3GZFA

Structure of the c-terminal domain of nsp4 from feline coronavirus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
GLFEGDKFVGSFESAAMGTFVIDMRSYETLVNSTSLDRIKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVSRNDKLYTPPTVSVNSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal domain of nsp4 from feline coronavirus
pubmed doi rcsb
source organism Feline coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 27
structure length 96
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3gzfA00
3VC8A 3VCBA 3GZFA
chains in the Genus database with same CATH superfamily
2WFAA 1MQ2A 4YG2A 4YXJA 2VA3A 7ICVA 4O5KA 2IA6A 5D46A 3NASA 2V4QA 1V9PA 1ZQBA 2A1AA 1ZQOA 2HDOA 3UQ2A 4FBTA 1K5OA 3HWTA 3HJEA 4J9QA 2YB4A 1ZQEA 4ECZA 2RDJA 4J03A 1ZQYA 3QU5A 9ICCA 3GIKA 4QZDA 2FPLA 1ZRMA 4EX6A 3MGVA 3RB4A 1S10A 3AM9A 2GOLA 4QZ8A 4ELVA 1TVAA 5KFOA 2ISOA 1T3NA 3JPPA 4DS5A 5DGAA 3NVWA 5ALUA 1J2NA 2HBMA 1NOMA 1PUZA 4RQ5A 2IHNA 3C5FA 2F44A 2ZXIA 4CGZA 2BZFA 5KT4A 4Q44A 3V6KA 1SIJA 4M04A 4F91B 4KMUA 2YX8A 4UBBA 8ICJA 2CXYA 4O0IA 2LHTA 4UASA 8ICTA 3A0BU 1BPYA 4C4TA 4TUPA 1ZQQA 2WF7A 1WWUA 5KFXA 2GO7A 1CI4A 5J0RA 4JV0A 5D4BA 4ZH4A 1X6JA 2C22A 9ICWA 2KSOA 5T14A 2GLEA 2F8LA 2FJ6A 3CRXA 5ALYA 3SV3A 3MC1A 3IN5A 3RJEA 2HOIA 5KFQA 1ZQUA 4YMOA 1Z4OA 5IIKA 5IIOA 2QB0B 2LMRA 4PHPA 2WF5A 1N56A 3CYMA 5ALQA 1BPXA 5AIAA 1NZPA 3PW2A 5DQGA 9ICRA 1WWVA 1S0MA 5J0SA 1NKCA 4EBDA 3JPQA 5GTIU 3HT3A 3HILA 4DL4A 1HEKA 8ICCA 2QB0A 4DL3A 1ZQLA 3TI0A 4YMMA 2W9CB 2I9GA 4KLSA 1X42A 3IDWA 2ASJA 4MEYA 5AK3A 5DG9A 2KK0A 4MFCA 4P0PB 4F50A 4F4WA 4UAVA 2H3ZA 2RP5A 4YFKA 3PW4A 4P4PA 3GU3A 2ZIVB 1PK1A 7ICPA 4US8A 2DUYA 5HHIA 1H38A 1KFSA 2ZJAA 1Q3UA 3PW5A 3PW0A 1QSSA 5KFAA 2RLTA 1L3TA 3QU7A 2LM4A 7ICGA 2KFNA 3Q8QB 2PKEA 1BVSA 2JZBA 5KFSA 2ZIVA 5KT7A 4RNOA 5KFCA 1B4FA 7ICTA 4KTQA 2E5SA 4NXZA 2PFOA 8ICKA 3MABA 1MA7A 3M9OB 3AMZA 2HHVA 4RPYA 5DB7A 1J2MA 8ICAA 1ZD5A 4PPXA 3GIJA 2XO7A 3RJFA 4O3SA 2G5IB 1SV4A 2A19A 1DK3A 5J0YA 2F8KA 1RYRA 3BZKA 4HAIA 4YCXA 3C2MA 5KG3A 2AGOA 3K4GA 4YR3A 1D8YA 4DCCA 2PFNA 4OJ5A 1B0XA 1SGGA 1JUDA 1CUKA 3S6JA 3M6KA 5EWEA 2UVWA 2H3VA 4B9SA 1JXLA 3LVWA 2FLLA 4F71A 1SB3C 5AK5A 2CN1A 5D49A 3RH6A 3QUCA 4AP9A 1ZQIA 3OHBA 4JV1A 5J2AA 2W9BA 1L7PA 3SD7A 3BQTA 5EOZA 2JEIA 2YB1A 2BCUA 3U26A 2W8LA 1ZQXA 4PZNA 2HOFA 1SKRA 4J9PA 3RJGA 3M9MB 4RQMA 2KJ9A 3FM9A 4RQ1A 4GXKA 1SWVA 2CRXA 4MEXA 2MAXA 1TAMA 4Q8EA 4UB4A 2ISPA 3SAHA 1UA1A 4DFDA 4M9HA 4KLOA 5CWRA 3SV4A 2QLTA 3MGIA 1ZQMA 5F9NA 1YZ7A 3SQIA 1NJYA 5CB1A 2FDRA 2ZJ5A 4RQ7A 2W04A 2KZZA 3AUOA 4NJ8A 2G09A 1VJ5A 5H2FU 1SV0C 3WK9A 1L5UA 2ZUCA 1ZQRA 2OEHA 4YP3A 3F2CA 5B5EU 1JIHA 2PXIA 4C4RA 3KOOA 4KLUA 9ICTA 5ALJA 2DFLA 1FEZA 4Z6DA 4BGDA 2BCVA 1ZD3A 1IM4A 2KJ8A 1SKSA 4RQ2A 4EYIB 3AN1A 5ALKA 2KD1A 2R8KA 2NO4A 2DKZA 3B0XA 4R63A 2P66A 2A1JB 4DLEA 4AYBC 4DSKA 2NO5A 5DGBA 3LWMA 3Q8KA 7ICKA 5CJ7A 4QWAA 2MUTB 1Z00B 4KLTA 3OHAA 4KLDA 2Y9TA 3RAXA 5DBAA 1XSPA 4RT3A 4ECSA 1CRXA 1X6IA 3TAQA 3MDCA 1MN8A 2YMLA 5KT6A 5KL8B 1F5SA 2JH7A 4PJ0U 4O3RA 9ICEA 3ZDEA 3C21A 5DKWA 3A0HU 4EBCA 5ALRA 5J29A 4C0ZA 4RUCA 4I27A 2E1EA 3GV5B 2KZMA 8ICOA 2GH1A 3SYZA 5KG2A 4UB8U 4BX9C 5DB6A 3WK4A 5AKEA 2W55A 5GTHU 2OM6A 1Z1VA 4ICAA 5AKJA 3L3FX 4NLKA 4UATA 2HCFA 3ORYA 2EH9A 4RZRA 3EZ5A 1Z19A 4DO9A 9ICKA 3H4DA 2YMQA 2W9CA 3UMGA 2JEJA 3IP4B 4R65A 4NL9A 3NS1A 1DRGA 4TQSA 3F5EA 2Y0SC 5F3XB 4UW9A 3ICXA 3QUTA 4C80A 3AQEA 1ZQFA 3TKAA 1N2XA 2C28A 4CF3A 5JU5A 5AKIA 4QZGA 3QEAZ 1Q8KA 3PY8A 3SR6A 4P0QB 3KTQA 2BQRA 3BS7A 5AKXA 4IR9A 5HR6A 4C8KA 5AICA 5J2GA 1XWLA 9ICSA 3RFAA 3HPOA 1JN3A 4DQQA 2XI9A 5ALDA 4CF5A 3AU2A 2IOFA 3QXGA 5J2BA 5KFMA 2VA2A 4J9KA 5KFNA 1N62A 3T5LA 1MSWD 3B9JA 4C8MA 3RB3A 4JWNA 4JWMA 5J8YA 5CA7A 3RAQA 4DF4A 1LVHA 5J0OA 5KFLA 4RQ0A 3R9KA 2BQ3A 4KN7A 4TUSA 2C2DA 3MR3A 5CP2A 5DG8A 1F44A 9ICQA 4Y2VA 2DPJA 5CRXA 2ZIWB 3PO4A 4XUSA 8ICVA 2W8KA 4FE3A 1JMSA 1L8OA 3RJKA 8ICFA 2W11A 4Y2YA 4F4ZA 4DOCA 4FS1A 1C7YA 2F1JA 2HSZA 3ZD9A 1D8BA 4FFDA 1RXVA 9ICJA 1ZRNA 4UB2A 3DV9A 4TQRA 3M8SA 2JXJA 2KJ5A 3H8WA 5BOMA 4NM2A 3ALRA 4J9OA 1UQVA 2EAMA 4R66A 3PR5B 3NTUA 2LKYA 1CEZA 5KFRA 3TADA 7ICMA 2E8MA 4CF4A 4PGQA 3DDHA 4IQWA 4FZLA 3QUBA 2WF6A 3RJIA 3N4MB 8ICHA 4MF8A 4Y2UA 8ICZA 5ALSA 5E79U 1JX4A 3KZIU 2JZBB 1O03A 2DPIA 4USAA 3GIMA 1NK0A 4G3IA 3PO5A 2KOBA 4PL2A 2H5XA 4YN4A 4B9LA 2FE9A 4QWBA 4DSFA 4I2IA 2F76X 1XNSA 2I6XA 3IHQB 3TAPA 2ZIUA 8ICMA 3RBDA 5IILA 4EEKA 4KLJA 5KG5A 4BXOA 1KFDA 4DFJA 1ZYQA 2K4IA 4KLQA 3BS5A 1NK8A 1KTQA 4ED2A 3PSIA 2HHUA 3E0FA 4NLNA 1OXJA 3RH5A 1T3QA 4F72A 2K60A 5AKKA 5G5GA 3PX6A 9ICPA 1PVPA 2R8JA 4YVZA 1NZBA 4NLZA 5AM4A 1NJZA 4BXOB 4ED3A 5KT2A 4Z6FA 7ICNA 1HJPA 4RU9A 4I2AA 1DK2A 1D9DA 3NUQA 3PMNA 4AYBF 3MFHA 1UHUA 4F5RA 2FMQA 4GC6A 3PSFA 3NVVA 1IXRA 4XQ8A 3IRUA 5JRTA 3RR8A 2HI0A 5EWFA 2PFQA 4I2HA 1SL1A 9ICNA 1TV9A 4Q8FA 4QZAA 1SL0A 3TADC 5KTQA 5KG7A 5AI6A 5KNIA 3WK6A 1SZHA 2RQ5A 1XU4A 4PGXA 1U4BA 3M1YA 4DOAA 4MF2A 4YXMA 4ECWA 1RQLA 2D8CA 4K4HA 3BQ0A 2DF4B 2ZIXA 2P6RA 4Y2RA 3N28A 4CRXA 5L9XA 5KFWA 9ICAA 4EYHB 3GFKB 1NNLA 1QSLA 1SKWA 1MQ3A 5JTIA 2JR5A 3OSNA 4F2RA 2KVSA 5AI9A 1KL9A 2NRTA 1L8LA 3BQ1A 1ZJNA 2JH1A 4NV0A 3IG5A 3VCBA 4J9RA 2A3VA 2BCSA 1L3UA 3NVYA 4KLIA 3C29A 1PVQA 2LM1A 2J6TA 3NRWA 3E58A 3C5GA 2EZXA 5KL1B 5J2KA 3RTVA 4DQSA 5J2EA 4F4KA 2B6GA 3N7PD 3LDAA 5DB9A 1NK9A 5DQIA 3SEIA 4M6WA 4F4YA 2KV2A 2WAQF 1A6SA 1QQ5A 5G5HA 2XIDA 2ZTDA 4CDGA 3TANA 1N5XA 8ICEA 1NK7A 4P4OA 9ICFA 2K4EA 3KD3A 2Y9UA 4C7YA 3H40A 3CP8A 3RF9A 2ZUBA 3F2DA 5J0TA 2D3DA 4ECQA 3SMVA 1SXDA 1NK4A 3MR2A 5KFIA 2IHMA 5ALWA 2HBKA 2V9WA 1Q46A 1RM6C 3ETLA 1Z1BA 4GIBA 2EAPA 2DQNB 9ICHA 5KG0A 2K8AA 2AXTU 4UARA 1L7NA 3UPQA 2KG5A 3AQFA 3WKAA 3C2KA 3LYSA 1YT3A 1FO4A 1SL2A 3V7LA 2BDPA 3FC4A 1BPZA 1XC9A 1C20A 2E3TA 4EX7A 2W03A 1XO1A 3FAHA 5IINA 5HMMA 3OPXA 3EW9A 3QU4A 1WCLA 3C28A 2JEFA 5DLFA 4M0AA 3F53A 3RH4A 5HR7A 4RPXA 9ICVA 2VJ4A 2G07A 2K4HA 8ICPA 9ICOA 2HW3A 2JV3A 2W3RA 1RXWA 4BUGA 1S0OA 4ED0A 4F5QA 2LYHA 3HX0A 4KLEA 2ZG6A 4U6PA 4YMNA 1X9WA 1BNPA 3GZFA 4ED8A 5AKLA 5AI8A 5DLGA 4C8LA 1U47A 1X2IA 2XGPA 4OD0A 2IOHA 4OJOA 8ICRA 1LB2B 2A1JA 2I5HA 5KFHA 4I2GA 4B9NA 3TFRA 5KFZA 7ICLA 4DL5A 4X5VA 4KMOB 4A8EA 1QH9A 5TISU 3I1YA 2GWSA 3PMLA 3RRHA 5ALGA 5JUMA 3B0YA 4R64A 3QEBZ 2PI4A 1UPHA 1ECWA 4K4IA 3WKDA 2MSNA 1ZQSA 3NVZA 5L1MA 2CPRA 2G06A 3BZCA 4KX3A 5J2IA 2NRVA 4Z6EA 3H8MA 4JB3A 5J0WA 4ELUA 4DS4A 4QJFB 2BPGA 4RQ4A 1KRPA 5L1KA 3UXOA 2XGQA 2ZJ8A 5J0PA 3H0MB 1A0PA 1B22A 8ICNA 3IV6A 2KIWA 4C7ZA 9ICGA 4EELA 5EE0A 2MA1A 5IIIA 4I28A 1ZQPA 2Y1IA 3V6HA 3H0LB 3BQ7A 1GO3F 4RQ8A 2BCQA 4KITB 5C5JA 3BQ2A 4F5NA 3RB6A 1NK5A 7ICRA 1S5LU 3PR4A 2NYVA 3LVVA 3PNCA 2FLPA 3D6JA 3OJSA 1T4GA 4C4SA 5IIJA 3TQ1A 2HVIA 3WK7A 3JPRA 3GV8B 3EYZA 4RQNA 5DDMA 7ICFA 5ALTA 5CEHA 1T7PA 4Z6CA 1KEJA 2YMPA 2BR0A 8ICBA 2K8CB 4QZHA 4DQPA 2J6UA 2M0NA 1L7OA 1IV8A 2WB1F 1XO0A 2W43A 4IRKA 9ICXA 1ZQAA 4TURA 3WKBA 1Y88A 5J2FA 4MHVA 5CR0A 4IQTA 1BNOA 2B21A 1NI3A 2XY7A 4OJ6A 9ICIA 4DLGA 3HKZC 4YR0A 3AL0B 4RQ3A 2ODGA 1ZQKA 2W3SA 2AGPA 1SZPA 4O3QA 4YQWA 3ZD8A 4F92B 3V7JA 4Q45A 4QWEA 3QU2A 4F2SA 4XA5A 2BCRA 3ZDCA 2OH2A 4IQVA 2OHFA 1V97A 3SENA 3LWLA 1QQ7A 1F0MA 4QZIA 4C8NA 1K1SA 4RUAA 4GLXA 4R8UB 1ZQGA 4O5EA 3V7KA 3V6JA 2F3NA 2XY5A 1DGJA 4OO1J 4Q43A 2NRZA 2D6FC 3KHHA 1X9XA 2I1QA 4QWDA 5IIMA 4GC7A 3G6YA 7ICSA 1PK3A 2WHEA 8ICUA 2FLNA 1BPEA 1PZNA 1L3VA 4KLGA 1FIQA 3RBEA 5KT3A 4NL9C 5ALXA 2AGQA 1S0VA 2XVTA 2KP7A 4DOBA 4P4MA 2HHXA 3UQ0A 2C2RA 1MC8A 2K8BB 5KFEA 2XY6A 3HRDD 5EWGA 5KFDA 2KMDA 1IG6A 3DEEA 5TZVA 2R8IA 1RDFA 3KKAC 1HIWA 3EUB2 1V38A 2KE7A 5AM3A 2DKXA 2PFPA 2V4RA 3D2SA 1SXEA 1QCKA 2HHWA 4FZMA 1ZOLA 3QZ7A 3KZXA 2KEYA 4JMUA 4NLBA 1Z4NA 5C0YA 3F5AA 2EDUA 2H3FA 1PVRA 2JMGA 1DGSA 2AH5A 2C2EA 4WJ3B 4UAWA 4UAZA 5HP4A 5J8YC 2BHNA 3L5KA 5DBBA 5AKYA 1XSLA 2VKQA 2NRWA 3JPTA 4DSIA 2ESEA 3Q8MA 1X66A 2RDIA 3M6ZA 1VLBA 2UVUA 2WF9A 2IOFK 1JROA 5KG6A 2N1RA 8ICYA 9ICBA 4O9MA 3K1RB 3PZPA 9ICLA 4DF8A 4ECYA 1ZQCA 3ISBA 3MDAA 1Z00A 3IM1A 3MBYA 3KFUF 4M9LA 3TACB 3T5HA 2L5YA 2XCPA 5J2CA 3PX0A 5K4LA 1S8OA 3T5JA 3VC8A 3JPSA 5DG7A 4EZ6A 2R8GA 7ICHA 2EAOA 4O3PA 4FS2A 4E0DA 2DWQA 4ACOA 3H4BA 4Y2PA 4PZOA 2WTFA 3PV8A 4J9MA 3RJJA 4NLCA 1RZTA 2QARA 7ICOA 1N60A 2ZIXB 1ZQ1C 3C2LA 4ECXA 2WF8A 1TK5A 1KBUA 4DSEA 4I29A 3MFIA 3CNHA 3UXPA 2OYYA 4M47A 8ICWA 4UAYA 1TK0A 4DL6A 1U49A 4EENA 4ED7A 1ZQTA 3T3FA 1ZQDA 4NWIA 1Z3EB 4CE6A 3SZ2A 2O6KA 5KT5A 4DQIA 2BPFA 3IG8A 2H3IA 4U7CA 3RR7A 1ZQHA 2LYBA 9ICUA 5DB8A 1KW4A 4DWIA 2BQUA 5J2HA 2ASDA 1N63A 4I2BA 1FFVA 4M6WB 5L1IA 2UVVA 3T5KA 3FDSA 5AKZA 3PW7A 3NGDA 3I76A 1XSNA 1U48A 2HVHA 4B9UA 1NKBA 5AKGA 2QB1A 4DFPA 3JPOA 3ETRA 1T8EA 2BPCA 5ALMA 1D8LA 1UCVA 2NV3A 2AHOB 3G6XA 4KLLA 2BDUA 4C8OA 1ZD2P 3QNMA 3OJUA 2Q4TA 1UA0A 3BDPA 3GV7B 1N61A 4QZEA 4ZOHC 2JHDA 3HW8A 2MUTA 5KFPA 1T94A 4MFFA 4IC9A 2W7OA 4P2HA 4B9TA 3ZDAA 3QX7A 5BPCA 4P0QA 2KHVA 5AKHA 1TE2A 3GIIA 2E8PA 4ECRA 1YZ6A 2ZTEA 2JRZA 4UB1A 1QQ6A 2HMXA 2HHTA 8ICLA 4IR1A 4DQRA 4KLMA 7ICIA 7ICQA 2VANA 4MFAA 1J97A 3ONNA 5AHXA 2YMMA 2EQYA 2RHFA 3ISDA 2YN4A 1LV5A 2LI6A 5DBCA 4RQ6A 3QUQA 3ZDDA 4J9SA 4UB6U 2AU0A 4B9VA 4LZDA 5KFGA 1NKEA 3ISCA 5J0QA 2KVCA 2B0CA 5KFYA 2FPMA 3M9NB 4QIWF 3K1ZA 2K89A 3C23A 1ZXIA 3QU9A 5DDYA 5KFKA 1KFTA 2KFZA 2ZIUB 4PHDA 2ZUDA 2E8NA 4DL2A 4ECUA 3N97B 4O5CA 1IIPA 4J9NA 2XCAA 3J81j 2BGWA 4KN4A 3WKEA 3UXNA 2IMWP 2OXOA 2P35A 2FMSA 5AI5A 1AROP 1FFUA 4EEYA 4PGYA 4UB5A 3ZDBA 3HKZF 1RYUA 3AEVA 4BDPA 3V72A 2E8OA 5ALLA 3UMBA 2Q0ZX 4PHAA 1HUOA 4RNNA 4DSJA 1S77D 4Y2TA 1QTMA 3WU2U 3D2NA 2BKEA 1V85A 1XS9D 5KFBA 3WK8A 4QZ9A 2VIXA 3AU6A 3C1YA 8ICGA 2EZZA 1B43A 2RRDA 5KFTA 7ICUA 1KSPA 2LYAA 1KDHA 1VDVA 3MR6A 4YD2A 2R18A 4M9JA 3HP6A 2Y1JA 2ZIWA 4I2DA 4QZCA 1X9MA 1WCNA 4QIWC 1KQQA 2F1IA 5ALOA 3M8RA 5AI0A 4FO6A 3N7RC 4O3MA 1ZQWA 3LK9A 2KKPA 3ED5A 3NRZA 2LBOA 1QSYA 3RJHA 5AM1A 1A76A 2PI5A 2Y0SF 4XRHA 4F5PA 2ES6A 1TKDA 3M7DA 2W9BB 5J0XA 4I2FA 2F2AB 1U45A 1ZQVA 1S0NA 2W9AA 5L1JA 4F5OA 1ED1A 2OWOA 3QYPA 3TARA 5AIBA 2F1HA 2KTQA 2PMZC 3EPIA 3Q8PB 5J2JA 3GILA 4ED6A 4JV2A 3WK5A 4J9LA 8ICQA 2G08A 4ECTA 3FYHA 4UBCA 3EWAA 5HHHA 4FZNA 1D9FA 3T79A 1P7DA 3Q8LA 1ZQJA 4DFKA 4DFMA 2LPEA 4UQGA 1LKYB 4Y2XA 4HYKA 3Q8SB 1S9FA 5KFFA 2F77X 3K75D 1L7MA 1S76D 1DOQA 2E1FA 1A77A 5HNKA 2W7PA 1L6NA 1WUDA 2W54A 2EANA 4R8UA 3CW2C 1OUQA 5ALHA 4ECVA 4Y2JA 3GQCA 2ZXHA 1S97A 8ICSA 4US9A 1RG6A 3I28A 3SAFA 4QNLA 2H3QA 5AI4A 5F9LA 4NY8A 2KNJA 4GXIA 1X9SA 1ZQNA 1M6YA 5BOLA 4P0PA 3F2BA 4QWCA 2KSOB 4TUQA 4NM1A 4OCZA 5AK6A 4KLFA 2HBJA 5EE9A 4RNMA 5KG4A 3E2EA 2ATLA 4LVSA 4Y2QA 1ZQZA 2XC9A 4BWMA 1OW5A 4GXJA 1TFRA 2AJQA 3PX4A 3MGHA 1TAUA 2AQ0A 4OJLA 3ZI4A 1LKYA 2KKVA 3PSPA 4PHEA 3C1ZA 3KHLA 4F4XA 4EBEA 4ED1A 2Z7JA 4LZGA 4F93B 4PL1A 4KLHA 3Q8RB 4DL7A 3GDXA 1ZETA 1WYGA 2JGAA 3MR5A 2G0AA 3KHGA 1KLNA 5A0LA 1ZJMA 2R8HA 2IBKA 2YY6A 1UT8A 4B9MA 2UVRA 4I2CA 2JEGA 2W9MA 2QARB 4IS7A 4IRDA 4BWJA 2NRXA 2KN7A 1NK6A 1QLNA 1EXNA 4BJQA 5L1LA 2G5HB 3JPNA 3WKCA 4M2YA 4DEZA 2WAQC 1KKXA 1JI7A 1WG8A 5KAIU 5J2DA 3PVXA 1RYSA 5B66U 1HUZA 4I2EA 3OTQA 3SAGA 2KICA 3O0FA 3SI8A 4RPZA 1BGXT 2DGZA 3KKAA 1SWWA 2M9NA 1URJA 4O3NA 3KHRA 2DL0A 1COKA 4I2JA 5KG1A 4B6JA 1SV0A 1DXSA 5KFUA 1COOA 1O08A 4M9NA 4IL6U 1KN5A 4NLGA 5AM0A 1BPDA 5AM5A 3QE9Y 1JXEA 2HHQA 4KX5A 2DBYA 2QKQA 4CNQA 4K4GA 1K1QA 5AK4A 4YD1A 2VJ5A 5FP0A 4RT2A 3H8SA 4FBUA 3UM9A 2VA8A 5DQHA 1N5WA 2K4PA 3D2QA 2FPKA 1TAQA 5ALFA 1TK8A 5KFJA 1RPLA 4F8RA 1X40A 3RB0A 1PK1B 3KBBA 2ASLA 2MU2A 4M9GA 1Q3VA 5ALPA 1BPBA 3BS5B 1AQ6A 7ICJA 5J0UA 3G6VA 5KAFU 4O3OA 3EPGA 4IRCA 3L4PA 2KHQA 4QZBA 4JK1A 4YR2A 2J6SA 4QW8A 3TFSA 3OSPA 2FMPA 3H0RB 2AQ4A 1U9LA 1L3SA 3PSTA 5ALVA 2KIVA 5ALEA 2HBLA 5EE1A 2OCEA 2XICA 3THVA 3OGUA 1N48A 7ICEA 3UMCA 4JUZA 1RQNA 3BJYA 4CCHA 1JALA 2FI1A 4OJPA 5ALZA 3QZ8A 4F3OA 9ICMA 2ALZA 5ALNA 2YTUA 1JRPA 3H8JA 5ALIA 4EZ9A 2YQEA 4DSLA 8ICIA 4GFJA 4Y2SA 1NJXA 1NJWA 4G9BA 4UAUA 2HHSA 4UB3A 5HMLA 5KFVA 2PMZF 2MRLA 5EE3A 4PH5A 4QZFA 1ZD4A 4QW9A 4LJXA 1UT5A 3H7IA 2WB1C 4ELTA 2P6UA 2HOQA 3N7SC 2KZ3A 2ZTCA 8ICXA 2EZYA 3RRGA 5AM2A 4IQUA 5CHGA
chains in the Genus database with same CATH topology
4PL2A 4AYBC 3PSPA 3OPXA 2KIWA 2PMZC 2XI9A 2Z7JA 2F76X 4OO1J 2MA1A 3C28A 4PL1A 1XNSA 2NV3A 2ZIUA 3CYMA 2OXOA 2JGAA 2D6FC 2BDUA 2G08A 4OJ5A 3KFUF 2G0AA 3H0LB 4FZNA 1GO3F 1Q3VA 3F53A 3T79A 2Q4TA 1P7DA 1CRXA 2K4IA 3HKZF 2YB4A 3M6KA 5A0LA 5HR7A 2JH1A 2H3VA 4NV0A 3PSIA 3IG5A 3VCBA 3E0FA 2VJ4A 2A3VA 3LVWA 2G07A 2JHDA 2K4HA 2XVTA 5KL8B 2JH7A 2F77X 2CN1A 3C29A 1PVQA 3VC8A 1HEKA 2E1FA 3LVVA 2KHQA 3NRWA 3MGVA 1T94A 2K8BB 4IC9A 1PVPA 5KL1B 4C0ZA 2W7PA 2W7OA 2GOLA 3SAGA 2YB1A 1L6NA 1NZBA 1WUDA 4BUGA 4ACOA 4BJQA 2E1EA 2GH1A 3D2NA 4BX9C 3H0RB 2HOFA 3DEEA 1OUQA 2G5HB 1F44A 2OM6A 3N7PD 2ZG6A 2KHVA 3PSTA 4ICAA 4NLCA 3L3FX 4P0QA 4U6PA 5CRXA 2WAQC 2ZIWB 4P0PB 2ZXHA 2HBMA 2VIXA 1HIWA 2KV2A 4FE3A 2KJ9A 2WAQF 2ZIXB 1ZQ1C 3GZFA 1Z19A 1A6SA 2H3ZA 1KBUA 2RP5A 2XIDA 3NUQA 2K8CB 2HBLA 2KICA 3O0FA 4AYBF 4CDGA 2RRDA 2CRXA 3SAFA 1TAMA 3D2SA 2XICA 3GU3A 4OJOA 4QNLA 2H3QA 2DGZA 2LYAA 2OYYA 2ZIVB 2ZXIA 4CGZA 2M0NA 2KNJA 3PSFA 4FZMA 3KZXA 3SAHA 2KEYA 2R18A 2WB1F 1XO0A 1Q3UA 3IP4B 1URJA 4JMUA 4NLBA 1D8BA 4P0PA 5C0YA 2ZIWA 3F2BA 1DRGA 2K4EA 3F5AA 2HMXA 4OJPA 3SQIA 4NWIA 2KJ5A 4QIWC 2H3FA 4KMOB 2YX8A 2JMGA 4A8EA 3F5EA 2Y0SC 1PVRA 3CP8A 3ALRA 3RF9A 3F2DA 3ONNA 4OJ6A 2W04A 4WJ3B 2LHTA 3ICXA 3SMVA 3HKZC 3IG8A 2G09A 2H3IA 3AQEA 2RHFA 3AL0B 3N7RC 4O3MA 4U7CA 2LKYA 1UPHA 2HBJA 1ECWA 2ZIVA 2HBKA 3F2CA 4GFJA 1SZHA 2KKPA 2LYBA 2LBOA 1Z1BA 2E5SA 2DQNB 2CPRA 2G06A 2VKQA 4KX3A 4KX5A 1MA7A 2PMZF 2MRLA 2KVCA 2K8AA 4FZLA 4P0QB 2VJ5A 2Y0SF 5T14A 3AQFA 2OH2A 4QIWF 2KJ8A 3K1ZA 2F8LA 3LYSA 3M6ZA 2K89A 2DF4B 3M7DA 4QJFB 2ZIXA 3CRXA 1YT3A 2KKVA 5HR6A 2N1RA 2ZIUB 2WB1C 2F2AB 2HOQA 4OJLA 3IN5A 4CRXA 2KD1A 3N7SC 1ED1A 3RFAA 2HOIA 2G5IB 2W03A 3PZPA 3H0MB 1A0PA 1IIPA 2KOBA 3D2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VC8 A;  3VCB A;  3GZF A; 
#chains in the Genus database with same CATH topology
 2WFA A;  1MQ2 A;  4YG2 A;  4YXJ A;  2VA3 A;  7ICV A;  4O5K A;  2IA6 A;  5D46 A;  3NAS A;  2V4Q A;  1V9P A;  1ZQB A;  2A1A A;  1ZQO A;  2HDO A;  3UQ2 A;  4FBT A;  1K5O A;  3HWT A;  3HJE A;  4J9Q A;  2YB4 A;  1ZQE A;  4ECZ A;  2RDJ A;  4J03 A;  1ZQY A;  3QU5 A;  9ICC A;  3GIK A;  4QZD A;  2FPL A;  1ZRM A;  4EX6 A;  3MGV A;  3RB4 A;  1S10 A;  3AM9 A;  2GOL A;  4QZ8 A;  4ELV A;  1TVA A;  5KFO A;  2ISO A;  1T3N A;  3JPP A;  4DS5 A;  5DGA A;  3NVW A;  5ALU A;  1J2N A;  2HBM A;  1NOM A;  1PUZ A;  4RQ5 A;  2IHN A;  3C5F A;  2F44 A;  2ZXI A;  4CGZ A;  2BZF A;  5KT4 A;  4Q44 A;  3V6K A;  1SIJ A;  4M04 A;  4F91 B;  4KMU A;  2YX8 A;  4UBB A;  8ICJ A;  2CXY A;  4O0I A;  2LHT A;  4UAS A;  8ICT A;  3A0B U;  1BPY A;  4C4T A;  4TUP A;  1ZQQ A;  2WF7 A;  1WWU A;  5KFX A;  2GO7 A;  1CI4 A;  5J0R A;  4JV0 A;  5D4B A;  4ZH4 A;  1X6J A;  2C22 A;  9ICW A;  2KSO A;  5T14 A;  2GLE A;  2F8L A;  2FJ6 A;  3CRX A;  5ALY A;  3SV3 A;  3MC1 A;  3IN5 A;  3RJE A;  2HOI A;  5KFQ A;  1ZQU A;  4YMO A;  1Z4O A;  5IIK A;  5IIO A;  2QB0 B;  2LMR A;  4PHP A;  2WF5 A;  1N56 A;  3CYM A;  5ALQ A;  1BPX A;  5AIA A;  1NZP A;  3PW2 A;  5DQG A;  9ICR A;  1WWV A;  1S0M A;  5J0S A;  1NKC A;  4EBD A;  3JPQ A;  5GTI U;  3HT3 A;  3HIL A;  4DL4 A;  1HEK A;  8ICC A;  2QB0 A;  4DL3 A;  1ZQL A;  3TI0 A;  4YMM A;  2W9C B;  2I9G A;  4KLS A;  1X42 A;  3IDW A;  2ASJ A;  4MEY A;  5AK3 A;  5DG9 A;  2KK0 A;  4MFC A;  4P0P B;  4F50 A;  4F4W A;  4UAV A;  2H3Z A;  2RP5 A;  4YFK A;  3PW4 A;  4P4P A;  3GU3 A;  2ZIV B;  1PK1 A;  7ICP A;  4US8 A;  2DUY A;  5HHI A;  1H38 A;  1KFS A;  2ZJA A;  1Q3U A;  3PW5 A;  3PW0 A;  1QSS A;  5KFA A;  2RLT A;  1L3T A;  3QU7 A;  2LM4 A;  7ICG A;  2KFN A;  3Q8Q B;  2PKE A;  1BVS A;  2JZB A;  5KFS A;  2ZIV A;  5KT7 A;  4RNO A;  5KFC A;  1B4F A;  7ICT A;  4KTQ A;  2E5S A;  4NXZ A;  2PFO A;  8ICK A;  3MAB A;  1MA7 A;  3M9O B;  3AMZ A;  2HHV A;  4RPY A;  5DB7 A;  1J2M A;  8ICA A;  1ZD5 A;  4PPX A;  3GIJ A;  2XO7 A;  3RJF A;  4O3S A;  2G5I B;  1SV4 A;  2A19 A;  1DK3 A;  5J0Y A;  2F8K A;  1RYR A;  3BZK A;  4HAI A;  4YCX A;  3C2M A;  5KG3 A;  2AGO A;  3K4G A;  4YR3 A;  1D8Y A;  4DCC A;  2PFN A;  4OJ5 A;  1B0X A;  1SGG A;  1JUD A;  1CUK A;  3S6J A;  3M6K A;  5EWE A;  2UVW A;  2H3V A;  4B9S A;  1JXL A;  3LVW A;  2FLL A;  4F71 A;  1SB3 C;  5AK5 A;  2CN1 A;  5D49 A;  3RH6 A;  3QUC A;  4AP9 A;  1ZQI A;  3OHB A;  4JV1 A;  5J2A A;  2W9B A;  1L7P A;  3SD7 A;  3BQT A;  5EOZ A;  2JEI A;  2YB1 A;  2BCU A;  3U26 A;  2W8L A;  1ZQX A;  4PZN A;  2HOF A;  1SKR A;  4J9P A;  3RJG A;  3M9M B;  4RQM A;  2KJ9 A;  3FM9 A;  4RQ1 A;  4GXK A;  1SWV A;  2CRX A;  4MEX A;  2MAX A;  1TAM A;  4Q8E A;  4UB4 A;  2ISP A;  3SAH A;  1UA1 A;  4DFD A;  4M9H A;  4KLO A;  5CWR A;  3SV4 A;  2QLT A;  3MGI A;  1ZQM A;  5F9N A;  1YZ7 A;  3SQI A;  1NJY A;  5CB1 A;  2FDR A;  2ZJ5 A;  4RQ7 A;  2W04 A;  2KZZ A;  3AUO A;  4NJ8 A;  2G09 A;  1VJ5 A;  5H2F U;  1SV0 C;  3WK9 A;  1L5U A;  2ZUC A;  1ZQR A;  2OEH A;  4YP3 A;  3F2C A;  5B5E U;  1JIH A;  2PXI A;  4C4R A;  3KOO A;  4KLU A;  9ICT A;  5ALJ A;  2DFL A;  1FEZ A;  4Z6D A;  4BGD A;  2BCV A;  1ZD3 A;  1IM4 A;  2KJ8 A;  1SKS A;  4RQ2 A;  4EYI B;  3AN1 A;  5ALK A;  2KD1 A;  2R8K A;  2NO4 A;  2DKZ A;  3B0X A;  4R63 A;  2P66 A;  2A1J B;  4DLE A;  4AYB C;  4DSK A;  2NO5 A;  5DGB A;  3LWM A;  3Q8K A;  7ICK A;  5CJ7 A;  4QWA A;  2MUT B;  1Z00 B;  4KLT A;  3OHA A;  4KLD A;  2Y9T A;  3RAX A;  5DBA A;  1XSP A;  4RT3 A;  4ECS A;  1CRX A;  1X6I A;  3TAQ A;  3MDC A;  1MN8 A;  2YML A;  5KT6 A;  5KL8 B;  1F5S A;  2JH7 A;  4PJ0 U;  4O3R A;  9ICE A;  3ZDE A;  3C21 A;  5DKW A;  3A0H U;  4EBC A;  5ALR A;  5J29 A;  4C0Z A;  4RUC A;  4I27 A;  2E1E A;  3GV5 B;  2KZM A;  8ICO A;  2GH1 A;  3SYZ A;  5KG2 A;  4UB8 U;  4BX9 C;  5DB6 A;  3WK4 A;  5AKE A;  2W55 A;  5GTH U;  2OM6 A;  1Z1V A;  4ICA A;  5AKJ A;  3L3F X;  4NLK A;  4UAT A;  2HCF A;  3ORY A;  2EH9 A;  4RZR A;  3EZ5 A;  1Z19 A;  4DO9 A;  9ICK A;  3H4D A;  2YMQ A;  2W9C A;  3UMG A;  2JEJ A;  3IP4 B;  4R65 A;  4NL9 A;  3NS1 A;  1DRG A;  4TQS A;  3F5E A;  2Y0S C;  5F3X B;  4UW9 A;  3ICX A;  3QUT A;  4C80 A;  3AQE A;  1ZQF A;  3TKA A;  1N2X A;  2C28 A;  4CF3 A;  5JU5 A;  5AKI A;  4QZG A;  3QEA Z;  1Q8K A;  3PY8 A;  3SR6 A;  4P0Q B;  3KTQ A;  2BQR A;  3BS7 A;  5AKX A;  4IR9 A;  5HR6 A;  4C8K A;  5AIC A;  5J2G A;  1XWL A;  9ICS A;  3RFA A;  3HPO A;  1JN3 A;  4DQQ A;  2XI9 A;  5ALD A;  4CF5 A;  3AU2 A;  2IOF A;  3QXG A;  5J2B A;  5KFM A;  2VA2 A;  4J9K A;  5KFN A;  1N62 A;  3T5L A;  1MSW D;  3B9J A;  4C8M A;  3RB3 A;  4JWN A;  4JWM A;  5J8Y A;  5CA7 A;  3RAQ A;  4DF4 A;  1LVH A;  5J0O A;  5KFL A;  4RQ0 A;  3R9K A;  2BQ3 A;  4KN7 A;  4TUS A;  2C2D A;  3MR3 A;  5CP2 A;  5DG8 A;  1F44 A;  9ICQ A;  4Y2V A;  2DPJ A;  5CRX A;  2ZIW B;  3PO4 A;  4XUS A;  8ICV A;  2W8K A;  4FE3 A;  1JMS A;  1L8O A;  3RJK A;  8ICF A;  2W11 A;  4Y2Y A;  4F4Z A;  4DOC A;  4FS1 A;  1C7Y A;  2F1J A;  2HSZ A;  3ZD9 A;  1D8B A;  4FFD A;  1RXV A;  9ICJ A;  1ZRN A;  4UB2 A;  3DV9 A;  4TQR A;  3M8S A;  2JXJ A;  2KJ5 A;  3H8W A;  5BOM A;  4NM2 A;  3ALR A;  4J9O A;  1UQV A;  2EAM A;  4R66 A;  3PR5 B;  3NTU A;  2LKY A;  1CEZ A;  5KFR A;  3TAD A;  7ICM A;  2E8M A;  4CF4 A;  4PGQ A;  3DDH A;  4IQW A;  4FZL A;  3QUB A;  2WF6 A;  3RJI A;  3N4M B;  8ICH A;  4MF8 A;  4Y2U A;  8ICZ A;  5ALS A;  5E79 U;  1JX4 A;  3KZI U;  2JZB B;  1O03 A;  2DPI A;  4USA A;  3GIM A;  1NK0 A;  4G3I A;  3PO5 A;  2KOB A;  4PL2 A;  2H5X A;  4YN4 A;  4B9L A;  2FE9 A;  4QWB A;  4DSF A;  4I2I A;  2F76 X;  1XNS A;  2I6X A;  3IHQ B;  3TAP A;  2ZIU A;  8ICM A;  3RBD A;  5IIL A;  4EEK A;  4KLJ A;  5KG5 A;  4BXO A;  1KFD A;  4DFJ A;  1ZYQ A;  2K4I A;  4KLQ A;  3BS5 A;  1NK8 A;  1KTQ A;  4ED2 A;  3PSI A;  2HHU A;  3E0F A;  4NLN A;  1OXJ A;  3RH5 A;  1T3Q A;  4F72 A;  2K60 A;  5AKK A;  5G5G A;  3PX6 A;  9ICP A;  1PVP A;  2R8J A;  4YVZ A;  1NZB A;  4NLZ A;  5AM4 A;  1NJZ A;  4BXO B;  4ED3 A;  5KT2 A;  4Z6F A;  7ICN A;  1HJP A;  4RU9 A;  4I2A A;  1DK2 A;  1D9D A;  3NUQ A;  3PMN A;  4AYB F;  3MFH A;  1UHU A;  4F5R A;  2FMQ A;  4GC6 A;  3PSF A;  3NVV A;  1IXR A;  4XQ8 A;  3IRU A;  5JRT A;  3RR8 A;  2HI0 A;  5EWF A;  2PFQ A;  4I2H A;  1SL1 A;  9ICN A;  1TV9 A;  4Q8F A;  4QZA A;  1SL0 A;  3TAD C;  5KTQ A;  5KG7 A;  5AI6 A;  5KNI A;  3WK6 A;  1SZH A;  2RQ5 A;  1XU4 A;  4PGX A;  1U4B A;  3M1Y A;  4DOA A;  4MF2 A;  4YXM A;  4ECW A;  1RQL A;  2D8C A;  4K4H A;  3BQ0 A;  2DF4 B;  2ZIX A;  2P6R A;  4Y2R A;  3N28 A;  4CRX A;  5L9X A;  5KFW A;  9ICA A;  4EYH B;  3GFK B;  1NNL A;  1QSL A;  1SKW A;  1MQ3 A;  5JTI A;  2JR5 A;  3OSN A;  4F2R A;  2KVS A;  5AI9 A;  1KL9 A;  2NRT A;  1L8L A;  3BQ1 A;  1ZJN A;  2JH1 A;  4NV0 A;  3IG5 A;  3VCB A;  4J9R A;  2A3V A;  2BCS A;  1L3U A;  3NVY A;  4KLI A;  3C29 A;  1PVQ A;  2LM1 A;  2J6T A;  3NRW A;  3E58 A;  3C5G A;  2EZX A;  5KL1 B;  5J2K A;  3RTV A;  4DQS A;  5J2E A;  4F4K A;  2B6G A;  3N7P D;  3LDA A;  5DB9 A;  1NK9 A;  5DQI A;  3SEI A;  4M6W A;  4F4Y A;  2KV2 A;  2WAQ F;  1A6S A;  1QQ5 A;  5G5H A;  2XID A;  2ZTD A;  4CDG A;  3TAN A;  1N5X A;  8ICE A;  1NK7 A;  4P4O A;  9ICF A;  2K4E A;  3KD3 A;  2Y9U A;  4C7Y A;  3H40 A;  3CP8 A;  3RF9 A;  2ZUB A;  3F2D A;  5J0T A;  2D3D A;  4ECQ A;  3SMV A;  1SXD A;  1NK4 A;  3MR2 A;  5KFI A;  2IHM A;  5ALW A;  2HBK A;  2V9W A;  1Q46 A;  1RM6 C;  3ETL A;  1Z1B A;  4GIB A;  2EAP A;  2DQN B;  9ICH A;  5KG0 A;  2K8A A;  2AXT U;  4UAR A;  1L7N A;  3UPQ A;  2KG5 A;  3AQF A;  3WKA A;  3C2K A;  3LYS A;  1YT3 A;  1FO4 A;  1SL2 A;  3V7L A;  2BDP A;  3FC4 A;  1BPZ A;  1XC9 A;  1C20 A;  2E3T A;  4EX7 A;  2W03 A;  1XO1 A;  3FAH A;  5IIN A;  5HMM A;  3OPX A;  3EW9 A;  3QU4 A;  1WCL A;  3C28 A;  2JEF A;  5DLF A;  4M0A A;  3F53 A;  3RH4 A;  5HR7 A;  4RPX A;  9ICV A;  2VJ4 A;  2G07 A;  2K4H A;  8ICP A;  9ICO A;  2HW3 A;  2JV3 A;  2W3R A;  1RXW A;  4BUG A;  1S0O A;  4ED0 A;  4F5Q A;  2LYH A;  3HX0 A;  4KLE A;  2ZG6 A;  4U6P A;  4YMN A;  1X9W A;  1BNP A;  3GZF A;  4ED8 A;  5AKL A;  5AI8 A;  5DLG A;  4C8L A;  1U47 A;  1X2I A;  2XGP A;  4OD0 A;  2IOH A;  4OJO A;  8ICR A;  1LB2 B;  2A1J A;  2I5H A;  5KFH A;  4I2G A;  4B9N A;  3TFR A;  5KFZ A;  7ICL A;  4DL5 A;  4X5V A;  4KMO B;  4A8E A;  1QH9 A;  5TIS U;  3I1Y A;  2GWS A;  3PML A;  3RRH A;  5ALG A;  5JUM A;  3B0Y A;  4R64 A;  3QEB Z;  2PI4 A;  1UPH A;  1ECW A;  4K4I A;  3WKD A;  2MSN A;  1ZQS A;  3NVZ A;  5L1M A;  2CPR A;  2G06 A;  3BZC A;  4KX3 A;  5J2I A;  2NRV A;  4Z6E A;  3H8M A;  4JB3 A;  5J0W A;  4ELU A;  4DS4 A;  4QJF B;  2BPG A;  4RQ4 A;  1KRP A;  5L1K A;  3UXO A;  2XGQ A;  2ZJ8 A;  5J0P A;  3H0M B;  1A0P A;  1B22 A;  8ICN A;  3IV6 A;  2KIW A;  4C7Z A;  9ICG A;  4EEL A;  5EE0 A;  2MA1 A;  5III A;  4I28 A;  1ZQP A;  2Y1I A;  3V6H A;  3H0L B;  3BQ7 A;  1GO3 F;  4RQ8 A;  2BCQ A;  4KIT B;  5C5J A;  3BQ2 A;  4F5N A;  3RB6 A;  1NK5 A;  7ICR A;  1S5L U;  3PR4 A;  2NYV A;  3LVV A;  3PNC A;  2FLP A;  3D6J A;  3OJS A;  1T4G A;  4C4S A;  5IIJ A;  3TQ1 A;  2HVI A;  3WK7 A;  3JPR A;  3GV8 B;  3EYZ A;  4RQN A;  5DDM A;  7ICF A;  5ALT A;  5CEH A;  1T7P A;  4Z6C A;  1KEJ A;  2YMP A;  2BR0 A;  8ICB A;  2K8C B;  4QZH A;  4DQP A;  2J6U A;  2M0N A;  1L7O A;  1IV8 A;  2WB1 F;  1XO0 A;  2W43 A;  4IRK A;  9ICX A;  1ZQA A;  4TUR A;  3WKB A;  1Y88 A;  5J2F A;  4MHV A;  5CR0 A;  4IQT A;  1BNO A;  2B21 A;  1NI3 A;  2XY7 A;  4OJ6 A;  9ICI A;  4DLG A;  3HKZ C;  4YR0 A;  3AL0 B;  4RQ3 A;  2ODG A;  1ZQK A;  2W3S A;  2AGP A;  1SZP A;  4O3Q A;  4YQW A;  3ZD8 A;  4F92 B;  3V7J A;  4Q45 A;  4QWE A;  3QU2 A;  4F2S A;  4XA5 A;  2BCR A;  3ZDC A;  2OH2 A;  4IQV A;  2OHF A;  1V97 A;  3SEN A;  3LWL A;  1QQ7 A;  1F0M A;  4QZI A;  4C8N A;  1K1S A;  4RUA A;  4GLX A;  4R8U B;  1ZQG A;  4O5E A;  3V7K A;  3V6J A;  2F3N A;  2XY5 A;  1DGJ A;  4OO1 J;  4Q43 A;  2NRZ A;  2D6F C;  3KHH A;  1X9X A;  2I1Q A;  4QWD A;  5IIM A;  4GC7 A;  3G6Y A;  7ICS A;  1PK3 A;  2WHE A;  8ICU A;  2FLN A;  1BPE A;  1PZN A;  1L3V A;  4KLG A;  1FIQ A;  3RBE A;  5KT3 A;  4NL9 C;  5ALX A;  2AGQ A;  1S0V A;  2XVT A;  2KP7 A;  4DOB A;  4P4M A;  2HHX A;  3UQ0 A;  2C2R A;  1MC8 A;  2K8B B;  5KFE A;  2XY6 A;  3HRD D;  5EWG A;  5KFD A;  2KMD A;  1IG6 A;  3DEE A;  5TZV A;  2R8I A;  1RDF A;  3KKA C;  1HIW A;  3EUB 2;  1V38 A;  2KE7 A;  5AM3 A;  2DKX A;  2PFP A;  2V4R A;  3D2S A;  1SXE A;  1QCK A;  2HHW A;  4FZM A;  1ZOL A;  3QZ7 A;  3KZX A;  2KEY A;  4JMU A;  4NLB A;  1Z4N A;  5C0Y A;  3F5A A;  2EDU A;  2H3F A;  1PVR A;  2JMG A;  1DGS A;  2AH5 A;  2C2E A;  4WJ3 B;  4UAW A;  4UAZ A;  5HP4 A;  5J8Y C;  2BHN A;  3L5K A;  5DBB A;  5AKY A;  1XSL A;  2VKQ A;  2NRW A;  3JPT A;  4DSI A;  2ESE A;  3Q8M A;  1X66 A;  2RDI A;  3M6Z A;  1VLB A;  2UVU A;  2WF9 A;  2IOF K;  1JRO A;  5KG6 A;  2N1R A;  8ICY A;  9ICB A;  4O9M A;  3K1R B;  3PZP A;  9ICL A;  4DF8 A;  4ECY A;  1ZQC A;  3ISB A;  3MDA A;  1Z00 A;  3IM1 A;  3MBY A;  3KFU F;  4M9L A;  3TAC B;  3T5H A;  2L5Y A;  2XCP A;  5J2C A;  3PX0 A;  5K4L A;  1S8O A;  3T5J A;  3VC8 A;  3JPS A;  5DG7 A;  4EZ6 A;  2R8G A;  7ICH A;  2EAO A;  4O3P A;  4FS2 A;  4E0D A;  2DWQ A;  4ACO A;  3H4B A;  4Y2P A;  4PZO A;  2WTF A;  3PV8 A;  4J9M A;  3RJJ A;  4NLC A;  1RZT A;  2QAR A;  7ICO A;  1N60 A;  2ZIX B;  1ZQ1 C;  3C2L A;  4ECX A;  2WF8 A;  1TK5 A;  1KBU A;  4DSE A;  4I29 A;  3MFI A;  3CNH A;  3UXP A;  2OYY A;  4M47 A;  8ICW A;  4UAY A;  1TK0 A;  4DL6 A;  1U49 A;  4EEN A;  4ED7 A;  1ZQT A;  3T3F A;  1ZQD A;  4NWI A;  1Z3E B;  4CE6 A;  3SZ2 A;  2O6K A;  5KT5 A;  4DQI A;  2BPF A;  3IG8 A;  2H3I A;  4U7C A;  3RR7 A;  1ZQH A;  2LYB A;  9ICU A;  5DB8 A;  1KW4 A;  4DWI A;  2BQU A;  5J2H A;  2ASD A;  1N63 A;  4I2B A;  1FFV A;  4M6W B;  5L1I A;  2UVV A;  3T5K A;  3FDS A;  5AKZ A;  3PW7 A;  3NGD A;  3I76 A;  1XSN A;  1U48 A;  2HVH A;  4B9U A;  1NKB A;  5AKG A;  2QB1 A;  4DFP A;  3JPO A;  3ETR A;  1T8E A;  2BPC A;  5ALM A;  1D8L A;  1UCV A;  2NV3 A;  2AHO B;  3G6X A;  4KLL A;  2BDU A;  4C8O A;  1ZD2 P;  3QNM A;  3OJU A;  2Q4T A;  1UA0 A;  3BDP A;  3GV7 B;  1N61 A;  4QZE A;  4ZOH C;  2JHD A;  3HW8 A;  2MUT A;  5KFP A;  1T94 A;  4MFF A;  4IC9 A;  2W7O A;  4P2H A;  4B9T A;  3ZDA A;  3QX7 A;  5BPC A;  4P0Q A;  2KHV A;  5AKH A;  1TE2 A;  3GII A;  2E8P A;  4ECR A;  1YZ6 A;  2ZTE A;  2JRZ A;  4UB1 A;  1QQ6 A;  2HMX A;  2HHT A;  8ICL A;  4IR1 A;  4DQR A;  4KLM A;  7ICI A;  7ICQ A;  2VAN A;  4MFA A;  1J97 A;  3ONN A;  5AHX A;  2YMM A;  2EQY A;  2RHF A;  3ISD A;  2YN4 A;  1LV5 A;  2LI6 A;  5DBC A;  4RQ6 A;  3QUQ A;  3ZDD A;  4J9S A;  4UB6 U;  2AU0 A;  4B9V A;  4LZD A;  5KFG A;  1NKE A;  3ISC A;  5J0Q A;  2KVC A;  2B0C A;  5KFY A;  2FPM A;  3M9N B;  4QIW F;  3K1Z A;  2K89 A;  3C23 A;  1ZXI A;  3QU9 A;  5DDY A;  5KFK A;  1KFT A;  2KFZ A;  2ZIU B;  4PHD A;  2ZUD A;  2E8N A;  4DL2 A;  4ECU A;  3N97 B;  4O5C A;  1IIP A;  4J9N A;  2XCA A;  3J81 j;  2BGW A;  4KN4 A;  3WKE A;  3UXN A;  2IMW P;  2OXO A;  2P35 A;  2FMS A;  5AI5 A;  1ARO P;  1FFU A;  4EEY A;  4PGY A;  4UB5 A;  3ZDB A;  3HKZ F;  1RYU A;  3AEV A;  4BDP A;  3V72 A;  2E8O A;  5ALL A;  3UMB A;  2Q0Z X;  4PHA A;  1HUO A;  4RNN A;  4DSJ A;  1S77 D;  4Y2T A;  1QTM A;  3WU2 U;  3D2N A;  2BKE A;  1V85 A;  1XS9 D;  5KFB A;  3WK8 A;  4QZ9 A;  2VIX A;  3AU6 A;  3C1Y A;  8ICG A;  2EZZ A;  1B43 A;  2RRD A;  5KFT A;  7ICU A;  1KSP A;  2LYA A;  1KDH A;  1VDV A;  3MR6 A;  4YD2 A;  2R18 A;  4M9J A;  3HP6 A;  2Y1J A;  2ZIW A;  4I2D A;  4QZC A;  1X9M A;  1WCN A;  4QIW C;  1KQQ A;  2F1I A;  5ALO A;  3M8R A;  5AI0 A;  4FO6 A;  3N7R C;  4O3M A;  1ZQW A;  3LK9 A;  2KKP A;  3ED5 A;  3NRZ A;  2LBO A;  1QSY A;  3RJH A;  5AM1 A;  1A76 A;  2PI5 A;  2Y0S F;  4XRH A;  4F5P A;  2ES6 A;  1TKD A;  3M7D A;  2W9B B;  5J0X A;  4I2F A;  2F2A B;  1U45 A;  1ZQV A;  1S0N A;  2W9A A;  5L1J A;  4F5O A;  1ED1 A;  2OWO A;  3QYP A;  3TAR A;  5AIB A;  2F1H A;  2KTQ A;  2PMZ C;  3EPI A;  3Q8P B;  5J2J A;  3GIL A;  4ED6 A;  4JV2 A;  3WK5 A;  4J9L A;  8ICQ A;  2G08 A;  4ECT A;  3FYH A;  4UBC A;  3EWA A;  5HHH A;  4FZN A;  1D9F A;  3T79 A;  1P7D A;  3Q8L A;  1ZQJ A;  4DFK A;  4DFM A;  2LPE A;  4UQG A;  1LKY B;  4Y2X A;  4HYK A;  3Q8S B;  1S9F A;  5KFF A;  2F77 X;  3K75 D;  1L7M A;  1S76 D;  1DOQ A;  2E1F A;  1A77 A;  5HNK A;  2W7P A;  1L6N A;  1WUD A;  2W54 A;  2EAN A;  4R8U A;  3CW2 C;  1OUQ A;  5ALH A;  4ECV A;  4Y2J A;  3GQC A;  2ZXH A;  1S97 A;  8ICS A;  4US9 A;  1RG6 A;  3I28 A;  3SAF A;  4QNL A;  2H3Q A;  5AI4 A;  5F9L A;  4NY8 A;  2KNJ A;  4GXI A;  1X9S A;  1ZQN A;  1M6Y A;  5BOL A;  4P0P A;  3F2B A;  4QWC A;  2KSO B;  4TUQ A;  4NM1 A;  4OCZ A;  5AK6 A;  4KLF A;  2HBJ A;  5EE9 A;  4RNM A;  5KG4 A;  3E2E A;  2ATL A;  4LVS A;  4Y2Q A;  1ZQZ A;  2XC9 A;  4BWM A;  1OW5 A;  4GXJ A;  1TFR A;  2AJQ A;  3PX4 A;  3MGH A;  1TAU A;  2AQ0 A;  4OJL A;  3ZI4 A;  1LKY A;  2KKV A;  3PSP A;  4PHE A;  3C1Z A;  3KHL A;  4F4X A;  4EBE A;  4ED1 A;  2Z7J A;  4LZG A;  4F93 B;  4PL1 A;  4KLH A;  3Q8R B;  4DL7 A;  3GDX A;  1ZET A;  1WYG A;  2JGA A;  3MR5 A;  2G0A A;  3KHG A;  1KLN A;  5A0L A;  1ZJM A;  2R8H A;  2IBK A;  2YY6 A;  1UT8 A;  4B9M A;  2UVR A;  4I2C A;  2JEG A;  2W9M A;  2QAR B;  4IS7 A;  4IRD A;  4BWJ A;  2NRX A;  2KN7 A;  1NK6 A;  1QLN A;  1EXN A;  4BJQ A;  5L1L A;  2G5H B;  3JPN A;  3WKC A;  4M2Y A;  4DEZ A;  2WAQ C;  1KKX A;  1JI7 A;  1WG8 A;  5KAI U;  5J2D A;  3PVX A;  1RYS A;  5B66 U;  1HUZ A;  4I2E A;  3OTQ A;  3SAG A;  2KIC A;  3O0F A;  3SI8 A;  4RPZ A;  1BGX T;  2DGZ A;  3KKA A;  1SWW A;  2M9N A;  1URJ A;  4O3N A;  3KHR A;  2DL0 A;  1COK A;  4I2J A;  5KG1 A;  4B6J A;  1SV0 A;  1DXS A;  5KFU A;  1COO A;  1O08 A;  4M9N A;  4IL6 U;  1KN5 A;  4NLG A;  5AM0 A;  1BPD A;  5AM5 A;  3QE9 Y;  1JXE A;  2HHQ A;  4KX5 A;  2DBY A;  2QKQ A;  4CNQ A;  4K4G A;  1K1Q A;  5AK4 A;  4YD1 A;  2VJ5 A;  5FP0 A;  4RT2 A;  3H8S A;  4FBU A;  3UM9 A;  2VA8 A;  5DQH A;  1N5W A;  2K4P A;  3D2Q A;  2FPK A;  1TAQ A;  5ALF A;  1TK8 A;  5KFJ A;  1RPL A;  4F8R A;  1X40 A;  3RB0 A;  1PK1 B;  3KBB A;  2ASL A;  2MU2 A;  4M9G A;  1Q3V A;  5ALP A;  1BPB A;  3BS5 B;  1AQ6 A;  7ICJ A;  5J0U A;  3G6V A;  5KAF U;  4O3O A;  3EPG A;  4IRC A;  3L4P A;  2KHQ A;  4QZB A;  4JK1 A;  4YR2 A;  2J6S A;  4QW8 A;  3TFS A;  3OSP A;  2FMP A;  3H0R B;  2AQ4 A;  1U9L A;  1L3S A;  3PST A;  5ALV A;  2KIV A;  5ALE A;  2HBL A;  5EE1 A;  2OCE A;  2XIC A;  3THV A;  3OGU A;  1N48 A;  7ICE A;  3UMC A;  4JUZ A;  1RQN A;  3BJY A;  4CCH A;  1JAL A;  2FI1 A;  4OJP A;  5ALZ A;  3QZ8 A;  4F3O A;  9ICM A;  2ALZ A;  5ALN A;  2YTU A;  1JRP A;  3H8J A;  5ALI A;  4EZ9 A;  2YQE A;  4DSL A;  8ICI A;  4GFJ A;  4Y2S A;  1NJX A;  1NJW A;  4G9B A;  4UAU A;  2HHS A;  4UB3 A;  5HML A;  5KFV A;  2PMZ F;  2MRL A;  5EE3 A;  4PH5 A;  4QZF A;  1ZD4 A;  4QW9 A;  4LJX A;  1UT5 A;  3H7I A;  2WB1 C;  4ELT A;  2P6U A;  2HOQ A;  3N7S C;  2KZ3 A;  2ZTC A;  8ICX A;  2EZY A;  3RRG A;  5AM2 A;  4IQU A;  5CHG A; 
#chains in the Genus database with same CATH homology
 4PL2 A;  4AYB C;  3PSP A;  3OPX A;  2KIW A;  2PMZ C;  2XI9 A;  2Z7J A;  2F76 X;  4OO1 J;  2MA1 A;  3C28 A;  4PL1 A;  1XNS A;  2NV3 A;  2ZIU A;  3CYM A;  2OXO A;  2JGA A;  2D6F C;  2BDU A;  2G08 A;  4OJ5 A;  3KFU F;  2G0A A;  3H0L B;  4FZN A;  1GO3 F;  1Q3V A;  3F53 A;  3T79 A;  2Q4T A;  1P7D A;  1CRX A;  2K4I A;  3HKZ F;  2YB4 A;  3M6K A;  5A0L A;  5HR7 A;  2JH1 A;  2H3V A;  4NV0 A;  3PSI A;  3IG5 A;  3VCB A;  3E0F A;  2VJ4 A;  2A3V A;  3LVW A;  2G07 A;  2JHD A;  2K4H A;  2XVT A;  5KL8 B;  2JH7 A;  2F77 X;  2CN1 A;  3C29 A;  1PVQ A;  3VC8 A;  1HEK A;  2E1F A;  3LVV A;  2KHQ A;  3NRW A;  3MGV A;  1T94 A;  2K8B B;  4IC9 A;  1PVP A;  5KL1 B;  4C0Z A;  2W7P A;  2W7O A;  2GOL A;  3SAG A;  2YB1 A;  1L6N A;  1NZB A;  1WUD A;  4BUG A;  4ACO A;  4BJQ A;  2E1E A;  2GH1 A;  3D2N A;  4BX9 C;  3H0R B;  2HOF A;  3DEE A;  1OUQ A;  2G5H B;  1F44 A;  2OM6 A;  3N7P D;  2ZG6 A;  2KHV A;  3PST A;  4ICA A;  4NLC A;  3L3F X;  4P0Q A;  4U6P A;  5CRX A;  2WAQ C;  2ZIW B;  4P0P B;  2ZXH A;  2HBM A;  2VIX A;  1HIW A;  2KV2 A;  4FE3 A;  2KJ9 A;  2WAQ F;  2ZIX B;  1ZQ1 C;  3GZF A;  1Z19 A;  1A6S A;  2H3Z A;  1KBU A;  2RP5 A;  2XID A;  3NUQ A;  2K8C B;  2HBL A;  2KIC A;  3O0F A;  4AYB F;  4CDG A;  2RRD A;  2CRX A;  3SAF A;  1TAM A;  3D2S A;  2XIC A;  3GU3 A;  4OJO A;  4QNL A;  2H3Q A;  2DGZ A;  2LYA A;  2OYY A;  2ZIV B;  2ZXI A;  4CGZ A;  2M0N A;  2KNJ A;  3PSF A;  4FZM A;  3KZX A;  3SAH A;  2KEY A;  2R18 A;  2WB1 F;  1XO0 A;  1Q3U A;  3IP4 B;  1URJ A;  4JMU A;  4NLB A;  1D8B A;  4P0P A;  5C0Y A;  2ZIW A;  3F2B A;  1DRG A;  2K4E A;  3F5A A;  2HMX A;  4OJP A;  3SQI A;  4NWI A;  2KJ5 A;  4QIW C;  2H3F A;  4KMO B;  2YX8 A;  2JMG A;  4A8E A;  3F5E A;  2Y0S C;  1PVR A;  3CP8 A;  3ALR A;  3RF9 A;  3F2D A;  3ONN A;  4OJ6 A;  2W04 A;  4WJ3 B;  2LHT A;  3ICX A;  3SMV A;  3HKZ C;  3IG8 A;  2G09 A;  2H3I A;  3AQE A;  2RHF A;  3AL0 B;  3N7R C;  4O3M A;  4U7C A;  2LKY A;  1UPH A;  2HBJ A;  1ECW A;  2ZIV A;  2HBK A;  3F2C A;  4GFJ A;  1SZH A;  2KKP A;  2LYB A;  2LBO A;  1Z1B A;  2E5S A;  2DQN B;  2CPR A;  2G06 A;  2VKQ A;  4KX3 A;  4KX5 A;  1MA7 A;  2PMZ F;  2MRL A;  2KVC A;  2K8A A;  4FZL A;  4P0Q B;  2VJ5 A;  2Y0S F;  5T14 A;  3AQF A;  2OH2 A;  4QIW F;  2KJ8 A;  3K1Z A;  2F8L A;  3LYS A;  3M6Z A;  2K89 A;  2DF4 B;  3M7D A;  4QJF B;  2ZIX A;  3CRX A;  1YT3 A;  2KKV A;  5HR6 A;  2N1R A;  2ZIU B;  2WB1 C;  2F2A B;  2HOQ A;  4OJL A;  3IN5 A;  4CRX A;  2KD1 A;  3N7S C;  1ED1 A;  3RFA A;  2HOI A;  2G5I B;  2W03 A;  3PZP A;  3H0M B;  1A0P A;  1IIP A;  2KOB A;  3D2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...