZPA 2BGSA 4XZHA 4AVOA 2EKGA 4PEEA 1BEV2 3U4SA 3CQJA 6PTDA 2Y38A 3CZUA 2DCYA 2VHLA 1XYMA 1KXQA 1U22A 1DQ1A 5ABJC 5KWRA 3EX2A 2WVVA 1R38A 3IJ6A 3M07A 3B8WA 1SFNA 3NO3A 3UCCA 3DPRB 2TYSA 2WRAA 3ZDSA 4DI8A 1DWGM 3ACFA 3QCWA 5GLUA 2WLQA 1DJQA 2XXZA 4XQDA 3M5XA 3HAGA 1MEIA 4BZYA 1C8M1 2JKXA 5DLCA 3FA4A 5EJ1B 4J6GA 3E2QA 4OUMA 4HKWA 3DKLA 1F3TA 3ZQ9A 1O94A 4GNVA 1JD7A 2PD9A 3L5AA 1OGBA 3VVGA 3MKVA 3WQOA 3OQ8A 4YG0A 2BOJA 1HRI2 2XUMA 1W3TA 2G5WA 3LZ5A 2EF6A 3KHDA 3VNJA 1GTHA 4WZFA 1U5IA 3EA2A 2QCGA 4XJUA 2Z0IA 1NT0A 1AQMA 1ICPA 2LM3A 4YW7A 4KRUA 3URNA 2XBO3 1J59A 4MX3A 4PMXA 2HYKA 4Q8UA 3WD1A 1RUG3 1TPC1 1D0GA 3GR7A 5A69A 3N29A 4UQBA 1CEOA 2OG9A 1SBEA 2BYVE 1AMKA 4JRLA 3MHZA 1EBGA 1S46A 1BMV2 1VBB1 3DHUA 4WM8A 3RO6A 3CAQA 4TVUA 2VZTA 2CLHA 4YM1A 1HT6A 3AK0A 4PSRA 2DP3A 4M6UA 4MZ1A 1CVNA 1N1YA 1EEXA 5FIXA 4Q4OA 4N53C 4K3UA 1WW4A 1ND3C 1EZ2A 2NYYA 1SCRA 3VKFC 1UIOA 1WDPA 1LOFC 3DG3A 3E02A 4OUSA 4UFKA 3EOOA 4O57A 4AEOA 2VRKA 2NV1A 4AZCA 1Q2SA 5CPLA 1QBAA 1T6BX 3KT1A 3AS0A 3IJ9A 3BJFA 2GLKA 1SBDA 1F5FA 1PVC2 4IXXA 5HR7A 4EZ4A 3UEQA 4H7ZA 2Z25A 2RUSA 3AFGA 2BDQA 4HU3A 1JDFA 5K9XA 4OVEA 3BTYA 1TTQA 1QJY1 2ZPXA 2EPNA 1WMXA 3RJXA 3ZFGA 1ELSA 3G1RA 2PDHA 1HX0A 1I2RA 4Q4Y1 3EO6A 3E0FA 2J47A 2JB4A 5D37A 2ZHNA 3M2MA 4JTNA 3ARTA 1K12A 2JKBA 3WH8A 2A3LA 4JGYA 2YCIX 4BIOA 3TJXA 1GKBA 3ZM8A 4L56A 3ABQA 3H4XA 1QU0A 2G8ZA 2ZZ2A 1RUD2 4UAPA 2YFNA 2XL7A 2OYKA 5A33A 4N53A 3NIYA 3GBGA 4BH9A 3W9AA 3VIIA 3KWXA 3K48A 2DU1A 1U33A 3TNOA 3UP8A 2J6XA 4R33A 4BQ3A 3OVQA 4F40A 1HB1A 4WVMB 4Q0VA 3UPWA 1KQRA 3HEIA 1D3CA 2INZA 1TTPA 1JOJA 2X09A 5U7SA 4UBPC 4HU0A 3N9LA 2R32A 3C61A 1CLVA 1YDOA 4DRSA 4DZHA 5CJ5A 4HCDA 2HWF2 1SJCA 4GE8A 4UTMA 1WAUA 4Y8EA 2BXYA 1DHKA 4LVGA 2D0FA 1R083 1W8NA 3P3PA 3M47A 5ERLA 1QWKA 5C3OA 1RD6A 9RUBA 3TH6A 3RYSA 3MYXA 1Q85A 3PVFA 3DFSA 3POGA 4GVGA 1RUE1 4MGZE 4COVA 3VDHA 2J1VA 4PIXA 3ZSEA 3AL6A 4PBEA 4UTTC 2WKGA 1B9ZA 3EYPA 1S3TC 1Q63A 1RUE3 5LIYX 3LQCA 2GNMA 3M3EA 2BGNE 4AX6A 3IDBB 2YC2A 1YQ8A 4LMFA 4LV4A 3KBWA 1RVF1 3LHVA 3POJA 3BALA 3GHTA 3H7UA 2VOVA 3ZT6A 3H7JA 2VNVA 4Y26A 2ISDA 2DF7A 1NEYA 3V5CA 3PJQA 5CG0A 2B7QA 1H2KA 1A5MC 1OUXA 3BLIA 3EX3A 3U0HA 4MNKA 5H91A 4R34A 4IE5A 2LUWA 3AZYA 4ERAA 3R05A 1EDGA 2ZRZA 4NYUA 4QAIA 2UWAA 4FOKA 4LF2A 5F2LA 2WAGA 3S5YA 3VLBB 4V1PA 3T4WA 2NX3A 1FWCC 4JBRA 3RCMA 4ROQA 5IBXA 3VKDA 4DF1A 2A73B 2BTMA 1YFUA 3GXMA 1DJXA 2D22A 5CPMA 3DGBA 3WUBA 3SRFA 4UFMA 3GFXA 1MS8A 1O4UA 4GUJA 2HWE3 4Y1UA 1N82A 5D2XA 1Q56A 1A5UA 1TWIA 2XN1A 4AG4A 2DZSA 3KVBA 1F2NA 1EJSC 4AI9A 2VM9A 2ZCGA 4RZ4A 1IV8A 3CQHA 2C79A 2ZZ7A 1XLIA 1ASJ1 2GDFA 1DZQA 3VX0A 3CIHA 3MDWA 3B0UX 3AMKA 3O0XA 4PTXA 2WFF2 2DU0A 3MO7A 1TRDA 1VHNA 3IEBA 4JX6A 1UOKA 1GZ1A 4A45A 3MUAA 2PA6A 3Q37A 5GJMA 2CL2A 3FBMA 3Q9OA 4TMBA 4H7LA 4JX4A 3AXDA 3ZIWA 1SQ7A 2LS6A 1AVBA 1WMDA 2W39A 3C3NA 1SZBA 1K45A 2P3EA 2ZGRA 2E68A 4ZQRA 1LZOA 4A3YA 3T2QA 1OB0A 1LOAA 2O7SA 3POIA 1QOXA 3ES7A 2Z27A 4XVDA 4AD1A 5BNOB 4ASMB 2WMGA 3SQSA 3GB6A 1HLCA 1KRIA 4DPPA 4HJWA 1NQJA 1XU1A 3CZJA 1DTNA 3E12A 5L9VA 3TTOA 3POFA 3OZOA 4CP9A 3GG8A 3VU2A 3DGRA 4DRRA 2CLPA 3G1VA 1X9PA 4AHOA 2DIKA 4LXFA 1H9PA 2XH4A 2ISVA 4XIAA 3O8AA 3J9SA 5IATA 2VOKA 3HD8B 3ID7A 3V0SA 3H24A 4M3CE 4CXXA 4D3WA 1Z44A 1RA5A 2FGBA 4E2OA 4MUZA 2NZ9A 2X0HA 5C7VA 3IVSA 1YFYA 2VZ1A 3EKGA 4MGQA 2GJPA 2XFWA 2MNRA 3KTCA 4AHYA 3VDDB 1EC7A 3P82A 4CDQB 3SH5A 2ZUVA 4ZOBA 2OSWA 3DCPA 1DQ5A 5FZCA 2VOTA 2VL4A 4XZBA 4YVPA 1QNYA 5DPNA 1L0PA 4Z82A 4K1ZA 4ZB2A 3WUFA 3VHNA 1LOFA 4P08A 1Q66A 1TVPA 1ECEA 2JJ6A 3MWAA 2YA0A 3HPXA 5J5RA 5DRIA 4M5PA 3WLTA 3MIHA 2HTMA 3ZFEC 2O1QA 1A5NC 5LBCA 3B8IA 3LCGA 1K4GA 3KCLA 1G4TA 2HPMA 1P6WA 3UJQA 3V4BA 4CNTA 2YBSA 4LAKA 4D6SA 5IK4A 3PUDA 1E1FA 3W00A 2WDBA 2PF0A 1RY0A 5HUOA 1PZ0A 5GJ6A 2WFF3 3Q45A 4BF5A 2BFUS 3TB0A 3COTA 1ZBCA 1G5AA 1Q8AA 1VRXA 2I16A 4PTWA 3L2IA 3HOBA 1NDWA 1PTAA 4LSBA 1HV1A 2VU9A 2FHBA 4C6DA 4IQEA 3T0TA 2VGBA 1V6JA 1XLBA 1F35A 8RUCA 1PZ1A 1EPWA 4JX0A 1RAKA 3QQ0A 1I4NA 3CMGA 2H8ZA 3NAVA 3RM4A 4XTMA 2HEVF 2QCSB 3L12A 4LUIA 4H8NA 2OB3A 1XRVA 4GNKB 2HJIA 4PODA 4AD2A 1WQ5A 2DDXA 3AIUA 4GB33 3PJWA 3QGAC 2XGIA 4NY2A 4CCCA 1N1VA 4MGTA 1R30A 4UFIA 4C60A 3URAA 1HDKA 1BQPA 4A44A 2PHWA 4X9SA 3HQOA 1Q2RA 2OELA 1NOWA 3LD8A 3HA1A 3QLQA 4QPIB 2W92A 1I6NA 3B4UA 4HCHA 2OYLA 1OOPB 3T40A 3HT2A 2AAMA 3NUKA 3WDHA 1EGVA 2E6AA 5G04L 2J7CA 2PHLA 1FWNA 5AYYA 1MQTC 1Y9QA 4OQ8A 4IV3A 3LA4A 2J22A 3IWZA 3IIAA 4XKYB 1AJ2A 3P3NA 5TBOA 1JW6A 1OCBA 4UNLA 1E72M 4GJZA 2NVAA 2G4IA 1OGGA 3KTSA 1PZ9A 4XVEA 4RNIA 4AU0A 4FOVA 2CXGA 3G24A 3FHQA 4AZ7A 5FXWA 1D7FA 3AMLA 1IQAA 3T0DA 3LENA 3L7RA 4UXDA 2QCLA 2GUUA 2JDAA 2VOXA 1IG3A 1EQPA 3OQEA 5I06A 3V5FA 2CESA 3OA5A 4CDXA 1IKPA 4LHKA 2DSKA 3ZN4A 2R30A 1OC5A 1MS5A 3WLKX 3DGTA 5D9MA 5FLJA 4YTQA 4B4PA 4XMAA 4GUGA 3P5BA 2RM22 2B7NA 1JCLA 2WSYA 3LY0A 1VRH1 2B5HA 2ZX0A 1D8CA 4K8FA 4LAMA 1UXZA 2J1RA 3RLUA 3W82A 5KHIA 4GD0A 2GU9A 3PF3A 3NQAA 4IDZA 3EXUA 3CB8A 2ZEZA 2Y24A 4CDWC 5C55A 1O4YA 1HIXA 3AXMA 1RV8A 3W7OA 1AL23 5GNYA 1GP5A 2Q1ZB 5FMBA 3NJ3A 1V7YA 1UW8A 4PCSA 3G6LA 3M43A 3C7HA 3CUIA 3W2LA 3MEPA 2FFCA 2E7AA 3I4IA 1QDOA 4HN1A 3RX3A 4FX8A 2F2KA 4GBDA 4C6EA 1FWEC 4R8HA 4ZEPA 1YFXA 2VUAA 3N7LA 2X53S 3MI6A 3CXOA 1XR2A 3APTA 4E4FA 4NRQA 1GICA 2HWGA 5BXRA 3AP7A 1RMU3 2W91A 1LQ0A 2NUXA 4BK4A 2NMNA 5EFUA 5MKGA 1W91A 5EHDA 1EV12 1LLWA 3BYWA 3MLKA 3NDZA 2JDYA 4IEYA 1QW9A 1WCSA 4UYBA 2JIWA 1PSCA 2Q8OA 3HJEA 3HN3A 4EZHA 1HJQA 1XIFA 2W95A 3ZXDA 5D2WA 3E0IA 1WOBA 2JEPA 4GACA 2VTXJ 1Q6DA 4S2DA 4PJYA 2A0NA 4C1LA 1DP0A 4IGHA 5F8PA 3BMVA 3ALGA 4TVCA 3LSBA 4FXFA 4HVRA 1R2RA 4LKFA 3ZIZA 4ORIA 2W0UA 3KM5A 3UERA 1VEPA 1UOGA 4XZUG 1OD0A 1RD5A 3BG5A 3PBWA 5HMEA 2R6OA 4NZCA 4HD5A 2DCJA 3LBOA 2AQWA 3MW3A 3TDFA 4HMZA 1OA2A 2CGOA 4AG0A 1YHFA 1FFRA 3QEZA 1ND2B 4YYFA 5A6ZA 1B35C 1TNRA 1KS5A 1UW9A 5T52A 4YNIA 1SFPA 4K8RB 2QBXA 3I49A 1X1ZA 2PLCA 2WVTA 3UESA 1VH7A 4WVXA 3W5MA 2EICA 2QJIA 2VQ0A 1KRBC 4HTYA 3W7LA 3I3MA 3TZNA 1VBD1 4LIVA 4JFTA 4R9AA 1V6YA 1VB2A 4GI6A 4LEQA 4META 1AYM2 3GIQA 7XIMA 2D2OA 4FEZA 4Z2HA 5JVLA 2Z29A 1MQTB 3W29A 1GQGA 1ECQA 4AEMA 4LYQA 4ZY9A 3S6TA 3IMNA 5AC8A 5D21A 1UWWA 3H7RA 4PC8A 3H0OA 4YFZA 3W1QA 3FLRA 2E67A 5FKBA 1OJXA 1PIFA 3KRSA 4W93A 3TU9A 1W1B1 4MM1A 1JFHA 4E0CA 4ZS3A 5T50A 2MANA 4IIEA 5GPRA 1MUMA 1NLRA 2WUHA 2EPOA 4WJ8A 5DMNA 4CE8A 1OX6A 1XYFA 3KOYA 3KBMA 1QKQA 1E0WA 3OIHA 2VW2A 1BXCA 3PTRB 3RGTA 4QRNA 2OQ7A 1BGGA 3HFTA 2VEKA 3P2VA 5G4EA 2Y5EA 3RMXA 1QJX2 4JEQA 2D3PA 4DO5A 4LO4B 5IK8A 3TW6A 4CCKA 4BJ0A 4JQAA 1V02E 4B2DA 2ZZ3A 3MVIA 1B57A 4RUBA 1XP3A 2G50A 1Q4NX 3BUVA 3EPNA 1U1JA 4PLOA 5HJYA 2ZUSA 4JPGA 3WW4A 3N2TA 4LKEA 3WW1A 5AY7A 3CO8A 4A2UA 2FH6A 1RBLA 4UBGA 2CGPA 3AS2A 3TMQA 4NP7A 4DNMA 2ZAHA 4NJGA 3W7GA 4LBUA 3WL1A 2ZGOA 1M7JA 3SN1A 4J28A 4S38A 3H7YA 4PMNA 4LHLA 4U5KA 4OMCA 2ZKMX 1HKMA 2XMLA 4KS0A 4FPOB 1S39A 1QVBA 4C7DA 5XINA 2GDVA 1RVF2 1S0FA 3S9YA 4WKAA 4GMP1 5BRBA 1H6XA 4FIQA 1HB2A 2GP5A 1BXBA 1X6NA 3W22A 3L0KA 4S3GA 1JG9A 1SACA 3ITYA 3T8QA 1LULA 2ZABA 1JEZA 5DMMA 3MP5A 3BGJA 1CAWB 1Q43A 1VFLA 5CPNA 3WNMA 3VBSA 4M01A 5FYUA 2WMJA 5FZAA 3GK0A 1QIQA 4RZ5A 2TPSA 3WL0A 3OLEA 2J27A 3EB2A 1W28A 1W5OA 1QHOA 3LDVA 2PDFA 1ADSA 1KDKA 1YXDA 2CWMA 2WVUA 2PDBA 1T8QA 3EAUA 1SMAA 3M5YA 3WQVA 4QHOA 2VC7A 2J8FA 2R14A 3TAKA 2BBFA 3D3AA 3AYTA 3NFUA 2HQAA 5CSSA 3VZKA 2YDEA 2W27A 2JXAA 2NN8A 3E5XA 1VYSX 2DT2A 2YXGA 3GHNA 4AC7C 1W1VA 3NR0A 4W4QA 2FZ9A 4FSAA 3E6CC 3OCPA 1ZREA 2R073 3LBCA 2ATMA 1I2PA 4UB9A 4YW2A 2RR13 1QBBA 2JD9A 3DI0A 4DELA 3T9PA 1ZALA 4Q4V2 2BFUL 2J42A 2HEJA 4QITA 2EIBA 1BEV1 2QR6A 2Z42A 1CXHA 3KMHA 3W7JA 3W1NA 3MHUA 1DEDA 4ISRA 1YIFA 1WBJA 4X0VA 2GDQA 2ZUNA 2I74A 4JKMA 4LVDA 1RPKA 1B3YA 1ZLPA 3HM7A 3B69A 4US6A 4L6OA 4MXWB 2X2GA 2IXJA 3GNEA 3PAJA 3W2NA 1FX5A 2ZX3A 3G0SA 1TMF3 1J93A 4MB5A 4MKSA 1EAH1 1AR73 3POCA 4Y9OA 3L23A 4WZCA 3KWSA 1W6TA 3QYSA 1RUF1 4NIHA 1WOAA 1W6OB 4B3LA 1DXIA 1ITQA 1VBA2 3KGZA 3NQDA 1WDSA 3OYWA 4JD4A 3VNZA 3U4XA 2I9UA 4ZPIA 4AHZA 4RX0A 1GOIA 4AF0B 4OBRA 3MV01 1FOBA 3E5UA 3EWXA 3OZYA 1QOQA 1K3IA 1HRI1 4M24A 3M5VA 5G2WA 2LTNA 3KHBA 4FFFA 4H83A 4QDQA 1IEQA 5CGQA 3SH3A 1C93A 1OA4A 4D6RA 3CMJA 2VTXA 1EV11 3F5LA 4PL2A 2K9ZA 4BS0A 1UL9A 4ENLA 4EXBA 5DUUA 3QV7A 3M44A 5I8TA 5G1MA 3WDPP 4DWSB 1G4SA 4UR9A 2VC9A 1F3XA 4Y4RA 1WKFA 4H9ZA 1FHLA 2PMWB 1L8PA 1U83A 5E0KA 3NVCA 2GQ3A 5I0TA 2H3DA 3QTPA 4XHXA 4L4LA 3SCTA 5FYSA 3TYCA 4FFIA 3O1UA 2V3DA 4FI9A 3ZYBA 3TOYA 1KFJA 1UB3A 1H2LA 2R24A 3DF0A 2P0IA 3RITA 2CLFA 1UCWA 3VUPA 1SHWB 1GEQA 4Q4V3 3WUDA 4P9WA 1E0XA 3IVUA 3S6PA 1V9U2 2XN0A 1KS4A 1ZNNA 1LORA 1LRTA 4PULA 4DJDC 4EK7A 2WZEA 1UMYA 2YFUA 4NPRA 1F5JA 3VKAA 3AYEA 5F3GA 2CZFA 4M80A 2ZICA 5BXXA 1G7UA 4HVOA 1GVOA 2QCCA 1EX5A 2QPSA 4HU8A 4HB7A 4KKXA 4W4ZA 2OSYA 1CJDA 3NKTA 3B8TA 2A2IA 2PDIA 5IDZA 1X36A 3H54A 5HPCA 4LO7A 2C5DA 5CEWA 2I7GA 4W89A 3LM3A 5ABFA 5IVCA 4OZOA 3TONA 2FB2A 1X8FA 1UJPA 2P0OA 2NQ5A 2WNVC 1JZ5A 1EC9A 3T4VA 2Q6ZA 1NH6A 3T08A 1LBMA 1TPVA 3E49A 5JOZA 3FMGA 1HGYA 3VZNA 4J40A 5LATA 1SW3A 2VH9A 5JIAA 1K5JA 1M06G 1C8NA 1H63A 2PAMA 2V5LA 5HJLA 4P9LA 4YVWA 3KGLA 2WABA 2ZZ5A 1XIJA 3QW4B 1DJYA 3TVAA 2GALA 1K5MC 2NQHA 4YGEA 1ZBE1 1ZTVA 3BICA 3NDOA 1MEC2 1FCVA 3LE0A 1VFTA 4TU1A 1R9ZA 4XBLA 2VR4A 1ITXA 4UBHA 1EGMA 5D9NA 1E70M 3I6RA 3QACA 4HMCA 2NQYA 2W0XA 1WGPA 1AH0A 5HV0A 5DCDA 3LDKA 3BGGA 1D7KA 4J1WA 2VD8A 2EPKX 2D2JA 2HEYF 3B9OA 5SV8A 3NNJA 1HN0A 1GVIA 3I2GA 4YMZA 3W1RA 3PS7A 1STMA 4Q4X3 5CC5A 3VIHA 3MMUA 2OO0A 4QNWA 1J0JA 4Z0JA 1VBD2 4YARA 4HHMA 4K7YA 3IK2A 1NAL1 1QPRA 2QIWA 5JIWA 5IK5A 1Q8VA 1VD6A 5ENLA 1U5XA 1YLVA 1M6JA 2QCDB 5I79A 1V0KA 2FZ1A 4I6VA 5FCCA 3I59B 3GYCA 1PK6B 3OHMB 2CZEA 3UGRA 5FZ1A 4AEDB 4CA9A 2IKIA 2BFGA 4XJZA 2WIIB 3NV4A 2F61A 5C71A 3WDQA 4EPEC 3GSMA 3OPTA 4J3TA 5DAXA 4YGBA 3QMTA 2X7VA 3V0BA 4G5DA 3BOLA 1TPWA 1VRH2 1G8WA 4UW3A 2VGIA 4Q8LA 3KTXA 3DYOA 3GIYA 3TN92 2OZ8A 3WFAA 4O11A 3IIPA 1HNYA 4NHMA 3NZRA 2UV8G 2HBVA 4ASKA 4P14A 1FAYA 3PHMA 4G9PA 3IGXA 1W37A 4YCPA 4CP2A 2GGHA 2HVNA 1YFWA 3SCGA 5BV6A 3V7PA 3WH9A 3GNOA 2J1AA 1I45A 2W3ZA 1VHCA 4K3ZA 1B3OA 1FPN3 4NWVA 2SFPA 4WVZA 3V56A 4XVHA 2B81A 4WIWA 5DDJ2 4I0BA 1B35A 2PTZA 1B3VA 4MYXA 1LQAA 3IJQA 1NE6A 4IGSA 3LSDA 2ZUMA 4GJYA 3H26A 1SPPA 3E5QA 4M8UA 1OLRA 4E27A 1NDVA 2PRHA 4OHWA 3CLWA 1W5PA 3K51A 2QJGA 5FZGA 1W9XA 3AJYA 2XIMA 3G7DA 4LS0A 5JQ9A 1CENA 2P10A 3IBMA 4PF1A 3GAKA 1BVP1 2XFYA 2Z26A 2YA1A 4Q4X2 1YRZA 2PDKA 1K5MB 2DYCA 3THTA 3ZYZA 1SDDB 2FCUA 3NQHA 4YM2A 3LERA 2YSWA 3QGVA 4OFCA 4HOOA 1CGPA 4JKKA 1V6TA 3HGJA 2ZX7A 2PP3A 3N6HA 2IXUA 1PGW2 4RHV1 1OFQA 2HDJA 4AD4A 4GUIA 4O18A 1K77A 1Z9AA 4OIFA 2GC0A 4K9SA 4EE2A 1W1TA 1EUAA 4A8RA 2CU5A 1G6NA 3PJUA 1UZHA 1NP0A 2C7FA 3UWQA 4ZXLA 1EJUC 3NQEA 1W56A 2A3BA 3DC8A 3U5UA 4QGCA 1T40A 4QT6A 3VPLA 5T5OA 3AVSA 3ONBA 3NNTA 4IFRA 2EEXA 5I00A 1ZRIA 5HJXA 3MF9A 4NAFA 3DV8A 1VPHA 2RHPA 4QQLA 4EP8C 1IPKA 2Y0FA 2FVKA 1Q7MA 4YW6A 1LHOA 1LWJA 2A6NA 2BHUA 3ARSA 3GTFA 4Q6XA 2ZX8A 4CP1A 2WKJA 3DI1A 4E9KA 2EXIA 1I5PA 2CLIA 1FNZA 3PUGA 2G37A 1QMJA 3P0XA 4AFCA 1F3EA 3ZSTA 2WS93 4XAGA 1Y7BA 1NKGA 3OBRA 2CBUA 2FD8A 3HZ3A 1TME2 1ONEA 3PWIA 1AYM1 4LCQA 2VCMA 4PHZA 1B3ZA 5FZHA 4ZQOA 4BYYA 3WH5A 4W85A 1CGXA 4JL1A 2BJSA 3VX1A 4FTBA 3REQA 4EN9B 3K3NA 1WUFA 4MMWA 1X38A 3B03A 2CITA 1XU2A 1PDYA 1BJQA 3MUZ1 3ZFEA 1BYHA 4LIUA 1MS9A 4G7EB 2P3ZA 3ZWSA 4ASTA 2ILMA 1KGUA 1TV8A 4Y8FA 3CJXA 1R3TA 1JYVA 3TN91 2VVDA 3ZJ8A 1R0MA 5L9BA 2QPUA 3W1AA 2WJEA 3MBDA 3H8AA 1DQXA 2WNUA 5FYHA 2ZC8A 4X61A 5F3EA 5ABGA 4C1NA 4EACA 2W67A 1SDWA 3LZZA 4XUGA 1JDEA 4J1XA 1KJLA 4A3QA 3A5VA 4KG8A 2Y8VA 8A3HA 3PUQA 3LCWA 3CPGA 1RUJ3 2PD5A 5EPAA 2XWEA 4ONVA 4XBNA 1NP2A 5CBIA 3W7DA 4P02B 4O14A 4QJ5B 3K8KA 3GR8A 1DQ2A 1I9CB 3A12A 2GZXA 3ANYA 4CQDA 2QQVA 2JGQA 1N8IA 2QGHA 5KITA 5C9UA 5T54A 1AJZA 1R47A 4RLIA 5JZGB 4ML4A 4CQ9A 4NAFB 4YG3A 3LRKA 4ATFA 4B7EA 4I9TA 4YW5A 3R1ZA 1FDJA 3W1UA 4QCFA 1DF0A 2ARXA 4PI2A 1IR2A 1CDGA 3VZOA 3LXBA 4FP1A 3ZSLA 2EG8A 1SO6A 3SXWA 1YE4A 3NPXA 5FYYA 3FC0A 1J5SA 1P5BA 3QJAA 3WF0A 4E4DX 2EPMX 4MZUA 2WMKA 2DBIA 3VOFA 2R82A 2POTA 2Y7DA 3CWOX 3KQ4B 2OKTA 1A6CA 2Y8UA 2VPVA 2W87A 2AKZA 1C8VA 2O9RA 5J3UA 1VFFA 1SMVA 4TYSA 2AZ5A 1EF2A 1R8LA 3CBWA 3D0JA 2X30A 1K5MA 1XFCA 1RJ8A 2IWGB 1XQLA 2VNCA 2EQDA 4IMEA 1PX4A 2DIJA 5D32A 3QV8A 4ZFCA 3STFA 1MFVA 4YGDA 4BM8A 2IKJA 1XGZA 3QD6A 2IVIB 1WAWA 2WZMA 2INFA 3P0WA 1XIBA 4KEMA 1RHCA 2RR12 3O9NA 1F2JA 4QX2A 2DJXA 1PAMA 4L5ZA 2UWCA 1IXNA 2J7FA 5FPXA 3BPWA 3VTRA 1B35B 1UUMA 4DY1A 2V8ZA 2J7GA 2OUHA 4ZA0A 1XCXA 3MI3A 4F3HA 1EY2A 4NWWA 2AGTA 3CQKA 4U3CA 5CXPA 3HV9A 2YA2A 4Z1DA 2QS8A 1K6AA 4LALA 4AZCB 4Y9AA 3GZTB 1V77A 1HQWA 4QM9A 3E5PA 1OX4A 1V6XA 4MSSA 1XIMA 4A3UA 1X9TA 1MZ5A 2WWJA 2E25A 1YIXA 1FXQA 1WZLA 1U1UA 4HNTA 5FAGA 3UG8A 1BQCA 5XIAA 2ZMLA 3WMCA 1SFSA 5A3TA 1YXYA 3AZZA 4UW4A 1W3NA 4BZ4A 4J2PA 1LECA 3USBA 1HO4A 1E6QM 2ZXDA 3C4UA 3CQ0A 2HEWF 4ONUA 2ZZJA 4WR3A 3ZJ6A 2A6WA 3I65A 4W6YA 1UD8A 3ZDVA 3QPEA 2UY2A 1QCWA 3ACGA 2W9XA 2YU2A 5I8SA 4AX7A 4ACZB 2ZRYA 3CZGA 5AC91 3FVMA 4AEDA 4JZ5A 3EKLA 1XIHA 5JXQA 1K1DA 4ARYA 2PHFA 2XTKA 3WF2A 5ISLA 1JI2A 2QCDA 2Y33A 1BKZA 1WV2A 2ANUA 2Q3RA 3WBEA 1X7IA 4AAPA 1SM9A 3UZZA 4L0PA 1UZ1A 3F2DA 3WLUA 1MSSA 2W61A 1O3TA 1XYZA 3DHFA 4QHBA 4XCAA 3KVKA 3KP1A 1JXJA 4F48A 1E6XM 3L68A 3GKAA 3L4UA 3IRDA 4DM2A 3VBFA 3WW2A 3BAKA 2J8TA 4E2BA 2NT1A 1W6PB 5JOYA 4M81A 3CPRA 4GFSA 3VMNA 3LCPA 3BIEA 4MFDA 3L65A 2FMDA 4LW7A 1QXPA 3WF4A 3MIBA 1JYTA 1Z7S1 4D6QA 2CLMA 4OHVA 2WK2A 4QE4A 4QROA 3WYZA 3CNAA 4FOUA 2Y5JA 1EHAA 3ZSMA 2EXOA 4HIBA 4UQAA 4CD4A 5A6BA 4L9ZA 5GALA 4IICA 2G3JA 5M5DA 3KF3A 2WVVB 7CGTA 2XUEA 3W2MA 4GI9A 2RH9A 1JR1A 1UXXX 3FUOA 5HAOA 3C7EA 3PNAA 3AI0A 4TWTA 4B3ZA 4AVBA 1KBIA 3VBOB 1W9DM 4F2UA 4BQWA 4V2XA 3WDYA 3QZAA 3NV2A 3JQWA 4PUKA 1EP3A 3R13A 3ZX7A 1VE0A 3UJSA 4IG2A 2A21A 5BXTA 1OEPA 3BOFA 4QB2A 4QLJA 2NZLA 5M1TA 4NJKA 5I91A 3W37A 3HF3A 4GZJA 3PZMA 2ZHKA 3NQMA 4F8AA 3R5EA 1RC6A 1ITCA 2J7HA 3CH9A 4BCUA 4KU7A 1PCWA 1KGXA 2ZIDA 4JTJA 4L7ZA 1V0AA 3WO8A 3M4FA 1KITA 4IZGA 3L9CA 3AIVA 3V5OA 1ZRRA 4E4ZA 1TPB1 3OPSA 2WT2A 3G8EA 2C4XA 3CUZA 2J1TA 3RYKA 1O5KA 1W8FA 1VGAA 2YYOA 4NAMA 4WSKA 2VW0A 1ZBE2 3OGGA 4Q6JA 4QEEA 4YLZA 4XETA 5CG8A 3KZPA 4LUMA 5DAPA 4UZSA 4FFGA 2X1SA 4Y1XA 3T8LA 4IMFA 3KCOA 1GTEA 3VKNA 3GD6A 3EHKA 5E6HA 1SO5A 2VR2A 1OF4A 4RXGA 1X8EA 8XIAA 1NVMA 1PS9A 4NSBA 1TJRA 1JYIA 2IPJA 4Y22A 4ALDA 3HB9A 4QPGB 4F9JA 3MANA 1RXGA 4EYUA 4UTUA 4MB3A 5CPQA 3BU7A 2ZRXA 4HNOA 3W2UA 5EZWA 3V3WA 3RQ0A 2E7FA 5FEZA 2VURA 3QM3A 4UTJA 4B1LA 2VVFA 3OOQA 1DQ6A 2PWGA 1X39A 4CQAA 1S55A 4FVVA 1YJKA 1H7XA 3ITGA 2J13A 4D8LA 2D2HA 4I9AA 1IS3A 2AACA 3OYWB 1EO7A 2ZZ1A 4PB4A 1Q6EA 4LOCA 3T2TA 3NQBA 4S2BA 3DXTA 2MEV3 1JQXA 1E4IA 2IUZA 4Y24A 4URIA 1JUIA 3WZ1A 3H53A 3A21A 1OT2A 3A4JA 1AR81 4OE7A 2D6PA 4O1FA 1ULPA 4Q4KA 4F0LA 3INPA 1ME8A 5HQEA 3WG4A 3EMCA 3ZLGA 3T7VA 1PMHX 4OT7A 4YVWC 1NG0A 2FZBA 2JF7A 1JDCA 1X6LA 5TF0A 1DGLA 2IC1A 2Z7GA 2V5JA 2BERA 5IVJA 5C33A 4XC9A 1FVPA 1NF0A 5C9WA 1W6NA 1QHPA 2EIEA 1HXS1 1YNYA 4COUA 3VBUC 2HNEA 1N47A 3UKNA 3R11A 4DVOA 2I17A 1A53A 1BRLB 2WNEA 1A0EA 3HPFA 5JIUA 1WDWA 2Z6JA 3F03K 1UIKA 1IPSA 1DYOA 1ENUA 1GJUA 5KZ6A 4C0BA 1YADA 2A6LA 2PXJA 1W3XA 2D44A 3DEMA 4WY0A 3D5HA 4FBFA 2ZX5A 3JZUA 5BWFA 4RNFA 1GNHA 2GWGA 2FJUB 4HJFA 2PDMA 3G1YA 2YBPA 4M3CF 1UU4A 1K9EA 1HG3A 1Y65A 2PWUA 1TPFA 2QCEA 1UC5A 1Q45A 1NU5A 1XICA 4FHAA 2GFTA 4Z1YA 5HQMA 3ALQA 3MZNA 3RHGA 5LEJA 3ZFFA 3MP3A 1S2VA 3LEKA 4DQWA 1BWLA 3GF6A 1LDCA 1J11A 2XWBB 1GHSA 1PZ7A 3LPPA 4F66A 3ZR5A 1H8VA 4AVNA 1JI6A 3WK3A 3R6SA 5A8QA 3II1A 3WFZA 1YI7A 3CL8A 3H8UA 2DZWA 3LPGA 3UY8A 1F8MA 1KWGA 3HNBM 3POYA 3LTPA 4L64A 1B09A 5DXYA 4TN7A 2ESCA 4PGLA 1DXFA 3VGFA 1VZWA 3LDRA 2VBDA 1NSJA 2OEJA 3ZR6A 1ZPTA 1UY3A 1BBT3 1GR3A 1QY4A 2V5DA 1C4RA 1MZRA 2WHKA 2ET7A 2ACQA 2XSXA 2DFCA 4JY8A 4RQPA 4F2BA 4RL7A 2QZ3A 2XJSA 4YNGA 1VAMA 1E0UA 5JAXA 2J24A 2EGZA 5FRAA 2ZQ0A 3LCFA 4JTTA 3CWHA 3EDJA 4MF4A 3NMBA 1GPWA 2XJ7A 1ZM1A 3NAPC 2Y7FA 4FK9A 5FKYA 2ATFA 2GYIA 1SO4A 1FWJC 2QQIA 5HCFA 3RS6A 4PYSA 3BVJA 5CA6A 3G0XA 2X1TA 1REFA 1EXBA 4NHYA 2OA2A 1FCUA 4CTEA 1ZU8A 2CKRA 1QQP1 4C6JA 4NZ3A 3OY8A 4XJ9A 5FJRA 5JOXA 4CU9A 5FJIA 4EF8A 4IIBA 4GIQA 1P43A 1E6ZA 2B4KA 2HE8A 4LX4A 1M68A 2IQ0A 4XUYA 3LNMA 1W9WA 3SGUA 4FPEA 3ZMOA 1GV9A 4NASA 3SRHA 1OYBA 3TV8A 5AC4A 4HPJA 1A50A 3PB2A 3GC2A 3QZEA 5FOOA 4AWDA 1OD3A 4L65A 5LIKX 5KC5A 2AL2A 4I09A 3KHCA 4MZ8A 5DEZA 4NNCA 3WBYA 1YC61 5FXXA 1UQYA 1V9U1 3HJRA 3STGA 1GQJA 2LROA 3QV9A 3VIGA 4WDUA 5B4XA 1XCWA 4DOUA 4J5NA 4NX0A 5AHMA 3VKCA 3HQ1A 3EB3A 4M51A 4C0HA 3GFYA 3KBSA 4CNPA 1IHIA 4DXSA 2PTYA 3UWVA 1BBT1 2CYFA 1IEVA 3LRMA 4ZVJA 1W6QA 4CEWA 3V0AA 2TMDA 1COV2 3ST7A 1H7WA 3AMDA 5BOFA 3MKCA 5FR3A 4EN6B 4JDMA 4RE2A 4Q0QA 4S3EA 1NY1A 2WT0A 5FZ3A 2VO5A 3CNYA 3CJIA 3AP5A 3PZGA 5T3NA 2FLIA 1KXGA 1ND3A 1YE6A 3SCFA 2QUUA 4PRWA 1CX4A 3HQXA 4GX9A 3M0XA 2ODOA 4DWDA 3OW1A 5JPNB 2FCTA 4N2YA 2QJJA 3TWIA 4TV6A 4UZUA 1BMV1 1NFPA 3TLLA 4W7VA 3UFYA 2V69A 3R2GA 3GG0A 2DVGA 1Q6OA 4IIGA 3WN6A 1MEC1 1T41A 4RV8A 1C8XA 5DX7A 2E31A 4NZ4A 4QXBA 4ATWA 1J0ZA 3FL7A 4L2NA 3SGZA 4D7YA 3RM9A 4D7SA 4RGKA 4YZ1A 4K7VA 2PDPA 1BG4A 4QAWA 4RDZA 3VD7A 3VIMA 4PRTA 3WD5A 4B16A 1ZJAA 4H6EA 5RUBA 5LBBA 4BDVB 3NJVA 2BSLA 1A3KA 4KWWA 2I5QA 1NCQB 4HOZA 3MU7A 2Z1KA 1HXS3 2W08A 5DAQA 5HR6A 3NPWA 1WBHA 3FJ4A 3LCXA 1J2BA 4PBOA 4XAFA 3RRDA 4MHRA 4MIMA 3B9DA 4NZFA 2QEZA 1FXPA 4FIRA 4BK9A 2QGYA 3UYIA 4U33A 3KS5A 1TZ9A 3TA6A 1XD0A 1GOOA 2XKOA 3ZPYA 1XBFA 2WJZA 1HIZA 4CXYA 1OF6A 2XVGA 5DXXA 4YWIA 2V30A 4KI5M 1TEIA 2FMYA 3GFZA 3PIJA 1VBUA 5JMOA 5IFPA 1BTMA 2X05A 4F79A 1G4EA 2HYXA 4XBSA 1MI3A 2ARBA 2ZJCA 1MZFA 5FP9A 1MDLA 5EPDA 2P6HA 5DZFA 4L97A 4AL9A 3SEEA 4BI7A 4TTGA 2C91A 1BPLB 5IT6A 2WSQA 4F0HA 1F6YA 4JY9A 4Z07A 3MA8A 2CHNA 2P8BA 4AXOA 1GW9A 1NWUA 1OSGA 1Z7AA 2REQB 1UD5A 5FWEA 1GOQA 4AVAA 3I7QA 4JAWA 1YX1A 4AZ5A 3SBFA 1OQDA 4FX6M 4P7OA 1X82A 5TIMA 2E51A 4Q8KA 3UWYA 3P6BA 2Y7GA 4GX8A 1CXKA 3HBZA 2E5BA 3VBHB 3ZKYA 1GVSA 2RMU2 5A3OA 4CPBA 3MGUA 1KM6A 1R7AA 2PBGA 3KRZA 4E8DA 4DXRA 3MCNA 1LU1A 1XV8A 3B9CA 4NILA 1F5ZA 4RQPC 3IUIA 2VFEA 1EWDA 2A5ZA 4U2ZA 4ES9A 2QV4A 2YZRA 3KLKA 3R6IA 1B1YA 3NSMA 1WZKA 1EOKA 4PCFA 1WW7A 1UZZA 5JVVA 1TTJA 4ROPA 4MGSA 1H51A 1UR8A 1YTDA 2EJAA 1VBA3 4AYUA 5F4SA 2PAEA 3B40A 3S8HA 1QJX3 3RNSA 1LTEA 4XOGA 5ACA3 3F7JA 1HJWA 1OOPA 1QASA 3BLLA 5LA0A 1R46A 1W1IE 4P9JA 2QCHA 1A8DA 2FDSA 3RRXA 3LAGA 1ML1A 5E5CA 2DZBA 3WQ8A 3BZJA 3AUJA 3VILA 3PZNA 5HMFA 2YDQA 3QSRA 2X5IB 3ZFFC 2WNOA 2Q8XA 4AFBA 2GOKA 2XKPA 2ZEXA 1U5HA 3C0LA 4JR5A 4YW1A 5IRPA 4K36A 3EB4A 1ODZA 3AZRA 4ES8A 3ABOA 3P14A 3K8MA 2ZGMA 2ZA2A 3HGSA 3VYLA 5K0UA 4ZQPA 3LI0A 3VZXA 1VYRA 3DESA 2GDUA 4ZODA 4LBNA 4JTIA 1BTCA 1ULGA 5CVRA 1XKJA 3QF0A 3CU7A 4GG9A 2WT1A 2V68A 3U57A 3O05A 2CYGA 2A70A 5LY2A 3SC7X 3UG3A 4CXWA 3WELA 4TMCA 3OVPA 3I7RA 3PNUA 3GDKA 3U37A 1JUEA 4DYKA 2TRSA 3N04A 4J4KA 4B1MA 4NHVA 1FBAA 4IEXA 2RDXA 3MLJA 3BPSA 5EP9A 1FXZA 4ACYA 2VXRA 2P53A 3QFEA 4BWLA 3ATZA 1LWHA 3VN4A 4QDRA 1H7PA 2WKLA 2YCJA 3A22A 3M0ZA 1BK1A 4W8LA 4A05A 3MHFA 1POJA 1GJWA 1J12A 1A3HA 2HBXA 2WZR3 3GXNA 3LLDA 4IX2A 4V27A 3VIFA 5JBFA 2IQTA 1UH4A 2QE3A 4YIWA 2GUYA 5EMKA 2C1HA 1VBJA 3VNIA 2YL9A 4JCLA 2WBKA 3KHJA 3IV3A 3ENLA 4QD2A 1HVXA 1WPCA 2ZX2A 3LV6A 4QIUA 4ZENA 3OBKA 1ZQ5A 2RVAA 3N12A 2CGNA 1O12A 3KAOA 3CIWA 3C0QA 5CZTA 2PZNA 2FFIA 1XPGA 1W5QA 1PO12 1BD0A 3PUEA 4OULA 3NA8A 3S46A 2VOMA 1UP2A 3SSJA 4XF4A 5G2HA 5GKAC 1GPFA 3F1QA 3WLNA 1GEHA 5FY4A 3H1WA 1OT5A 2HLEA 2A5HA 5AECA 5FXVA 4RE4A 3WLIA 4U3AA 2I07B 1HUVA 3NSXA 3ZYJB 1QJU1 1R3QA 3EWUA 5K7JA 4PMZA 3E6DA 1K6WA 2YB7A 4NVTA 5A1AA 1VJZA 3A24A 3S9IA 1TWDA 2G9FA 1FWHC 1NXD1 1VFSA 3GHRA 3U48A 4GFIA 4LVFA 3W4RA 2JWPA 2CXEA 4G1KA 4C6LA 1T99A 4FI4A 3AC0A 4CVWA 1E71M 4AFMA 2FTPA 3HPSA 4Y9NA 5FACA 5J5DA 1ZZ8A 3PU8A 1MVQA 1JZ6A 3W24A 2D97A 1CB2A 4NX5A 3S3GA 3WQ5A 3OG3A 2YHJA 2VFHA 4HMEA 2E6FA 5D2VA 4Y33A 5AFEA 3H2AA 1F6KA 1TELA 1QO5A 1UC4A 3AVRA 5BNNC 4BF7A 4LHNA 1XC4A 5DZGA 2FBEA 4R27A 2VUNA 1CPNA 1UG6A 4R9OA 4V1YA 1ONXA 5K3VA 5J37A 4CEYB 4QX1A 3W28A 4C1KA 2HZGA 1UOBA 1VPXA 3QV6A 1C1FA 5JLVA 4LU0A 3H2EA 4AQ2A 3TYEA 2LALA 1KO0A 5KMYA 1SW0A 1M04A 1QDSA 1YQCA 1IT0A 1WCDJ 2PGFA 2VD7A 1ZRFA 3PZ9A 4OTKA 4WM7C 2Q8CA 1YDYA 1JZ8A 4LUYA 1TJ1A 1Q6CA 4C6MA 1G6CA 4JHMA 1GZWA 4FPGA 2D0HA 1TVLA 3FKRA 4FS9A 3LIHA 1XLCA 4FLSA 1FWSA 3RU6A 3GQYA 3NNGA 2FJKA 2I56A 3SKVA 2DY3A 3AWNA 3M16A 1CWYA 1QDCA 4MNJA 4EAYA 1TRIA 3H23A 1IS5A 2V4VA 4TTUA 4B91A 3P81A 1AQFA 5BXPA 2BW8A 1TREA 4GWEA 1M3UA 1VAHA 4DBDA 4TV5A 1PDZA 3KWVA 4I8YA 4KIEA 3BQ5A 4KESA 1LOQA 4FPHA 1QNSA 1OX4B 1IT7A 1ZZBA 2VECA 2AQVA 3PBGA 1VEMA 1OFBA 2CHHA 3VMOA 2R94A 2CAVA 1KBLA 2ZADA 3QXBA 1OLQA 2E40A 5AHFA 2QMKA 2D2GA 1VBE2 4MG2A 4H14A 2V0TA 3I10A 3LKJA 5D03A 1JS9A 3NW4A 5CZJA 3KT7A 2Y6JA 4NIRA 1AQ0A 4JDNA 3QC0A 3VBRA 3FDGA 2XH7A 2DPEA 1PUDA 4HNCA 3UXKA 3O6YX 4F8XA 1JODA 5GZEA 1KCXA 1S4CA 1CPUA 4RR3A 5IAXA 4D6DA 2CY6A 5FCZA 3GWQA 2D6MA 2QHAA 4FPCA 3IM0A 5J36A 1AR72 2NXHA 4GINA 4U4MA 1XBZA 2L5HA 3LTSA 2VE1A 3PULA 3H6OA 9XIAA 4JFSA 2YYUA 5CEHA 1GVRA 2UBPC 1DHKB 4J1OA 2BOGX 1B3XA 4IOTA 4ML9A 1DJHA 2CWSA 4OWGA 3J26N 4CP0A 2V9DA 2QVSB 2F4LA 2E6VA 4DLMA 2XDVA 3EWBX 1QI4A 1LU2A 2UWBA 1C8M2 4TXWA 1FV2A 3T30A 1R3YA 1K7FA 2PLV1 3AFKA 2YDRA 2WYFA 3HMJG 3MBWA 2VMFA 1X98A 2VENA 3ETQA 1V93A 3GS6A 4NIIA 2QQPA 3F5JA 4W87A 4CDWB 2BWAA 4XILA 4I2OA 5HINA 1ULEA 1H2JA 4BIFA 3UY7A 4UFJA 4QCEA 3SCRA 2VGDA 1MZEA 3E0VA 3POWA 3BAYA 4TQTA 2AAAA 1ODMA 4XSMA 5CPOA 4L4PA 1VFUA 5DBUA 4GKYA 1MS1A 3C3VA 3LLXA 3W7KA 4RR3B 1MRQA 2W1WA 3HNMA 5C5YA 4I5UA 3RMEA 4PRRA 1V6NA 1N1SA 5FMOS 1OWQA 2GC1A 2KA3A 2O14A 2VMIA 3LSCA 3MPPG 2PRMA 4H9TA 3KLSA 3S7IA 5FMDA 2FDIA 2X41A 5AVNA 2KR2A 2EXJA 1XIEA 1VR6A 5A6SA 2IS7A 1ZENA 3MS8A 2ACRA 2GUBA 4BKNA 3MJMA 1T2XA 4QSFA 4Q8OA 3T81A 4RHV3 1OUSA 4XDQA 2R6QA 2V63A 1XBYA 3AYAA 3UZYA 3JB8A 1ZZ7A 3JS3A 3CHXA 1F73A 5G5IA 5FMOL 3VKMA 2FPVA 3BG9A 1RY8A 3M4HA 2B9UA 4CDQC 3P5ZA 3OVRA 4O28A 3RLHA 3ZT5A 1JNEA 4AZIA 3ICJA 1QT1A 4K1YA 1PO22 4O1DA 4OUEA 1R85A 4W5UA 5E1QA 2V3GA 4LRSA 1UKGA 2R9RA 4WM8B 4CUBA 5H9SA 4EX4A 1CQ9A 3SISA 4EWND 2VMHA 1S2UA 3GE7A 4AI8A 4M0XA 2CFFA 1BWVA 2YIHA 3U1XA 2CZ5A 1SLAA 2R1MA 2HV5A 1QXLA 4YM0A 2QQOA 1G9DA 3VCNA 3WD0A 3ASIA 4XZNX 3ES4A 1SFTA 3B9AA 2ARCA 5BU9A 4PCNA 5LYRA 2OS2A 1W54A 2G1MA 3GZAA 4JQRA 1LOSA 4FMVA 4KT2A 2DEPA 2NLRA 3VHRA 3KVMA 1S5TA 3BAIA 4R88A 4QXHA 1W3HA 2Y4SA 3EMZA 5FI8A 3W2JA 3ZWTA 3HBLA 4U2AA 4H9MA 1VENA 1P7TB 2ZVRA 2Q30A 1UR4A 4A29A 5C3PA 1YW1A 2RS31 3IPVA 4N02A</