3GZFA

Structure of the c-terminal domain of nsp4 from feline coronavirus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
GLFEGDKFVGSFESAAMGTFVIDMRSYETLVNSTSLDRIKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVSRNDKLYTPPTVSVNSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure of the C-terminal domain of nsp4 from feline coronavirus
pubmed doi rcsb
source organism Feline coronavirus
molecule tags Viral protein
total genus 27
structure length 96
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3gzfA00
3VC8A 3VCBA 3GZFA
chains in the Genus database with same CATH superfamily
2JZBB 5DGAA 5J0XA 1ZQKA 2DUYA 5AM4A 3OHBA 5KFOA 5KFHA 1FIQA 7ICSA 4J9NA 2XI9A 4RQNA 9ICVA 1NK7A 5HHIA 5L1IA 1F44A 4QJFB 3RB6A 1KDHA 3K1RB 2IA6A 3FC4A 3ISBA 1ZD5A 4OCZA 3Q8PB 1ZXIA 3C21A 3NRWA 1T8EA 2R18A 1RYRA 5BOMA 4IQVA 4YMMA 2NRTA 1BNOA 2PFQA 5ALUA 5J2GA 4M9NA 3ICXA 2OXOA 1GO3F 3TARA 5AM3A 4KMOB 4PGYA 3MR5A 2HHSA 2BCUA 3NTUA 5DQGA 4BWJA 2JZBA 5DG7A 7ICIA 3KZIU 3M9NB 3ISDA 2N1RA 3ORYA 2BZFA 2H3IA 3KKAC 2ZUBA 4B9LA 5J2HA 4NLCA 5F9LA 1RG6A 1T94A 3F2CA 4Y2SA 2E1FA 5CWRA 4A8EA 5L1MA 8ICPA 5ALDA 4BUGA 4FZNA 2CPRA 4DFMA 3M9OB 1ZQWA 4KN4A 4EELA 4QW9A 2HW3A 4OJ6A 4DOBA 3RJEA 4ECTA 3PW2A 5J29A 3HPOA 2BGWA 1L3UA 4RQ6A 4DSJA 2XGPA 5L1JA 1NJWA 1L3VA 1XO1A 3WKAA 1FFVA 3SAGA 3LK9A 2ALZA 2H5XA 3FM9A 2UVRA 4EEYA 1UA1A 3BS5A 1BPYA 4RQ1A 5KTQA 5JRTA 3BZCA 3H7IA 2EQYA 1KL9A 5AIAA 2HHUA 3SQIA 4UAZA 1S97A 4EENA 2BCSA 8ICRA 2HDOA 3KFUF 9ICXA 3BQ1A 2ODGA 2F8LA 2WTFA 8ICWA 2W9AA 2JH1A 1HIWA 2DKZA 3H8JA 3CW2C 1DGJA 4EYHB 3R9KA 4P0PA 5KFNA 4P0PB 2NRZA 3HT3A 2VJ5A 2A1JB 3ZDAA 5KFIA 2JV3A 2KJ8A 2BKEA 3HRDD 4GXJA 3SV3A 7ICLA 4F2RA 2KVCA 4F4XA 4F8RA 4TQSA 2EAPA 4IS7A 3RAXA 1JMSA 3T3FA 5DLFA 4KLMA 4UB5A 1SL0A 4IR1A 2F3NA 5ALHA 2Y1JA 3PZPA 4Y2PA 5IIIA 5BOLA 2WB1F 4J9OA 3QEBZ 3SD7A 4RT3A 4DEZA 2YY6A 4ZOHC 3PSPA 2ISPA 3T5LA 5KL1B 2RQ5A 1TVAA 3E58A 1JIHA 1D8LA 2BQUA 1MSWD 2BPCA 4TURA 1S77D 5KL8B 5KFEA 4O0IA 4IRDA 2V4RA 4I2FA 3L3FX 3PVXA 2YMPA 5KFXA 3ED5A 1DRGA 2EZXA 1QCKA 4Q44A 1X9XA 5KFLA 2QLTA 2V4QA 4B9VA 3FAHA 4DSFA 3G6YA 4FZMA 3BQ2A 5ALGA 1CRXA 5GTHU 5AKLA 1NJXA 3SAHA 2OH2A 2KFNA 2F1JA 2OYYA 2BR0A 2VIXA 5J2KA 4I2AA 4R65A 4QNLA 5AIBA 1LKYB 1Z3EB 4ECSA 1RZTA 3MC1A 1DK3A 1Z19A 4MF8A 3B0YA 4Z6FA 1UPHA 2XY6A 2K4EA 3V6JA 4RU9A 4F93B 5CA7A 4M9HA 2G09A 3IG5A 4Y2YA 2PMZC 3Q8QB 5HR7A 2FDRA 2ZUDA 3HKZC 4DQIA 4EYIB 3JPRA 3MDAA 2G0AA 5EWEA 4CRXA 9ICUA 1N5WA 4KLQA 4ED2A 1YT3A 2BPFA 8ICEA 1V9PA 1FO4A 5J2CA 2A19A 1RXVA 5BPCA 3IM1A 2HHXA 5KFGA 3PW7A 3ONNA 2IMWP 3M1YA 4YVZA 2PI5A 5KFDA 5F3XB 2L5YA 3UXOA 4C4RA 1ZQLA 4F72A 1AQ6A 3TFSA 1C20A 2ZG6A 3BQ0A 3RR8A 3D2QA 1Q46A 3PW4A 1KFSA 3AUOA 4QWDA 3C29A 1ZQHA 4OO1J 1RQNA 5KG6A 1VJ5A 4QZ8A 2B0CA 4RQMA 1QSLA 3AM9A 4F50A 3OHAA 5DB7A 5ALVA 4O5CA 4ECQA 7ICMA 4DFJA 4KX5A 2XY5A 4JV2A 4F92B 5J2JA 3WK6A 1ZYQA 4DQPA 2XY7A 1S76D 2PMZF 1ZQOA 4C80A 2HSZA 9ICKA 1AROP 4YR2A 2D6FC 3JPOA 1NJYA 2HHQA 1BGXT 2BDUA 3VC8A 2ISOA 1A77A 2CN1A 5DBAA 1JALA 1N63A 5KG5A 7ICFA 4NM2A 3SV4A 4ECWA 1MN8A 4FZLA 4AP9A 4EX7A 2NO5A 5ALQA 2KMDA 4Z6DA 3N28A 4YMNA 1TK0A 5CJ7A 2JR5A 1U49A 1VDVA 5ALJA 5J0UA 4F4WA 4BGDA 5GTIU 2D8CA 3RJHA 3D2SA 1ZQJA 2DPIA 2P66A 2DFLA 1NNLA 5AKHA 4KLGA 4DS4A 5DB6A 3MR2A 4RQ0A 1D9FA 3J81j 3QU7A 5HR6A 3N7SC 1COKA 3RB4A 3ZD8A 5KT5A 3Q8SB 5KT7A 4DFPA 4RPXA 1C7YA 2ZJAA 1ZOLA 1SV4A 2MAXA 2KD1A 4OJOA 3WKBA 5AI9A 4J9MA 1N61A 2ZTCA 1XSLA 2UVVA 4Y2VA 4FS2A 3AU2A 4UQGA 4Y2QA 4YD2A 1MC8A 2RHFA 3H4BA 2FI1A 3EW9A 1EXNA 5AM1A 3THVA 2K8CB 3BJYA 9ICTA 4NL9C 8ICVA 2EZYA 3H4DA 7ICVA 1RM6C 4I28A 4KITB 4KLOA 3QNMA 4EX6A 3KTQA 5J2IA 2HBJA 2KVSA 3TQ1A 4ECUA 2IHNA 1JN3A 1HUOA 4J9QA 2C22A 4RQ7A 1DOQA 5AKEA 2KV2A 3AEVA 1X2IA 2Y9UA 4C4SA 4PZNA 8ICFA 2FPLA 3KBBA 2M9NA 3TANA 2W9BA 5J0OA 2C2DA 3ALRA 2B21A 1LV5A 3RB0A 2ZXHA 4R63A 9ICQA 9ICGA 3N7PD 2E8PA 3BDPA 1ZRMA 1SWVA 1WYGA 4QW8A 2IOFA 3H0RB 1URJA 3RF9A 3IN5A 3Q8RB 4O5KA 3E0FA 2OWOA 4DSKA 3DDHA 2GLEA 1ZD2P 3LWLA 2P6UA 3UPQA 3RBDA 3SR6A 3GILA 1Z4NA 3CP8A 1S10A 1NZBA 4KN7A 1SL2A 4KLDA 3SYZA 2ASLA 1L7OA 2KJ9A 2YN4A 1NK9A 1SL1A 5J0WA 3HJEA 1QTMA 2HBLA 1V97A 2P35A 1X6IA 2EH9A 2LKYA 5ALEA 1VLBA 4LZGA 4CCHA 4M9GA 5KFBA 4UB4A 3UXNA 2R8IA 5KG0A 5B66U 1CUKA 2H3FA 4UB3A 2W11A 2VKQA 2AXTU 1WWVA 5J0PA 4Y2TA 3WK8A 5KFYA 2AU0A 2W9MA 3D6JA 2UVUA 4J9PA 4J9RA 3MR6A 1NK6A 4F91B 3RTVA 2Q4TA 2HHWA 4TUPA 4KLSA 3ZDBA 2KNJA 2LYBA 3EYZA 4RNNA 3U26A 3MGVA 2HHTA 3JPNA 3V7LA 4JWNA 7ICNA 1Z4OA 3WK7A 1TAMA 4I2GA 4KLTA 4PL1A 2B6GA 3V6HA 3QEAZ 9ICJA 1UCVA 1XSPA 4RT2A 5KT2A 5TZVA 3MBYA 3RFAA 3ZDEA 5AKGA 4LZDA 9ICFA 7ICHA 5TISU 4GLXA 3PMNA 2BCVA 8ICNA 4UAWA 2K60A 2ZTEA 3NVZA 4M6WA 5HMLA 3JPTA 4IRKA 4M6WB 1PVRA 2JMGA 4DFDA 3KKAA 7ICKA 2K8BB 4RQ3A 3K75D 1XNSA 2HVIA 3PSFA 4P2HA 4DL2A 3IHQB 1S0MA 4NM1A 1TV9A 5KT6A 5AICA 1L6NA 8ICHA 5AHXA 3TFRA 3H8WA 2HOQA 5E79U 3NGDA 4YXJA 3F2DA 2XO7A 2W55A 3NVVA 5B5EU 4EBDA 3LWMA 4Y2RA 4QIWC 4X5VA 5F9NA 3AU6A 1H38A 2F1IA 5CR0A 3QUCA 5DQIA 4JV0A 4ELUA 1A0PA 1KFTA 2UVWA 3BS5B 4XRHA 1RDFA 5DDYA 2CXYA 3JPPA 4YP3A 4IQUA 2W8KA 1JRPA 4GXKA 3ZDCA 4B9NA 3WK9A 5EWFA 2AH5A 1IM4A 2AHOB 1XWLA 4QZDA 2FPKA 3T5HA 1KTQA 5JU5A 4DL3A 1UT5A 5ALFA 1X40A 4I2EA 4EZ6A 4O3MA 4B9MA 7ICJA 5J2BA 2Z7JA 4Q8FA 5CRXA 3RH4A 3GIMA 5AKIA 1ZQIA 2NO4A 7ICTA 5DLGA 4F4KA 3TAPA 2G07A 3CRXA 3QUBA 5C5JA 1PZNA 5AI8A 3ZI4A 1PK3A 3C23A 1O03A 4F5RA 2DL0A 3PR5B 1TKDA 4QZBA 3ZDDA 1T4GA 3MABA 3SZ2A 2K89A 1S5LU 5CP2A 5KFFA 3T5JA 2W7OA 4KLIA 3MR3A 2ATLA 4OD0A 4HYKA 1QQ7A 3GV5B 4TUQA 4M04A 2KTQA 2BCRA 1U47A 2GH1A 4BXOA 4QZIA 3PV8A 4BXOB 2E8MA 2J6UA 1DXSA 4BWMA 5EWGA 2LYHA 3C1ZA 3Q8KA 1RXWA 2JHDA 4LVSA 1QH9A 2AGQA 3GV7B 4ECYA 4ED6A 5AKXA 2V9WA 1L3TA 5ALSA 1CI4A 3KZXA 8ICOA 2DBYA 1B0XA 4UAVA 5EE0A 2G5HB 3QE9Y 3N97B 1B43A 3PSTA 9ICIA 1NK8A 2PXIA 4YMOA 5AI6A 3QU5A 3L4PA 5JUMA 1PVQA 2ES6A 5J0YA 4CF3A 3IG8A 5J2EA 1L8OA 3SENA 5ALMA 4K4GA 4GXIA 4MFAA 2ZJ8A 3C5FA 2PI4A 1SIJA 3N7RC 2KK0A 5JTIA 2W8LA 4UW9A 4FO6A 2J6SA 4PHAA 3FYHA 4LJXA 1WCNA 4DSLA 2DF4B 7ICGA 8ICXA 4QZ9A 1XO0A 3GIKA 4PH5A 2E3TA 3LDAA 2KJ5A 5AI0A 3RR7A 1WUDA 3AQFA 3H8MA 1B22A 1LVHA 1SV0C 1IIPA 1SV0A 4C4TA 4DWIA 5T14A 2YB1A 5DGBA 1TFRA 2WF5A 5DBBA 1YZ7A 2KEYA 2WF6A 3RRGA 3T5KA 4DSEA 3I1YA 4MF2A 1ZQAA 5ALRA 1ZQEA 4K4HA 3C5GA 5KFSA 2FE9A 9ICCA 9ICLA 4NLBA 4GC7A 2QKQA 4CGZA 9ICBA 2BQ3A 5KFCA 2A1AA 1L3SA 2G06A 5C0YA 4C8LA 2EAMA 2ZUCA 4Q8EA 3GU3A 4UARA 1K5OA 2VA3A 5CEHA 2JEFA 4Z6EA 4PJ0U 1ZQQA 2WAQC 2WF9A 4DCCA 2K8AA 4FS1A 1ZQZA 7ICRA 4PPXA 3BQ7A 1HUZA 2F44A 2XC9A 3HKZF 1KQQA 3F53A 3BZKA 1OXJA 4DF8A 4AYBC 1HEKA 2JGAA 1WG8A 5EE1A 4YQWA 4BDPA 2H3VA 4F5QA 1BPZA 5DB9A 3QUTA 2I5HA 1L8LA 2JEGA 5KFWA 4QZAA 4JB3A 4UB6U 1NZPA 1KN5A 4YN4A 2XCPA 1Z1VA 3ISCA 4I2HA 1Q3UA 4R64A 5ALTA 2ZIWA 2Q0ZX 2ZIWB 4P4MA 4I2CA 4PL2A 3AQEA 2QB0A 3RRHA 4KLEA 2QB0B 1L7PA 4F71A 2Y0SC 2W43A 3TADC 2ASJA 2JXJA 5G5HA 3TADA 9ICWA 4C0ZA 3C2MA 3UMGA 3WK5A 2PFOA 2R8KA 3WKDA 5ALYA 1FEZA 4NLZA 5ALKA 5J0TA 2ZIVA 4KLHA 2YMLA 4B9SA 2ZIVB 5KFMA 1DK2A 3MGHA 4RQ4A 4BX9C 1PK1A 5KNIA 1PK1B 5AK5A 2K4HA 1ZQTA 5AM5A 2BHNA 4PZOA 4XUSA 2CRXA 1FFUA 4PHEA 1IG6A 4UAUA 2HBKA 1RYUA 3DEEA 2EANA 2YQEA 5L1LA 3AL0B 2BQRA 3QZ8A 4IQWA 1V85A 4DOAA 5J8YC 5J8YA 5AK6A 3IP4B 5ALPA 3UMBA 4JUZA 2KSOA 3H0LB 1O08A 4O5EA 2KSOB 1COOA 3OGUA 5KG3A 2KZZA 4DL5A 4NL9A 3M8RA 3C1YA 8ICYA 3ETLA 4HAIA 5J2AA 3PW5A 2E8NA 1ZRNA 3OSPA 3K1ZA 4J9KA 2M0NA 5KFQA 9ICMA 3LVVA 8ICIA 4G9BA 2F8KA 5IIMA 2RDIA 4JWMA 2RP5A 4RUAA 5KFJA 2ZIUA 2I1QA 2JH7A 2FPMA 5KFRA 2ZIUB 1ZQDA 4FE3A 4PGXA 7ICUA 3AMZA 8ICMA 2W9CA 2W9CB 5AM2A 3M7DA 1S8OA 1A76A 4QWBA 2W9BB 8ICJA 1S0OA 2GO7A 3PY8A 1B4FA 4P4OA 1L7MA 2MRLA 4MHVA 1MQ3A 5FP0A 1KFDA 3HILA 4FFDA 2XGQA 4RQ2A 1K1SA 1ZD3A 2XIDA 4M0AA 2LMRA 2G5IB 3H8SA 1SXDA 1QQ5A 2LBOA 2OEHA 1J2MA 8ICUA 5K4LA 1Z1BA 4QWEA 3SI8A 2BDPA 3TI0A 4FBUA 3QYPA 7ICEA 1XC9A 2HMXA 2XCAA 1ZQPA 1QQ6A 9ICOA 2KZ3A 4QZFA 1QSYA 1CEZA 3HX0A 3GIJA 5AK4A 4DL4A 4OJPA 8ICTA 3A0BU 5AI4A 3TKAA 1DGSA 4MFCA 2QARA 5AI5A 1KBUA 4TQRA 2QARB 1ZQFA 4YR0A 2DKXA 4EZ9A 5AM0A 3NVWA 2FLPA 3UXPA 4P4PA 4I27A 4DFKA 1JX4A 4NLNA 3B9JA 5G5GA 3H0MB 1KEJA 3Q8MA 3M6KA 4NJ8A 3M8SA 5ALNA 5AKYA 2W54A 3UQ0A 2D3DA 4DL6A 4C8NA 3IDWA 4F2SA 5AK3A 3WKEA 2FMQA 4J03A 1Y88A 4ECXA 4NV0A 3G6VA 4QZGA 3PX6A 4PHPA 4KLUA 4DSIA 3IRUA 4CNQA 7ICPA 1NKEA 2R8JA 1D9DA 3SEIA 2VJ4A 1BNPA 4PHDA 3CYMA 3NRZA 4UAYA 2GWSA 1U45A 1NKCA 3PO4A 3OTQA 4B6JA 4O3SA 2RLTA 1WWUA 2KZMA 4EEKA 3JPSA 4M9JA 5DBCA 4YCXA 3GV8B 1JROA 5CHGA 2JEJA 2LHTA 2G08A 5L9XA 2LM1A 2NYVA 1OUQA 3SAFA 3GQCA 4RQ5A 2K4IA 5KFKA 2HBMA 5HMMA 4O9MA 2E5SA 2E1EA 1V38A 2KN7A 8ICBA 2W3RA 1NK0A 3QZ7A 4IL6U 1OW5A 3E2EA 2KICA 2WF8A 3KOOA 5HNKA 4YFKA 2AQ4A 3PR4A 2HOIA 5IIJA 2R8HA 3I76A 2J6TA 8ICKA 3RJGA 9ICAA 4F3OA 3OPXA 1K1QA 2Y1IA 1X6JA 5KFUA 2MSNA 5EE3A 2IHMA 4GIBA 5J0RA 2PFNA 1TE2A 2WB1C 4MEXA 4E0DA 4QWCA 3UM9A 4PGQA 4I2BA 1WCLA 3ZD9A 2KKPA 5DKWA 1Q3VA 5ALXA 3QX7A 5KG1A 9ICHA 4RNMA 5J2DA 1KW4A 5J0QA 1MQ2A 1J97A 1IXRA 3V7KA 4Q45A 4ECVA 1RQLA 1Z00A 1Z00B 3RBEA 4U7CA 4M47A 4NXZA 3F5EA 3OSNA 2P6RA 1XSNA 8ICQA 2K4PA 4XQ8A 1D8YA 2GOLA 3FDSA 4JK1A 2DGZA 3WK4A 3A0HU 3TAQA 5IIOA 1QSSA 4DL7A 2A1JA 1ZQCA 3F2BA 1HJPA 1SGGA 3CNHA 4NWIA 1L5UA 2YTUA 3B0XA 4DQRA 1SWWA 1KSPA 3PNCA 1BPBA 5KG2A 1U9LA 4UASA 4QIWF 1ZQSA 9ICPA 4QZEA 1A6SA 5DQHA 2NRXA 1NK5A 2VA8A 2OM6A 3RJIA 4Y2UA 4F5PA 4YG2A 3WU2U 4DQSA 4JMUA 3QU9A 1ZQXA 4O3NA 4ECRA 4F5OA 3HP6A 1N56A 2A3VA 2KG5A 9ICSA 4QWAA 2F77X 2KHVA 2XVTA 4KLLA 2ESEA 4JV1A 2KOBA 3MGIA 2HOFA 3V7JA 3WKCA 1NI3A 4C7YA 3MDCA 4F4YA 1L7NA 5H2FU 1ZD4A 3GIIA 1N60A 4KX3A 8ICCA 1X9SA 9ICNA 3M9MB 4USAA 2R8GA 5DG9A 3QU4A 4Y2JA 2DQNB 1ZJMA 1KKXA 1UHUA 2AGOA 2WHEA 1P7DA 4ECZA 2OHFA 3T79A 4NLKA 4B9UA 3C2KA 4IR9A 1X9MA 2LM4A 3RH5A 1BPDA 3L5KA 1RYSA 3RH6A 2DPJA 3GZFA 4UATA 4YR3A 2FLLA 4DS5A 3RJKA 1F5SA 4ED1A 3EPGA 1S0VA 1LKYA 1SB3C 1NOMA 4Y2XA 2H3ZA 3V72A 3NASA 1S9FA 4KLJA 1ED1A 4ED7A 1NK4A 5KAFU 2I9GA 3KHRA 4ED0A 3KD3A 3PW0A 4UB8U 1TK8A 2ZXIA 5KT4A 4NLGA 2I6XA 3KHGA 4RPYA 5ALWA 2E8OA 2EAOA 4B9TA 1XU4A 4ELTA 1JUDA 4US9A 2W3SA 2FMPA 2IBKA 4I2JA 1JXEA 2YX8A 4DQQA 2VANA 2BCQA 5ALOA 4U6PA 4K4IA 2PFPA 3VCBA 8ICZA 4NY8A 3AN1A 4QZHA 1JI7A 2W03A 4CDGA 2NRVA 2O6KA 1ZQGA 1J2NA 3C28A 1UA0A 2YMQA 4P0QA 4P0QB 2EZZA 1SKRA 1LB2B 4UBBA 4UBCA 5D49A 3GDXA 3O0FA 2KIWA 1ZQMA 5L1KA 3HW8A 1S0NA 2AJQA 4KMUA 3F5AA 3NVYA 4XA5A 5J2FA 5ALIA 4R66A 4DO9A 5KG7A 2NV3A 2IOFK 2KHQA 1BPXA 4CF5A 3ETRA 2YMMA 5A0LA 1ZETA 5DB8A 2F1HA 2BPGA 5KFVA 3N4MB 4KTQA 1ZQUA 4BJQA 2LYAA 4I29A 1KRPA 2KIVA 4IRCA 8ICSA 5ALLA 2C2EA 4J9LA 4DOCA 3EZ5A 1BPEA 3G6XA 4RPZA 4OJLA 4R8UA 2MU2A 4R8UB 2WF7A 7ICQA 3K4GA 1Q8KA 4EBEA 3MFIA 3PO5A 2HVHA 5DDMA 3MFHA 1BVSA 5IILA 4C8MA 5D46A 3EPIA 4RQ8A 1T3QA 3NUQA 1SZPA 2LI6A 2FMSA 3UQ2A 2ZJ5A 2DWQA 1SZHA 4C8OA 4IC9A 4WJ3B 1XS9D 3IV6A 4G3IA 2HCFA 3D2NA 1M6YA 4RZRA 2WAQF 1KLNA 2ASDA 4Z6CA 2W7PA 3RB3A 4QZCA 8ICGA 4O3RA 3LYSA 5EOZA 1TAUA 3EWAA 4ELVA 5AKZA 4DLGA 2YB4A 1PUZA 4OJ5A 4MFFA 4AYBF 3JPQA 9ICRA 3QXGA 1TK5A 2H3QA 2QB1A 4I2IA 2OCEA 2F76X 1PVPA 2HI0A 2Y9TA 3OJSA 4F4ZA 4IQTA 5KG4A 3EUB2 2AGPA 1NKBA 1TAQA 4UB1A 5KFAA 4ED8A 4RNOA 4YD1A 5HHHA 1ZQ1C 2MUTA 1N48A 4I2DA 2MUTB 1N5XA 4KLFA 5KFZA 4M2YA 1ZQRA 1SKSA 1D8BA 3H40A 5KFPA 3PSIA 4J9SA 4C7ZA 4ZH4A 5HP4A 1X42A 4M9LA 2KFZA 2Y0SF 1IV8A 2C2RA 4O3QA 5CB1A 4F5NA 5DG8A 2XICA 2AQ0A 4ACOA 1MA7A 3RJFA 3S6JA 3GFKB 2PKEA 4ED3A 4ICAA 5D4BA 5IIKA 4DF4A 5AKKA 8ICAA 2JRZA 3DV9A 2RRDA 5AKJA 3SMVA 3OJUA 3V6KA 2KE7A 3PX0A 1YZ6A 1ZQBA 1RPLA 4EBCA 5KAIU 5IINA 2VA2A 3HWTA 2LPEA 2WFAA 1ZQYA 2MA1A 2KP7A 1N62A 3PX4A 1ECWA 1NJZA 1ZQNA 1UQVA 2F2AB 4O3OA 4CE6A 4UB2A 1UT8A 1QLNA 2FJ6A 4TUSA 1T3NA 4MEYA 4GFJA 3PMLA 4DLEA 2ZTDA 2FLNA 3QUQA 1F0MA 4FBTA 3I28A 3NS1A 5KFTA 2EDUA 5KT3A 2RDJA 1X9WA 2W04A 2KKVA 3M6ZA 3RJJA 1X66A 4C8KA 3TACB 3BQTA 4YXMA 1ZQVA 5EE9A 1SKWA 8ICLA 2HHVA 1SXEA 4CF4A 3QU2A 3C2LA 4Q43A 1JXLA 2ZIXA 4GC6A 1U4BA 2ZIXB 3KHHA 3Q8LA 7ICOA 3UMCA 1U48A 4O3PA 2NRWA 3BS7A 3RAQA 3LVWA 5ALZA 2IOHA 3KHLA 9ICEA 4US8A 2JEIA 1N2XA 2C28A 1T7PA 1ZJNA 5J0SA 4RUCA
chains in the Genus database with same CATH topology
2ZIVA 1L6NA 4KX5A 2XIDA 3F2BA 2ZIVB 2G5IB 2RRDA 3SMVA 3NUQA 1ED1A 2RHFA 2GH1A 4FZMA 2HBLA 2LBOA 2LKYA 4NLBA 3SQIA 4NWIA 1CRXA 2HOQA 2XI9A 1SZHA 2LHTA 2G08A 2ZXIA 4BX9C 2PMZF 2K8CB 4CGZA 4IC9A 3SAHA 1Z1BA 1F44A 2K4HA 2OH2A 1OUQA 3F2DA 4WJ3B 4QJFB 3SAFA 2G06A 2CRXA 3KFUF 5C0YA 2F8LA 4QIWF 2OYYA 2JHDA 2D6FC 2HBKA 3GU3A 4QIWC 2JH1A 2K4IA 3D2NA 3DEEA 1HIWA 2BDUA 2H3FA 2HBMA 2HMXA 2MA1A 2VIXA 3NRWA 3VC8A 4QNLA 1ECWA 2E5SA 2VKQA 3AL0B 2WAQF 2E1EA 2OM6A 2R18A 4P0PA 2F2AB 4P0PB 2YX8A 1A0PA 2CN1A 2WAQC 3KZXA 2VJ5A 2K8AA 2W7PA 1Z19A 2G5HB 4U6PA 2KJ8A 2KICA 3PSTA 3IP4B 4JMUA 1UPHA 3VCBA 3LYSA 3H0LB 3ICXA 2K4EA 2OXOA 2HBJA 4GFJA 1GO3F 2G09A 2KVCA 3IG5A 4FZLA 2Q4TA 2HOIA 4KMOB 4OJPA 2PMZC 5HR7A 3HKZF 2KNJA 2LYBA 2W03A 3F53A 2YB4A 3MGVA 3HKZC 2A3VA 4CDGA 2F77X 4OJ5A 4AYBF 2KV2A 2KHVA 1PVQA 3C28A 1KBUA 2H3QA 2XVTA 4AYBC 1HEKA 2JGAA 2G0AA 4P0QA 2KOBA 3IG8A 3OPXA 2F76X 4P0QB 2HOFA 4CRXA 2N1RA 1PVPA 1TAMA 2H3VA 1YT3A 2H3IA 3K1ZA 3D2SA 4PL1A 2W04A 4O3MA 2KKVA 2KIWA 3M6ZA 3O0FA 2Z7JA 2M0NA 4NLCA 3PZPA 3F5AA 3ALRA 3N7RC 1T94A 3LVVA 4KX3A 3F2CA 2ZXHA 3H0MB 5CRXA 2E1FA 3N7PD 3M6KA 2WB1F 3RFAA 2RP5A 2NV3A 3ONNA 2KHQA 2WB1C 1ZQ1C 4A8EA 2ZIUA 2JH7A 4BUGA 4FZNA 2ZIUB 4FE3A 2CPRA 3PSPA 2DQNB 1Q3UA 5KL1B 2ZIXA 3H0RB 5A0LA 1D8BA 2ZIXB 2G07A 3CRXA 2KKPA 2ZIWA 1P7DA 1URJA 2DF4B 2ZG6A 2ZIWB 3T79A 5HR6A 3D2QA 1Q3VA 3M7DA 4PL2A 3AQEA 3PSIA 4OJ6A 3RF9A 2LYAA 3N7SC 4BJQA 3IN5A 1XO0A 4NV0A 3E0FA 2KJ5A 1PVRA 2JMGA 3GZFA 3C29A 2Y0SF 2K89A 5KL8B 1WUDA 3AQFA 2K8BB 2Y0SC 4OO1J 2W7OA 1IIPA 3L3FX 3LVWA 4U7CA 3F5EA 2VJ4A 4OJOA 2KD1A 5T14A 1XNSA 3CP8A 3CYMA 3PSFA 4OJLA 4C0ZA 2XICA 1DRGA 2YB1A 2MRLA 1A6SA 4ACOA 1NZBA 1MA7A 3SAGA 2GOLA 2KEYA 2DGZA 4ICAA 2H3ZA 2KJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VC8 A;  3VCB A;  3GZF A; 
#chains in the Genus database with same CATH topology
 2JZB B;  5DGA A;  5J0X A;  1ZQK A;  2DUY A;  5AM4 A;  3OHB A;  5KFO A;  5KFH A;  1FIQ A;  7ICS A;  4J9N A;  2XI9 A;  4RQN A;  9ICV A;  1NK7 A;  5HHI A;  5L1I A;  1F44 A;  4QJF B;  3RB6 A;  1KDH A;  3K1R B;  2IA6 A;  3FC4 A;  3ISB A;  1ZD5 A;  4OCZ A;  3Q8P B;  1ZXI A;  3C21 A;  3NRW A;  1T8E A;  2R18 A;  1RYR A;  5BOM A;  4IQV A;  4YMM A;  2NRT A;  1BNO A;  2PFQ A;  5ALU A;  5J2G A;  4M9N A;  3ICX A;  2OXO A;  1GO3 F;  3TAR A;  5AM3 A;  4KMO B;  4PGY A;  3MR5 A;  2HHS A;  2BCU A;  3NTU A;  5DQG A;  4BWJ A;  2JZB A;  5DG7 A;  7ICI A;  3KZI U;  3M9N B;  3ISD A;  2N1R A;  3ORY A;  2BZF A;  2H3I A;  3KKA C;  2ZUB A;  4B9L A;  5J2H A;  4NLC A;  5F9L A;  1RG6 A;  1T94 A;  3F2C A;  4Y2S A;  2E1F A;  5CWR A;  4A8E A;  5L1M A;  8ICP A;  5ALD A;  4BUG A;  4FZN A;  2CPR A;  4DFM A;  3M9O B;  1ZQW A;  4KN4 A;  4EEL A;  4QW9 A;  2HW3 A;  4OJ6 A;  4DOB A;  3RJE A;  4ECT A;  3PW2 A;  5J29 A;  3HPO A;  2BGW A;  1L3U A;  4RQ6 A;  4DSJ A;  2XGP A;  5L1J A;  1NJW A;  1L3V A;  1XO1 A;  3WKA A;  1FFV A;  3SAG A;  3LK9 A;  2ALZ A;  2H5X A;  3FM9 A;  2UVR A;  4EEY A;  1UA1 A;  3BS5 A;  1BPY A;  4RQ1 A;  5KTQ A;  5JRT A;  3BZC A;  3H7I A;  2EQY A;  1KL9 A;  5AIA A;  2HHU A;  3SQI A;  4UAZ A;  1S97 A;  4EEN A;  2BCS A;  8ICR A;  2HDO A;  3KFU F;  9ICX A;  3BQ1 A;  2ODG A;  2F8L A;  2WTF A;  8ICW A;  2W9A A;  2JH1 A;  1HIW A;  2DKZ A;  3H8J A;  3CW2 C;  1DGJ A;  4EYH B;  3R9K A;  4P0P A;  5KFN A;  4P0P B;  2NRZ A;  3HT3 A;  2VJ5 A;  2A1J B;  3ZDA A;  5KFI A;  2JV3 A;  2KJ8 A;  2BKE A;  3HRD D;  4GXJ A;  3SV3 A;  7ICL A;  4F2R A;  2KVC A;  4F4X A;  4F8R A;  4TQS A;  2EAP A;  4IS7 A;  3RAX A;  1JMS A;  3T3F A;  5DLF A;  4KLM A;  4UB5 A;  1SL0 A;  4IR1 A;  2F3N A;  5ALH A;  2Y1J A;  3PZP A;  4Y2P A;  5III A;  5BOL A;  2WB1 F;  4J9O A;  3QEB Z;  3SD7 A;  4RT3 A;  4DEZ A;  2YY6 A;  4ZOH C;  3PSP A;  2ISP A;  3T5L A;  5KL1 B;  2RQ5 A;  1TVA A;  3E58 A;  1JIH A;  1D8L A;  2BQU A;  1MSW D;  2BPC A;  4TUR A;  1S77 D;  5KL8 B;  5KFE A;  4O0I A;  4IRD A;  2V4R A;  4I2F A;  3L3F X;  3PVX A;  2YMP A;  5KFX A;  3ED5 A;  1DRG A;  2EZX A;  1QCK A;  4Q44 A;  1X9X A;  5KFL A;  2QLT A;  2V4Q A;  4B9V A;  3FAH A;  4DSF A;  3G6Y A;  4FZM A;  3BQ2 A;  5ALG A;  1CRX A;  5GTH U;  5AKL A;  1NJX A;  3SAH A;  2OH2 A;  2KFN A;  2F1J A;  2OYY A;  2BR0 A;  2VIX A;  5J2K A;  4I2A A;  4R65 A;  4QNL A;  5AIB A;  1LKY B;  1Z3E B;  4ECS A;  1RZT A;  3MC1 A;  1DK3 A;  1Z19 A;  4MF8 A;  3B0Y A;  4Z6F A;  1UPH A;  2XY6 A;  2K4E A;  3V6J A;  4RU9 A;  4F93 B;  5CA7 A;  4M9H A;  2G09 A;  3IG5 A;  4Y2Y A;  2PMZ C;  3Q8Q B;  5HR7 A;  2FDR A;  2ZUD A;  3HKZ C;  4DQI A;  4EYI B;  3JPR A;  3MDA A;  2G0A A;  5EWE A;  4CRX A;  9ICU A;  1N5W A;  4KLQ A;  4ED2 A;  1YT3 A;  2BPF A;  8ICE A;  1V9P A;  1FO4 A;  5J2C A;  2A19 A;  1RXV A;  5BPC A;  3IM1 A;  2HHX A;  5KFG A;  3PW7 A;  3ONN A;  2IMW P;  3M1Y A;  4YVZ A;  2PI5 A;  5KFD A;  5F3X B;  2L5Y A;  3UXO A;  4C4R A;  1ZQL A;  4F72 A;  1AQ6 A;  3TFS A;  1C20 A;  2ZG6 A;  3BQ0 A;  3RR8 A;  3D2Q A;  1Q46 A;  3PW4 A;  1KFS A;  3AUO A;  4QWD A;  3C29 A;  1ZQH A;  4OO1 J;  1RQN A;  5KG6 A;  1VJ5 A;  4QZ8 A;  2B0C A;  4RQM A;  1QSL A;  3AM9 A;  4F50 A;  3OHA A;  5DB7 A;  5ALV A;  4O5C A;  4ECQ A;  7ICM A;  4DFJ A;  4KX5 A;  2XY5 A;  4JV2 A;  4F92 B;  5J2J A;  3WK6 A;  1ZYQ A;  4DQP A;  2XY7 A;  1S76 D;  2PMZ F;  1ZQO A;  4C80 A;  2HSZ A;  9ICK A;  1ARO P;  4YR2 A;  2D6F C;  3JPO A;  1NJY A;  2HHQ A;  1BGX T;  2BDU A;  3VC8 A;  2ISO A;  1A77 A;  2CN1 A;  5DBA A;  1JAL A;  1N63 A;  5KG5 A;  7ICF A;  4NM2 A;  3SV4 A;  4ECW A;  1MN8 A;  4FZL A;  4AP9 A;  4EX7 A;  2NO5 A;  5ALQ A;  2KMD A;  4Z6D A;  3N28 A;  4YMN A;  1TK0 A;  5CJ7 A;  2JR5 A;  1U49 A;  1VDV A;  5ALJ A;  5J0U A;  4F4W A;  4BGD A;  5GTI U;  2D8C A;  3RJH A;  3D2S A;  1ZQJ A;  2DPI A;  2P66 A;  2DFL A;  1NNL A;  5AKH A;  4KLG A;  4DS4 A;  5DB6 A;  3MR2 A;  4RQ0 A;  1D9F A;  3J81 j;  3QU7 A;  5HR6 A;  3N7S C;  1COK A;  3RB4 A;  3ZD8 A;  5KT5 A;  3Q8S B;  5KT7 A;  4DFP A;  4RPX A;  1C7Y A;  2ZJA A;  1ZOL A;  1SV4 A;  2MAX A;  2KD1 A;  4OJO A;  3WKB A;  5AI9 A;  4J9M A;  1N61 A;  2ZTC A;  1XSL A;  2UVV A;  4Y2V A;  4FS2 A;  3AU2 A;  4UQG A;  4Y2Q A;  4YD2 A;  1MC8 A;  2RHF A;  3H4B A;  2FI1 A;  3EW9 A;  1EXN A;  5AM1 A;  3THV A;  2K8C B;  3BJY A;  9ICT A;  4NL9 C;  8ICV A;  2EZY A;  3H4D A;  7ICV A;  1RM6 C;  4I28 A;  4KIT B;  4KLO A;  3QNM A;  4EX6 A;  3KTQ A;  5J2I A;  2HBJ A;  2KVS A;  3TQ1 A;  4ECU A;  2IHN A;  1JN3 A;  1HUO A;  4J9Q A;  2C22 A;  4RQ7 A;  1DOQ A;  5AKE A;  2KV2 A;  3AEV A;  1X2I A;  2Y9U A;  4C4S A;  4PZN A;  8ICF A;  2FPL A;  3KBB A;  2M9N A;  3TAN A;  2W9B A;  5J0O A;  2C2D A;  3ALR A;  2B21 A;  1LV5 A;  3RB0 A;  2ZXH A;  4R63 A;  9ICQ A;  9ICG A;  3N7P D;  2E8P A;  3BDP A;  1ZRM A;  1SWV A;  1WYG A;  4QW8 A;  2IOF A;  3H0R B;  1URJ A;  3RF9 A;  3IN5 A;  3Q8R B;  4O5K A;  3E0F A;  2OWO A;  4DSK A;  3DDH A;  2GLE A;  1ZD2 P;  3LWL A;  2P6U A;  3UPQ A;  3RBD A;  3SR6 A;  3GIL A;  1Z4N A;  3CP8 A;  1S10 A;  1NZB A;  4KN7 A;  1SL2 A;  4KLD A;  3SYZ A;  2ASL A;  1L7O A;  2KJ9 A;  2YN4 A;  1NK9 A;  1SL1 A;  5J0W A;  3HJE A;  1QTM A;  2HBL A;  1V97 A;  2P35 A;  1X6I A;  2EH9 A;  2LKY A;  5ALE A;  1VLB A;  4LZG A;  4CCH A;  4M9G A;  5KFB A;  4UB4 A;  3UXN A;  2R8I A;  5KG0 A;  5B66 U;  1CUK A;  2H3F A;  4UB3 A;  2W11 A;  2VKQ A;  2AXT U;  1WWV A;  5J0P A;  4Y2T A;  3WK8 A;  5KFY A;  2AU0 A;  2W9M A;  3D6J A;  2UVU A;  4J9P A;  4J9R A;  3MR6 A;  1NK6 A;  4F91 B;  3RTV A;  2Q4T A;  2HHW A;  4TUP A;  4KLS A;  3ZDB A;  2KNJ A;  2LYB A;  3EYZ A;  4RNN A;  3U26 A;  3MGV A;  2HHT A;  3JPN A;  3V7L A;  4JWN A;  7ICN A;  1Z4O A;  3WK7 A;  1TAM A;  4I2G A;  4KLT A;  4PL1 A;  2B6G A;  3V6H A;  3QEA Z;  9ICJ A;  1UCV A;  1XSP A;  4RT2 A;  5KT2 A;  5TZV A;  3MBY A;  3RFA A;  3ZDE A;  5AKG A;  4LZD A;  9ICF A;  7ICH A;  5TIS U;  4GLX A;  3PMN A;  2BCV A;  8ICN A;  4UAW A;  2K60 A;  2ZTE A;  3NVZ A;  4M6W A;  5HML A;  3JPT A;  4IRK A;  4M6W B;  1PVR A;  2JMG A;  4DFD A;  3KKA A;  7ICK A;  2K8B B;  4RQ3 A;  3K75 D;  1XNS A;  2HVI A;  3PSF A;  4P2H A;  4DL2 A;  3IHQ B;  1S0M A;  4NM1 A;  1TV9 A;  5KT6 A;  5AIC A;  1L6N A;  8ICH A;  5AHX A;  3TFR A;  3H8W A;  2HOQ A;  5E79 U;  3NGD A;  4YXJ A;  3F2D A;  2XO7 A;  2W55 A;  3NVV A;  5B5E U;  4EBD A;  3LWM A;  4Y2R A;  4QIW C;  4X5V A;  5F9N A;  3AU6 A;  1H38 A;  2F1I A;  5CR0 A;  3QUC A;  5DQI A;  4JV0 A;  4ELU A;  1A0P A;  1KFT A;  2UVW A;  3BS5 B;  4XRH A;  1RDF A;  5DDY A;  2CXY A;  3JPP A;  4YP3 A;  4IQU A;  2W8K A;  1JRP A;  4GXK A;  3ZDC A;  4B9N A;  3WK9 A;  5EWF A;  2AH5 A;  1IM4 A;  2AHO B;  1XWL A;  4QZD A;  2FPK A;  3T5H A;  1KTQ A;  5JU5 A;  4DL3 A;  1UT5 A;  5ALF A;  1X40 A;  4I2E A;  4EZ6 A;  4O3M A;  4B9M A;  7ICJ A;  5J2B A;  2Z7J A;  4Q8F A;  5CRX A;  3RH4 A;  3GIM A;  5AKI A;  1ZQI A;  2NO4 A;  7ICT A;  5DLG A;  4F4K A;  3TAP A;  2G07 A;  3CRX A;  3QUB A;  5C5J A;  1PZN A;  5AI8 A;  3ZI4 A;  1PK3 A;  3C23 A;  1O03 A;  4F5R A;  2DL0 A;  3PR5 B;  1TKD A;  4QZB A;  3ZDD A;  1T4G A;  3MAB A;  3SZ2 A;  2K89 A;  1S5L U;  5CP2 A;  5KFF A;  3T5J A;  2W7O A;  4KLI A;  3MR3 A;  2ATL A;  4OD0 A;  4HYK A;  1QQ7 A;  3GV5 B;  4TUQ A;  4M04 A;  2KTQ A;  2BCR A;  1U47 A;  2GH1 A;  4BXO A;  4QZI A;  3PV8 A;  4BXO B;  2E8M A;  2J6U A;  1DXS A;  4BWM A;  5EWG A;  2LYH A;  3C1Z A;  3Q8K A;  1RXW A;  2JHD A;  4LVS A;  1QH9 A;  2AGQ A;  3GV7 B;  4ECY A;  4ED6 A;  5AKX A;  2V9W A;  1L3T A;  5ALS A;  1CI4 A;  3KZX A;  8ICO A;  2DBY A;  1B0X A;  4UAV A;  5EE0 A;  2G5H B;  3QE9 Y;  3N97 B;  1B43 A;  3PST A;  9ICI A;  1NK8 A;  2PXI A;  4YMO A;  5AI6 A;  3QU5 A;  3L4P A;  5JUM A;  1PVQ A;  2ES6 A;  5J0Y A;  4CF3 A;  3IG8 A;  5J2E A;  1L8O A;  3SEN A;  5ALM A;  4K4G A;  4GXI A;  4MFA A;  2ZJ8 A;  3C5F A;  2PI4 A;  1SIJ A;  3N7R C;  2KK0 A;  5JTI A;  2W8L A;  4UW9 A;  4FO6 A;  2J6S A;  4PHA A;  3FYH A;  4LJX A;  1WCN A;  4DSL A;  2DF4 B;  7ICG A;  8ICX A;  4QZ9 A;  1XO0 A;  3GIK A;  4PH5 A;  2E3T A;  3LDA A;  2KJ5 A;  5AI0 A;  3RR7 A;  1WUD A;  3AQF A;  3H8M A;  1B22 A;  1LVH A;  1SV0 C;  1IIP A;  1SV0 A;  4C4T A;  4DWI A;  5T14 A;  2YB1 A;  5DGB A;  1TFR A;  2WF5 A;  5DBB A;  1YZ7 A;  2KEY A;  2WF6 A;  3RRG A;  3T5K A;  4DSE A;  3I1Y A;  4MF2 A;  1ZQA A;  5ALR A;  1ZQE A;  4K4H A;  3C5G A;  5KFS A;  2FE9 A;  9ICC A;  9ICL A;  4NLB A;  4GC7 A;  2QKQ A;  4CGZ A;  9ICB A;  2BQ3 A;  5KFC A;  2A1A A;  1L3S A;  2G06 A;  5C0Y A;  4C8L A;  2EAM A;  2ZUC A;  4Q8E A;  3GU3 A;  4UAR A;  1K5O A;  2VA3 A;  5CEH A;  2JEF A;  4Z6E A;  4PJ0 U;  1ZQQ A;  2WAQ C;  2WF9 A;  4DCC A;  2K8A A;  4FS1 A;  1ZQZ A;  7ICR A;  4PPX A;  3BQ7 A;  1HUZ A;  2F44 A;  2XC9 A;  3HKZ F;  1KQQ A;  3F53 A;  3BZK A;  1OXJ A;  4DF8 A;  4AYB C;  1HEK A;  2JGA A;  1WG8 A;  5EE1 A;  4YQW A;  4BDP A;  2H3V A;  4F5Q A;  1BPZ A;  5DB9 A;  3QUT A;  2I5H A;  1L8L A;  2JEG A;  5KFW A;  4QZA A;  4JB3 A;  4UB6 U;  1NZP A;  1KN5 A;  4YN4 A;  2XCP A;  1Z1V A;  3ISC A;  4I2H A;  1Q3U A;  4R64 A;  5ALT A;  2ZIW A;  2Q0Z X;  2ZIW B;  4P4M A;  4I2C A;  4PL2 A;  3AQE A;  2QB0 A;  3RRH A;  4KLE A;  2QB0 B;  1L7P A;  4F71 A;  2Y0S C;  2W43 A;  3TAD C;  2ASJ A;  2JXJ A;  5G5H A;  3TAD A;  9ICW A;  4C0Z A;  3C2M A;  3UMG A;  3WK5 A;  2PFO A;  2R8K A;  3WKD A;  5ALY A;  1FEZ A;  4NLZ A;  5ALK A;  5J0T A;  2ZIV A;  4KLH A;  2YML A;  4B9S A;  2ZIV B;  5KFM A;  1DK2 A;  3MGH A;  4RQ4 A;  4BX9 C;  1PK1 A;  5KNI A;  1PK1 B;  5AK5 A;  2K4H A;  1ZQT A;  5AM5 A;  2BHN A;  4PZO A;  4XUS A;  2CRX A;  1FFU A;  4PHE A;  1IG6 A;  4UAU A;  2HBK A;  1RYU A;  3DEE A;  2EAN A;  2YQE A;  5L1L A;  3AL0 B;  2BQR A;  3QZ8 A;  4IQW A;  1V85 A;  4DOA A;  5J8Y C;  5J8Y A;  5AK6 A;  3IP4 B;  5ALP A;  3UMB A;  4JUZ A;  2KSO A;  3H0L B;  1O08 A;  4O5E A;  2KSO B;  1COO A;  3OGU A;  5KG3 A;  2KZZ A;  4DL5 A;  4NL9 A;  3M8R A;  3C1Y A;  8ICY A;  3ETL A;  4HAI A;  5J2A A;  3PW5 A;  2E8N A;  1ZRN A;  3OSP A;  3K1Z A;  4J9K A;  2M0N A;  5KFQ A;  9ICM A;  3LVV A;  8ICI A;  4G9B A;  2F8K A;  5IIM A;  2RDI A;  4JWM A;  2RP5 A;  4RUA A;  5KFJ A;  2ZIU A;  2I1Q A;  2JH7 A;  2FPM A;  5KFR A;  2ZIU B;  1ZQD A;  4FE3 A;  4PGX A;  7ICU A;  3AMZ A;  8ICM A;  2W9C A;  2W9C B;  5AM2 A;  3M7D A;  1S8O A;  1A76 A;  4QWB A;  2W9B B;  8ICJ A;  1S0O A;  2GO7 A;  3PY8 A;  1B4F A;  4P4O A;  1L7M A;  2MRL A;  4MHV A;  1MQ3 A;  5FP0 A;  1KFD A;  3HIL A;  4FFD A;  2XGQ A;  4RQ2 A;  1K1S A;  1ZD3 A;  2XID A;  4M0A A;  2LMR A;  2G5I B;  3H8S A;  1SXD A;  1QQ5 A;  2LBO A;  2OEH A;  1J2M A;  8ICU A;  5K4L A;  1Z1B A;  4QWE A;  3SI8 A;  2BDP A;  3TI0 A;  4FBU A;  3QYP A;  7ICE A;  1XC9 A;  2HMX A;  2XCA A;  1ZQP A;  1QQ6 A;  9ICO A;  2KZ3 A;  4QZF A;  1QSY A;  1CEZ A;  3HX0 A;  3GIJ A;  5AK4 A;  4DL4 A;  4OJP A;  8ICT A;  3A0B U;  5AI4 A;  3TKA A;  1DGS A;  4MFC A;  2QAR A;  5AI5 A;  1KBU A;  4TQR A;  2QAR B;  1ZQF A;  4YR0 A;  2DKX A;  4EZ9 A;  5AM0 A;  3NVW A;  2FLP A;  3UXP A;  4P4P A;  4I27 A;  4DFK A;  1JX4 A;  4NLN A;  3B9J A;  5G5G A;  3H0M B;  1KEJ A;  3Q8M A;  3M6K A;  4NJ8 A;  3M8S A;  5ALN A;  5AKY A;  2W54 A;  3UQ0 A;  2D3D A;  4DL6 A;  4C8N A;  3IDW A;  4F2S A;  5AK3 A;  3WKE A;  2FMQ A;  4J03 A;  1Y88 A;  4ECX A;  4NV0 A;  3G6V A;  4QZG A;  3PX6 A;  4PHP A;  4KLU A;  4DSI A;  3IRU A;  4CNQ A;  7ICP A;  1NKE A;  2R8J A;  1D9D A;  3SEI A;  2VJ4 A;  1BNP A;  4PHD A;  3CYM A;  3NRZ A;  4UAY A;  2GWS A;  1U45 A;  1NKC A;  3PO4 A;  3OTQ A;  4B6J A;  4O3S A;  2RLT A;  1WWU A;  2KZM A;  4EEK A;  3JPS A;  4M9J A;  5DBC A;  4YCX A;  3GV8 B;  1JRO A;  5CHG A;  2JEJ A;  2LHT A;  2G08 A;  5L9X A;  2LM1 A;  2NYV A;  1OUQ A;  3SAF A;  3GQC A;  4RQ5 A;  2K4I A;  5KFK A;  2HBM A;  5HMM A;  4O9M A;  2E5S A;  2E1E A;  1V38 A;  2KN7 A;  8ICB A;  2W3R A;  1NK0 A;  3QZ7 A;  4IL6 U;  1OW5 A;  3E2E A;  2KIC A;  2WF8 A;  3KOO A;  5HNK A;  4YFK A;  2AQ4 A;  3PR4 A;  2HOI A;  5IIJ A;  2R8H A;  3I76 A;  2J6T A;  8ICK A;  3RJG A;  9ICA A;  4F3O A;  3OPX A;  1K1Q A;  2Y1I A;  1X6J A;  5KFU A;  2MSN A;  5EE3 A;  2IHM A;  4GIB A;  5J0R A;  2PFN A;  1TE2 A;  2WB1 C;  4MEX A;  4E0D A;  4QWC A;  3UM9 A;  4PGQ A;  4I2B A;  1WCL A;  3ZD9 A;  2KKP A;  5DKW A;  1Q3V A;  5ALX A;  3QX7 A;  5KG1 A;  9ICH A;  4RNM A;  5J2D A;  1KW4 A;  5J0Q A;  1MQ2 A;  1J97 A;  1IXR A;  3V7K A;  4Q45 A;  4ECV A;  1RQL A;  1Z00 A;  1Z00 B;  3RBE A;  4U7C A;  4M47 A;  4NXZ A;  3F5E A;  3OSN A;  2P6R A;  1XSN A;  8ICQ A;  2K4P A;  4XQ8 A;  1D8Y A;  2GOL A;  3FDS A;  4JK1 A;  2DGZ A;  3WK4 A;  3A0H U;  3TAQ A;  5IIO A;  1QSS A;  4DL7 A;  2A1J A;  1ZQC A;  3F2B A;  1HJP A;  1SGG A;  3CNH A;  4NWI A;  1L5U A;  2YTU A;  3B0X A;  4DQR A;  1SWW A;  1KSP A;  3PNC A;  1BPB A;  5KG2 A;  1U9L A;  4UAS A;  4QIW F;  1ZQS A;  9ICP A;  4QZE A;  1A6S A;  5DQH A;  2NRX A;  1NK5 A;  2VA8 A;  2OM6 A;  3RJI A;  4Y2U A;  4F5P A;  4YG2 A;  3WU2 U;  4DQS A;  4JMU A;  3QU9 A;  1ZQX A;  4O3N A;  4ECR A;  4F5O A;  3HP6 A;  1N56 A;  2A3V A;  2KG5 A;  9ICS A;  4QWA A;  2F77 X;  2KHV A;  2XVT A;  4KLL A;  2ESE A;  4JV1 A;  2KOB A;  3MGI A;  2HOF A;  3V7J A;  3WKC A;  1NI3 A;  4C7Y A;  3MDC A;  4F4Y A;  1L7N A;  5H2F U;  1ZD4 A;  3GII A;  1N60 A;  4KX3 A;  8ICC A;  1X9S A;  9ICN A;  3M9M B;  4USA A;  2R8G A;  5DG9 A;  3QU4 A;  4Y2J A;  2DQN B;  1ZJM A;  1KKX A;  1UHU A;  2AGO A;  2WHE A;  1P7D A;  4ECZ A;  2OHF A;  3T79 A;  4NLK A;  4B9U A;  3C2K A;  4IR9 A;  1X9M A;  2LM4 A;  3RH5 A;  1BPD A;  3L5K A;  1RYS A;  3RH6 A;  2DPJ A;  3GZF A;  4UAT A;  4YR3 A;  2FLL A;  4DS5 A;  3RJK A;  1F5S A;  4ED1 A;  3EPG A;  1S0V A;  1LKY A;  1SB3 C;  1NOM A;  4Y2X A;  2H3Z A;  3V72 A;  3NAS A;  1S9F A;  4KLJ A;  1ED1 A;  4ED7 A;  1NK4 A;  5KAF U;  2I9G A;  3KHR A;  4ED0 A;  3KD3 A;  3PW0 A;  4UB8 U;  1TK8 A;  2ZXI A;  5KT4 A;  4NLG A;  2I6X A;  3KHG A;  4RPY A;  5ALW A;  2E8O A;  2EAO A;  4B9T A;  1XU4 A;  4ELT A;  1JUD A;  4US9 A;  2W3S A;  2FMP A;  2IBK A;  4I2J A;  1JXE A;  2YX8 A;  4DQQ A;  2VAN A;  2BCQ A;  5ALO A;  4U6P A;  4K4I A;  2PFP A;  3VCB A;  8ICZ A;  4NY8 A;  3AN1 A;  4QZH A;  1JI7 A;  2W03 A;  4CDG A;  2NRV A;  2O6K A;  1ZQG A;  1J2N A;  3C28 A;  1UA0 A;  2YMQ A;  4P0Q A;  4P0Q B;  2EZZ A;  1SKR A;  1LB2 B;  4UBB A;  4UBC A;  5D49 A;  3GDX A;  3O0F A;  2KIW A;  1ZQM A;  5L1K A;  3HW8 A;  1S0N A;  2AJQ A;  4KMU A;  3F5A A;  3NVY A;  4XA5 A;  5J2F A;  5ALI A;  4R66 A;  4DO9 A;  5KG7 A;  2NV3 A;  2IOF K;  2KHQ A;  1BPX A;  4CF5 A;  3ETR A;  2YMM A;  5A0L A;  1ZET A;  5DB8 A;  2F1H A;  2BPG A;  5KFV A;  3N4M B;  4KTQ A;  1ZQU A;  4BJQ A;  2LYA A;  4I29 A;  1KRP A;  2KIV A;  4IRC A;  8ICS A;  5ALL A;  2C2E A;  4J9L A;  4DOC A;  3EZ5 A;  1BPE A;  3G6X A;  4RPZ A;  4OJL A;  4R8U A;  2MU2 A;  4R8U B;  2WF7 A;  7ICQ A;  3K4G A;  1Q8K A;  4EBE A;  3MFI A;  3PO5 A;  2HVH A;  5DDM A;  3MFH A;  1BVS A;  5IIL A;  4C8M A;  5D46 A;  3EPI A;  4RQ8 A;  1T3Q A;  3NUQ A;  1SZP A;  2LI6 A;  2FMS A;  3UQ2 A;  2ZJ5 A;  2DWQ A;  1SZH A;  4C8O A;  4IC9 A;  4WJ3 B;  1XS9 D;  3IV6 A;  4G3I A;  2HCF A;  3D2N A;  1M6Y A;  4RZR A;  2WAQ F;  1KLN A;  2ASD A;  4Z6C A;  2W7P A;  3RB3 A;  4QZC A;  8ICG A;  4O3R A;  3LYS A;  5EOZ A;  1TAU A;  3EWA A;  4ELV A;  5AKZ A;  4DLG A;  2YB4 A;  1PUZ A;  4OJ5 A;  4MFF A;  4AYB F;  3JPQ A;  9ICR A;  3QXG A;  1TK5 A;  2H3Q A;  2QB1 A;  4I2I A;  2OCE A;  2F76 X;  1PVP A;  2HI0 A;  2Y9T A;  3OJS A;  4F4Z A;  4IQT A;  5KG4 A;  3EUB 2;  2AGP A;  1NKB A;  1TAQ A;  4UB1 A;  5KFA A;  4ED8 A;  4RNO A;  4YD1 A;  5HHH A;  1ZQ1 C;  2MUT A;  1N48 A;  4I2D A;  2MUT B;  1N5X A;  4KLF A;  5KFZ A;  4M2Y A;  1ZQR A;  1SKS A;  1D8B A;  3H40 A;  5KFP A;  3PSI A;  4J9S A;  4C7Z A;  4ZH4 A;  5HP4 A;  1X42 A;  4M9L A;  2KFZ A;  2Y0S F;  1IV8 A;  2C2R A;  4O3Q A;  5CB1 A;  4F5N A;  5DG8 A;  2XIC A;  2AQ0 A;  4ACO A;  1MA7 A;  3RJF A;  3S6J A;  3GFK B;  2PKE A;  4ED3 A;  4ICA A;  5D4B A;  5IIK A;  4DF4 A;  5AKK A;  8ICA A;  2JRZ A;  3DV9 A;  2RRD A;  5AKJ A;  3SMV A;  3OJU A;  3V6K A;  2KE7 A;  3PX0 A;  1YZ6 A;  1ZQB A;  1RPL A;  4EBC A;  5KAI U;  5IIN A;  2VA2 A;  3HWT A;  2LPE A;  2WFA A;  1ZQY A;  2MA1 A;  2KP7 A;  1N62 A;  3PX4 A;  1ECW A;  1NJZ A;  1ZQN A;  1UQV A;  2F2A B;  4O3O A;  4CE6 A;  4UB2 A;  1UT8 A;  1QLN A;  2FJ6 A;  4TUS A;  1T3N A;  4MEY A;  4GFJ A;  3PML A;  4DLE A;  2ZTD A;  2FLN A;  3QUQ A;  1F0M A;  4FBT A;  3I28 A;  3NS1 A;  5KFT A;  2EDU A;  5KT3 A;  2RDJ A;  1X9W A;  2W04 A;  2KKV A;  3M6Z A;  3RJJ A;  1X66 A;  4C8K A;  3TAC B;  3BQT A;  4YXM A;  1ZQV A;  5EE9 A;  1SKW A;  8ICL A;  2HHV A;  1SXE A;  4CF4 A;  3QU2 A;  3C2L A;  4Q43 A;  1JXL A;  2ZIX A;  4GC6 A;  1U4B A;  2ZIX B;  3KHH A;  3Q8L A;  7ICO A;  3UMC A;  1U48 A;  4O3P A;  2NRW A;  3BS7 A;  3RAQ A;  3LVW A;  5ALZ A;  2IOH A;  3KHL A;  9ICE A;  4US8 A;  2JEI A;  1N2X A;  2C28 A;  1T7P A;  1ZJN A;  5J0S A;  4RUC A; 
#chains in the Genus database with same CATH homology
 2ZIV A;  1L6N A;  4KX5 A;  2XID A;  3F2B A;  2ZIV B;  2G5I B;  2RRD A;  3SMV A;  3NUQ A;  1ED1 A;  2RHF A;  2GH1 A;  4FZM A;  2HBL A;  2LBO A;  2LKY A;  4NLB A;  3SQI A;  4NWI A;  1CRX A;  2HOQ A;  2XI9 A;  1SZH A;  2LHT A;  2G08 A;  2ZXI A;  4BX9 C;  2PMZ F;  2K8C B;  4CGZ A;  4IC9 A;  3SAH A;  1Z1B A;  1F44 A;  2K4H A;  2OH2 A;  1OUQ A;  3F2D A;  4WJ3 B;  4QJF B;  3SAF A;  2G06 A;  2CRX A;  3KFU F;  5C0Y A;  2F8L A;  4QIW F;  2OYY A;  2JHD A;  2D6F C;  2HBK A;  3GU3 A;  4QIW C;  2JH1 A;  2K4I A;  3D2N A;  3DEE A;  1HIW A;  2BDU A;  2H3F A;  2HBM A;  2HMX A;  2MA1 A;  2VIX A;  3NRW A;  3VC8 A;  4QNL A;  1ECW A;  2E5S A;  2VKQ A;  3AL0 B;  2WAQ F;  2E1E A;  2OM6 A;  2R18 A;  4P0P A;  2F2A B;  4P0P B;  2YX8 A;  1A0P A;  2CN1 A;  2WAQ C;  3KZX A;  2VJ5 A;  2K8A A;  2W7P A;  1Z19 A;  2G5H B;  4U6P A;  2KJ8 A;  2KIC A;  3PST A;  3IP4 B;  4JMU A;  1UPH A;  3VCB A;  3LYS A;  3H0L B;  3ICX A;  2K4E A;  2OXO A;  2HBJ A;  4GFJ A;  1GO3 F;  2G09 A;  2KVC A;  3IG5 A;  4FZL A;  2Q4T A;  2HOI A;  4KMO B;  4OJP A;  2PMZ C;  5HR7 A;  3HKZ F;  2KNJ A;  2LYB A;  2W03 A;  3F53 A;  2YB4 A;  3MGV A;  3HKZ C;  2A3V A;  4CDG A;  2F77 X;  4OJ5 A;  4AYB F;  2KV2 A;  2KHV A;  1PVQ A;  3C28 A;  1KBU A;  2H3Q A;  2XVT A;  4AYB C;  1HEK A;  2JGA A;  2G0A A;  4P0Q A;  2KOB A;  3IG8 A;  3OPX A;  2F76 X;  4P0Q B;  2HOF A;  4CRX A;  2N1R A;  1PVP A;  1TAM A;  2H3V A;  1YT3 A;  2H3I A;  3K1Z A;  3D2S A;  4PL1 A;  2W04 A;  4O3M A;  2KKV A;  2KIW A;  3M6Z A;  3O0F A;  2Z7J A;  2M0N A;  4NLC A;  3PZP A;  3F5A A;  3ALR A;  3N7R C;  1T94 A;  3LVV A;  4KX3 A;  3F2C A;  2ZXH A;  3H0M B;  5CRX A;  2E1F A;  3N7P D;  3M6K A;  2WB1 F;  3RFA A;  2RP5 A;  2NV3 A;  3ONN A;  2KHQ A;  2WB1 C;  1ZQ1 C;  4A8E A;  2ZIU A;  2JH7 A;  4BUG A;  4FZN A;  2ZIU B;  4FE3 A;  2CPR A;  3PSP A;  2DQN B;  1Q3U A;  5KL1 B;  2ZIX A;  3H0R B;  5A0L A;  1D8B A;  2ZIX B;  2G07 A;  3CRX A;  2KKP A;  2ZIW A;  1P7D A;  1URJ A;  2DF4 B;  2ZG6 A;  2ZIW B;  3T79 A;  5HR6 A;  3D2Q A;  1Q3V A;  3M7D A;  4PL2 A;  3AQE A;  3PSI A;  4OJ6 A;  3RF9 A;  2LYA A;  3N7S C;  4BJQ A;  3IN5 A;  1XO0 A;  4NV0 A;  3E0F A;  2KJ5 A;  1PVR A;  2JMG A;  3GZF A;  3C29 A;  2Y0S F;  2K89 A;  5KL8 B;  1WUD A;  3AQF A;  2K8B B;  2Y0S C;  4OO1 J;  2W7O A;  1IIP A;  3L3F X;  3LVW A;  4U7C A;  3F5E A;  2VJ4 A;  4OJO A;  2KD1 A;  5T14 A;  1XNS A;  3CP8 A;  3CYM A;  3PSF A;  4OJL A;  4C0Z A;  2XIC A;  1DRG A;  2YB1 A;  2MRL A;  1A6S A;  4ACO A;  1NZB A;  1MA7 A;  3SAG A;  2GOL A;  2KEY A;  2DGZ A;  4ICA A;  2H3Z A;  2KJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...