3GZAA

Crystal structure of putative alpha-l-fucosidase (np_812709.1) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
438
structure length
438
Chain Sequence
ELPVPKPHQLKWHEAEMGAVFHYDLHVFDGIRYGQGNNRINPIEDYNIFNPTELNTDQWVQAAKAAGCKFAVLTATHETGFGLWQSDVNPYCLKAVKWRDGKGDIVRDFVNSCRKYGLQPGIYIGIRWNSLLGIHNFKAEGEGAFARNRQAWYKRLCEKMVTELCTRYGDLYMIWFDGGADDPRADGPDVEPIVNKYQPNCLFYHNIDRADFRWGGSETGTVEYPCWSTFPVPCSHHKRIESSIDQLELLKHGDKNGRYWVPAMADTPLRGANGRHEWFWEPDDENNIYPLNTLMDKYEKSVGRNATLILGLTPDPTGLIPAGDAQRLKEMGDEINRRFSSPIARISGQKKSLTLKLGKEQSVNYCIIQENIKNGERIRQYQIEAKVNGKWQTVCKGESVGHKRIEKFEPVEATALRLTVSESIALPDIINFSAYSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords putative alpha-L-fucosidase
total genus 140
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1510 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3gzaA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gzaA01
4WKFA 5E9AA 2JF6A 3ALFA 3RM8A 3VINA 3ECQA 1ISXA 1PIGA 1TE1A 2OYLA 1XH1A 1XSJA 3THDA 5CZKA 2XHYA 5D9MA 2YDQA 3N04A 2WSKA 3FY1A 4MAZA 1UH2A 3ZM8A 2EPNA 4HA1A 5BRPA 2UY3A 4HTYA 4QCFA 1W1PA 3FAWA 1OGBA 3EMZA 1DWAM 1OBAA 3WELA 3MV01 2E9BA 4OOUA 1XD1A 1AQ0A 3CZGA 1MWOA 3GH5A 1V6YA 2VQUA 1G01A 4HOZA 1J0JA 3ZQ9A 2QMJA 4WSKA 4AD2A 3A47A 4D71A 1W1TA 5A8OA 4GO8A 4AZ7A 1E72M 1OD0A 3WEMA 3VIPA 1KBBA 3DYMA 2QHAA 1XD0A 4D6IA 3W81A 1XH2A 1HX0A 4J3VA 1ZJBA 1KQYA 2NT1A 5D8WA 3II1A 4RL3A 2E8ZA 2W4XA 3PHAA 2WMFA 4WKHA 4PMDA 1K9FA 2XSAA 1ZBCA 2XVLA 3IAQA 1E71M 3L4WA 3NCOA 2JALA 1OT1A 4S3KA 3QHOA 1UWQA 2PWDA 3AHTA 4Z2GA 5M03A 4B9YA 2B31A 3D5HA 5A2AA 4CU8A 4ZXLA 4EK7A 1MW1A 3GM8A 4PMVA 4AZIA 4AZCA 2VJXA 4J3WA 1JYNA 2Y4SA 3TTOA 2ZX6A 2VI0A 3CIVA 1J0HA 2CCRA 2XVNA 3T0BA 4QP0A 3WD0A 5F7UA 1UKQA 1IV8A 4IUGA 4CD5A 1SFSA 4AD1A 4UQBA 3AS0A 3MMWA 1C91A 3OLEA 1M03A 3NSNA 3DECA 3AFBA 4J28A 3WH7A 1VFMA 1OD8A 1VFFA 3QOMA 4AZ6A 4AZBA 2YL6A 2WC4A 1HL9A 1LL4A 3VM7A 4CCDA 2GDVA 1LQ0A 3ARZA 2ZX7A 1QBAA 3SCUA 3JUGA 1VENA 1JF5A 4CVUA 1UHVA 3WUEA 2E9MA 1OWQA 1HNYA 3KL0A 2DSZA 4UQAA 4UQ9A 4WSJA 3B9AA 1MW2A 3I3DA 4C7FA 2BY2A 2J25A 3VIGA 5FL0A 2JF7A 4Z2IA 2JFEX 4CVWA 2AAAA 3CHCA 4DM1A 4UQCA 5D4YA 2J79A 1EH9A 3CZ8A 1PAMA 2VZVA 3ARXA 3J7HA 2XIIA 1YHTA 4AIEA 4FF5A 9CGTA 2PBOA 4P7NA 3GNOA 4GO9A 2IUZA 1EQPA 3DYOA 4MNLA 4BA0A 4H2CA 2V3GA 1CDGA 1GQKA 2J75A 4PUDA 5LYRA 2WHJA 3VTRA 2BHYA 1AQHA 3ZR5A 1HKIA 1O6IA 2CPUA 4CUCA 1XHGA 1KWGA 1BGAA 1Q6GA 4JCMA 5A6JA 4LYRA 3GXIA 7TAAA 2IXVA 2WYSA 2PB1A 4M8UA 3TP4A 1QHOA 2WVVA 2VR5A 2DEPA 4W7VA 1VB9A 3CZLA 4BQ5A 3GXFA 3MUZ1 3FXYA 3PN8A 3ZSSA 2QPUA 1WDSA 2GK1B 1MFVA 2J62A 3WN6A 2XGBA 3A6OA 1EO7A 2CKRA 3SCPA 2PC8A 2X2YA 3LPPA 3WSUA 3NDYA 3GTNA 2PWFA 3WUFA 3DYPA 1HVXA 5CPSA 1KGUA 4JL2A 4BQ3A 1EHAA 2DIJA 2ZIDA 1B3XA 5EBAA 2WZIA 6CGTA 3MANA 1Q6EA 1L0PA 3ZJ8A 2EBNA 3CH9A 1VIWA 4AYSA 2CEQA 2CKSA 2ZX8A 1UR0A 1HP5A 3TONA 1JAKA 2XWDA 1UYQA 1QNQA 4B3KA 2WB5A 4BZYA 2GFTA 2DT3A 1JFHA 2WC7A 1OM0A 1CECA 1OINA 2VX5A 3MMUA 4W88A 2D1ZA 3IJ7A 3TTYA 4H8UA 1UR2A 3EDEA 2YBTA 5I5RA 3PZTA 2V3EA 3AYRA 1J11A 1CZ1A 1W9UA 2WKGA 1GZJA 1HP4A 2V38A 5FL1A 2WHLA 1LLOA 3AS1A 4IM4A 3OA5A 2D24A 2G3MA 4KRTA 4CCCA 3QHNA 2BHUA 2VCCA 2X1IA 1C7SA 2WVSA 3F5JA 4H8HA 1E56A 4D1JA 1JDDA 3BAWA 3AIBA 5FOOA 4D6CA 1FFQA 1H09A 1ZJAA 3SUWA 5CGMA 1XSKA 4DUVA 3FHQA 3M6DA 1BPLB 1XGZA 4HA4A 1LL6A 1DTUA 1S46A 1Y7VA 3GXMA 1BQCA 1BG9A 3WNNA 3BLKA 3AIEA 4ATDA 3KEHA 2ZUMA 1JYWA 2YA0A 3BAYA 4B3LA 1D7FA 1WCGA 3TOPA 1OGSA 1XYZA 2DH3A 3AS3A 3L4VA 1W91A 2V3DA 4JFVA 4W8AA 5BXTA 3N18A 2DQXA 3MU7A 5DFAA 5CJ5A 3SURA 2OWXA 2X0YA 1GVYA 5C70A 1GOOA 1XYFA 1BYCA 1V6XA 1XCXA 1BVZA 1UUQA 5JBFA 1MFUA 1D2KA 1WPCA 5IDIA 2A3AA 2F2HA 5HXMA 4LGXA 3WDHA 1RD6A 4BS0A 2Z1SA 1QI5A 4ZE4A 1AMYA 1TZ7A 2ZWYA 2YA2A 3W37A 2J8GA 1CXHA 1LF1A 2DT0A 4C7GA 2RGLA 8A3HA 2VX4A 4MNJA 4MPKA 2O92A 4PMOA 4YN5A 3EMCA 1UG6A 1CTNA 2VR4A 4TTUA 1A47A 3AMGA 2VCBA 3WEOA 2QLYA 5CLWA 3RJYA 1E0XA 3CLWA 4PMNA 3VMOA 2YL8A 2XM1A 1JGIA 2HVMA 4LQ1A 1TUXA 2JIWA 4OUEA 1E55A 4QLJA 4ZFMA 2WAGA 1FP9A 3AYSA 1ZBVA 3W29A 3L2LA 3MMDA 1HT6A 4AD4A 4D6DA 3MSGA 1WE5A 4W86A 2V5CA 4JL1A 1FH7A 3VIFA 4V28A 4F9DA 1JYVA 1G0CA 3B8SA 4KGJA 4J27A 1EHNA 1JD9A 4AMCA 5BXSA 3WH8A 5D9NA 4KGLA 2C0HA 3SCRA 5I77A 3WUGA 2PWHA 1TVPA 7A3HA 4CN6A 2ZXDA 3PZQA 1H0IA 1V6WA 3ZT7A 4OJYA 3WDQA 3ZMRA 1C90A 3ARUA 1DP0A 2BVYA 1QOXA 1AQMA 3VMPA 5FKYA 3BH4A 2A3EA 3ZR6A 3PZ9A 3NIYA 4MB5A 1G94A 4LPCA 1VFOA 1W1VA 1HJSA 4UFHA 3T0DA 1W32A 4E2OA 4BQ2A 1UQYA 3WQ4A 2FGLA 1CENA 2VUYA 4PUEA 2WLZA 4PYSA 3EDDA 1UKOA 1G1YA 5GPRA 1K9EA 3AMCA 1V0LA 3UETA 3FNDA 4OZOA 1UR4A 3POCA 4LYQA 2ZICA 1BGGA 3N15A 4GXPA 1NP2A 4CD8A 1E6SM 3VIKA 1GJWA 4JZ5A 3AROA 2DSUA 3NDZA 4GKLA 3ARYA 3TA9A 1UKPA 1GOWA 4MNMA 4AIOA 4HOXA 3RM9A 1FH8A 1NWRA 4TXEA 4AD0A 2CERA 2RGMA 4EANA 5LA2A 1R86A 2OSYA 4P8XA 1JIBA 3OLGA 3PTQA 3VPLA 2BS9A 4F8XA 4HU8A 4RE2A 1F4AA 1WNOA 3VGDA 3VD5A 1WDPA 1W9XA 1V3LA 7CGTA 5IHRA 4PRWA 1SR0A 1WZMA 4MB1A 2JEPA 3SEPA 2VZUA 5ABEA 2XGIA 2PBGA 3OG2A 3MUIA 4M1RA 4TVUA 4MJ4A 1NQ6A 1QHZA 1CXKA 2WVTA 5CPTA 3PZGA 2WSPA 2XJ7A 4IISA 5GQBA 1HJXA 3N17A 4D6EA 1BG4A 3FN9A 1KXHA 1LJYA 2J47A 4FLSA 1I1XA 3WD1A 1MXDA 2UWFA 2XIBA 3WKZA 1C8XA 3WD3A 3I3BA 4Z2LA 5CXPA 1BSIA 3L2MA 4HZ8A 5HDRA 4ML4A 5D8ZA 5E6YA 4GZJA 4P8VA 2VRKA 1B30A 1H49A 1Q6CA 4BF7A 1KBKA 1G9HA 3THCA 2XPKA 3MV11 1E3ZA 1WDQA 4PTMA 2EPOA 5D9PA 5CSYA 3BAXA 3CHDA 5IHSA 3SCTA 5DF0A 4P7LA 2WHKA 4P7QA 1ITXA 1QI2A 4U33A 5AC4A 3KWXA 4QFUA 1E9LA 4UFJA 1CLVA 5ECUA 1JYXA 1C3FA 4JIEA 1EGZA 4UQDA 4FLRA 1QBBA 1X6NA 1HJUA 4XV0A 1EOKA 3BSGA 3AS2A 2BVTA 1QI0A 4ZENA 1M7XA 3CZKA 3M46A 4ZE5A 3W6LA 3N1AA 1VEPA 5I0DA 1R8LA 1WZAA 2D22A 2PWEA 4D72A 1ODZA 1NOFA 2QPSA 3MKKA 4AY1A 2WCSA 1J01A 3UESA 2E0PA 1Q6DA 1E4NA 3VGBA 1ESWA 3CHEA 3OLIA 1UKTA 4AZGA 4CD6A 3CUHA 4GINA 1X6LA 4GZIA 1JZ7A 1CBGA 2YLLA 5DMYA 4IPNB 4HMDA 1XCWA 3N12A 1V03A 2JE8A 5A2BA 1E6RA 1EDGA 2YJQA 1PPIA 1ZS2A 5M5DA 5JIPA 4NI3A 2ZUNA 5A6MA 1MW0A 1E73M 1DHKA 3NJ3A 1TA3B 2C7FA 1LG2A 3W6MA 4JHOA 1B2YA 5ABFA 1E40A 1UR9A 1H3GA 1KWKA 4UFLA 3ZOAA 1W2PA 1UD5A 5BCAA 2YDSA 2OYKA 3SCWA 3CZEA 5I2UA 1R85A 3VDBA 3HU7A 4D6HA 4JFTA 3GZAA 4K68A 1N82A 4OBRA 2XFYA 1QHPA 4XZBA 4JHZA 1ISWA 2CBUA 5KEZA 3GBEA 3F4VA 1KXVA 2Y5EA 2ZX5A 1NM9A 3U7BA 3TTQA 4J3SA 1Q6FA 2FDMA 1QW9A 3VOCA 3VIMA 1E3XA 3I3EA 2CBIA 5A6BD 4J3TA 1K9TA 2EXOA 1DWJM 2VX7A 3AOFA 4BCEA 1VBRA 3IJ9A 4JFUA 4HA3A 3CMGA 3WDRA 4HU0A 4W7WA 1E5NA 2WBGA 2WANA 2XTKA 5I79A 3UCQA 2ZUVA 1J0KA 1SMAA 4Z2HA 4U3AA 1V0NA 2OWWA 2J7FA 3PZUA 3O2LA 2NW0A 3CHFA 3VIIA 2OSWA 4CU6A 4WKAA 5A6LA 3VD3A 5A1AA 5HNNA 3W27A 3BCFA 3GBDA 4JFWA 4GZEA 2D0FA 4PCTA 3U5UA 1QPKA 2A3BA 4AEFA 3FHAA 2CYGA 4QLKA 2BY3A 1CIUA 4D1IA 2V5DA 1XH0A 1QI3A 1FFRA 4RE3A 4TUFA 4LYPA 1UWIA 2IXUA 3UR8A 1OIFA 4GQRA 5EFDA 1C93A 1UA7A 3VD9A 2WZHA 3AICA 1WO2A 4FLOA 1PEZA 4WF7A 1CGVA 1J9YA 1LWJA 4MADA 1VJSA 5AC5A 3CBWA 1Q4NX 5CGTA 4PTWA 1HKMA 3IK2A 4DWSA 3N9KA 1BTCA 2NT0A 1UH3A 3NSXA 3WNOA 2ZWZA 2ZOXA 2OYMA 1GQJA 2ZX9A 2E8YA 4U31A 1CXLA 3UG5A 1KCKA 4XZWA 4EAMA 4AZHA 3WFZA 5C71A 1JZ8A 3ZJKA 1JD7A 4WLCA 1PIFA 3WQ6A 1SMDA 4CGTA 1DWGM 1E5JA 5LA0A 1EA9C 3O9NA 2J77A 4PTXA 4UR9A 3WL0A 1FHDA 3AZTA 1TR1A 1KR0A 3ARWA 1E1FA 5A69A 1E0VA 1MQRA 3VU2A 4AW7A 2YDRA 1BAGA 5A6KA 1K6AA 1JI2A 4PMQA 5A8PA 1V0KA 4MDPA 1LWHA 1NARA 1KR1A 4WK9A 3RILA 3AQUA 1CGWA 4MB4A 1J0YA 2VMFA 3IANA 3WNPA 1RP9A 5BROA 4F79A 5HPOA 1VRXA 1W9VA 1PX3A 1B90A 2QV4A 2W63A 4UOQA 2PF0A 3K4DA 3K1DA 1QI4A 1CEOA 1CXIA 1WZKA 2TAAA 3EYPA 1GOIA 1WB0A 4TVDA 2D0HA 3WDPP 4F66A 1GOMA 4JKLA 1JXKA 1KXTA 2O9RA 1HF6A 4UNIA 1PX8A 1WDRA 3E1F1 2Y24A 4PTVA 4TVCA 3CO4A 1CYGA 5E09A 3OGRA 1E43A 2J7HA 3K8LA 3W38A 5EMYA 3EMQA 1QVBA 4UZSA 1R7OA 1F4HA 4CCEA 1NH6A 1W3JA 3WENA 2WK2A 2J7CA 4CN4A 1EOMA 5M17A 3F5KA 4A3HA 3FAXA 4P7OA 4E8CA 1CGYA 1B9ZA 2XFRA 5C8BB 3QGVA 2VTFA 1H2JA 4V2XA 5GNZA 3HMCA 2E40A 2BHZA 1V02A 3PBGA 4B9ZA 1JG9A 4D6FA 3WFLA 2Y8KA 1GCYA 1GQIA 1JZ6A 4R5EA 5E70A 2DH2A 1NOUA 2WMIB 4HPGA 3VGFA 3AXIA 4DUWA 3W26A 4R27A 1LL7A 1ODUA 3S6TA 2WWDA 1EDQA 2CXGA 4UZUA 4N42A 4XUYA 2XM2A 4M24A 4W84A 1ISYA 5BXRA 1H4PA 3WF4A 1J0ZA 5BYWA 2XUCA 4PSRA 4M80A 2XVPA 4AC1X 3EDFA 4X0NA 3SUTA 3WNKA 1E6QM 3PTMA 3ARPA 1ZB5A 4MJ2A 1K9DA 5FIPA 5D9OA 3VDHA 1TMQA 1B3VA 1GHSA 1BYDA 3VIOA 2WW5A 4NSBA 1IZKA 3PZMA 5CSUA 1BHGA 1CGTA 1ZL1A 1KFWA 4YHGA 2J4GA 4W7UA 4ATWA 3WMSA 4TTGA 4CU7A 1V0MA 1TA3A 2VO5A 4JFSA 2DSKA 4BQ4A 3L4UA 2GJXB 2X09A 3CUIA 2CITA 3VIJA 1BVNP 3A3HA 4H8VA 3OB8A 1UD3A 2YLAA 2VRJA 5HBFA 3T2OA 1WP6A 1SYTA 2J7DA 3VMNA 2X8RA 3WEZA 2VZTA 3APGA 4AZ5A 3WNLA 1TFVA 3GDBA 3PZIA 3VO0A 2OLHA 1MVYA 2AMGA 4M29A 2D20A 2ZXQA 2CESA 4TOQA 3SCSA 3ZJ7A 2XSBA 2CBJA 2W91A 1JZ3A 1W1YA 2O9PA 3BSHA 4D6GA 2BXZA 2EJ1A 2WC3A 4N0RA 1PZ3A 2O9OA 3T2PA 2BNJA 3VX0A 3AIVA 3CUFA 1P6WA 4NZCA 4HOWA 4NRSA 1I75A 3OBAA 1HJVA 2V3FA 1KCLA 2W66A 1UWRA 5I78A 3K46A 1R87A 1XV8A 4AWEA 3ZJ6A 3VILA 2WCGA 4ACZA 1UR1A 4U2YA 2VNCA 2D0GA 4Z2JA 3VNYA 2W92A 1OIMA 1QNRA 4HPHA 4P7RA 1H41A 1NWTA 3AIRA 2DDXA 2CHNA 4U5KA 3L4YA 3W0KA 1CPUA 2VOTA 1PJ9A 3D3AA 1UWSA 3L4ZA 1G5AA 3RDKA 5HPCA 3L4TA 3GH7A 4ACZB 3WF2A 4U2ZA 3VM5A 2WMHA 4AD3A 2VX6A 2WKLA 3QR3A 3VD4A 2XVGA 3ARQA 4MDOA 1QW8A 5A6BA 3AZSA 3M7SA 3WDJA 3SCOA 4AISA 5CQ1A 4MAVA 3NUKA 1R7AA 3O6AA 3ZSTA 4HMEA 5JBEA 4AEEA 1MYRA 2XYLA 3OZPA 3VD7A 5BWFA 4CN1A 1B3ZA 3BLPX 3EDJA 4W5UA 3AISA 2D3NA 3WQ5A 4QLLA 3WY1A 1XRVA 5BXPA 5E0CA 5A95A 3GNPA 4PCSA 2W61A 2ZE0A 5EFFA 3CPUA 1B0IA 5A94A 3RO8A 2D2OA 5A6SA 1L8NA 3U5YA 1TCMA 1C8QA 3ALGA 3VUPA 1H0GA 2D3LA 1BYBA 1MQPA 5ABHA 1E0WA 3MUAA 4UOJA 2BY0A 2JEQA 4PMZA 4ACYA 2AOSA 5JIWA 2YL9A 2OSXA 5IFTA 5A8NA 1OB0A 5DT5A 5A8QA 5CPQA 2A3CA 3AI0A 2YA1A 4M82A 4EE9A 4ZEPA 1E6NA 3PZOA 3WF3A 5CG0A 3AZRA 3BXWA 1ISZA 1VF8A 3WD2A 1W9PA 1WKYA 1HKKA 5I3DA 4L4PA 2FH6A 2VZSA 1ZBKA 1HVQA 1FHLA 3UERA 1OT2A 5I24A 4OBSA 1E4MM 2UY2A 3VKKA 2VCAA 2ZUTA 3SCNA 1JZ5A 4L4OA 2EQDA 1PZ2A 2D23A 5JUVA 2BV9A 1HXJA 2UY4A 4DM2A 1FP8A 1E6PA 3SUUA 3PTKA 5E0FA 3WH5A 4OOZA 3M07A 2G4FA 3EDKA 1GPFA 3KL5A 1YQ2A 1HKJA 1ISVA 1JXJA 2EPMX 2WZEA 2J7EA 3SCQA 3BMWA 1WZLA 3ARRA 3B9EA 1ITCA 4W87A 4B15A 2XWEA 1DEDA 1E4IA 3AHYA 1QNOA 2BY1A 1OCQA 2QF8A 4JKKA 3AIUA 1BYAA 3ARSA 2DSWA 4XB3A 5AYBA 1VEMA 2O9TA 4W5ZA 3AMLA 1UKSA 1M53A 3WF0A 1ZU8A 3T2QA 2YL5A 2BVDA 1V3KA 2CBVA 1E15A 1NOWA 2VC9A 4UQEA 1VAHA 2E3ZA 2GVYA 3WH6A 1D3CA 3T08A 1GW1A 1BLIA 2CNCA 4W89A 2E4TA 2WLYA 4AZCB 2WNWA 2GJRA 2VT0A 2WVUA 3TTSA 2J7GA 3AHVA 4WIWA 2W62A 3FW6A 1GORA 2XFFA 3ARTA 3EBVA 4M56A 3ARVA 1H1NA 4C7DA 2WM0A 3WQWA 1GNXA 3UG3A 4GIAA 2GSJA 1JZ2A 2WMGA 2ESCA 5FCZA 1GOQA 4PMYA 1JDAA 1JFXA 4A4AA 1E6ZA 4KWUA 3W24A 1E4LA 3KE0A 1CXEA 5A3HA 1RH9A 3K8MA 3QOKA 1GOKA 5ABGA 4AIUA 3OZOA 1H11A 2G3NA 2Y2WA 2WHMA 2BFGA 1RP8A 2ZUUA 5JBDA 2GJXA 4QAWA 2WMJA 1JF6A 4Q22A 1JI1A 2FH8A 2VVSA 2HISA 3AIQA 3UG4A 1CXFA 4U3CA 4PMRA 3WUBA 2EPKX 2PI6A 1DWFM 3HJEA 4IPLA 2FGZA 1UZ1A 4GPNA 4QCEA 4DWSD 3RIKA 1JNDA 2DPEA 3AMKA 3A4WA 3VGEA 3W28A 1JDCA 4J3UA 2WXDM 4W93A 1J12A 4B16A 1HL8A 1PX4A 2J8FA 1UZ4A 3K8KA 1MXGA 1UQZA 4DWSC 1IZJA 1NWSA 1CGXA 2XVKA 3CUGA 1J0IA 1MW3A 4E4PA 3RCNA 3N13A 1US2A 3OLDA 1E6XM 2OWCA 2JIEA 3VIHA 2VL4A 5GNXA 3AHZA 4NRRA 4RE4A 5EB8A 5I23A 6A3HA 2CHOA 1AVAA 2G3JA 1A3HA 2YOCA 3SIMA 3A4XA 4JCLA 3WMBA 1KGWA 2VVNA 3WDIA 4AXNA 1GUVA 4LX4A 3SUVA 3BAJA 1KQZA 1HJWA 3CUJA 1U30A 1B1YA 1US3A 2X05A 1M04A 2YBUA 3GXDA 2GUYA 1GONA 1UD8A 3N11A 6TAAA 1PBGA 2WMKA 4MTVA 2DT2A 3SUSA 3AMDA 4YHEA 1LG1A 1W2VA 3UR7A 3WH9A 4GI8A 3WNMA 1GVIA 1VFUA 1UWUA 1HIZA 2WMIA 2NSXA 3CZJA 3A4AA 3AIWA 1V02E 2DIEA 2DT1A 1C7TA 3WF1A 2XG9A 3F5LA 1WAWA 2BXYA 2F61A 2WBKA 1RPKA 2DGAA 3AJ7A 1TVNA 1VEOA 3W25A 3W4RA 2VZOA 5M3WA 1UD6A 3W82A 3DC0A 4P8WA 2GJPA 3MUY1 4TX6A 4CD4A 3WBEA 2EPLX 2GDUA 1C92A 3AXHA 1CGUA 3VDAA 1ZBWA 3KL3A 3WMCA 1UH4A 5TD4A 3SCVA 3CTTA 4PMUA 3NYDA 1ECEA 4PSPA 1V08A 4JAWA 2ZXBA 2F8QA 2Q8XA 4KRUA 4QDMA 1U33A 1XSIA 3ZT6A 3OGVA 3KZSA 1FH9A 5DO8A 3RMEA 2WVVB 4J7RA 3BCDA 4JKMA 1W9DM 1I1WA 4UFKA 3B9DA 3VDCA 2GK1A 1V3HA 1VJZA 4CD7A 4Q7NA 4X9YA 4ZXOA 3DHPA 5FD0A 3LPGA 1JL8A 2WWCA 5BRQA 4UFIA 3VX1A 1B3WA 2Y8VA 5AYIA 3VGHA 5A2CA 5A6AA 3UEQA 1B31A 4HZ7A 1UOKA 1IT0A 3IJ8A 4PN2A 1JAEA 3T09A 1GHRA 2PWGA 3G6MA 3L4XA 3RJXA 4FMVA 4W8LA 3BC9A 4H04A 3DHUA 3U57A 2J7BA 1W9BM 1KGXA 3LPFA 4HMCA 1CWYA 1QNSA 4ATLA 1V6UA 1W3KA 3WD4A 2W5FA 2WPGA 3G6LA 2DSVA 1GJUA 1UD4A 3GYCA 4CKQA 2J74A 1CLXA 3GNRA 3IAPA 4E8DA 4URIA 4LXFA 3WL1A 4D6JA 2WCAA 2YKKA 3QHMA 1HN1A 1BFNA 1C8YA 1FA2A 2J78A 1UA3A 3BAIA 2QMKA 3MSDA 5AY7A 1V3JA 1FOBA 3AXXA 2MANA 2VURA 3HN3A 3BAKA 2YIHA 4GI9A 5KZ6A 1EO5A 1GQLA 5IFPA 1KB3A 1V3MA 2X0HA 3BGAA 4FLQA 2VRQA 1M01A 1J18A 4OIFA 3OGSA 1QNPA 5DT7A 3T0AA 3WIJA 4DUXA 2ZUWA 4FK9A 1CNVA 3LPOA 2Z1KA 1HJQA 3U7VA 2ZXAA 3LMYA 4H7VA 4H41A 8CGTA 4W8BA 1X1NA 4EKJA 3PZVA 1OGGA 4UTFA 3RM4A 4GQQA 1W3LA 2G41A 2CETA 1UD2A 2FHCA 4V27A 4A3YA 1UR8A 4PBGA 3NSMA 4W85A 4HZ6A 1W3HA 3MO4A 4YPJA 4Y7EA 3GH4A 2W67A 2G8ZA 3K4AA 4WJXA 1EQCA 5A8MA 5CLTA 5LA1A 4KMQA 1B3YA 5GNYA 4GI6A 1EDTA 5I6SA 1XC6A 3AHXA 3MS8A 2A3HA 3VGGA 2UY5A 1NP0A 4AD5A 4P8UA 4Z2KA 5DEZA 5E6ZA 5ABFB 4M81A 1H5VA 3CMJA 1JNEA 2VQTA 4KH2A 4NF7A 1O7AA 4MB3A 4XX6A 3VNZA 3WQVA 3ZIZA 2ZUSA 3ZO9A 1DWIM 4PMXA 3WQ8A 4F9JA 1NWUA 3CGTA 2E9LA 1VBUA 3BMVA 4S3JA 3S2CA 4OKDA 2FHBA 3VVGA 4UFMA 2EO7A 3OIHA 1MQQA 4U5IA 1JZ4A 1J10A 3RPMA 1Z32X 3POHA 5HOSA 1KXQA 2FHFA 2CIPA 1E70M 4X0VA 2EEXA 4PEEA 4UOZA 1V6VA 4J3XA 3PZNA 4DWSB 1TG7A 4UCFA 3WBAA 2G3IA 1UWTA 1U2YA 1EXPA 1E1EA 1BF2A 2C8NA 3ZT5A 1OSEA 4MNKA 3W53A 4HP5A 1EIBA 1DWHM 4TX8A 5IXEA 1V3IA
chains in the Genus database with same CATH superfamily
3SXWA 1EJ7L 3DERA 1R083 4EXQA 3THDA 4DIAA 1P0DA 4WQ6A 3URBA 5CZKA 2PTMA 2DCTA 1PGSA 5L36A 3ILFA 4DAIA 3OTFA 2WSKA 1WZXA 3RGTA 1W2OA 2OQ7A 1UIOA 1QH7A 2NMOA 1I2QA 4ZQOA 3HT1A 4MH0E 1VBGA 2EPNA 2ABAA 3HF3A 4M7TA 4KWOA 1NDYA 4QCFA 2A2IA 3VKMA 4LJHA 1L7QA 1IYXA 3EMZA 1WMFA 1SFNA 2Y0FA 1DWAM 1QQP3 3GNXA 3W74A 2E9BA 2EVXA 4OOUA 2ZMLA 3WJZA 3CZGA 4IP5A 1MWOA 1G01A 3FWEA 4YTQA 3NZGA 5C3RA 2BERA 3GWQA 1NZCA 4S2CA 3L0KA 4ZCWA 3R1ZA 3LEMA 1PGL1 4YGDA 1CN1A 4GACA 4V2VA 1KBBA 3VFCA 2FYMA 1MVEA 1M4WA 1POJA 3MIDA 4JDYA 5FYTA 5C9XA 3W02A 3LUTA 1AUYA 3NJVA 4GH4B 4J3VA 1OI6A 2NT1A 4MHBA 4GMEA 1W8FA 2PXJA 4WCJA 5BPXA 2YROA 2E8ZA 3L5AA 2JKPA 4LS2A 5HV4A 4UTMA 4GX9A 1AODA 4DJFC 4FPFA 2B31A 1WW5A 4CU8A 4Y5SA 1LBLA 4ZXLA 1MW1A 2HS6A 3R12A 2D73A 4JYDA 1PTDA 2V6AA 4RR3B 2Y63A 4AZIA 4FFGA 4AZCA 2WNOA 4J3WA 1RUF1 1W1ZA 1YFUA 1XG3A 1J0HA 3CZUA 2XVNA 3LZZA 3WD0A 1UKQA 1EF2A 1IV8A 3SNMA 4CD5A 3TKFA 1TWZA 3EXUA 1ZZ7A 4UQBA 3AS0A 5F32A 4UTWA 1PIV2 2A5HA 2Y70A 2DZVA 4J28A 1X8CA 3WH7A 2D6NA 1OD8A 2IQTA 3IPVB 5AHIA 3GC5A 4LCRA 2TODA 2R072 4JAAA 3H2NA 3RRXA 3LOTA 4CCDA 2JG8A 1QQP1 1LQ0A 4K20A 1XNKA 1VENA 3BU7A 4MGKE 4N4QA 5D2TA 2XH2A 3VK5A 1P0EA 3VBHA 1GVOA 2XGZA 4HPJA 2HZGA 3UYCA 4GY0A 1NIUA 2HE8A 4PULA 5ERLA 3E2VA 3AU6A 3KOYA 2E9MA 3PPFA 1OFRA 1BJQA 1ZRRA 3BTNA 5F2WA 1HNYA 1RK6A 4D8ZA 5LWBA 2NVDA 5BNOB 3B9AA 3NM3A 3IVSA 3I3DA 2KD7A 1AL7A 1KO0A 3EAUA 1VBA2 4Q4X2 1QY4A 2J25A 2ON3A 4L1WA 2ISVA 3VIGA 3VNJA 1YJLA 2GP5A 2JF7A 2QDRA 2JFEX 4CVWA 1AR61 4UQCA 4D9PA 4OV4A 5FY5A 2XIOA 3CZ8A 2JKAA 5GVJA 1KXGA 1TRIA 3AL5A 2A3YA 2BX7A 2W6RA 1BVWA 2XIIA 3KLKA 2YXGA 3FE5A 3KSCA 5CKSA 9CGTA 4RFRB 3O16A 2YGYA 3DXTA 2AQWA 4P7NA 1XU1A 3GNOA 3IN9A 1OUXA 3MBWA 5F6LB 3T7VA 3HIFA 2IUZA 4PBOA 4Z08A 4PDWC 3BMXA 3WJWA 2Z5WA 3CU2A 2C24A 2NQZA 4XUNA 5T5PA 3S9IA 1CDGA 1YRRA 2VWSA 3VCCA 3NJXA 4QQLA 1GQKA 3LNMA 3T1LA 4YWSA 4PUDA 1WBHA 1A3WA 5GLZA 2HBTA 5BNNC 3ILNA 5K0UB 3L2IA 2CPUA 2UWCA 2DUOA 1XHGA 1ZUAX 4CZSA 2ARBA 4LBMA 2Y5SA 3QH6A 1QAPA 4R9AA 4I7WA 4JN7A 3W01A 3GXIA 3LRMA 4GUGA 4IXHA 4M8UA 1UXXX 1A6CA 2WVVA 3KTXA 4OHVA 2DEPA 5DG1A 4LPLA 1ZJHA 4CDQB 4KCWA 5F5AA 4BQ5A 2C26A 3TSDA 3GXFA 3MUZ1 1E0UA 2A6LA 4GZ7A 5BMXA 3PN8A 1V9U3 2IVIB 2GK1B 3WLLA 3GKFA 3ASIA 3WN6A 1QJX1 3ME2A 1Q43A 3KVJA 1VR3A 4NPMA 3A6OA 3BICA 1U1HA 5ECVA 1RUH2 4WR3A 2CKRA 2GVLA 3WBXA 4DO6A 4QPIB 2XGXA 4LF2A 3IIPA 3JRKA 1AD1A 3QKZA 2ZA2A 2QKDA 5C9AA 1NF7A 4RQPB 1HVXA 5CPSA 1TPVA 5BOEA 2PD9A 1W0NA 2YB4A 1ENQA 1HXS1 4BQ3A 3MZHA 2FZDA 1GVQA 2V73A 1B3XA 3CMFA 4S3FA 1L9WA 1O5KA 2CU5A 5LNRA 6TIMA 4AI1A 2WJFA 2PMWB 2VNOA 2ODOA 4XOGA 2EBNA 1X1OA 1VIWA 1H8VA 4Q7BA 3R10A 2ZX8A 2CKSA 3PULA 3VOFA 1LHWA 2F6XA 1QXPA 2QVHA 3EB2A 1C28A 2AQVA 1AYM1 4NMIA 1KM0A 2VFEA 2J6XA 4XETA 4LE4A 2QCSB 1JFHA 1CECA 3HPAA 2BVBA 3KBJA 4DRSA 1XLEA 1DORA 1EC9A 5LATA 1H2NA 4LTSA 1EJWC 2D1ZA 2A5ZA 1GSLA 1XKJA 1UR2A 1L2UA 4PH6A 2WRAA 1DJZA 1X8EA 2JICA 1EYEA 5JOZA 1NDZA 3ITXA 3EWCA 4QWNA 2HWF2 1SEFA 2O1QA 3PVBB 1GZJA 1HP4A 2WKGA 2J66A 3KT4A 3CO8A 4P02B 3OPZA 4IM4A 2D24A 2ZGMA 1P0KA 3QHNA 1W9WA 1QHDA 1TWSA 3W59A 2X1IA 5FQ0B 2A6XA 4IIFA 3HG2A 3VI2A 5ACA1 3UPWA 3Q8EA 1W9YA 2FDGA 3H4GA 3W1PA 5C9WA 3SEEA 1YXDA 1G86A 3AIBA 5FOOA 4WY0F 1QMJA 4DUVA 2DCJA 3FHQA 4UWDA 1CZVA 4FTBA 3OUIA 4GNVA 1HQLA 3IVUA 1TEIA 4D6SA 1D8WA 4K3ZA 3LDVA 1BG9A 3ENRA 2B7NA 4LHSA 1RVF3 2A71A 1ZCOA 4LKSA 4ATDA 2ZUMA 5LEKA 3HNBM 1S2CA 3MP4A 5F4XA 2YA0A 4B3LA 1KFLA 4IGMA 4Q8QA 1WCGA 4K7JA 2F17A 3TOPA 1OGSA 1HO4A 1XYZA 2D2GA 2DH3A 5CGQA 3R43A 5T91A 2YBKA 2R49A 1ZRQA 1R38A 1F35A 3OOQA 4PRRA 3OPSA 3L4VA 3NSTA 1W91A 2V3DA 2ZFAA 1AR72 4W8AA 3N18A 2DQXA 1FCQA 5DFAA 4A3UA 2PDUA 2X0YA 4NY2A 1GOOA 4GJ1A 4HPKB 3QR1A 1GNYA 1BVZA 1UUQA 3M9YA 1A0DA 1D2KA 2VDHA 3ZFEA 2Y6LA 4ZTXA 1HB4A 4CEWC 3HGRA 2DFBA 2ZTNA 2F38A 4MOZA 3CL6A 2FDFA 3WX5A 4KWVA 1ZBA1 3RNDA 1KRAC 4I8DA 2FCTA 2QQUA 3E0LA 5EPAA 1AMYA 3P3BA 4I02A 2XBO3 2Q09A 3WBWA 3U4SA 3RFRA 2VX4A 3BOWA 1TR9A 2O92A 3M5ZA 4MPKA 1RY0A 5BNNA 4HOOA 4YN5A 1TREA 3EMCA 4AY7A 3KCCA 4HNCA 1UG6A 1CTNA 5HCBA 3W6YA 1A47A 3AMGA 2VCBA 5E1RA 2QLYA 3RJYA 2JDMA 5GLTA 1SBFA 4MGQA 4O4WA 1PKYA 1OD5A 4PMNA 1LQ2A 2XM1A 3N7JA 4ZPIA 3CJIC 2DUZA 4LWWA 1R081 5JCTA 3VBUA 4XFFA 1E55A 4NI8A 2RJLA 4Z1BA 3RAOA 1QKQA 2X42A 3ELFA 1DU3D 2VZPA 4RZ6A 2PTWA 1EWEA 4YM0A 1P8JA 5L19A 4XTIA 1PV8A 3BQ5A 2OPWA 1S0DA 4GBUA 3TA6A 4ZFCA 3R25A 4J4KA 3LGGA 4MFDA 1JYVA 2X5IB 3B8SA 1ELSA 1JD9A 3H3LA 3WH8A 5D9NA 1AXZA 1XE8A 4GJJA 5DMMA 3KHJA 3VFLA 4MG2A 1SLIA 4RDYA 4S1FA 3ZO0B 2B5HA 3TW7A 3DGTA 1WW4A 4NX0A 4CN6A 7A3HA 1SUXA 3H7YA 2V69A 3TU9A 3BOFA 2YHJA 2OQYA 3ZMRA 2BVYA 4LEQA 1AQMA 1SG3A 3VMPA 2HXTA 3BH4A 1WXYA 5I7GA 2GJLA 3CB8A 3PZ9A 1HV0A 1J5SA 5CBJA 1G94A 3QY7A 4UTWC 1SVDA 1K8ZA 4DEFA 1F8VA 4KPLA 3J4UH 4I2OA 1FCBA 5B4NA 1N7KA 1O94A 1GW9A 3EB3A 5EYWA 4QSFA 3G3DA 1KBIA 4OECA 4E2OA 4Y1YA 1UQYA 2Y33A 4Q4V3 1W6TA 3WQ4A 2FGLA 4PUEA 2Y0OA 2WLZA 4TZDA 1UKOA 1NJJA 1X33A 1JS9A 1G1YA 4N7UA 3FA5A 3W2LA 4I3PA 3ZYFA 3CAWA 3UETA 2G4IA 2BBVA 1UR4A 2W39A 2XFWA 3D46A 1YPFA 5JSPA 1FDZA 3PFMA 3PWAA 5HWJA 4MZ8A 3WY6A 4EP8C 1LLWA 4HHPA 4JNMA 4YS1A 1AYM2 3NPXA 2WS91 1C3HA 1VS1A 3N19B 3SQLA 2XINA 3VC6A 1LBFA 4R7JA 4BIFA 5FZ6A 4RPPA 2FIQA 3NFUA 1LQAA 4GKLA 1ND3C 4HOXA 3GIPA 4N4PA 3RM9A 1RUE3 3APYA 4Y26A 1DQ1A 1BXCA 4QM9A 4EANA 3U0HA 5LA2A 2P34A 1R86A 3TJIA 4DO0A 5EXOA 4IQEA 3EBRA 1F4AA 1H8TB 5LKYA 3QW4B 4RW3A 3GU1A 2DVXA 5FAXA 4N2YA 4FB7A 1QGLA 2NQYA 3PIGA 1VBJA 3VD5A 5IHRA 2PDHA 1NCQA 5T9CE 2YCEA 8XIMA 4MWAA 2ZOEB 3SEPA 3OG2A 2OZ0A 1XYBA 2RR13 4LQRA 2QF7A 1OFPA 3N9RA 4IUOA 1DQ2A 4K7YA 4TVUA 4HQVA 2RAGA 1QHZA 3EWUA 3PZGA 7ENLA 3OHMB 1TMF1 2G9ZA 1XUUA 3N17A 3FN9A 1LJYA 4E2DA 3ZLHA 4UMAA 4E2VA 1A80A 3NOYA 4FLSA 5D05A 1RMU1 5CB7A 3LERA 1IWAA 3B97A 3WD3A 3I3BA 4Z2LA 4DEVA 2D97A 3BANA 2CGNA 2E28A 2ZZ4A 5HDRA 5E6YA 5IVYA 4L7ZA 4PODA 1AYN3 1BTMA 4P8VA 2QQIA 5CADA 1Q6CA 1KBKA 5DCEA 3VBOB 5HCFA 1YPXA 4A6OA 2Y6ZA 1G9HA 5HCAA 2XPKA 3SSJA 2Z29A 3M3QA 1M7JA 5AZ1A 2BBAA 2ZGLA 7REQB 4LKDA 1Z8AA 1VBD3 4S23A 5GZDA 4XD4A 5D9PA 2OR2A 3CHDA 1SO4A 5DF0A 1QK2A 1QI2A 2IPFA 4XDPA 4U33A 5AC4A 3KWXA 4XZNX 1E9LA 3IDBB 3OD0A 4CEWB 3LEKA 1CQ9A 4Z8BA 4JIRA 3UWWA 1VH7A 1VRH2 1UIKA 4OCTA 2I9UA 4E6MA 2Z24A 2WN3A 1SJCA 2DBIA 1X6NA 3DFYA 3M0YA 3PR2A 4XV0A 3T05A 7REQA 4MHUA 3BUCA 4Y9MA 1EOKA 4JS3A 1YIPA 1LB2A 4PZVA 3SDOA 1M7XA 4ZE5A 3W6LA 5E0KA 1RUH3 1FWNA 1R8LA 2OZ3A 2VTXJ 2D22A 5F1VA 1NOFA 1ODZA 2QPSA 2ZZ1A 3NZRA 1U12A 5PTDA 3QGAC 4IE5A 2ZZ2A 2WCSA 5GLWA 1DQ5A 2EICA 1VJIA 5LZLA 4P9JA 1E4NA 3LV6A 3NURA 3CHEA 3C3UA 1FATA 2FDJA 2RMU2 3L65A 4AZGA 2HDJA 1D8CA 4FP3A 2F2KA 4GINA 4EAYA 1TTJA 3R7MA 2PHLA 1UMYA 3PSWA 1UY3A 4FOVA 1WW7A 4FXGB 3UZZA 1PZ8A 5K0UA 5DMYA 4HMDA 3N12A 2XZ9A 5FLHA 2OGJA 5FZ0A 4UTTC 5A2BA 5FKBA 4YU1A 4TYSA 1PPIA 5M5DA 1L7RA 5FDBA 2BTVC 3AKSA 3VBHC 4JGZA 3SFKA 2O7SA 5A6MA 3CAKA 5F3IA 1W0OA 3V0BA 4BE3A 3NJ3A 1DHKA 2W95A 5FJPA 1H1IA 1TA3B 1XIDA 2JWPA 4AHXA 3VBRB 4CCMA 3P6BA 3LS9A 4C60A 1OPOA 1E40A 3PJXA 1ZP4A 2BOEX 2BGOA 3LHWA 4LNYA 3SCWA 5I2UA 4EN6B 1R85A 3I65A 4DJDD 3ZIXA 4JFTA 3RF9A 4XVEA 4ZU5A 5CVRA 4NN0A 1K02A 2DV9A 3PC0A 5JXHA 1KCZA 3UA3A 3MKVA 1XYNA 1LRTA 3K2OA 4XJZA 3LA3A 4J3SA 1Q6FA 3PIJA 3QLDA 1UP0A 4F2BA 1RUNA 2EAKA 1NXMA 1Z7S3 5EHDA 1ULGA 1K45A 1QATA 1IS5A 2CBIA 2Q3OA 5A6BD 1OYBA 3S1UA 2R041 1J2WA 4Z0JA 1FWHC 1SACA 4R9BA 2E67A 3GU9A 2VX7A 4BCEA 3SQMA 1B54A 4JQTA 2DIKA 1CJDA 1MZFA 1A53A 3GTHA 3ZVHB 2P3JA 2JGQA 4HU0A 1E5NA 5FPBA 2WT0A 2WANA 3R2GA 2RDXA 1VBC1 1PE1A 3QN3A 1BWVA 3USBA 3UP8A 4JNYA 3QTGA 2O0TA 5FZ8A 2OWWA 3B0UX 4CUAA 2DF7A 4P9WA 4QPWA 4LU0A 3BLIA 1QOPA 4NJ4A 1AH0A 2PHDA 2OKOA 4NXKA 4FHAA 1VFLA 3ZWSA 5IK4A 3AC0A 4GRSA 4MSSA 4NIDA 1CAUB 5A1AA 4Q8PA 3T78A 1RUD1 3T3YA 2PRHA 3W20A 2D0FA 4PCTA 1UQXA 4I7UA 1Z48A 2CLEA 3V5OA 1W5PA 4AEFA 2A3BA 3LXAA 2JDYA 4JX0A 4Q4V2 3G1XA 4L6DA 4LBNA 1CIUA 2V5DA 2OZ8A 4D1IA 5EMMA 5TIMA 3CWNA 3W87A 4OHQA 3GG0A 1FFRA 3IDAA 4NROA 4COWA 1UWIA 3A3WA 4LYPA 3POIA 4RQPC 2J1TA 1EBGA 4O1BA 1KLZA 1XRTA 3RX2A 4A7ZA 2WZHA 2WNVA 2RG4A 4WM7C 1G7VA 4AQ2A 4LO8A 2WO3A 4MLOA 2PDGA 1LHVA 1VR6A 4COVA 1UZVA 5HUOA 4JIIX 1J9YA 1LWJA 1SLLA 1K7FA 1IS6A 3W58A 4C6FA 3CBWA 1Q4NX 5K4ZA 1MI3A 1S3HA 4F48A 3LA7A 1XYCA 2YXXA 1HKMA 4C6CA 1Y3TA 4A6GA 1UD1A 1VAVA 3GLCA 4DWSA 1BTCA 3ZYZA 3DI1A 4XD6A 3SO7A 4H1ZA 1OURA 3KT7A 1R093 2VELA 1LOAA 2OYMA 4RV3A 2GNTA 2AKMA 3KF3A 2JDUA 1GQJA 1F3XA 2ZX9A 3NGFA 1FWEC 4XW3A 2ZVIA 1A5BA 3AX4A 3PTRB 4EAMA 5IAXA 2Y62A 3WFZA 3GXUA 4WVZA 4QQOA 2WNUA 2RS32 1VPYA 1JD7A 1HRV2 4WX2A 1PIFA 3ZXKA 2Y88A 3WQ6A 3CKHA 1SMDA 4DF0A 3TVAA 1DWGM 1D4M3 1U0AA 1QJY2 4AHWA 5A3LA 5EZWA 2WV8A 3CWHA 1UOFA 1AR81 2XL9A 3ARWA 4BM8A 3VU2A 1IZCA 1UO9A 3CEPA 4UI9L 4PRTA 3WDYA 4MDPA 3I2GA 1POQA 5FP4A 3VHRA 1LWHA 4JEQA 2YSWA 5D2YA 3H0OA 3AQUA 1EF3A 4HHLA 4CU9A 4ISQA 3TRSB 4JEJA 5D33A 1RP9A 4EVZA 4QDQA 1WKDA 5BROA 1R30A 1OFBA 4GI4A 4KBBA 2QJNA 4MMWA 1V6JA 4LV4A 3BUVA 4AYGA 1YIFA 4UOQA 4ROPA 1UIJA 1XINA 3K1DA 3SCGA 1G7UA 4S39A 5T26A 4AB4A 1ZX5A 1A5AA 3LDKA 4RD7A 5HMDA 3P67A 3RPTA 4URTA 4GY1A 2D0HA 3GYEA 3WDPP 3ORWA 2D2HA 1S55A 1GOMA 1R1A3 1DG6A 1JXKA 5LRSA 1KXTA 4LBJA 2O9RA 1UW9A 3IIOA 3I7DA 5FP8A 3U4XA 3M3CA 2CDOA 2Y24A 2ADAA 4PTVA 2DZBA 4ZY9A 4X60A 5E09A 1ZJIA 2AGKA 3RR4A 3UWEA 3WD5A 5FF7A 5EMYA 4JIQA 5DCBA 4L9BA 2ES3A 4U4MA 5REQB 3XINA 3H8OA 5FZEA 4CCEA 4Q4OA 3SJ3A 2HEYF 4PCNA 1W3JA 3UNDA 2WZ8A 3V0SA 1CT5A 1M9HA 2WK2A 3NKGA 4NO4A 2J42A 1EOMA 2WABA 2R063 4A29A 3F5KA 3FAXA 5CZSA 4QG8A 2LS6A 5C8BB 1Q8VA 3TOJA 3S2LA 1B35C 4LAKA 4IEOA 4CQAA 2E40A 5AOUA 3L0NA 4IPIA 4AEDB 3PBGA 3QQ1A 2VVDA 2V8ZA 3WFLA 5IK5A 3EWZA 1GQIA 3GHNA 5FZ1A 5E70A 1NOUA 2QEZA 4HPGA 3VGFA 3WQ1A 3W26A 3M0JA 4HLTA 4H9TA 2PUZA 3Q2DA 3MBDA 1ODUA 3C7EA 1RUC2 1JBCA 2F4LA 1C57A 3W1MA 1UR3M 5C8CA 2VOWA 1KLYA 5CZTA 3LXCA 5BXRA 2P50A 1H4PA 3T40A 5C8WA 2VEKA 4PSRA 1PGW1 4DUOA 3WXPA 5AC6A 3ZXJA 1A8DA 2V30A 2XVPA 3P8IA 1FMD3 4AC1X 1RUG1 4HCDA 2GZWA 5LIWX 4WJ8A 4HN8A 1RUJ3 1E6QM 3PTMA 3USUB 4ML9A 4AHOA 5I3KA 1DQWA 2HWC3 1U5IA 1B3VA 1SFLA 1PKMA 2X5IC 3GHUA 3OGGA 2Q8CA 3PAOA 4FNTA 4NSBA 1IZKA 1NTHA 2V5KA 1CGTA 4UTIA 4AFYA 1KRBC 3GDRA 2FFCA 1LDCA 4NRPA 4C90A 3WMSA 3LI0A 3OO2A 4CU7A 2VO5A 1TA3A 3VZNA 4GNKB 4LFYA 1IHIA 3WK1A 2GJXB 3W70A 3CUIA 4GIYA 5T52A 2BGNE 4HK6A 3QF0A 3H7UA 3Q58A 3LQCA 5H8MA 4H2HA 3OB8A 1PM4A 4O61A 2LM3A 5D38A 1OD3A 1ZP3A 3W7PA 2VRJA 2OW4A 3QMSA 1S2WA 1MSSA 4D7SA 2K46A 3C7HA 4HBNA 2BG5A 4AZ5A 3APGA 4QR6A 4BK4A 5JZGC 1K1DA 1W0PA 2A6YA 3ETQA 2BPA2 4QTGA 4HA0A 1WKEA 3PBWA 1PCKA 3MZNA 3VO0A 4DPQA 5E8AA 3QY8A 1NA1C 1MVYA 1UX7A 1EEPA 1TME1 3CIWA 3EX2A 2WIIB 2FPVA 2D20A 4JQAA 3JZUA 4IV1C 4U10A 5HA7A 1NFGA 2CESA 3SCSA 5HXVA 2CLMA 5F3GA 1XIGA 4WJEA 3GCWA 1YADA 1SZEA 4DZIA 3OUJA 5DX7A 4N8MA 4LALA 2P53A 1XYOA 1XE7A 2E7FA 4UXDA 2X7VA 3RHGA 4XHBA 2O9OA 2J13A 4LO5B 2BNJA 5ANQA 3C8FA 2AACA 3CUFA 2BOJA 1ZRCA 5FYMA 3M6YA 3VBUB 1RHI3 5FF3A 2VUCA 2NUYA 2PLKA 4HHMA 4X6QB 3LCXA 2XLGA 3H55A 1KTNA 2V3FA 1JPDX 4YZ5A 1UWRA 2WDBA 4Q8NA 3W7RA 1TV8A 3ZJ6A 5CC7A 1WW6A 4I3GA 3ITQA 4Y9NA 2HWC2 4URAA 3OG3A 5FEZA 1PDZA 3URAA 1RUD3 2A73B 3DDMA 2W92A 2XONA 3ES7A 1QOQA 4P7RA 3EXTA 3FEMA 4LE3A 5C0QA 5JVLA 2W9XA 3WX7A 5E89A 2DDXA 3W0KA 4M6PA 1PJ9A 4TLFA 5I3FA 1T40A 5HPCA 1COV2 1GZWA 1DIOA 3GH7A 1ZBE3 3N2TA 3WF2A 1TVLA 3BLOA 3VM5A 3GHRA 2WMHA 2WKLA 1ULCA 3QR3A 3Q94A 4HGXA 1N47A 4JPGA 3M41A 4BB3A 1R092 3VD4A 4I90A 1WMEA 1WCDJ 2XIQA 4H7CA 4GH4C 4LCQA 5F37A 4QNWA 3VOJA 3M0VA 3MKCA 4OFCA 3WHUA 4HMEA 1VIWB 4AEEA 1MYRA 3FSTA 4Y90A 3OZPA 1CAXA 3KVAA 4CN1A 2EAWA 2G19A 3BLPX 2RDUA 1VBC2 4O57A 1W04A 1GKQA 1ND2C 3S6PA 1EUAA 4JDMA 3GVWA 5F6KA 5JXIA 1W8ZA 5A95A 3GNPA 2QQJA 3UW6A 5AHEA 3K75B 2LLEA 4PT6A 4BISA 3TNBA 5HR6A 5A5WA 2O55A 3GZUC 1AXYA 5HNTA 1BYBA 1MQPA 5ABHA 1E0WA 4PB4A 4DI8A 2YW3A 4NP7A 3S3GA 2FTPA 3WYZA 4GFIA 2JEQA 1W6NA 1KDKA 4XCAA 3LWCA 3FDGA 3LCPA 1OFQA 4PMZA 4ACYA 1L6YA 1B35A 5JIWA 2OSXA 3TROA 3JB8A 5IFTA 4S2FA 5A8NA 4UC5A 5CPQA 2A3CA 5DXYA 5KHHA 4QXHA 5AECA 4LW7A 4FP1A 1FWBC 3AZRA 2ZABA 1W9PA 2Q01A 3DHFA 4GXWA 2C9AA 2PLJA 5D32A 1EL3A 4NVPA 3WLSA 3A3XA 3T8QA 2HS8A 2E09A 4DQWA 4Y22B 4AQSA 2HWB1 4XBKA 3V5CA 1GTHA 3U3HA 3GS6A 3SCNA 3NG3A 4AHZA 1AXKA 5ACA2 2EQDA 2D23A 5JUVA 2BV9A 4EN8B 4WM8C 4HU4A 5DAVA 2UY4A 1FP8A 1E6PA 2RS51 3L5LA 3C2YA 1RL3A 3PUEA 4O65A 3SUUA 3WH5A 1CONA 1GQHA 4NJGA 5C4WB 5KC6A 1EFZA 3S6DA 1LT7A 1ZZBA 4Q4W1 3KL5A 1HKJA 3S8HA 4Y22A 2WC2A 3SCQA 5HJXA 1D2QA 4NILA 2PDWA 5AC91 3MLLA 4ARYA 4Z1YA 5A1FA 1AFSA 1HRV1 4W87A 1W5QA 4XQWA 4YYCA 4LANA 4I9MA 2Q1ZB 3ZFFB 1B09A 2QZ3A 5LGXA 2P1FA 4UWMA 3LDRA 2IQDA 2QAFA 1QJY1 4Q1RA 2QF8A 1NT0A 3AIUA 1BYAA 3TUUA 3PWGA 3F2DA 2ACUA 3UWUA 4DELA 4XB3A 1VEMA 3L5MA 5B80A 4E2QA 1MR5A 1UKSA 1AW1A 2OEKA 3D47A 3EPOA 2DP3A 4A05A 1VC4A 2YL5A 4NKCA 1P5BA 4L61A 5H8PA 1VAHA 3WH6A 4MUZA 1BLIA 1R1ZA 3W7IA 4AZCB 3AYAA 1FNZA 3WDUA 5IBXA 4LA3A 2HNEA 4G1KA 1NYWA 3FW6A 2X2GA 5E93A 2BWCA 3EGJA 1REFA 3KAOA 4YYOA 4XQ4A 3KHCA 1EX1A 2WM0A 3WNXA 1GNXA 1SW0A 3WQWA 1JZ2A 1B57A 4WVXA 4N7QA 2ESCA 1W06A 1JFXA 3KUMA 3LN3A 4QQHA 5FZFA 3JW7A 4K6BA 2EXIA 4RHV3 2Z26A 2ZX3A 1E4LA 3Q65A 4JRLA 2QTWB 2IXKA 2QDGA 1CXEA 3KXQA 2J9YA 4NIRA 1RH9A 3K8MA 1OVDA 3RZGA 2XSXA 5LRRA 3MPGA 4K8HA 2YCLA 2BFGA 1PHQA 3OEAA 1RP8A 3VABA 5JBDA 4AUBA 2IKHA 1FT9A 3BLEA 4CA9A 4O50A 5KXEA 1OVPA 3NQ7A 4ZS2A 2VVSA 5GJMA 3MUXA 2CZFA 1I0BA 3ABRA 1FMD1 5A3PA 3N9PA 5BNOA 2NQJA 4TV6A 5CBIA 2CU0A 4DWDA 2ZEXA 3H8AA 4Y1VA 1DWFM 2FHRA 4B7EA 5FY0A 3UWZA 1A5OC 5FZ4A 5IK8A 3TAKA 4U28A 3AUOA 1HQTA 2PDFA 4IX2A 1JPHA 4WSHA 3N6JA 3G0UA 1JNDA 3AMKA 2JXAA 2IFWA 1WQ5A 1O3RA 3TEVA 4AY8A 4W93A 4GK8A 2X1RA 3REQA 1J12A 4J2MA 4K1GA 4LLFA 2YCIX 4DYEA 2DORA 3GHSA 1UZ4A 2PZNA 3J7LA 2WNZA 3K8KA 3I2OA 1OH3A 1NWSA 1WWYA 1J0IA 4LLOA 4BMBA 4E4PA 2QIIA 3GFYA 3OLDA 3WG6A 1XRFA 4N43B 1TPC1 3GZTB 1XIBA 3FV9A 2YUEA 2PGFA 5GNXA 3HVDA 4IJRA 2PS2A 3P3PA 4NRRA 4RE4A 2IZWA 1W3IA 2X29A 3PTDA 4S2BA 1J1LA 3SRKA 1UC4A 4JQ1A 3SIMA 1IPSA 3DFHA 1FV3A 3VBHB 3UZJA 2R16A 4N9HA 4PLMA 4AXNA 3MI2A 3SUVA 2QJJA 4AF0A 1LLZA 3U37A 1G6CA 2X05A 3CUJA 1M04A 2YBUA 3T30A 4GWNA 2WS93 3D6NA 1LWIA 1UD8A 3N11A 2WNNA 1DBNA 5FREA 4J1XA 4MTVA 1H4HA 2PLCA 3SUSA 3STCA 1RSCA 5GZFA 1EC7A 3WO8A 4DOUA 2ISWA 1VJ2A 1EEXA 3CV7A 1GVIA 4GUIA 5L9RA 1VFUA 1BXHA 4NL1A 3LFIA 3AXEA 3C56A 4X22A 5FUNA 3ZFGA 2NSXA 5L9VA 2Y6FA 4GA9A 4IV1B 5GLUA 3EZ4A 5G2WA 1SJAA 4M7SA 1V02E 1BXNA 4GUHA 4CCNA 1OXCA 4UW5A 3MICA 3NO5A 4ZSTA 3AL6A 4IMAA 1LBMA 1XF0A 5JZGB 2J1RA 5K9CA 4FPOB 4XTDA 1TVNA 2W87A 3T1MA 1TIWA 2ZGRA 4FXSA 5FZOB 3W25A 4FEZA 4GUFA 4LIVA 3CTLA 1UD6A 3G1SA 3EOUA 2ZRZA 1BRLB 2GJPA 2UY8A 3QJAA 4TX6A 1XSRA 1V6IA 3A9BA 3QPYA 4ASLA 2GDUA 3PPHA 1C92A 3W3OA 1CGUA 3VDAA 4IP7A 3KL3A 2WR9A 4O54A 5TD4A 3LAGA 2REQA 5A3MA 3C0LA 3NYDA 1ECEA 1PS9A 1QU0A 3GDMA 4QKNA 3AFGA 4UBPC 3WQGA 1V08A 3VKNA 2XUEA 3I6EA 3MW7A 3KCOA 2W3ZA 2Y0IA 3J7NA 2DWRA 1LCOA 5H6HA 3IRSA 2JD4A 3RMEA 4PUUA 3VNMA 1H60A 2P5BA 1V77A 4BXFA 2WVVB 4GGHA 2CLIA 2Y38A 3J9SA 4JKMA 5TQLA 1M06G 1I1WA 3U2CA 1H9PA 1LHUA 3OYXA 5C3OA 4CRQA 4JTSA 3VDCA 4R9XA 1PVXA 5IVFA 2BP1A 5DUXA 3GUWA 4CD7A 4Q7NA 4HZFA 4JTQA 3DHPA 3B9OA 5EV7A 3UGFA 3NQHA 2WWCA 1H1MA 5BRQA 5GALA 2R1BA 3KWVA 1MNSA 1SFTA 4ZMGA 2Y8VA 1MDRA 5AYIA 3T0CA 1GYLA 4UTJA 5A2CA 3S2MA 1B31A 3W1NA 3IJ8A 3UJOA 3KCLA 3NYZA 4PN2A 6ALDA 2XLFA 4GC4A 2SLIA 5L7OC 4KGGA 2PWGA 3QACA 3W1TA 1XLHA 4FI4A 1RUF2 1ZLPA 3DHUA 5DMLA 2VGGA 3VBOA 3OYWB 5FJUA 3R4SA 1H5YA 3LPFA 1S0JA 4FPCA 1X9TA 3PUQA 1QNSA 4ATLA 3WG4A 2VOVA 3C0QA 2W5FA 2WPGA 2DSVA 4A2UA 2BYVE 1UYXA 3NQDA 4HCHA 3P61A 3VE9A 1GEQA 5IVVA 3GYCA 1Y4WA 3LZ3A 4DJFA 3GNRA 1CLXA 4KFPA 1E1CB 4DJDA 3ZX7A 2WPBA 4DJEA 1I60A 2XQRA 2QAPA 1JUHA 4LUMA 1HDKA 1ONRA 1C8YA 1UA3A 3LLFA 5JSOA 2QMKA 1RVKA 2CFFA 3NTYA 4K21A 4I8YA 3W7QA 2DVFA 1H8TA 2VURA 3AXXA 3P93A 4GB32 4WOZA 3H2MA 3FLPA 2ZZ3A 4GI9A 2YBSA 4B4HA 4C91A 4ZOAA 3HAGA 3SIZA 5FYYA 3OIXA 4AEKA 2QQPA 1KB3A 3NNTA 3ZFGC 5A7WA 4FLQA 3NAPB 5JSRA 3GAYA 4OIFA 4XIMA 4C6NA 3K3NA 4LKEA 2XH0A 1KTCA 3BN6A 4MF4A 5EA9A 1CNVA 3GNDA 3F4WA 3P62A 1XFBA 1RBLA 1K5JA 1O5LA 4MWAD 4W8BA 4EKJA 3RRAA 2RDWA 4PTNA 5I0TA 2AQOA 3MY9A 4LO6B 1ICSA 3SISA 3GY1A 4L56A 3ZMOA 3CAVA 2Q02A 2GAUA 2G41A 1RUSA 2R7EB 4GMP3 3ZXFA 1WD4A 1BD0A 1UD2A 2FHCA 4V27A 1SZBA 2PZ0A 3B0YA 1UOBA 3NSMA 3U1XA 1QMLA 1TMLA 2DCZA 4QHZA 2HWE3 2B4GA 2J6VA 4QX2A 3DG6A 4D6QA 1QPQA 3K4AA 5JZGA 1WCUA 3I3QA 1GYMA 2FTWA 5D09A 2BZNA 1JTZX 3EA1A 1B3YA 4N53C 2GVJA 1XPGA 3W7LA 2OO0A 5I6SA 3MS8A 1PMJX 2A3HA 4FPYA 3MA8A 5FZ3A 1XLKA 4EPDC 3GTXA 1AJZA 4C6LA 1C8M1 3G18A 1O6UA 3EOSA 1S2BA 1GR3A 3SRDA 2VFFA 2CLHA 5EKYA 2Q8EA 3T8LA 1QR7A 3CHVA 3CT2A 4XX6A 3VNZA 1M5WA 3RX3A 5FSEC 4L9ZA 3USUA 4MVAA 1DCSA 4MYEA 3I4KA 1QJX2 4IG2B 1NWUA 1FQ0A 5CFCB 1VBUA 3DBPA 1RUE2 5FJKA 1VGAA 4RUBA 3R0RA 4B5XA 4KBXA 3OIHA 1OA2A 3DN7A 2L5HA 1N1TA 3BTYA 2WUHA 5J98B 5BNOC 4NAFA 2ZGOA 4XWUA 4FAMA 4KEMA 2YG0A 4MGZE 1E70M 4X0VA 5FAGA 3ZPOA 2C0AA 2NWSA 1QEXA 2BU9A 4BQXA 1V6VA 5C2GA 3O7OA 4N9DA 4HZMA 3PZNA 2POTA 4TMBA 2J1AA 3EOOA 3JR2A 1UWTA 1I1EA 1EXPA 3G22A 4NJHA 2VQAA 3W53A 4AEDC 3MGUA 1VHNA 4TX8A 3V0UA 1V3IA 3TNQA 4FNRA 4NNBA 4WKFA 3VUSA 3RM8A 2B4KA 4I9AA 4M51A 3AU2A 4EE2A 4LOCA 1ONAA 4H9MA 4JGZB 1WOBA 1MEIA 4PBEA 1KDMA 1PO23 4LITA 3E6EA 3CDZB 4HK5A 3WDWA 2YDQA 3M4HA 2YDEA 1CESA 2DUPA 2UY3A 1YQ8A 1W3VA 2VMHA 2X53S 4HYVA 1ZAHA 2XR4A 2ZCWA 3T4VA 3NO1A 4L6HA 2G37A 2NV1A 3EPNA 4A3RA 1OBAA 1S0IA 5BRBA 3EO6A 3UG8A 3MV01 4E2BA 2Y7FA 2OODA 1EYWA 2C4XA 1ZBA3 2VQUA 3IUHA 3ZQ9A 2P3YA 3A47A 1UP2A 5A8OA 5DDJ1 1FWSA 2Z27A 4Q4Y1 1OD0A 4GISA 3WEMA 2ZKMX 4LV9A 4AGVA 2QHAA 3S46A 2NV9A 2ZRYA 3H7RA 4CP0A 1S2VA 1TX0A 1DV7A 3I4EA 1JXNA 1HX0A 1O8PA 1H7XA 2WO1A 4AU0A 4GVIA 2I16A 3NM1A 4XD5A 1VBB3 1W1IE 4HHHA 2WINB 4MM1A 4RL3A 2ZAAA 4KL1A 3PHAA 1F2JA 3ALQA 2R94A 4SLIA 1GK8A 1K9FA 2XSAA 3N2OA 1E71M 1UPPA 3NCOA 4S3KA 4DXKA 4IGHA 3T55A 3HBZA 2PWDA 1NZIA 4L8QA 4Z2GA 1RVF1 1OA4A 1XRUA 2WN2A 1XRSA 2VMCA 3P5ZA 1SQ4A 2WA3A 2OT1A 3UVIA 1QJY3 1DQ4A 3GM8A 1CIYA 4DLFA 2VJXA 1O12A 3TWIA 2VFGA 4AHPA 3KMHA 1JYNA 4EWEA 2Y4SA 4ZQRA 4BI7A 1KEXA 5E1QA 3LYEA 3RN6A 4QP0A 4IUGA 2KXLA 4AD1A 3KCXA 4PTDA 1RXFA 2CY6A 1C91A 1VRDA 2G9FA 1N3QA 4P9GA 2A79A 4CQ9A 3QD6A 2ZEYA 2A6ZA 4DLMA 4LTAA 1OOPB 4AZBA 2YL6A 2VC5A 4ENLA 1HL9A 3VM7A 4Z82A 2CNAA 5DPNA 2GDVA 1R6WA 4EF8A 1WBLA 2ZX7A 5FPAA 1TQ5A 3SN4A 1FVPA 5I06A 3VDDA 5D03A 2YGLA 1MEC1 4CVUA 3RRDA 2BQPA 3F03K 4JDNA 4LEJA 5G4EA 3UF9A 1UKGA 4GWEA 2YFNA 4NJKA 3PBMA 5CPMA 4CPBA 3LGDA 2DSZA 1XC4A 3PG8A 3N36A 2AENA 4UQAA 3HJRA 1TJRA 4GXMA 3PG9A 2Z2BA 4UQ9A 1H9WA 4QX7A 1L2QA 4OT7A 1GUIA 4IE6A 1YC61 3QV7A 2ASHA 3V0AA 1TPWA 4DM1A 4HVRA 3APTA 3OHIA 3EWXA 5D4YA 4ZGYA 2QUNA 1PAMA 2WQ8A 4GB33 2Q8DA 3FSUA 3LENA 2TEPA 2NX9A 1H61A 4AIEA 4NAOA 2WNVC 1AJ2A 4QAIA 4QGNA 1W5OA 2VGIA 3OEXA 1NEYA 4RS5A 1KFEA 4JIPA 4BQ1A 4MNLA 4BA0A 1RCQA 4NT0A 1ZVFA 2VEGA 3NJYA 3DU0A 3NL5A 4NHVA 1RUG2 4MV2A 2J75A 4BLIA 4C6OA 2BNMA 3VTRA 4XDOA 3GD6A 5KBFA 3EOEA 3ZR5A 4JTFA 4CCKA 5AFEA 1O6IA 2R1MA 4CUCA 1ZNPA 1YQCA 4Y3OA 4YW5A 3VKFC 2RH9A 3GGLA 4G3YC 4PQ9A 3UKTA 3AVSA 2JD9A 3P14A 2IXVA 3TP4A 3OU8A 2GN3A 2VR5A 3WLIA 5B7ZA 4W7VA 1VB9A 1X7FA 4FALA 2WLPA 4ZS3A 5C3QA 1SSGA 2HSAA 1FOD1 4Q8OA 4C65A 3AKTA 1OSGA 2GSYA 1STMA 4PFHA 1WDSA 1MS1A 3MIHA 2J62A 4KIEA 1B4EA 1GOHA 1MEC3 3VL8A 2PTZA 3QYSA 1TE6A 5F2MA 1EO7A 4N43C 2TBVA 4GY7A 4LOTA 2X2YA 3WSUA 1VYSX 4F2UA 2K2SA 4FP2A 4EYUA 3MT1A 1I4NA 4G56A 3GTNA 4FS9A 2PWFA 1EP3A 2Q71A 4B2DA 1KGUA 2P37A 5EPDA 2NXHA 4EOUA 3C3VA 2IXJA 1G9DA 4JL2A 4CDUB 3FMGA 1EHAA 2DIJA 2OO6A 3NQBA 3MF9A 3V1PA 1VBE3 1NE6A 2XH7A 1GWKA 3ORJA 5EJ1B 1Q6EA 2PLMA 3N29A 5KR7A 3I7QA 3ZJ8A 3T4HB 1UR0A 4YWIA 3PSVA 3TONA 3TLQA 3W7GA 1NA1A 1POV1 4B5SA 4DZHA 3TXZA 2WS92 1QNQA 2ZEWA 4B3KA 2DVAA 3O1OA 2OMAA 1AJKA 3R4UA 4H7LA 1OINA 3COTA 4BJ0A 4P5HA 4MZUA 2VX5A 3T6CA 1QOOA 4CE8A 3ZYRA 4QGLA 1N8WA 4XYXA 4XUTA 4FX7A 4LUYA 3SBFA 1BSLA 4IGSA 3MWAA 3R6SA 4H8UA 1Q85A 1QNVA 3EDEA 2YBTA 5I5RA 1XJBA 4HN4A 3TV8A 3AYRA 3T0TA 4MKVA 3B69A 1V6NA 3K51A 3RLUA 3CUXA 1CZ1A 4KEVA 4GA8A 3VNDA 5FL1A 2WHLA 1V0AA 5LIYX 3P1IA 1LLOA 3AS1A 3GKAA 1SDDB 2G3MA 1UAIA 1JQXA 1RBOB 5HQMA 2VMDA 4OUMA 1C7SA 2WVSA 4QE4A 1P4CA 3S5QA 1BF6A 5BW6A 5IVJA 1JDDA 4D6CA 2Q8ZA 1VBE2 4XIOA 1NELA 4GQGA 2IS7A 1H09A 1ZJAA 3NQ2A 3LY0A 3SUWA 4EPBC 4KRZA 3M7AA 2D69A 3R94A 3EWBX 4GX8A 1UOJA 1BPLB 3M6DA 3RWKX 1XGZA 1OCJA 3UXKA 1ENXA 4G9SB 2H0VA 2V9DA 4EPEC 4CEYB 1RMU2 4A45A 3GXMA 1BQCA 2PGRA 4YWAA 3C2VA 1S2TA 1OH4A 1JDFA 5LK5A 4XF1A 4HL0A 3BPSA 1G9FA 1JYWA 5AVNA 2ZGPA 2NLYA 1D7FA 2V2DA 3AMHA 1OCNA 3ZSMA 1YE4A 1XBVA 1OEPA 5CU1A 4YMZA 2D5FA 2FDHA 3MQTA 1C9DA 4JNZA 5HBAA 1POV3 1UWWA 1WLDA 1VIZA 1EJXC 3DFTA 1V6XA 1XCXA 5EU9A 5LZ6A 5JBFA 1MFUA 1GG1A 3JBG1 1IXNA 3W2UA 4AFDA 4N90A 2VHLA 4O8AA 5K9DA 3H8XA 5LBEA 4BS0A 4AI2A 2Z1SA 1QI5A 4EN9B 3ZIWA 1TMHA 2ZPXA 3SY8A 2BEOA 2YA2A 3GG1A 1Z9AA 2J8GA 5GZGA 2RS53 1OX4A 4BEQA 3LSBA 1UYYA 5CBLA 1CXHA 1JUEA 4B8EA 3ZDVA 4TN7A 1LF1A 2DT0A 4C7GA 4PUNA 8A3HA 4PMOA 2EXJA 2Y6KA 4GJYA 3RYSA 2BGQA 4C0HA 1CX9A 3DXIA 5FY7A 3ANYA 4IHCA 4ZU4A 2VR4A 4EPKA 4PE8A 1KQRA 2OEJA 3K77A 2XKPA 2FDKA 1IXOA 1XLJA 3LA4A 1WKFA 3Q67A 3V56A 3CLWA 4ZSUA 5KMYA 2YL8A 2FZ1A 1BEUA 1D4VB 3S2JA 1GKPA 4XAYA 1FX5A 2WAGA 3U2EA 2DVDA 1FP9A 3AYSA 3TW6A 3W29A 2GGGA 4AD4A 1FYUA 2OZTA 4EZ4A 3STGA 2G97A 2E53A 5KHKA 4K1WA 4QX5A 3MSGA 1WE5A 3GE7A 1W6OA 2V5CA 4W86A 4KCTA 1E5IA 3VIFA 2E33A 3QPEA 1QJU1 2QQNA 4KGJA 3H7VA 4J27A 3CWOX 2WSQA 1A4MA 3SCHA 3KZPA 2C0HA 2RS33 1XIMA 5I77A 1W39A 5HMFA 4IXXA 4XSMA 3PZQA 4BI5A 3NRUA 3D0JA 3GHTA 1ND3A 4OJYA 4TXWA 4H9YA 1C90A 3D5OA 2CLLA 4FX8A 4JQ3A 5J5RA 4US5A 1UYPA 4XFBA 5GZCA 1W5MA 2A3EA 5G4WA 2ID4A 4MB5A 4E9KA 3TYJA 1GEHA 3H50A 2GLKA 2VH9A 2OOGA 3W7NA 2PA6A 3R4DB 3IWZA 1OG6A 1ZZ6A 1W54A 2DVUA 1LCLA 4QX1A 3M8LA 3CEUA 4Q29A 4O1CA 1QPRA 5FZHA 4BQ2A 4Q6JA 2VTXA 2D40A 1EJSC 1CENA 2TUNA 4IFRA 1W6MA 1O3TA 1DXEA 3PUOA 1EXBA 5C8CC 1F74A 3QXBA 2EJAA 4K6AA 4J9JA 4OZOA 3FNDA 3POCA 2XIMA 5HV0A 3PB0A 4MYAA 3SKVA 1XQNA 3A5VA 4LJ3A 4ATEA 4PFMA 4OI0A 1E6SM 1OQDA 3VIKA 5H9SA 2PDPA 4JZ5A 3OA3A 3LLXA 2DSUA 3HB9A 4MG4A 4CNTA 3RZLA 3IDCB 2HBUA 4LBKA 3CL1A 3FVDA 1CX4A 1GOWA 3ZYGA 2GWNA 4NYUA 3LCLA 2VGDA 5KZEA 2AYHA 1FH8A 1NWRA 1DBTA 1V6TA 2CERA 2RGMA 1OHFA 3GF6A 1GICA 1XI3A 1O3QA 4GMP0 2BOIA 4ZODA 4P8XA 1JIBA 3OLGA 1FMD2 2NPIA 2BS9A 4L5ZA 3VPLA 4ERIA 4L1XA 1HB3A 3DPRA 1UUOA 2QCEA 3FGCB 2ZX1A 2OX0A 3VGDA 3GW3A 1W1A1 1EJRC 2NYYA 2EG8A 4REQB 4K8FA 3VBSC 5AC92 3XISA 1Q8OA 4QPIC 1OOPC 4A3ZA 1WZMA 2VZUA 4HNLA 2XGIA 2ACSA 5CC6A 2GH2A 2Z42A 4C6PA 1NQ6A 2YFOA 1CXKA 2I17A 1O5UA 4CP1A 5BU9A 1AF9A 3IM0A 3RMYA 2WSPA 2F6BA 2XJ7A 3UY7A 4MFEA 3DAQA 1Z7AA 4AR2A 1PIV3 2G9GA 5D2AA 1PVNA 2J47A 4WDXA 1YE6A 1I1XA 3IK4A 3WD1A 3WKZA 1GV9A 2UWFA 4QKBA 1X38A 5JMOA 1CPMA 1XU2A 3L2MA 4O15A 2P88A 3HGSA 4ML4A 4NU7A 5D8ZA 4D69A 5EGRA 1OY0A 1B30A 3L2YA 1H49A 4GYFA 1NY1A 4BF7A 3THCA 3VZMA 1MPXA 3MW3A 4ZXKA 3IIAA 3TYZA 1XLDA 2EPOA 2CZVA 3LSCA 2PGWA 1RHCA 3BAXA 4M19A 5CSYA 2PHXA 4P7LA 1XBXA 1JR1A 2R9RA 2UYBA 4IIBA 3IIIA 4QFUA 3MSRA 3WQ7A 1C4RA 5A32B 5BNPC 5ECUA 2ICSA 1VBA3 1C3FA 4JIEA 4RX0A 4RPQA 3EWWA 1UU5A 4A2SA 3GU2A 4LS1A 2R043 3N14A 3UVAA 3PBVA 1HJUA 4QM1A 1K5MC 3FBMA 1AL21 4R4XA 2OX4A 1UMIA 1WLTA 2BVTA 4WUIA 4E4SA 4AI8A 1TV7A 3M46A 3NA8A 4LC6A 4LO7A 2K9ZA 1WZAA 4BWLA 1Y9QA 2ZBTA 4YZ2A 4D72A 4K9SA 6REQA 4IV3C 4AY1A 4QX0A 3HG3A 4YM2A 2ZZ6A 3PUSA 2QUVA 3W7MA 1Q6DA 3MPBA 3WZ1A 3WDXA 1LT8A 3E12A 1JCNA 1BXBA 2HYKA 2EALA 5FZIA 2PAKA 4NWWA 4CD6A 2ZA9A 1DQUA 3B8TA 3CUHA 5BUVA 1VCGA 4NWVA 2ZHNA 3IPWA 4R7WA 4A8NA 4MZYA 3J8F1 1LOQA 3SN1A 4B1MA 3LE0A 2NQHA 1XCWA 2GC2A 3QH2A 2R1DA 2XHKA 4B91A 4OI2A 1DE6A 1EDGA 3GVGA 3LRKA 2D2JA 1TME2 3TEWA 5JIPA 4O7XA 1ALDA 3KV5A 3I4IA 2UYAA 4NHKA 3ROUA 1K03A 3C2EA 3B8DA 3H2CA 3RJ2X 5KETA 3NPVA 1Z89A 4X2PA 1IPJA 2BBFA 4TR9A 1IR1A 3TC7A 1MRAA 3HM7A 4HNOA 3M0XA 5LY2A 2E6YA 5JDBA 1MNZA 2RHGA 4QDPA 1OX4B 4B4FA 1C1FA 4ONVA 3FVMA 1G9CA 1Z44A 3V1HA 2BZDA 2WWUA 1UD5A 2WSUA 1HX6A 2QV5A 5BCAA 5FKCA 4E5TA 4Y33A 4D6HA 1LNSA 3P0XA 5C9UA 5HWMA 1L3JA 4K68A 1N82A 5FTTC 4Q4SA 4Z42C 4JHZA 1PMHX 2QNKA 1ISWA 4Q8UA 1H8TC 1OYCA 3GBEA 4XFIA 2VD7A 1NM9A 3O6YX 5IATA 4HSLA 2BNNA 3LG3A 3G1HA 1QW9A 4IW3A 4BK5A 2WYFA 5CISA 3KBNA 1S1AA 1O66A 4AAPA 2JG9A 2EXOA 3IEBA 3SADA 3O14A 1KKOA 2I45A 3UGRA 2NZ9A 2A1XA 1IT8A 1FWGC 3K4WA 4MJMA 1JVNA 5HK4A 4DBWA 2WFF2 4MGTA 3RK8A 3WDRA 2ZGUA 3DXUA 4ATFA 5CG9A 1U83A 4W7WA 2WBGA 5IAVA 5T5OA 4MHRA 2V82A 8TIMA 2XTKA 2AKZA 4LHNA 2R1KA 4BHYA 3GG8A 1VBD1 5IVEA 4KH9A 4U3AA 1V0NA 3F95A 1FPN2 1XGDA 2XQXA 2BJSA 4RHV2 2E5DA 4M3PA 1DKWA 4R9DA 2QS8A 5D8AA 1ZM1A 3VIIA 4XJAA 2OSWA 5F2SA 3UJQA 3RCYA 4M3CB 5A6LA 1Q7QA 5IJRA 4DJED 5CCZA 4G6CA 3W27A 4LKFA 3BCFA 3P60A 4JFWA 2V5BA 2FQIA 3OQ8A 4IOTA 4AQTA 4NZFA 2CYGA 7PTDA 1RUI1 3FOKA 4GWJA 2B7YA 1XH0A 1QI3A 1T6MA 3V0BB 4JTUA 3WP4A 4LSBA 6PTDA 3NV2A 4Y1UA 3UR8A 1TJ1A 1PL9A 2Y64A 1OZQA 1YTKA 3H1MA 4ZQNA 3AICA 2OQLA 1WO2A 5FXXA 1AA1B 2DZWA 4YJ5A 2OZJA 5CSSA 1F8MA 1N8FA 5FJTA 4DX3A 5T9BG 4HK8A 2NSOA 3SQSA 3IV3A 4MADA 4RXGA 4FXFA 1FXZA 3CAQA 5AC5A 1YNPA 4UT5A 3TK7A 2AREA 2C19A 2VDGA 1OPMA 4JX5A 3MEPA 5BU6A 2PQSA 2QQOA 1LEMA 3H6OA 1A34A 1VB4A 3HFYA 1RGSA 3NSXA 5J7MA 3GXNA 4NRMA 1HQWA 4B3ZA 5JXGA 4QISA 2VUJA 2ZOXA 1XYMA 1Y8BA 1P7TA 4WVMA 2QW5A 1A5UA 3KM8A 1NDWA 3N9SA 2PTXA 2E8YA 1ULOA 1KCKA 1ND3B 4KS0A 4XZWA 2OX1A 1W8UA 4OI1A 1J8VA 3ZYHA 4Y5TA 3ZJKA 1OX6A 2NVCA 3M7WA 3SH4A 3GC4A 2UY9A 5FF0A 4JTIA 4BZ4A 2V72A 2VBBA 1FY6A 3C0JA 4YLWA 4CGTA 1E5JA 3TR9A 1EA9C 4IMFA 2OKTA 1MUMA 5AYXA 1K77A 4YRDA 1TR1A 5AFBA 1MQRA 5EBUA 3AZXA 2W27A 5KHGA 5A6KA 2Y85A 4LUIA 5JVVA 1H1ZA 2OFJA 5C5TA 4PMQA 3TYEA 2GMEA 2MNRA 1CAVA 4PQQA 2HJPA 1NARA 1CAUA 1KR1A 1CD3G 3VOHA 4WK9A 3RILA 4TWTA 4AHQA 1NUKA 1OFDA 4O1AA 3RMJA 4ZTYA 1A5LC 4W8JA 3AUJA 4JX6A 3C8NA 3GTIA 5FK8A 2R1NA 1ZCCA 3VA8A 1PX3A 2W08A 1CW2A 1RQHA 4XQDA 1QI4A 1CXIA 2CV6A 3SN0A 3B04A 2QQKA 3EYPA 3DKQA 3MVTA 1GOIA 4H14A 3HPXA 2C1GA 4CDWA 3TN3A 1QDSA 2JJ6A 4Y9PA 1B9BA 5KXBA 3PNZA 2ACRA 3U11A 3GR7A 5DQ0A 4GH3A 1PX8A 1Y5VA 1S39A 3LEPA 3LCFA 1P0NA 2NN8A 4QNEA 1JH5A 2GNDA 3OGRA 3M16A 1K70A 3B7MA 5CNAA 4QBXA 5T3NA 3TEXA 3EMQA 4N9BA 2K0GA 1R7OA 3CQKA 5IW0A 1JDEA 1NH6A 4P9XA 3BVJA 3WENA 2QJIA 3BI3A 4MSVA 2J7CA 3IJLA 3PPGA 1WDWA 4Y2WA 2YZRA 3TNPB 2RS12 1TMF2 4A3HA 4CEWA 3NWRA 4OHWA 3QGVA 1PK6A 2QZ2A 4LYKA 2AGSA 4QXKA 4F4RA 1P6CA 3I59B 3ABZA 3HMCA 3VXGA 3KVBA 2PAMA 2VECA 1TX2A 4YVWA 5J09A 3VBSB 1V02A 2BHZA 4FF7A 1CAXB 3TJ4A 4B9ZA 3GBWA 3A9IA 4D6FA 1F07A 4Q27A 1GCYA 4H2AA 1MS8A 1FBAA 4XF9A 4AX7A 1IWPA 2DH2A 3E3HA 3CJXA 3I2JA 4I0AA 1TE1B 4KQNA 3TYCA 3F2BA 2FVKA 2PP1A 4R27A 4IXLA 5SV5A 3GIQA 2WWDA 1EDQA 4PR4A 2GU9A 2XM2A 1DXFA 3QCWA 1HLCA 4ZZ5A 1T6BX 3SJNA 5ABJB 3FJNA 1RUF3 2NX1A 3PY2A 3TC6A 1XNCA 4W4ZA 4M80A 1PVC2 4DINB 4LBRA 4YG0A 4X0NA 1VBD2 3RGBA 1NFPA 1TV3A 1W9SA 5C5YA 4MJ2A 3TYDA 2Z1WA 3TX9A 1VFHA 1PK6B 3VDHA 1KBJA 1TMQA 1GHSA 4R3UA 3VIOA 1WMDA 2ZBJA 1JYTA 3H1YA 4OHZA 4UTLA 2E1DA 3KV9A 4XDQA 3MYOA 2VEPA 4YHGA 1R2RA 3INAA 3MP3A 3EX3A 4IEVA 4IP4A 3QBUA 4PF1A 4I9JA 4XUGA 1V0MA 3H3ZA 4JFSA 2DSKA 4BQ4A 3WLHA 1T5AA 1IQAA 4PUJA 2BB0A 3DX5A 4ZA0A 3SH5A 4FPHA 1HQNA 2B39A 1UD3A 3UCCA 4C1XA 2QQLA 2WFF3 3P3NA 3BG5A 3T2OA 5HBFA 4UBGA 1CIWA 1SPPB 3P82A 3W5NA 3CB3A 1F5FA 2G3FA 3VMNA 4CCLA 2X8RA 2VZTA 1YWKA 4FAHA 3PUGA 1TFVA 4DB7A 2MEV3 5CEHA 3NV1A 2W1QA 3CL7A 5M2FX 3GDBA 5HQEA 1E1CA 3ZXAC 3VB9A 2RDNA 2HWGA 1XIJA 2NQ9A 1OA3A 5K9XA 2ZXQA 4B1LA 4JIHA 4TOQA 2EG6A 3TDFA 2WJSA 3QLQA 4QPYA 3QLLA 1EAH1 4EWJA 4UTHA 1U5YA 4OWGA 3R4IA 1VALA 3NKTA 5LNUA 1W1YA 2ZYFA 2VULA 3BSHA 3N25A 5ABJC 5FYVA 2EJ1A 2YFZA 4PB3A 1O95A 3VDDC 3CQHA 1H2KA 3NNLA 1PZ3A 1ODMA 4NHLA 4WM8A 2W46A 1DJHA 3VBFC 2YW4A 3O0VA 1DLLA 1YRZA</