3GZFA

Structure of the c-terminal domain of nsp4 from feline coronavirus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
GLFEGDKFVGSFESAAMGTFVIDMRSYETLVNSTSLDRIKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVSRNDKLYTPPTVSVNSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal domain of nsp4 from feline coronavirus
pubmed doi rcsb
source organism Feline coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 27
structure length 96
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3gzfA00
3VCBA 3VC8A 3GZFA
chains in the Genus database with same CATH superfamily
4F5PA 4F2RA 3HILA 1BNOA 1L7PA 2D3DA 4DF4A 4ECUA 2LYHA 4HAIA 5J0YA 5J0QA 3I76A 4DFDA 4O3SA 1JALA 2VJ4A 9ICKA 5CR0A 4NLZA 3C5FA 4ED2A 4EZ9A 4KLFA 5HHIA 2XICA 3PSFA 4F8RA 3RR7A 2HOFA 3QE9Y 4C8KA 1UQVA 2KKVA 7ICIA 2W11A 2ZTDA 4DQSA 4ED7A 4F2SA 2KK0A 2V4RA 3WK8A 5ALMA 2HI0A 3JPNA 4YVZA 3GIIA 4CGZA 5AIAA 2GO7A 2WB1F 4TUPA 3ISBA 4UB2A 4Z6DA 2HBMA 4KX5A 4B9UA 2EZYA 3H8MA 3N7RC 4F93B 4GFJA 3D2NA 5KFHA 1Y88A 1UHUA 3BS5A 2KVSA 4ECSA 3RB0A 2WF7A 4J9MA 1L8LA 5AKKA 4JWMA 3ETRA 3SV4A 3JPOA 2Q0ZX 4ELTA 4UASA 5EE0A 4TURA 5CB1A 1X66A 1ZJNA 4BXOA 5DKWA 4IQWA 9ICRA 5JUMA 1DXSA 4UBCA 3MBYA 3SYZA 5DB8A 3PX6A 2LYAA 3TQ1A 1N5WA 5C0YA 1T3NA 3JPRA 1O08A 3KOOA 2DQNB 2R8HA 4DSJA 4B9SA 4KLEA 2HSZA 1L7NA 5AK6A 2NV3A 2XIDA 4BUGA 1X9WA 2K89A 2G5HB 1VDVA 3WK5A 2IOHA 5ALHA 3QU4A 4EYIB 3VC8A 4YXMA 4Q8EA 8ICBA 2E8PA 1Z3EB 4Y2JA 3V7JA 1Z00B 4I2AA 1SKSA 4DSIA 2CPRA 1N2XA 5J2KA 1ZQHA 4UARA 3RFAA 4CF3A 4BWMA 5KFDA 2KICA 1JROA 3RJIA 2QB0B 1RXWA 2I1QA 4O5EA 4E0DA 3WK9A 1X9SA 2L5YA 3BQ1A 4KTQA 2NO4A 2LM1A 4RPXA 2AU0A 1U4BA 1S10A 5IIOA 2NRXA 2F1HA 4I2EA 5J0PA 3Q8MA 5JRTA 4LJXA 1SL2A 4TUSA 1IV8A 4RT2A 1ZQNA 4YG2A 5EE3A 3PO5A 4YMNA 1EXNA 3ETLA 5H2FU 4NL9C 4Z6FA 9ICXA 4O3MA 2FPLA 3HRDD 1C7YA 1RPLA 4DS5A 1S8OA 2W8LA 5KT4A 4JV1A 1RDFA 1WCLA 3M9OB 4RUAA 3T5KA 1QQ6A 4NV0A 3GU3A 4XA5A 3GDXA 1XC9A 5G5GA 5DQHA 2KFZA 2H3FA 4EBCA 5ALEA 2ZJ8A 4NLCA 1DRGA 2PFNA 5KFQA 5KT2A 3RJFA 5L1MA 1ZOLA 2DPIA 3H7IA 2KEYA 5J0XA 4MFCA 5AKLA 2LI6A 2HHUA 2G06A 5J0SA 3PO4A 5B66U 5T14A 9ICLA 3C21A 4FS2A 4ED3A 2FMQA 4QZBA 4F5QA 1ZQQA 1RYSA 2NYVA 1T8EA 1QSYA 5AM2A 1KL9A 5TZVA 4JV2A 5TISU 2HOQA 5DDYA 2PKEA 2AJQA 4XQ8A 2OHFA 4DF8A 2XY5A 5CJ7A 4YXJA 3PNCA 1XSLA 1KFSA 3C1YA 1HUOA 4OJPA 4PH5A 4PHDA 8ICQA 2G07A 3L5KA 5KNIA 4QWAA 4DFPA 2NRTA 4ECQA 4OJOA 3TADC 1JMSA 3UPQA 3Q8LA 1CUKA 1BPXA 1PVPA 4B9LA 5KFUA 1QQ5A 3KHLA 5KFNA 1S77D 5AKEA 3UXNA 3RBEA 2BDUA 2KJ5A 4I29A 5D46A 2DWQA 7ICLA 4ELUA 5KAIU 4C8OA 2PMZF 4C8MA 3CYMA 4PL1A 3KZIU 1KKXA 2F8KA 2W03A 4BJQA 5KFMA 5AK5A 2I9GA 5ALLA 5KFEA 5KFOA 2DF4B 2BCRA 1JI7A 1DOQA 2XGQA 2KSOA 4JB3A 4I27A 4RQ8A 4G9BA 3MC1A 3MR5A 5DB7A 1AROP 4Y2SA 3N7PD 5KG1A 4UB5A 1JRPA 1ZQGA 2EH9A 2IOFA 2QLTA 1FIQA 3OPXA 2FLLA 4ED6A 3MR2A 3RJJA 4IL6U 4YFKA 3FM9A 4UB8U 1SWVA 1P7DA 4USAA 4ECWA 2KG5A 2KIWA 1NK8A 1BPZA 2K4HA 3EUB2 5KFIA 7ICEA 3KFUF 1X6JA 1SL0A 1V85A 2NRZA 5J2DA 2KVCA 1IIPA 5L9XA 3T79A 4ICAA 1TVAA 1Q3VA 2WF5A 5DG9A 4CF5A 3UXPA 2HHXA 4J9NA 1XO0A 4QZAA 1FO4A 4F71A 4XRHA 3K75D 1NK6A 3F53A 2KD1A 4CRXA 5J8YC 3RJEA 3SQIA 2RDIA 3C2KA 4UAUA 4M9GA 8ICJA 3RB3A 4FBUA 3KHHA 2M9NA 3F5EA 1ZQTA 1NK4A 3C1ZA 2LHTA 5CWRA 3SR6A 3GFKB 1A6SA 5KFAA 7ICRA 2H3ZA 3C23A 4IQTA 3TFSA 3PSPA 5HP4A 2FI1A 4GXKA 4M2YA 5IIIA 3ICXA 2M0NA 1NKEA 3TANA 2DPJA 1O03A 1PK1A 4DSEA 5AI9A 5DLGA 1JN3A 4GXIA 3UXOA 4IRDA 1S0VA 3JPQA 1CI4A 2PFOA 4I2BA 4OJ5A 5KT6A 1S76D 4HYKA 1NK0A 2WAQC 2WF6A 3RAQA 4UAYA 1L7MA 3BQ7A 3WK6A 2K4EA 3SAGA 2JH1A 1NZPA 3LDAA 5KFXA 1KW4A 2JR5A 3N7SC 1NJWA 3GILA 5L1IA 8ICKA 5CP2A 4QIWF 1T4GA 2G5IB 3NTUA 2K8AA 5DBCA 1M6YA 2W9BA 2W9CA 2PMZC 1BVSA 4P4MA 3AEVA 1Q3UA 4YN4A 2H3VA 4F91B 4J9KA 2F3NA 1NK9A 3RRHA 1F44A 3THVA 3GV7B 4C8LA 4J9SA 3BZKA 3SEIA 2R8JA 3SENA 1A0PA 4X5VA 2JRZA 4QW8A 4NJ8A 7ICUA 2KNJA 3H8SA 1TV9A 2ZG6A 3K1ZA 3Q8QB 4B9VA 1Z00A 1ZQDA 5F9LA 2HW3A 2YB1A 2IOFK 3H0LB 3BS7A 4IR1A 1KFTA 1ZD3A 5KFJA 8ICWA 4M9JA 9ICAA 2HBKA 1J2MA 4F5OA 2DUYA 3TADA 5J2CA 3G6YA 1JUDA 5KAFU 5KFBA 1B43A 2C2DA 5ALFA 1KEJA 2ISPA 8ICYA 2MRLA 5J2EA 4Z6EA 1U48A 4M9HA 2UVVA 4ECVA 4I2HA 3QUCA 3FYHA 4M9LA 9ICJA 1MSWD 5KG5A 2KOBA 5DLFA 3ZD8A 4DQQA 7ICNA 2MU2A 3FC4A 2NRWA 2YMLA 3JPPA 4M0AA 4KLTA 4RNOA 4QZIA 9ICBA 2BKEA 2VJ5A 4NLBA 4Y2YA 8ICGA 2XCAA 1BPBA 3GZFA 5KFYA 1QH9A 4FZLA 1ZXIA 2E8MA 1YZ6A 1PVQA 4NM2A 1PVRA 3MABA 3PZPA 1KN5A 3D6JA 4PGXA 2LM4A 3V6JA 3E58A 3WKAA 5A0LA 4PZOA 4PGQA 1KFDA 2JZBB 4KN4A 4QWCA 5AI8A 1HEKA 4LZGA 4MHVA 1GO3F 1CEZA 3UMCA 5J0UA 1TAUA 3F2CA 1L3UA 4KLSA 1DGSA 3F2BA 4YMMA 1ZQXA 4C80A 1N5XA 4GIBA 3AL0B 5EE9A 1NNLA 5J29A 3RJHA 4OD0A 3U26A 4R8UA 2FJ6A 3EWAA 3PW4A 4EENA 2P35A 5ALDA 4FBTA 7ICJA 2XGPA 2W04A 1ZETA 3UMBA 4QZHA 3BQ2A 2HBLA 1NK5A 3K4GA 4IQVA 4J9PA 1UT8A 5KFGA 4GC7A 1ZQRA 3KTQA 3AUOA 2IBKA 2DKZA 3OGUA 3KKAA 3NVZA 2AGOA 1LV5A 1DK3A 3ZDDA 2UVRA 5DB6A 2BR0A 4QJFB 8ICEA 4QWEA 2E5SA 9ICGA 4CNQA 4RPYA 3ZDAA 3KKAC 2W9AA 4FZMA 1NJXA 3NUQA 9ICHA 3MFIA 3O0FA 2KV2A 5DG8A 5K4LA 1ZQVA 5KG7A 3JPSA 3M1YA 2LBOA 2H3IA 2K8BB 3SI8A 4DLEA 1XS9D 1JX4A 5J0RA 3QUTA 3EZ5A 3HJEA 3KZXA 4EBDA 1X42A 4RQ2A 7ICVA 4P0QA 2ZXHA 5ALIA 1ZQEA 2EAMA 4ED8A 4NM1A 2MA1A 4R66A 1A76A 3BQTA 4Y2VA 3Q8PB 2N1RA 2R8KA 2RP5A 5JTIA 5CA7A 4C0ZA 2ZUCA 3M7DA 3C28A 1SL1A 5IINA 3HW8A 5AICA 2ZIXB 5GTIU 2JEIA 3DEEA 4KN7A 4Y2PA 4F4KA 3ISDA 4NLNA 5EOZA 4DL7A 2YTUA 2KHQA 4Y2RA 4KLIA 1ZQMA 5CHGA 1S0OA 5IIKA 1ZD4A 1TKDA 2YMPA 4FZNA 4DQIA 1L5UA 4KITB 4O3RA 4Q44A 3MR3A 2I5HA 2ZUBA 3NRWA 3S6JA 5ALZA 4JWNA 5KFCA 3PMNA 2F2AB 4JV0A 2W55A 3H0MB 2JEFA 1K5OA 5J2IA 4NXZA 2OCEA 1U49A 1SZPA 2W54A 3H4BA 2G09A 3QU7A 4C8NA 1WWUA 4QW9A 3CW2C 1FFVA 8ICVA 1T7PA 2WAQF 5AKYA 2BPGA 2KE7A 2BZFA 3N4MB 2ZIWA 4RQ7A 1YZ7A 2EAOA 5KFFA 4J9LA 1L3VA 3OHAA 5KG2A 2VKQA 4U7CA 2NO5A 3C2MA 7ICQA 3WKCA 1ZJMA 3L3FX 3ED5A 4Q43A 1BNPA 2FPKA 2F76X 4M47A 2OM6A 3IRUA 2KTQA 1A77A 2HOIA 4UB6U 4J9QA 3FAHA 5HMMA 4K4HA 2EQYA 3NVYA 2UVUA 2A19A 1MQ3A 4DL5A 1T3QA 3IM1A 4J03A 3Q8KA 2HMXA 3LYSA 4B9MA 1SKRA 5BOMA 3PW7A 3IDWA 2R18A 2KFNA 1K1SA 2JMGA 1V9PA 1X9MA 2K8CB 3WKBA 4YCXA 2LYBA 2BCVA 1J2NA 1XWLA 1C20A 1N56A 4F92B 3PSIA 2F44A 2WFAA 1JXEA 4RT3A 4OCZA 3WKDA 5DGBA 2DBYA 2HHSA 2Y9UA 4QZ9A 3T3FA 4DFKA 5DGAA 3TARA 8ICZA 3QU9A 4F4ZA 2E1EA 2KIVA 3GIJA 4KLMA 1X6IA 5IILA 7ICOA 4P0PB 4P4PA 4Y2TA 3V72A 3ORYA 1X9XA 4IC9A 3JPTA 3KBBA 4JUZA 1KSPA 3SMVA 3KD3A 5ALUA 4OO1J 2HHTA 3H8JA 3HKZC 4EBEA 4GC6A 4IR9A 2MUTA 3RAXA 2H5XA 3I1YA 2W8KA 5DQIA 2KN7A 3BDPA 4RQ4A 1ZQZA 8ICRA 5AM3A 7ICKA 2A3VA 4Y2XA 5AM0A 2F1IA 5AIBA 5CEHA 2WB1C 1MA7A 8ICLA 1UT5A 5KL1B 4PJ0U 2XY6A 3QNMA 3EPIA 4R64A 2D8CA 5HMLA 3C5GA 3PV8A 8ICTA 1ZD5A 1ZQOA 2W9CB 2W9BB 5KFLA 1SZHA 4C4SA 4I2GA 4RQ3A 7ICSA 5EE1A 3RRGA 5EWEA 2QKQA 4I2CA 4NLGA 2DKXA 5ALWA 1L8OA 1COKA 3NRZA 2IA6A 4EYHB 3N97B 1SXEA 5J2JA 2BDPA 4RPZA 1FEZA 2YQEA 1WCNA 3TKAA 1ZQWA 3PX0A 5KFWA 4UB4A 2ZIUA 2R8GA 3Q8SB 2F77X 4KLDA 5BPCA 3OSPA 3TI0A 1U47A 5D4BA 5J2FA 3T5HA 1L3TA 2XVTA 5HNKA 3C2LA 3DV9A 1V38A 3AN1A 7ICHA 4BGDA 3MDCA 9ICPA 1KQQA 5GTHU 3RR8A 1UCVA 1Z19A 3DDHA 1MQ2A 4Z6CA 4MEYA 3RB4A 2KZZA 1PUZA 2PXIA 3QUQA 4JMUA 4YQWA 2HHQA 4PPXA 3HX0A 1BPYA 8ICFA 9ICTA 2OXOA 5L1JA 1U9LA 2A1JB 3PSTA 3RF9A 2R8IA 2EAPA 3LK9A 4DL4A 1XSNA 2VA8A 4EX6A 8ICHA 3K1RB 2I6XA 3G6VA 1WG8A 4I28A 1SV0C 4C7ZA 1N62A 3OTQA 4DFJA 1N63A 1MN8A 4O9MA 1QQ7A 3LWMA 3D2QA 2W7OA 2FLPA 3NASA 3WK4A 1WWVA 1RG6A 2MAXA 3GIMA 4DO9A 3EPGA 4M9NA 1KTQA 2YY6A 2ZIVA 4UBBA 2B21A 2ASDA 1NOMA 2AGQA 8ICIA 2BCSA 4P2HA 2BCUA 1X40A 1N48A 1V97A 4F3OA 2V9WA 1AQ6A 9ICUA 4YR0A 5ALVA 1ECWA 1XO1A 4O3QA 1QSSA 2ZTCA 1SV0A 4UB3A 1ZQBA 4QZGA 2OEHA 4RQMA 1D8LA 5CRXA 4F72A 4TQRA 1IM4A 1D9FA 3M8RA 4UB1A 2JH7A 2XC9A 4DL6A 5J2GA 3AU6A 5DQGA 4KX3A 1RYRA 3N28A 1ZQFA 5KFPA 2XO7A 2AGPA 4DL3A 1TK8A 4QZDA 3PR4A 4Q8FA 1NK7A 2LPEA 5KG4A 2B6GA 1S0MA 1QCKA 8ICMA 3MGIA 3KHRA 3Q8RB 1S0NA 1S9FA 1DK2A 1XNSA 4YD2A 2FMPA 2WF9A 4RQ5A 1KLNA 1ZQAA 4M6WB 2YMMA 3IG8A 2WTFA 4FO6A 8ICSA 4NWIA 2ASJA 4DL2A 1OW5A 4O0IA 4DQPA 1B0XA 4F4YA 4M04A 4DCCA 3PR5B 1VJ5A 2BQUA 9ICQA 5ALTA 3PX4A 4ECZA 5J0OA 4J9RA 5KL8B 2DL0A 2KSOB 2W9MA 4ZOHC 2H3QA 2KZ3A 3HP6A 3ZI4A 2CRXA 5ALRA 5EWGA 2O6KA 2ZIUB 2K4PA 4DOCA 1ZYQA 4MFFA 1DGJA 5AM5A 3ZDBA 4BX9C 5ALJA 3UM9A 1HJPA 4PL2A 4F5NA 2YN4A 2RHFA 2JGAA 4F4XA 3J81j 3E2EA 4IRKA 7ICMA 4PHEA 4RZRA 4CF4A 1Z4OA 2PFQA 5DB9A 1TK0A 3RJGA 3NGDA 5AKZA 1ZQ1C 1JXLA 2P6UA 3CRXA 8ICAA 9ICCA 1ZQLA 3IV6A 4BWJA 5ALKA 1MC8A 4KLUA 2G08A 4ECRA 3QXGA 3RB6A 5HHHA 1KRPA 9ICMA 5KFRA 3M6ZA 4KLHA 1LVHA 5ALXA 8ICNA 3BZCA 2JV3A 3TACB 2QARB 2AQ0A 4ED0A 2ZUDA 4B9TA 3NVVA 5HR6A 4KMUA 5AKXA 3V7KA 1XSPA 2GH1A 4DFMA 3QX7A 2AQ4A 1PZNA 1LB2B 3SZ2A 4YR3A 3AQEA 3UMGA 4CCHA 4UAVA 5KT3A 9ICFA 3FDSA 4PHPA 3GV5B 5IIJA 4KLLA 1PK1B 1N60A 5ALPA 4UAWA 4ACOA 2J6TA 2XY7A 4XUSA 5AM1A 3B0YA 3SAHA 3GV8B 3ZDEA 5J8YA 4DEZA 4IRCA 4ZH4A 2QB1A 2DFLA 3E0FA 2MUTB 1UA0A 7ICFA 2Y1JA 5ALSA 3SD7A 2C2EA 4KLGA 3NVWA 2BQ3A 2ZJ5A 1COOA 1CRXA 4FS1A 5C5JA 4Q45A 4FE3A 3QEAZ 3LVWA 2WF8A 4DSLA 2F1JA 2BCQA 4I2JA 4ECXA 4C4TA 1ZQUA 2B0CA 4DWIA 4Y2QA 2RLTA 1LKYB 1QLNA 3LWLA 4MF2A 4DSKA 2D6FC 2BGWA 2Y9TA 4O3NA 1HUZA 2G0AA 4BDPA 1NKCA 2LMRA 1X2IA 4B6JA 5ALOA 2ASLA 5AK4A 3HWTA 4LZDA 3CP8A 5DBAA 1TK5A 2ODGA 5B5EU 5BOLA 1F5SA 1L7OA 2Y0SC 2CXYA 2HDOA 4P4OA 4AYBC 3TAPA 2E3TA 5G5HA 4QWBA 8ICUA 1D9DA 3AMZA 4US8A 3HPOA 2ZJAA 3IHQB 1Z1BA 1B4FA 3RH4A 1NJZA 4Y2UA 2HBJA 4O5KA 4LVSA 1FFUA 2IHMA 4JK1A 1SB3C 3MDAA 1ZQIA 5DBBA 2FLNA 1SXDA 4YMOA 5AI5A 2AXTU 5KFZA 5FP0A 2ALZA 2OH2A 1IXRA 2ZTEA 3MGHA 3ALRA 1ZQSA 1TAQA 3T5LA 2HVIA 2XI9A 1ZQYA 1H38A 5AI6A 3H40A 3PY8A 5KFSA 2AHOB 4EEKA 4CDGA 2E8NA 1QTMA 3F5AA 2C22A 2ISOA 2AH5A 3R9KA 4PGYA 4F4WA 2JXJA 1UPHA 3BS5B 3M9NB 1L3SA 1ZQJA 4DS4A 5KG3A 4EEYA 2QARA 3OHBA 2C2RA 2W7PA 1TE2A 4RQ1A 3QU2A 3OSNA 5F9NA 1NKBA 9ICNA 3C29A 3PW5A 3H0RB 4QZFA 1ZQKA 3TAQA 2FMSA 2HHWA 2Y1IA 4QZEA 4DSFA 3HT3A 2JEGA 2RDJA 5KFVA 2IHNA 4FFDA 5KFKA 4ECTA 4I2DA 4C7YA 4R8UB 4ED1A 8ICPA 2RRDA 1D8BA 2HCFA 3BQ0A 2HHVA 4YD1A 5AKIA 1N61A 1YT3A 2K4IA 3IN5A 3NS1A 2Q4TA 5F3XB 2OYYA 3AQFA 1ZQCA 4PHAA 3WK7A 4RNNA 2KMDA 5KT7A 3RTVA 5AHXA 1SWWA 2E1FA 4RQNA 4UAZA 2XCPA 3QZ7A 3RJKA 4GXJA 4A8EA 1S97A 3MR6A 4K4GA 2LKYA 1OUQA 2JEJA 4KLJA 9ICOA 3QEBZ 4MEXA 3SAFA 1KDHA 3AU2A 5KT5A 1WYGA 9ICWA 4M6WA 3ISCA 1ZRMA 2ZXIA 1Q8KA 2EDUA 3PMLA 3F2DA 2FPMA 3EW9A 4QZ8A 3T5JA 3PVXA 3OJUA 3RH5A 3M8SA 3PW0A 1URJA 5AI0A 3G6XA 1HIWA 4TQSA 3PW2A 3UQ2A 5L1LA 2ATLA 4KLQA 4MFAA 3ZDCA 5ALGA 4UW9A 2YB4A 2HVHA 1ED1A 8ICOA 1NZBA 4U6PA 4YP3A 4ELVA 4OJLA 4NL9A 4RU9A 1QSLA 2CN1A 2FDRA 2KJ8A 4US9A 5J0TA 3QYPA 2QB0A 4KMOB 3V7LA 4RUCA 5J2AA 1NI3A 3L4PA 7ICGA 2KKPA 3WU2U 4EZ6A 3MGVA 2C28A 1PK3A 4F5RA 2ES6A 3IG5A 1T94A 3GQCA 2MSNA 3HKZF 2KHVA 2GOLA 9ICVA 2YX8A 4RQ0A 4NLKA 5AK3A 3AM9A 4NY8A 2W3SA 5KTQA 9ICEA 3V6KA 2P6RA 2KJ9A 5J2BA 4RNMA 2W3RA 2FE9A 2VANA 2EZXA 4K4IA 1RQLA 4P0QB 5KG0A 5AI4A 2J6SA 1RXVA 8ICXA 2K60A 4O3OA 2UVWA 9ICIA 1TAMA 5AKJA 4EX7A 1D8YA 2WHEA 1KBUA 2ZIXA 1LKYA 2GWSA 2PFPA 5AKHA 3M9MB 4GLXA 8ICCA 3I28A 2KZMA 1IG6A 4G3IA 2NRVA 5ALYA 1SIJA 1S5LU 1Z4NA 3H4DA 3GIKA 3LVVA 2BHNA 2BQRA 9ICSA 4DOAA 3VCBA 7ICTA 5ALQA 5J0WA 5AM4A 1UA1A 4QWDA 2J6UA 4KLOA 2P66A 2E8OA 2A1JA 3RBDA 1B22A 1VLBA 3A0BU 3D2SA 1OXJA 5D49A 5KG6A 4EELA 5DG7A 4OJ6A 5E79U 3B0XA 2PI5A 4O3PA 4MF8A 4RQ6A 1RQNA 1ZD2P 2BPFA 1F0MA 5EWFA 1K1QA 4PZNA 2BPCA 1U45A 4QNLA 2ZIWB 3B9JA 1Q46A 4R65A 1BGXT 3A0HU 2YMQA 4WJ3B 1BPEA 5IIMA 2OWOA 5ALNA 3QZ8A 2IMWP 3WKEA 2F8LA 2ZIVB 2Y0SF 3H8WA 4C4RA 2VIXA 3V6HA 5JU5A 1ZRNA 3MFHA 4CE6A 2DGZA 3TFRA 1J97A 1WUDA 2Z7JA 3QU5A 5HR7A 4ECYA 3RH6A 3CNHA 1ZQPA 1BPDA 1SGGA 2VA2A 4F50A 1RYUA 4DLGA 4YR2A 5AKGA 3EYZA 3BJYA 4AP9A 4QZCA 4TUQA 2A1AA 4UATA 4O5CA 2VA3A 1RZTA 4I2IA 3UQ0A 1SKWA 3ZD9A 2JZBA 2V4QA 2ESEA 2GLEA 4BXOB 4B9NA 2EZZA 4IS7A 2RQ5A 3IP4B 3QUBA 5J2HA 7ICPA 5DDMA 3M6KA 1L6NA 4AYBF 1XU4A 1JIHA 2W43A 4J9OA 4IQUA 4R63A 4UQGA 4DQRA 1TFRA 4P0PA 3ONNA 2KP7A 3OJSA 4I2FA 3KHGA 3SV3A 1RM6C 4QIWC 5L1KA 4DOBA 5KFTA 1NJYA 2JHDA 2PI4A 1SV4A 2EANA 1Z1VA
chains in the Genus database with same CATH topology
2K4EA 2K89A 2G5HB 3SAGA 2RRDA 2VKQA 3IG5A 4U7CA 2JH1A 1P7DA 3NUQA 1D8BA 2KOBA 3IG8A 2KV2A 3O0FA 2KIWA 4NWIA 1Z1BA 1YT3A 2K4IA 3IN5A 3L3FX 1T94A 2K4HA 3HKZF 3N7SC 2KHVA 3VC8A 2LBOA 2GOLA 2H3IA 2Q4TA 2VJ4A 2K8BB 2YX8A 2HBJA 3AQEA 3KFUF 2A3VA 2OYYA 3AQFA 2F76X 2VJ5A 4NLBA 4QIWF 2OM6A 2HOQA 1MA7A 2WB1C 2G5IB 2KVCA 1IIPA 5KL1B 2HOIA 3GZFA 5KL8B 2CPRA 2E1FA 4ICAA 3T79A 3D2QA 2K8AA 2W7OA 2F8LA 3KZXA 2XICA 2ZIVB 1Q3VA 2KJ9A 2Y0SF 3RFAA 2VIXA 2H3QA 3PSFA 1SZHA 4FZLA 4ACOA 2KICA 2PMZC 4P0QA 1XO0A 2ZXHA 2HOFA 2CRXA 4P0QB 2MA1A 4OJPA 4A8EA 1PVQA 1PVRA 3F53A 2ZIUB 2KD1A 3PZPA 2N1RA 2G07A 2DGZA 2H3VA 1Q3UA 2OH2A 4CRXA 2RP5A 1WUDA 2Z7JA 2LKYA 1OUQA 3SAHA 2KKVA 3SQIA 5HR7A 5A0LA 4OJOA 4C0ZA 4BX9C 1TAMA 2ZIVA 3ALRA 2HMXA 3M7DA 3E0FA 3C28A 4PL2A 3LYSA 1F44A 3SAFA 1KBUA 2ZIXA 1HEKA 2RHFA 1GO3F 2ZIXB 2JGAA 3DEEA 1PVPA 2XI9A 2R18A 1A0PA 3F2CA 3F5EA 3F2BA 2ZIUA 2JMGA 1CRXA 2KHQA 2ZXIA 2F77X 4CGZA 3AL0B 3F2DA 2KNJA 4FE3A 2LHTA 3LVWA 2K8CB 1A6SA 2ZG6A 2WB1F 3K1ZA 2H3ZA 2LYBA 3LVVA 2BDUA 2KJ5A 4FZNA 2HBMA 3PSPA 4KX5A 3VCBA 4CDGA 4O3MA 2YB1A 3F5AA 2XVTA 3N7RC 4GFJA 1ECWA 3D2NA 1URJA 1ZQ1C 3PSIA 3CRXA 3H0LB 2PMZF 1HIWA 1UPHA 3CYMA 3IP4B 2D6FC 4PL1A 4NV0A 3GU3A 2HBKA 5CRXA 2G08A 2W03A 2W04A 2H3FA 3ICXA 3NRWA 3M6KA 4BJQA 2M0NA 2W7PA 4AYBF 1Z19A 1L6NA 2HBLA 2YB4A 2JH7A 2G0AA 1ED1A 2F2AB 2DF4B 3C29A 1NZBA 3M6ZA 4U6PA 4NLCA 3H0RB 4KX3A 3H0MB 3D2SA 4JMUA 1DRGA 2E1EA 4OJLA 3CP8A 4P0PA 2CN1A 2G09A 2KJ8A 3ONNA 2OXOA 4P0PB 4OJ5A 3N7PD 4KMOB 4OJ6A 2MRLA 3PSTA 3RF9A 4IC9A 4WJ3B 2KEYA 2LYAA 5HR6A 4QIWC 5C0YA 2Y0SC 2WAQC 2KKPA 2WAQF 3SMVA 2DQNB 2G06A 4AYBC 4QJFB 4QNLA 4OO1J 2JHDA 2E5SA 2NV3A 3OPXA 2XIDA 3MGVA 2GH1A 2ZIWA 3HKZC 1XNSA 4BUGA 5T14A 2ZIWB 4FZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCB A;  3VC8 A;  3GZF A; 
#chains in the Genus database with same CATH topology
 4F5P A;  4F2R A;  3HIL A;  1BNO A;  1L7P A;  2D3D A;  4DF4 A;  4ECU A;  2LYH A;  4HAI A;  5J0Y A;  5J0Q A;  3I76 A;  4DFD A;  4O3S A;  1JAL A;  2VJ4 A;  9ICK A;  5CR0 A;  4NLZ A;  3C5F A;  4ED2 A;  4EZ9 A;  4KLF A;  5HHI A;  2XIC A;  3PSF A;  4F8R A;  3RR7 A;  2HOF A;  3QE9 Y;  4C8K A;  1UQV A;  2KKV A;  7ICI A;  2W11 A;  2ZTD A;  4DQS A;  4ED7 A;  4F2S A;  2KK0 A;  2V4R A;  3WK8 A;  5ALM A;  2HI0 A;  3JPN A;  4YVZ A;  3GII A;  4CGZ A;  5AIA A;  2GO7 A;  2WB1 F;  4TUP A;  3ISB A;  4UB2 A;  4Z6D A;  2HBM A;  4KX5 A;  4B9U A;  2EZY A;  3H8M A;  3N7R C;  4F93 B;  4GFJ A;  3D2N A;  5KFH A;  1Y88 A;  1UHU A;  3BS5 A;  2KVS A;  4ECS A;  3RB0 A;  2WF7 A;  4J9M A;  1L8L A;  5AKK A;  4JWM A;  3ETR A;  3SV4 A;  3JPO A;  2Q0Z X;  4ELT A;  4UAS A;  5EE0 A;  4TUR A;  5CB1 A;  1X66 A;  1ZJN A;  4BXO A;  5DKW A;  4IQW A;  9ICR A;  5JUM A;  1DXS A;  4UBC A;  3MBY A;  3SYZ A;  5DB8 A;  3PX6 A;  2LYA A;  3TQ1 A;  1N5W A;  5C0Y A;  1T3N A;  3JPR A;  1O08 A;  3KOO A;  2DQN B;  2R8H A;  4DSJ A;  4B9S A;  4KLE A;  2HSZ A;  1L7N A;  5AK6 A;  2NV3 A;  2XID A;  4BUG A;  1X9W A;  2K89 A;  2G5H B;  1VDV A;  3WK5 A;  2IOH A;  5ALH A;  3QU4 A;  4EYI B;  3VC8 A;  4YXM A;  4Q8E A;  8ICB A;  2E8P A;  1Z3E B;  4Y2J A;  3V7J A;  1Z00 B;  4I2A A;  1SKS A;  4DSI A;  2CPR A;  1N2X A;  5J2K A;  1ZQH A;  4UAR A;  3RFA A;  4CF3 A;  4BWM A;  5KFD A;  2KIC A;  1JRO A;  3RJI A;  2QB0 B;  1RXW A;  2I1Q A;  4O5E A;  4E0D A;  3WK9 A;  1X9S A;  2L5Y A;  3BQ1 A;  4KTQ A;  2NO4 A;  2LM1 A;  4RPX A;  2AU0 A;  1U4B A;  1S10 A;  5IIO A;  2NRX A;  2F1H A;  4I2E A;  5J0P A;  3Q8M A;  5JRT A;  4LJX A;  1SL2 A;  4TUS A;  1IV8 A;  4RT2 A;  1ZQN A;  4YG2 A;  5EE3 A;  3PO5 A;  4YMN A;  1EXN A;  3ETL A;  5H2F U;  4NL9 C;  4Z6F A;  9ICX A;  4O3M A;  2FPL A;  3HRD D;  1C7Y A;  1RPL A;  4DS5 A;  1S8O A;  2W8L A;  5KT4 A;  4JV1 A;  1RDF A;  1WCL A;  3M9O B;  4RUA A;  3T5K A;  1QQ6 A;  4NV0 A;  3GU3 A;  4XA5 A;  3GDX A;  1XC9 A;  5G5G A;  5DQH A;  2KFZ A;  2H3F A;  4EBC A;  5ALE A;  2ZJ8 A;  4NLC A;  1DRG A;  2PFN A;  5KFQ A;  5KT2 A;  3RJF A;  5L1M A;  1ZOL A;  2DPI A;  3H7I A;  2KEY A;  5J0X A;  4MFC A;  5AKL A;  2LI6 A;  2HHU A;  2G06 A;  5J0S A;  3PO4 A;  5B66 U;  5T14 A;  9ICL A;  3C21 A;  4FS2 A;  4ED3 A;  2FMQ A;  4QZB A;  4F5Q A;  1ZQQ A;  1RYS A;  2NYV A;  1T8E A;  1QSY A;  5AM2 A;  1KL9 A;  5TZV A;  4JV2 A;  5TIS U;  2HOQ A;  5DDY A;  2PKE A;  2AJQ A;  4XQ8 A;  2OHF A;  4DF8 A;  2XY5 A;  5CJ7 A;  4YXJ A;  3PNC A;  1XSL A;  1KFS A;  3C1Y A;  1HUO A;  4OJP A;  4PH5 A;  4PHD A;  8ICQ A;  2G07 A;  3L5K A;  5KNI A;  4QWA A;  4DFP A;  2NRT A;  4ECQ A;  4OJO A;  3TAD C;  1JMS A;  3UPQ A;  3Q8L A;  1CUK A;  1BPX A;  1PVP A;  4B9L A;  5KFU A;  1QQ5 A;  3KHL A;  5KFN A;  1S77 D;  5AKE A;  3UXN A;  3RBE A;  2BDU A;  2KJ5 A;  4I29 A;  5D46 A;  2DWQ A;  7ICL A;  4ELU A;  5KAI U;  4C8O A;  2PMZ F;  4C8M A;  3CYM A;  4PL1 A;  3KZI U;  1KKX A;  2F8K A;  2W03 A;  4BJQ A;  5KFM A;  5AK5 A;  2I9G A;  5ALL A;  5KFE A;  5KFO A;  2DF4 B;  2BCR A;  1JI7 A;  1DOQ A;  2XGQ A;  2KSO A;  4JB3 A;  4I27 A;  4RQ8 A;  4G9B A;  3MC1 A;  3MR5 A;  5DB7 A;  1ARO P;  4Y2S A;  3N7P D;  5KG1 A;  4UB5 A;  1JRP A;  1ZQG A;  2EH9 A;  2IOF A;  2QLT A;  1FIQ A;  3OPX A;  2FLL A;  4ED6 A;  3MR2 A;  3RJJ A;  4IL6 U;  4YFK A;  3FM9 A;  4UB8 U;  1SWV A;  1P7D A;  4USA A;  4ECW A;  2KG5 A;  2KIW A;  1NK8 A;  1BPZ A;  2K4H A;  3EUB 2;  5KFI A;  7ICE A;  3KFU F;  1X6J A;  1SL0 A;  1V85 A;  2NRZ A;  5J2D A;  2KVC A;  1IIP A;  5L9X A;  3T79 A;  4ICA A;  1TVA A;  1Q3V A;  2WF5 A;  5DG9 A;  4CF5 A;  3UXP A;  2HHX A;  4J9N A;  1XO0 A;  4QZA A;  1FO4 A;  4F71 A;  4XRH A;  3K75 D;  1NK6 A;  3F53 A;  2KD1 A;  4CRX A;  5J8Y C;  3RJE A;  3SQI A;  2RDI A;  3C2K A;  4UAU A;  4M9G A;  8ICJ A;  3RB3 A;  4FBU A;  3KHH A;  2M9N A;  3F5E A;  1ZQT A;  1NK4 A;  3C1Z A;  2LHT A;  5CWR A;  3SR6 A;  3GFK B;  1A6S A;  5KFA A;  7ICR A;  2H3Z A;  3C23 A;  4IQT A;  3TFS A;  3PSP A;  5HP4 A;  2FI1 A;  4GXK A;  4M2Y A;  5III A;  3ICX A;  2M0N A;  1NKE A;  3TAN A;  2DPJ A;  1O03 A;  1PK1 A;  4DSE A;  5AI9 A;  5DLG A;  1JN3 A;  4GXI A;  3UXO A;  4IRD A;  1S0V A;  3JPQ A;  1CI4 A;  2PFO A;  4I2B A;  4OJ5 A;  5KT6 A;  1S76 D;  4HYK A;  1NK0 A;  2WAQ C;  2WF6 A;  3RAQ A;  4UAY A;  1L7M A;  3BQ7 A;  3WK6 A;  2K4E A;  3SAG A;  2JH1 A;  1NZP A;  3LDA A;  5KFX A;  1KW4 A;  2JR5 A;  3N7S C;  1NJW A;  3GIL A;  5L1I A;  8ICK A;  5CP2 A;  4QIW F;  1T4G A;  2G5I B;  3NTU A;  2K8A A;  5DBC A;  1M6Y A;  2W9B A;  2W9C A;  2PMZ C;  1BVS A;  4P4M A;  3AEV A;  1Q3U A;  4YN4 A;  2H3V A;  4F91 B;  4J9K A;  2F3N A;  1NK9 A;  3RRH A;  1F44 A;  3THV A;  3GV7 B;  4C8L A;  4J9S A;  3BZK A;  3SEI A;  2R8J A;  3SEN A;  1A0P A;  4X5V A;  2JRZ A;  4QW8 A;  4NJ8 A;  7ICU A;  2KNJ A;  3H8S A;  1TV9 A;  2ZG6 A;  3K1Z A;  3Q8Q B;  4B9V A;  1Z00 A;  1ZQD A;  5F9L A;  2HW3 A;  2YB1 A;  2IOF K;  3H0L B;  3BS7 A;  4IR1 A;  1KFT A;  1ZD3 A;  5KFJ A;  8ICW A;  4M9J A;  9ICA A;  2HBK A;  1J2M A;  4F5O A;  2DUY A;  3TAD A;  5J2C A;  3G6Y A;  1JUD A;  5KAF U;  5KFB A;  1B43 A;  2C2D A;  5ALF A;  1KEJ A;  2ISP A;  8ICY A;  2MRL A;  5J2E A;  4Z6E A;  1U48 A;  4M9H A;  2UVV A;  4ECV A;  4I2H A;  3QUC A;  3FYH A;  4M9L A;  9ICJ A;  1MSW D;  5KG5 A;  2KOB A;  5DLF A;  3ZD8 A;  4DQQ A;  7ICN A;  2MU2 A;  3FC4 A;  2NRW A;  2YML A;  3JPP A;  4M0A A;  4KLT A;  4RNO A;  4QZI A;  9ICB A;  2BKE A;  2VJ5 A;  4NLB A;  4Y2Y A;  8ICG A;  2XCA A;  1BPB A;  3GZF A;  5KFY A;  1QH9 A;  4FZL A;  1ZXI A;  2E8M A;  1YZ6 A;  1PVQ A;  4NM2 A;  1PVR A;  3MAB A;  3PZP A;  1KN5 A;  3D6J A;  4PGX A;  2LM4 A;  3V6J A;  3E58 A;  3WKA A;  5A0L A;  4PZO A;  4PGQ A;  1KFD A;  2JZB B;  4KN4 A;  4QWC A;  5AI8 A;  1HEK A;  4LZG A;  4MHV A;  1GO3 F;  1CEZ A;  3UMC A;  5J0U A;  1TAU A;  3F2C A;  1L3U A;  4KLS A;  1DGS A;  3F2B A;  4YMM A;  1ZQX A;  4C80 A;  1N5X A;  4GIB A;  3AL0 B;  5EE9 A;  1NNL A;  5J29 A;  3RJH A;  4OD0 A;  3U26 A;  4R8U A;  2FJ6 A;  3EWA A;  3PW4 A;  4EEN A;  2P35 A;  5ALD A;  4FBT A;  7ICJ A;  2XGP A;  2W04 A;  1ZET A;  3UMB A;  4QZH A;  3BQ2 A;  2HBL A;  1NK5 A;  3K4G A;  4IQV A;  4J9P A;  1UT8 A;  5KFG A;  4GC7 A;  1ZQR A;  3KTQ A;  3AUO A;  2IBK A;  2DKZ A;  3OGU A;  3KKA A;  3NVZ A;  2AGO A;  1LV5 A;  1DK3 A;  3ZDD A;  2UVR A;  5DB6 A;  2BR0 A;  4QJF B;  8ICE A;  4QWE A;  2E5S A;  9ICG A;  4CNQ A;  4RPY A;  3ZDA A;  3KKA C;  2W9A A;  4FZM A;  1NJX A;  3NUQ A;  9ICH A;  3MFI A;  3O0F A;  2KV2 A;  5DG8 A;  5K4L A;  1ZQV A;  5KG7 A;  3JPS A;  3M1Y A;  2LBO A;  2H3I A;  2K8B B;  3SI8 A;  4DLE A;  1XS9 D;  1JX4 A;  5J0R A;  3QUT A;  3EZ5 A;  3HJE A;  3KZX A;  4EBD A;  1X42 A;  4RQ2 A;  7ICV A;  4P0Q A;  2ZXH A;  5ALI A;  1ZQE A;  2EAM A;  4ED8 A;  4NM1 A;  2MA1 A;  4R66 A;  1A76 A;  3BQT A;  4Y2V A;  3Q8P B;  2N1R A;  2R8K A;  2RP5 A;  5JTI A;  5CA7 A;  4C0Z A;  2ZUC A;  3M7D A;  3C28 A;  1SL1 A;  5IIN A;  3HW8 A;  5AIC A;  2ZIX B;  5GTI U;  2JEI A;  3DEE A;  4KN7 A;  4Y2P A;  4F4K A;  3ISD A;  4NLN A;  5EOZ A;  4DL7 A;  2YTU A;  2KHQ A;  4Y2R A;  4KLI A;  1ZQM A;  5CHG A;  1S0O A;  5IIK A;  1ZD4 A;  1TKD A;  2YMP A;  4FZN A;  4DQI A;  1L5U A;  4KIT B;  4O3R A;  4Q44 A;  3MR3 A;  2I5H A;  2ZUB A;  3NRW A;  3S6J A;  5ALZ A;  4JWN A;  5KFC A;  3PMN A;  2F2A B;  4JV0 A;  2W55 A;  3H0M B;  2JEF A;  1K5O A;  5J2I A;  4NXZ A;  2OCE A;  1U49 A;  1SZP A;  2W54 A;  3H4B A;  2G09 A;  3QU7 A;  4C8N A;  1WWU A;  4QW9 A;  3CW2 C;  1FFV A;  8ICV A;  1T7P A;  2WAQ F;  5AKY A;  2BPG A;  2KE7 A;  2BZF A;  3N4M B;  2ZIW A;  4RQ7 A;  1YZ7 A;  2EAO A;  5KFF A;  4J9L A;  1L3V A;  3OHA A;  5KG2 A;  2VKQ A;  4U7C A;  2NO5 A;  3C2M A;  7ICQ A;  3WKC A;  1ZJM A;  3L3F X;  3ED5 A;  4Q43 A;  1BNP A;  2FPK A;  2F76 X;  4M47 A;  2OM6 A;  3IRU A;  2KTQ A;  1A77 A;  2HOI A;  4UB6 U;  4J9Q A;  3FAH A;  5HMM A;  4K4H A;  2EQY A;  3NVY A;  2UVU A;  2A19 A;  1MQ3 A;  4DL5 A;  1T3Q A;  3IM1 A;  4J03 A;  3Q8K A;  2HMX A;  3LYS A;  4B9M A;  1SKR A;  5BOM A;  3PW7 A;  3IDW A;  2R18 A;  2KFN A;  1K1S A;  2JMG A;  1V9P A;  1X9M A;  2K8C B;  3WKB A;  4YCX A;  2LYB A;  2BCV A;  1J2N A;  1XWL A;  1C20 A;  1N56 A;  4F92 B;  3PSI A;  2F44 A;  2WFA A;  1JXE A;  4RT3 A;  4OCZ A;  3WKD A;  5DGB A;  2DBY A;  2HHS A;  2Y9U A;  4QZ9 A;  3T3F A;  4DFK A;  5DGA A;  3TAR A;  8ICZ A;  3QU9 A;  4F4Z A;  2E1E A;  2KIV A;  3GIJ A;  4KLM A;  1X6I A;  5IIL A;  7ICO A;  4P0P B;  4P4P A;  4Y2T A;  3V72 A;  3ORY A;  1X9X A;  4IC9 A;  3JPT A;  3KBB A;  4JUZ A;  1KSP A;  3SMV A;  3KD3 A;  5ALU A;  4OO1 J;  2HHT A;  3H8J A;  3HKZ C;  4EBE A;  4GC6 A;  4IR9 A;  2MUT A;  3RAX A;  2H5X A;  3I1Y A;  2W8K A;  5DQI A;  2KN7 A;  3BDP A;  4RQ4 A;  1ZQZ A;  8ICR A;  5AM3 A;  7ICK A;  2A3V A;  4Y2X A;  5AM0 A;  2F1I A;  5AIB A;  5CEH A;  2WB1 C;  1MA7 A;  8ICL A;  1UT5 A;  5KL1 B;  4PJ0 U;  2XY6 A;  3QNM A;  3EPI A;  4R64 A;  2D8C A;  5HML A;  3C5G A;  3PV8 A;  8ICT A;  1ZD5 A;  1ZQO A;  2W9C B;  2W9B B;  5KFL A;  1SZH A;  4C4S A;  4I2G A;  4RQ3 A;  7ICS A;  5EE1 A;  3RRG A;  5EWE A;  2QKQ A;  4I2C A;  4NLG A;  2DKX A;  5ALW A;  1L8O A;  1COK A;  3NRZ A;  2IA6 A;  4EYH B;  3N97 B;  1SXE A;  5J2J A;  2BDP A;  4RPZ A;  1FEZ A;  2YQE A;  1WCN A;  3TKA A;  1ZQW A;  3PX0 A;  5KFW A;  4UB4 A;  2ZIU A;  2R8G A;  3Q8S B;  2F77 X;  4KLD A;  5BPC A;  3OSP A;  3TI0 A;  1U47 A;  5D4B A;  5J2F A;  3T5H A;  1L3T A;  2XVT A;  5HNK A;  3C2L A;  3DV9 A;  1V38 A;  3AN1 A;  7ICH A;  4BGD A;  3MDC A;  9ICP A;  1KQQ A;  5GTH U;  3RR8 A;  1UCV A;  1Z19 A;  3DDH A;  1MQ2 A;  4Z6C A;  4MEY A;  3RB4 A;  2KZZ A;  1PUZ A;  2PXI A;  3QUQ A;  4JMU A;  4YQW A;  2HHQ A;  4PPX A;  3HX0 A;  1BPY A;  8ICF A;  9ICT A;  2OXO A;  5L1J A;  1U9L A;  2A1J B;  3PST A;  3RF9 A;  2R8I A;  2EAP A;  3LK9 A;  4DL4 A;  1XSN A;  2VA8 A;  4EX6 A;  8ICH A;  3K1R B;  2I6X A;  3G6V A;  1WG8 A;  4I28 A;  1SV0 C;  4C7Z A;  1N62 A;  3OTQ A;  4DFJ A;  1N63 A;  1MN8 A;  4O9M A;  1QQ7 A;  3LWM A;  3D2Q A;  2W7O A;  2FLP A;  3NAS A;  3WK4 A;  1WWV A;  1RG6 A;  2MAX A;  3GIM A;  4DO9 A;  3EPG A;  4M9N A;  1KTQ A;  2YY6 A;  2ZIV A;  4UBB A;  2B21 A;  2ASD A;  1NOM A;  2AGQ A;  8ICI A;  2BCS A;  4P2H A;  2BCU A;  1X40 A;  1N48 A;  1V97 A;  4F3O A;  2V9W A;  1AQ6 A;  9ICU A;  4YR0 A;  5ALV A;  1ECW A;  1XO1 A;  4O3Q A;  1QSS A;  2ZTC A;  1SV0 A;  4UB3 A;  1ZQB A;  4QZG A;  2OEH A;  4RQM A;  1D8L A;  5CRX A;  4F72 A;  4TQR A;  1IM4 A;  1D9F A;  3M8R A;  4UB1 A;  2JH7 A;  2XC9 A;  4DL6 A;  5J2G A;  3AU6 A;  5DQG A;  4KX3 A;  1RYR A;  3N28 A;  1ZQF A;  5KFP A;  2XO7 A;  2AGP A;  4DL3 A;  1TK8 A;  4QZD A;  3PR4 A;  4Q8F A;  1NK7 A;  2LPE A;  5KG4 A;  2B6G A;  1S0M A;  1QCK A;  8ICM A;  3MGI A;  3KHR A;  3Q8R B;  1S0N A;  1S9F A;  1DK2 A;  1XNS A;  4YD2 A;  2FMP A;  2WF9 A;  4RQ5 A;  1KLN A;  1ZQA A;  4M6W B;  2YMM A;  3IG8 A;  2WTF A;  4FO6 A;  8ICS A;  4NWI A;  2ASJ A;  4DL2 A;  1OW5 A;  4O0I A;  4DQP A;  1B0X A;  4F4Y A;  4M04 A;  4DCC A;  3PR5 B;  1VJ5 A;  2BQU A;  9ICQ A;  5ALT A;  3PX4 A;  4ECZ A;  5J0O A;  4J9R A;  5KL8 B;  2DL0 A;  2KSO B;  2W9M A;  4ZOH C;  2H3Q A;  2KZ3 A;  3HP6 A;  3ZI4 A;  2CRX A;  5ALR A;  5EWG A;  2O6K A;  2ZIU B;  2K4P A;  4DOC A;  1ZYQ A;  4MFF A;  1DGJ A;  5AM5 A;  3ZDB A;  4BX9 C;  5ALJ A;  3UM9 A;  1HJP A;  4PL2 A;  4F5N A;  2YN4 A;  2RHF A;  2JGA A;  4F4X A;  3J81 j;  3E2E A;  4IRK A;  7ICM A;  4PHE A;  4RZR A;  4CF4 A;  1Z4O A;  2PFQ A;  5DB9 A;  1TK0 A;  3RJG A;  3NGD A;  5AKZ A;  1ZQ1 C;  1JXL A;  2P6U A;  3CRX A;  8ICA A;  9ICC A;  1ZQL A;  3IV6 A;  4BWJ A;  5ALK A;  1MC8 A;  4KLU A;  2G08 A;  4ECR A;  3QXG A;  3RB6 A;  5HHH A;  1KRP A;  9ICM A;  5KFR A;  3M6Z A;  4KLH A;  1LVH A;  5ALX A;  8ICN A;  3BZC A;  2JV3 A;  3TAC B;  2QAR B;  2AQ0 A;  4ED0 A;  2ZUD A;  4B9T A;  3NVV A;  5HR6 A;  4KMU A;  5AKX A;  3V7K A;  1XSP A;  2GH1 A;  4DFM A;  3QX7 A;  2AQ4 A;  1PZN A;  1LB2 B;  3SZ2 A;  4YR3 A;  3AQE A;  3UMG A;  4CCH A;  4UAV A;  5KT3 A;  9ICF A;  3FDS A;  4PHP A;  3GV5 B;  5IIJ A;  4KLL A;  1PK1 B;  1N60 A;  5ALP A;  4UAW A;  4ACO A;  2J6T A;  2XY7 A;  4XUS A;  5AM1 A;  3B0Y A;  3SAH A;  3GV8 B;  3ZDE A;  5J8Y A;  4DEZ A;  4IRC A;  4ZH4 A;  2QB1 A;  2DFL A;  3E0F A;  2MUT B;  1UA0 A;  7ICF A;  2Y1J A;  5ALS A;  3SD7 A;  2C2E A;  4KLG A;  3NVW A;  2BQ3 A;  2ZJ5 A;  1COO A;  1CRX A;  4FS1 A;  5C5J A;  4Q45 A;  4FE3 A;  3QEA Z;  3LVW A;  2WF8 A;  4DSL A;  2F1J A;  2BCQ A;  4I2J A;  4ECX A;  4C4T A;  1ZQU A;  2B0C A;  4DWI A;  4Y2Q A;  2RLT A;  1LKY B;  1QLN A;  3LWL A;  4MF2 A;  4DSK A;  2D6F C;  2BGW A;  2Y9T A;  4O3N A;  1HUZ A;  2G0A A;  4BDP A;  1NKC A;  2LMR A;  1X2I A;  4B6J A;  5ALO A;  2ASL A;  5AK4 A;  3HWT A;  4LZD A;  3CP8 A;  5DBA A;  1TK5 A;  2ODG A;  5B5E U;  5BOL A;  1F5S A;  1L7O A;  2Y0S C;  2CXY A;  2HDO A;  4P4O A;  4AYB C;  3TAP A;  2E3T A;  5G5H A;  4QWB A;  8ICU A;  1D9D A;  3AMZ A;  4US8 A;  3HPO A;  2ZJA A;  3IHQ B;  1Z1B A;  1B4F A;  3RH4 A;  1NJZ A;  4Y2U A;  2HBJ A;  4O5K A;  4LVS A;  1FFU A;  2IHM A;  4JK1 A;  1SB3 C;  3MDA A;  1ZQI A;  5DBB A;  2FLN A;  1SXD A;  4YMO A;  5AI5 A;  2AXT U;  5KFZ A;  5FP0 A;  2ALZ A;  2OH2 A;  1IXR A;  2ZTE A;  3MGH A;  3ALR A;  1ZQS A;  1TAQ A;  3T5L A;  2HVI A;  2XI9 A;  1ZQY A;  1H38 A;  5AI6 A;  3H40 A;  3PY8 A;  5KFS A;  2AHO B;  4EEK A;  4CDG A;  2E8N A;  1QTM A;  3F5A A;  2C22 A;  2ISO A;  2AH5 A;  3R9K A;  4PGY A;  4F4W A;  2JXJ A;  1UPH A;  3BS5 B;  3M9N B;  1L3S A;  1ZQJ A;  4DS4 A;  5KG3 A;  4EEY A;  2QAR A;  3OHB A;  2C2R A;  2W7P A;  1TE2 A;  4RQ1 A;  3QU2 A;  3OSN A;  5F9N A;  1NKB A;  9ICN A;  3C29 A;  3PW5 A;  3H0R B;  4QZF A;  1ZQK A;  3TAQ A;  2FMS A;  2HHW A;  2Y1I A;  4QZE A;  4DSF A;  3HT3 A;  2JEG A;  2RDJ A;  5KFV A;  2IHN A;  4FFD A;  5KFK A;  4ECT A;  4I2D A;  4C7Y A;  4R8U B;  4ED1 A;  8ICP A;  2RRD A;  1D8B A;  2HCF A;  3BQ0 A;  2HHV A;  4YD1 A;  5AKI A;  1N61 A;  1YT3 A;  2K4I A;  3IN5 A;  3NS1 A;  2Q4T A;  5F3X B;  2OYY A;  3AQF A;  1ZQC A;  4PHA A;  3WK7 A;  4RNN A;  2KMD A;  5KT7 A;  3RTV A;  5AHX A;  1SWW A;  2E1F A;  4RQN A;  4UAZ A;  2XCP A;  3QZ7 A;  3RJK A;  4GXJ A;  4A8E A;  1S97 A;  3MR6 A;  4K4G A;  2LKY A;  1OUQ A;  2JEJ A;  4KLJ A;  9ICO A;  3QEB Z;  4MEX A;  3SAF A;  1KDH A;  3AU2 A;  5KT5 A;  1WYG A;  9ICW A;  4M6W A;  3ISC A;  1ZRM A;  2ZXI A;  1Q8K A;  2EDU A;  3PML A;  3F2D A;  2FPM A;  3EW9 A;  4QZ8 A;  3T5J A;  3PVX A;  3OJU A;  3RH5 A;  3M8S A;  3PW0 A;  1URJ A;  5AI0 A;  3G6X A;  1HIW A;  4TQS A;  3PW2 A;  3UQ2 A;  5L1L A;  2ATL A;  4KLQ A;  4MFA A;  3ZDC A;  5ALG A;  4UW9 A;  2YB4 A;  2HVH A;  1ED1 A;  8ICO A;  1NZB A;  4U6P A;  4YP3 A;  4ELV A;  4OJL A;  4NL9 A;  4RU9 A;  1QSL A;  2CN1 A;  2FDR A;  2KJ8 A;  4US9 A;  5J0T A;  3QYP A;  2QB0 A;  4KMO B;  3V7L A;  4RUC A;  5J2A A;  1NI3 A;  3L4P A;  7ICG A;  2KKP A;  3WU2 U;  4EZ6 A;  3MGV A;  2C28 A;  1PK3 A;  4F5R A;  2ES6 A;  3IG5 A;  1T94 A;  3GQC A;  2MSN A;  3HKZ F;  2KHV A;  2GOL A;  9ICV A;  2YX8 A;  4RQ0 A;  4NLK A;  5AK3 A;  3AM9 A;  4NY8 A;  2W3S A;  5KTQ A;  9ICE A;  3V6K A;  2P6R A;  2KJ9 A;  5J2B A;  4RNM A;  2W3R A;  2FE9 A;  2VAN A;  2EZX A;  4K4I A;  1RQL A;  4P0Q B;  5KG0 A;  5AI4 A;  2J6S A;  1RXV A;  8ICX A;  2K60 A;  4O3O A;  2UVW A;  9ICI A;  1TAM A;  5AKJ A;  4EX7 A;  1D8Y A;  2WHE A;  1KBU A;  2ZIX A;  1LKY A;  2GWS A;  2PFP A;  5AKH A;  3M9M B;  4GLX A;  8ICC A;  3I28 A;  2KZM A;  1IG6 A;  4G3I A;  2NRV A;  5ALY A;  1SIJ A;  1S5L U;  1Z4N A;  3H4D A;  3GIK A;  3LVV A;  2BHN A;  2BQR A;  9ICS A;  4DOA A;  3VCB A;  7ICT A;  5ALQ A;  5J0W A;  5AM4 A;  1UA1 A;  4QWD A;  2J6U A;  4KLO A;  2P66 A;  2E8O A;  2A1J A;  3RBD A;  1B22 A;  1VLB A;  3A0B U;  3D2S A;  1OXJ A;  5D49 A;  5KG6 A;  4EEL A;  5DG7 A;  4OJ6 A;  5E79 U;  3B0X A;  2PI5 A;  4O3P A;  4MF8 A;  4RQ6 A;  1RQN A;  1ZD2 P;  2BPF A;  1F0M A;  5EWF A;  1K1Q A;  4PZN A;  2BPC A;  1U45 A;  4QNL A;  2ZIW B;  3B9J A;  1Q46 A;  4R65 A;  1BGX T;  3A0H U;  2YMQ A;  4WJ3 B;  1BPE A;  5IIM A;  2OWO A;  5ALN A;  3QZ8 A;  2IMW P;  3WKE A;  2F8L A;  2ZIV B;  2Y0S F;  3H8W A;  4C4R A;  2VIX A;  3V6H A;  5JU5 A;  1ZRN A;  3MFH A;  4CE6 A;  2DGZ A;  3TFR A;  1J97 A;  1WUD A;  2Z7J A;  3QU5 A;  5HR7 A;  4ECY A;  3RH6 A;  3CNH A;  1ZQP A;  1BPD A;  1SGG A;  2VA2 A;  4F50 A;  1RYU A;  4DLG A;  4YR2 A;  5AKG A;  3EYZ A;  3BJY A;  4AP9 A;  4QZC A;  4TUQ A;  2A1A A;  4UAT A;  4O5C A;  2VA3 A;  1RZT A;  4I2I A;  3UQ0 A;  1SKW A;  3ZD9 A;  2JZB A;  2V4Q A;  2ESE A;  2GLE A;  4BXO B;  4B9N A;  2EZZ A;  4IS7 A;  2RQ5 A;  3IP4 B;  3QUB A;  5J2H A;  7ICP A;  5DDM A;  3M6K A;  1L6N A;  4AYB F;  1XU4 A;  1JIH A;  2W43 A;  4J9O A;  4IQU A;  4R63 A;  4UQG A;  4DQR A;  1TFR A;  4P0P A;  3ONN A;  2KP7 A;  3OJS A;  4I2F A;  3KHG A;  3SV3 A;  1RM6 C;  4QIW C;  5L1K A;  4DOB A;  5KFT A;  1NJY A;  2JHD A;  2PI4 A;  1SV4 A;  2EAN A;  1Z1V A; 
#chains in the Genus database with same CATH homology
 2K4E A;  2K89 A;  2G5H B;  3SAG A;  2RRD A;  2VKQ A;  3IG5 A;  4U7C A;  2JH1 A;  1P7D A;  3NUQ A;  1D8B A;  2KOB A;  3IG8 A;  2KV2 A;  3O0F A;  2KIW A;  4NWI A;  1Z1B A;  1YT3 A;  2K4I A;  3IN5 A;  3L3F X;  1T94 A;  2K4H A;  3HKZ F;  3N7S C;  2KHV A;  3VC8 A;  2LBO A;  2GOL A;  2H3I A;  2Q4T A;  2VJ4 A;  2K8B B;  2YX8 A;  2HBJ A;  3AQE A;  3KFU F;  2A3V A;  2OYY A;  3AQF A;  2F76 X;  2VJ5 A;  4NLB A;  4QIW F;  2OM6 A;  2HOQ A;  1MA7 A;  2WB1 C;  2G5I B;  2KVC A;  1IIP A;  5KL1 B;  2HOI A;  3GZF A;  5KL8 B;  2CPR A;  2E1F A;  4ICA A;  3T79 A;  3D2Q A;  2K8A A;  2W7O A;  2F8L A;  3KZX A;  2XIC A;  2ZIV B;  1Q3V A;  2KJ9 A;  2Y0S F;  3RFA A;  2VIX A;  2H3Q A;  3PSF A;  1SZH A;  4FZL A;  4ACO A;  2KIC A;  2PMZ C;  4P0Q A;  1XO0 A;  2ZXH A;  2HOF A;  2CRX A;  4P0Q B;  2MA1 A;  4OJP A;  4A8E A;  1PVQ A;  1PVR A;  3F53 A;  2ZIU B;  2KD1 A;  3PZP A;  2N1R A;  2G07 A;  2DGZ A;  2H3V A;  1Q3U A;  2OH2 A;  4CRX A;  2RP5 A;  1WUD A;  2Z7J A;  2LKY A;  1OUQ A;  3SAH A;  2KKV A;  3SQI A;  5HR7 A;  5A0L A;  4OJO A;  4C0Z A;  4BX9 C;  1TAM A;  2ZIV A;  3ALR A;  2HMX A;  3M7D A;  3E0F A;  3C28 A;  4PL2 A;  3LYS A;  1F44 A;  3SAF A;  1KBU A;  2ZIX A;  1HEK A;  2RHF A;  1GO3 F;  2ZIX B;  2JGA A;  3DEE A;  1PVP A;  2XI9 A;  2R18 A;  1A0P A;  3F2C A;  3F5E A;  3F2B A;  2ZIU A;  2JMG A;  1CRX A;  2KHQ A;  2ZXI A;  2F77 X;  4CGZ A;  3AL0 B;  3F2D A;  2KNJ A;  4FE3 A;  2LHT A;  3LVW A;  2K8C B;  1A6S A;  2ZG6 A;  2WB1 F;  3K1Z A;  2H3Z A;  2LYB A;  3LVV A;  2BDU A;  2KJ5 A;  4FZN A;  2HBM A;  3PSP A;  4KX5 A;  3VCB A;  4CDG A;  4O3M A;  2YB1 A;  3F5A A;  2XVT A;  3N7R C;  4GFJ A;  1ECW A;  3D2N A;  1URJ A;  1ZQ1 C;  3PSI A;  3CRX A;  3H0L B;  2PMZ F;  1HIW A;  1UPH A;  3CYM A;  3IP4 B;  2D6F C;  4PL1 A;  4NV0 A;  3GU3 A;  2HBK A;  5CRX A;  2G08 A;  2W03 A;  2W04 A;  2H3F A;  3ICX A;  3NRW A;  3M6K A;  4BJQ A;  2M0N A;  2W7P A;  4AYB F;  1Z19 A;  1L6N A;  2HBL A;  2YB4 A;  2JH7 A;  2G0A A;  1ED1 A;  2F2A B;  2DF4 B;  3C29 A;  1NZB A;  3M6Z A;  4U6P A;  4NLC A;  3H0R B;  4KX3 A;  3H0M B;  3D2S A;  4JMU A;  1DRG A;  2E1E A;  4OJL A;  3CP8 A;  4P0P A;  2CN1 A;  2G09 A;  2KJ8 A;  3ONN A;  2OXO A;  4P0P B;  4OJ5 A;  3N7P D;  4KMO B;  4OJ6 A;  2MRL A;  3PST A;  3RF9 A;  4IC9 A;  4WJ3 B;  2KEY A;  2LYA A;  5HR6 A;  4QIW C;  5C0Y A;  2Y0S C;  2WAQ C;  2KKP A;  2WAQ F;  3SMV A;  2DQN B;  2G06 A;  4AYB C;  4QJF B;  4QNL A;  4OO1 J;  2JHD A;  2E5S A;  2NV3 A;  3OPX A;  2XID A;  3MGV A;  2GH1 A;  2ZIW A;  3HKZ C;  1XNS A;  4BUG A;  5T14 A;  2ZIW B;  4FZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...