3GZFA

Structure of the c-terminal domain of nsp4 from feline coronavirus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
b'GLFEGDKFVGSFESAAMGTFVIDMRSYETLVNSTSLDRIKSYANSFNKYKYYTGSMGEADYRMACYAHLGKALMDYSVSRNDKLYTPPTVSVNSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure of the C-terminal domain of nsp4 from feline coronavirus
pubmed doi rcsb
source organism Feline coronavirus
molecule tags Viral protein
total genus 27
structure length 96
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.420 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3gzfA00
3GZFA 3VC8A 3VCBA
chains in the Genus database with same CATH superfamily
3ZDCA 2PXIA 4G3IA 9ICXA 4ECVA 4EENA 2VANA 4DL2A 4M0AA 8ICYA 3G6XA 1UT5A 3EPGA 2LKYA 1TAMA 5AK5A 2RRDA 5L9XA 9ICTA 3SAFA 2ZUDA 1B43A 5KT5A 5AM3A 4P4MA 7ICFA 1ZQUA 1TVAA 1RG6A 3GIMA 5B66U 1NZPA 1XO0A 3RJJA 5JUMA 3HILA 3UMBA 1ZQEA 1SWVA 4I2HA 1X9SA 3N7SC 2DKZA 3N7RC 4KLHA 1RYSA 2MUTB 2Z7JA 3T79A 1U4BA 1KFDA 1O08A 3M9OB 2EAMA 3H4BA 4PL1A 2KMDA 2YMMA 3UM9A 3ISDA 2PMZF 3IG5A 4UASA 2MU2A 3FYHA 1XSPA 3HJEA 4UQGA 4I2CA 4JV0A 5ALIA 4J9MA 2NRWA 5BPCA 4O3QA 1FIQA 1X6IA 4ED1A 2XC9A 1T3QA 5J2JA 5AI9A 4BGDA 2PI4A 3TACB 2V4QA 5KFGA 3M8SA 1ZJMA 1X42A 1N5WA 4PHEA 1SL1A 2VA3A 2R8IA 1L3TA 2W03A 5ALJA 4HYKA 4CDGA 2KG5A 3OHAA 1ZRNA 2G09A 3RB0A 4UAYA 2DL0A 3JPSA 2HDOA 2XGPA 3QYPA 3V7LA 5AM4A 3GV5B 1MA7A 2W11A 2H5XA 3Q8KA 2RP5A 2AQ0A 7ICPA 3WK4A 3TADA 5AKLA 5IIIA 4C8OA 4KX5A 4TUSA 3OPXA 1V85A 4UATA 2N1RA 3HWTA 3RF9A 3WK7A 3F2DA 5IIMA 5AHXA 3SYZA 2HHUA 1D8LA 5AK6A 4DSIA 2MA1A 4F4KA 5AI8A 1ZQMA 4LZGA 3SV3A 3SR6A 3HW8A 4NXZA 5DG8A 3BS7A 4ED2A 4M6WB 5AKJA 4IRCA 3F5EA 1U9LA 3FAHA 3SAGA 1XNSA 2DWQA 2XCPA 4I2DA 8ICIA 5F9LA 7ICUA 2M0NA 1K5OA 4PHAA 3UMGA 3G6YA 1L8OA 4MF2A 2OH2A 5TZVA 3BZKA 2HVIA 1ECWA 4XQ8A 2BCSA 3NVWA 4IRKA 3V6KA 2YMQA 4YR0A 1RM6C 1DK2A 4O5CA 3SEIA 2G5HB 4QW9A 4ED7A 2YMPA 3UXPA 4Y2JA 2JGAA 3PNCA 4O3NA 3NASA 3RJEA 2KTQA 8ICFA 2QLTA 2D8CA 4NLCA 5KG5A 2F44A 4OJ6A 3UPQA 4C80A 3MR2A 7ICOA 4C0ZA 3KZXA 1UCVA 1A76A 4RQ0A 5CRXA 3RH5A 4M9NA 3ZDBA 1ZQIA 2UVVA 2BPFA 4EEYA 3D2NA 3AM9A 5EE3A 4DLEA 1VDVA 1L3UA 5DB9A 1SL0A 4RPZA 3GQCA 2G08A 1D9FA 9ICFA 2VJ5A 5J2KA 3MDAA 3WKBA 1S0MA 2ISOA 2W9BA 5AI6A 5KG3A 3C28A 5JU5A 1X66A 1K1SA 1DXSA 4JWNA 2F3NA 4PHPA 3C5FA 5AKXA 1ZD5A 4AP9A 5J2AA 4RT2A 3TKAA 5DBAA 1UT8A 8ICRA 3T3FA 1KFTA 2K8CB 5HMLA 8ICJA 1FO4A 8ICTA 1EXNA 1ZQAA 1UPHA 3HX0A 3K4GA 3NTUA 2RHFA 2W55A 3FDSA 1SV4A 5DB6A 2KJ8A 1KN5A 3JPTA 1BPEA 4P2HA 5KNIA 4P0PB 5EWEA 3C5GA 1CRXA 4MFFA 1ZYQA 1Z4OA 2BCRA 2WB1C 1U47A 3Q8PB 3WK8A 4RQ1A 4DFMA 2V9WA 1NJZA 3GZFA 3QUQA 5F3XB 2FPKA 4RPXA 3PZPA 1SKWA 1YT3A 1CI4A 2IA6A 5J2IA 1ZQBA 4QZCA 1MQ2A 3I76A 3MC1A 3EW9A 4B9MA 2LMRA 4YR2A 1PUZA 5KG7A 3NUQA 2ZUBA 1HUOA 1NI3A 1SXDA 2W9MA 1S97A 4ECSA 4YCXA 3V6JA 5DB8A 3MGIA 1S77D 4AYBF 4TUQA 3JPQA 1S76D 1XU4A 5KFXA 2W8LA 3EZ5A 4ELVA 3L4PA 4Y2PA 1Y88A 5AKZA 4ED0A 5FP0A 4I27A 5AICA 4Q43A 5AK4A 2A1JA 4OCZA 4DF4A 4RQNA 3M9MB 4O3MA 3RFAA 3TI0A 2C2DA 1KTQA 4NY8A 4ED6A 5KG0A 2PFNA 2ZUCA 1V97A 4KMOB 1RXVA 1ZQHA 2JR5A 2KVSA 9ICWA 3Q8LA 5ALDA 1QQ7A 2E8NA 3QNMA 3C2KA 4GIBA 1BPDA 3QU2A 1NNLA 3OSPA 4TUPA 4KTQA 2F1HA 3RJHA 3H0MB 2R18A 4CF4A 3QU4A 9ICLA 2KSOB 2EH9A 2OEHA 2HBKA 5L1MA 2ZIWB 5J0UA 2FMSA 9ICQA 2JZBA 2HHWA 1KKXA 3AEVA 8ICAA 4Z6EA 2D3DA 1PK3A 1D9DA 5KFAA 3J81j 1HEKA 4Z6CA 4MFCA 4FBUA 2HSZA 2YMLA 2BHNA 3HPOA 1RYUA 4DQQA 1SV0A 2IOFK 2WHEA 4IQVA 4K4IA 1NKEA 1B0XA 2P35A 4QNLA 3PY8A 4J03A 3PSPA 5J0PA 2AQ4A 3H0RB 2KVCA 3QUTA 4EBCA 2EDUA 2XGQA 4BXOA 1C20A 5DGAA 4O3OA 4UAWA 3ZD9A 5DBCA 4QZEA 1TKDA 4JK1A 4R8UB 3PX4A 4RPYA 2CN1A 4M9HA 1KEJA 4R65A 1KSPA 1A6SA 1ZQFA 2B0CA 4NL9A 1U49A 2H3VA 3IRUA 5DB7A 3S6JA 2AU0A 5KFUA 1ZQCA 2VIXA 4OJPA 3I28A 3B0YA 3MGVA 3NS1A 3EUB2 5J2GA 2MSNA 5J2FA 4EBDA 2XICA 9ICBA 1H38A 1MQ3A 5DKWA 9ICVA 2C28A 4U7CA 1JX4A 3D6JA 1WYGA 3K1RB 3CRXA 3NGDA 1Z3EB 4AYBC 2DPIA 3V7KA 1V38A 3RTVA 2KJ5A 2HOQA 5CP2A 2Q0ZX 4F5RA 3GV8B 1IM4A 4ICAA 4NL9C 3Q8SB 2IMWP 4F8RA 1L5UA 3RR7A 1NK9A 2P6UA 9ICRA 3AU2A 5AM5A 1ZQYA 2BKEA 2W9CB 5DDMA 1CUKA 5J2EA 4RNOA 4PJ0U 4NM2A 1UA1A 4UARA 2PI5A 3GDXA 5KFYA 3SZ2A 3WU2U 2EAPA 2ZJ5A 3H8SA 1ZQTA 1VJ5A 2DF4B 4Q8EA 4JV2A 1ZD3A 4F5OA 1LB2B 2K89A 5L1IA 5ALPA 4IRDA 3R9KA 1JALA 7ICIA 4CF3A 2B6GA 4DSEA 2GH1A 2FLPA 3CP8A 4X5VA 2GOLA 1RQNA 2QARA 5KG2A 2AGOA 3JPNA 9ICCA 1OXJA 2KHVA 3LVVA 2AH5A 2H3ZA 5DDYA 2KHQA 2LI6A 3C2MA 1NK7A 2UVWA 4JB3A 4NV0A 1NK5A 1Q8KA 4F72A 2XI9A 1Z1VA 4NLBA 1ZQGA 4IQWA 3DEEA 3IV6A 3GILA 1O03A 1DOQA 3M1YA 5CR0A 2IHNA 4MHVA 3CNHA 7ICLA 2ZXIA 1WWUA 4EEKA 3SV4A 1L7PA 3ZDAA 4MFAA 3T5KA 2F2AB 3WK5A 3MR3A 2Y0SC 2JHDA 2W43A 3TQ1A 3ZDEA 4F2SA 3IG8A 3MFIA 5EE1A 3AU6A 5J0YA 2CRXA 7ICQA 1SXEA 5AM0A 4RQ7A 5KFBA 1ZQSA 4EX6A 7ICSA 5KFPA 2EAOA 5DQIA 5EE9A 5JTIA 2IHMA 2ZIVA 1BVSA 2NYVA 5ALGA 1ZD4A 1ZQVA 1K1QA 4EBEA 1QCKA 2KFZA 3QE9Y 2PFOA 4NJ8A 1T3NA 2O6KA 5AKYA 5IILA 3G6VA 2OCEA 5KT6A 5AKIA 5KT2A 2J6UA 3SMVA 5KFZA 2MUTA 1WCNA 2AJQA 1OUQA 2KD1A 4ELTA 4DEZA 1ED1A 3ICXA 3NRWA 4DL6A 4P0QA 2JRZA 4DLGA 4UW9A 4RUAA 3SI8A 3WK6A 2GLEA 3N7PD 2WB1F 4P4OA 3THVA 3PX6A 1SWWA 2V4RA 1RXWA 3MBYA 2QKQA 7ICNA 4GXIA 5AIAA 4KLUA 3VCBA 4O3SA 3C23A 1SL2A 4E0DA 3AMZA 4CF5A 3DV9A 2KKPA 2WTFA 1IV8A 5ALFA 4KMUA 4EYHB 1TK8A 2AXTU 4KITB 1PK1B 4P4PA 2ZJ8A 2ALZA 5AKEA 5DBBA 4C7ZA 2FLLA 2LHTA 3F2CA 3IHQB 2GO7A 2G0AA 3BQ1A 1KL9A 2ZJAA 5A0LA 2QB1A 2P6RA 4B6JA 4J9OA 1XO1A 2A19A 5AKGA 4J9PA 2YN4A 4B9TA 3LYSA 2CPRA 3MR5A 4RT3A 1GO3F 1X6JA 3TADC 5ALLA 3MDCA 1L3SA 1QSSA 4F93B 3M7DA 4ECYA 1S5LU 4KLJA 7ICEA 3MABA 5KL8B 2AGQA 4XUSA 4F91B 1SZPA 3RJIA 4NM1A 5HHHA 2ZIXB 2E8OA 3PVXA 1TAQA 5ALMA 1Z4NA 9ICEA 3AQEA 3RAQA 3H4DA 3GIJA 4GXKA 1Z00A 2ZG6A 3EPIA 4M6WA 4Y2UA 4BUGA 3PSTA 3K75D 3PMLA 7ICHA 1X9WA 3UXOA 2E8PA 3RR8A 2A3VA 5CJ7A 2QB0A 5IINA 4PGQA 1SB3C 4UBCA 8ICWA 5CA7A 2W9BB 1BPXA 3WKDA 8ICOA 4UB8U 1NK8A 4OJ5A 1JI7A 1WCLA 3F53A 4PGXA 2H3QA 4DQSA 1ZETA 4DSLA 1MN8A 2HCFA 4DOBA 5ALYA 8ICEA 2HBLA 1NZBA 3QXGA 5L1JA 4QZGA 4OJLA 4K4HA 1KLNA 1ZOLA 4WJ3B 5HNKA 4A8EA 3PR5B 5AI0A 1A77A 2VKQA 2W9AA 4F5QA 4NLKA 4KLSA 1QTMA 3KHLA 4DL3A 4C7YA 4KX3A 2JMGA 1UA0A 4PZOA 2XO7A 1KBUA 3JPRA 4RNNA 2FMPA 4DOCA 1N60A 5AI4A 4B9NA 4NLNA 4M2YA 1MC8A 4LVSA 1T4GA 5KG6A 1X9XA 1V9PA 3ZD8A 4MEXA 5J2BA 8ICMA 2WF9A 4O5EA 5KFLA 2ZTCA 2E5SA 3KTQA 4RQ4A 2AHOB 4ECZA 3SQIA 1ZXIA 1DGSA 8ICPA 1PVRA 4DO9A 9ICHA 3NVYA 3RB4A 1NK4A 3KKAA 4CRXA 4KLMA 3E2EA 9ICOA 3H8WA 4B9VA 4DL4A 2Y1JA 4RNMA 4UB1A 1TAUA 3KBBA 3RAXA 1WG8A 4YXJA 3TFRA 4R63A 4Q8FA 8ICKA 2LYBA 5DQGA 4YG2A 9ICPA 2RQ5A 5EWGA 1C7YA 3ZDDA 3V72A 2K4PA 2ASLA 1UHUA 2UVRA 2F1JA 2A1JB 2K8AA 3H0LB 3B9JA 4QJFB 3CYMA 1PVPA 1BPYA 3GFKB 5HR6A 2JEIA 1NJXA 1XSNA 2UVUA 3KKAC 2MAXA 3QUCA 1ZQKA 5C0YA 3E0FA 5F9NA 4RQ6A 2I5HA 3N4MB 2VJ4A 3FM9A 2OXOA 3GU3A 2XIDA 4YVZA 4Y2SA 3C29A 4M9JA 1JMSA 1S0VA 2WF8A 4F2RA 3ETRA 3H8JA 1N48A 2DPJA 2C22A 4PH5A 1ZJNA 2R8HA 4PGYA 4UB6U 1JIHA 4O9MA 3M8RA 4YXMA 4EX7A 4J9LA 4BWMA 1X9MA 4Y2VA 4Y2TA 3LWMA 2KICA 5ALVA 5J2DA 1KQQA 4O0IA 2KP7A 5ALSA 4B9UA 5ALWA 1TE2A 1IG6A 4J9SA 1Q3UA 1T7PA 3ED5A 1XSLA 2KOBA 9ICGA 3U26A 4ED3A 2KN7A 2YB1A 4DQRA 2WF5A 5KT3A 4I2FA 1ZQ1C 1CEZA 4Z6FA 4Z6DA 2M9NA 1JXLA 4CNQA 4I2GA 4BWJA 5C5JA 3WKCA 4ECUA 5GTIU 5G5HA 4LZDA 4UB3A 1J2NA 8ICBA 5ALQA 1OW5A 4DWIA 3RH4A 1YZ6A 4FS2A 2Y0SF 2F1IA 2FLNA 5KFVA 3KOOA 4OD0A 4BXOB 1IXRA 1D8BA 2MRLA 2ZXHA 3NVZA 2R8GA 5CHGA 1TV9A 1QH9A 5GTHU 3D2SA 2ZIWA 3RB6A 2HI0A 3KHGA 5ALKA 1Z19A 8ICSA 3MFHA 5KFKA 4DOAA 3PMNA 1NKCA 2ODGA 5B5EU 2KIVA 1U48A 4J9KA 2GWSA 3LDAA 2JEFA 4UAVA 4TQSA 2LM1A 4UB2A 2DQNB 4KLEA 2VA8A 3AQFA 4NWIA 4J9RA 1DK3A 3OJUA 4NLZA 3IP4B 1QLNA 5ALRA 2RDIA 1BPZA 8ICZA 1SV0C 2HHVA 4O5KA 3QX7A 3QZ7A 5KTQA 4KLTA 1BNPA 5HHIA 3C2LA 3TAPA 2BDPA 4DFJA 2YTUA 2HHQA 2OWOA 3SENA 3H8MA 5HMMA 4F5PA 2LYAA 1NJYA 3ONNA 8ICCA 7ICTA 3ISCA 2FMQA 5AI5A 4ECXA 2CXYA 2C2EA 2KJ9A 2K4HA 7ICGA 4DL5A 4KLLA 4DQPA 9ICKA 1XS9D 5ALHA 1NK6A 4DS5A 4RQ3A 1WUDA 3V6HA 5KFFA 4BDPA 4I2AA 4FZMA 2DUYA 4C8NA 2W54A 4I29A 1LKYA 1COOA 1JRPA 5DLFA 3PW0A 1MSWD 3B0XA 4EZ6A 2F76X 7ICMA 1NKBA 3RBEA 4EZ9A 2LYHA 1QSYA 2ZIUA 4IL6U 7ICRA 2IBKA 4KLIA 3MR6A 2H3IA 3C1YA 1ZQNA 3QU7A 4DFKA 1SKRA 4MEYA 5AKHA 4QZBA 2QARB 2HVHA 4O3RA 2EZZA 1BPBA 2BQ3A 4J9NA 3PR4A 4UAUA 4YD1A 4QWEA 5IIOA 1F44A 4I2IA 3ETLA 3LVWA 3A0HU 3QEBZ 2ZTEA 1BGXT 5IIJA 1WWVA 3LWLA 4CE6A 4JV1A 2R8KA 5IIKA 2BCUA 1S9FA 7ICVA 1TFRA 3UXNA 5L1KA 3Q8RB 3BS5A 1D8YA 2FE9A 3PW4A 2ASDA 4EELA 1FFVA 1PVQA 2HHTA 3I1YA 4ZOHC 4FZLA 3UQ2A 2E1FA 5KFCA 4RU9A 5KT4A 5DG9A 4O3PA 3TANA 4R64A 4PPXA 3K1ZA 4ECWA 3C21A 4IQTA 3SD7A 1RDFA 3PO5A 1RQLA 2JH1A 1UQVA 2E3TA 2ZIVB 4ELUA 2ASJA 4DSKA 2KK0A 3IDWA 2F8KA 3AN1A 4QZIA 9ICAA 2HW3A 3NVVA 1SKSA 2DGZA 2FI1A 3M6KA 1F5SA 4Y2YA 5D46A 1U45A 3BJYA 1KRPA 4DQIA 4PHDA 2HBMA 1JN3A 1KDHA 5DG7A 3F5AA 5KFRA 2R8JA 4K4GA 5BOMA 4P0QB 3PV8A 5D49A 5ALEA 4FBTA 1N61A 4EYIB 3RJKA 5HP4A 5KFOA 2W8KA 2NV3A 2KKVA 2BPGA 4M9LA 4FFDA 2F8LA 4US9A 5AKKA 2NO5A 2JEJA 3PX0A 4C4TA 2BZFA 2KZZA 1S10A 1ZQLA 4FZNA 1ZD2P 3A0BU 5KFDA 2C2RA 2EQYA 2BGWA 2BCQA 4C4SA 3PW5A 2G07A 2XY6A 4JMUA 4F5NA 3N28A 4F4YA 2LBOA 3SAHA 3PSFA 3VC8A 3BDPA 2YX8A 4MF8A 4QW8A 3HKZC 1Q3VA 5J0XA 2LM4A 2KV2A 5G5GA 3F2BA 5AM1A 2FPMA 4Q44A 5TISU 1B4FA 3LK9A 1IIPA 3BQ7A 4QIWF 2EZYA 1T94A 2EZXA 1RYRA 3BQTA 2K4IA 3EYZA 2J6SA 3GV7B 2G5IB 4YD2A 4YN4A 5KAIU 2P66A 2KEYA 3L5KA 3TAQA 4F92B 4C8KA 4TQRA 4B9SA 3ZI4A 4NLGA 2DKXA 1Z00B 4YQWA 2XY7A 1PK1A 4RZRA 3M9NB 4YR3A 4ECQA 2PFPA 2VA2A 2BPCA 1F0MA 2QB0B 3N97B 9ICNA 5J0SA 2WF6A 1NK0A 3KHRA 4YMNA 3TFSA 2ATLA 4DCCA 3QEAZ 2HBJA 2ISPA 2BDUA 5KFSA 2KZMA 5H2FU 3ISBA 4BJQA 2HMXA 3WKEA 4TURA 3T5JA 2H3FA 5KAFU 3KD3A 5DGBA 1JROA 3H40A 7ICJA 5T14A 4C4RA 5KFIA 8ICGA 2BQUA 2Y1IA 2B21A 4Y2QA 5DQHA 2XCAA 1Q46A 5KT7A 1N56A 4HAIA 2I9GA 2ZIXA 2J6TA 9ICMA 5J0RA 1Z1BA 3L3FX 4OJOA 1NOMA 4GFJA 2F77X 5KFQA 2YQEA 2WAQF 3QU9A 3UMCA 4I28A 1QSLA 2PMZC 3OGUA 5D4BA 1TK0A 2ZTDA 4OO1J 1ZQPA 4U6PA 4UAZA 4JWMA 3PSIA 4F4ZA 1N5XA 4I2JA 1LVHA 5K4LA 4FE3A 1N2XA 2BCVA 1QQ5A 2IOHA 2NRTA 1L7NA 2LPEA 3QU5A 2KFNA 4KN4A 4ED8A 8ICUA 2NRZA 2E1EA 4BX9C 1X2IA 1ZQQA 3EWAA 5E79U 9ICSA 3E58A 3AL0B 4GXJA 5J2HA 1NJWA 2NRXA 3RH6A 2JV3A 8ICQA 2L5YA 4GLXA 3Q8MA 2HOFA 5KFNA 2IOFA 5KG1A 1DGJA 4DSFA 2PKEA 5KFMA 3JPOA 4GC6A 4C8MA 2XVTA 3D2QA 4P0PA 1B22A 1L3VA 1VLBA 4DFDA 4KLGA 2DFLA 3CW2C 3KZIU 4YP3A 1AROP 3IN5A 4QWBA 4QIWC 1HJPA 2HHSA 1XC9A 3M6ZA 2FDRA 4R66A 5EOZA 4M47A 1RPLA 9ICIA 2I1QA 1BNOA 3HT3A 2FJ6A 3OTQA 2RLTA 4I2EA 3NRZA 2D6FC 3IM1A 2EANA 4DS4A 4IQUA 2K60A 3BZCA 3V7JA 4USAA 3UQ0A 2ESEA 3C1ZA 1N63A 2YY6A 3GIIA 3DDHA 4Y2XA 8ICHA 1S8OA 4XRHA 4F4WA 2OHFA 2JZBB 1ZQXA 4QZFA 1SIJA 5J29A 8ICNA 3ORYA 2W04A 2KE7A 2JEGA 4M9GA 5ALXA 1AQ6A 1ZQRA 4UBBA 2E8MA 4IS7A 5KFTA 3MGHA 2YB4A 5BOLA 4KN7A 5KFJA 2K8BB 1SGGA 4DL7A 5J0OA 4JUZA 1SZHA 3RRGA 2Q4TA 2XY5A 4ECTA 2W3RA 3GIKA 3Q8QB 2AGPA 4YMOA 5EE0A 4GC7A 4ZH4A 4Y2RA 5JRTA 4DFPA 2W7PA 2JXJA 3PW2A 2KZ3A 2WAQC 2HOIA 1FEZA 2KSOA 1J97A 2WFAA 4C8LA 1JUDA 2KNJA 4B9LA 3T5LA 3RJGA 2OYYA 1ZQDA 3OSNA 4M04A 2W7OA 1ZQWA 1COKA 1J2MA 1XWLA 4QWAA 2KIWA 1L6NA 4QZAA 2G06A 2HHXA 4YFKA 4QZDA 3RRHA 4F4XA 3QUBA 3RB3A 5ALNA 5J0WA 1T8EA 4RUCA 9ICUA 3WK9A 2RDJA 4QZ8A 5KG4A 2JH7A 8ICVA 4RQMA 4G9BA 3WKAA 3QZ8A 4J9QA 3RJFA 1ZQOA 3T5HA 2Y9TA 4FS1A 2NO4A 1LKYB 1JXEA 4KLOA 5CEHA 2PFQA 4KLDA 4RQ8A 4DF8A 2FPLA 4R8UA 3JPPA 2BR0A 2Y9UA 5ALTA 1FFUA 4PL2A 4RQ2A 1M6YA 1RZTA 5ALOA 1L7OA 5J0QA 5L1LA 4I2BA 5KFWA 1HUZA 2ZIUB 3O0FA 1N62A 1L7MA 4CGZA 5CB1A 1HIWA 3H7IA 1PZNA 5J8YA 4IR1A 1S0NA 3HKZF 4UB5A 5J0TA 3AUOA 1TK5A 1A0PA 1KFSA 7ICKA 4F3OA 4QZHA 5KFHA 2NRVA 4RQ5A 4IR9A 5CWRA 4FO6A 1QQ6A 4XA5A 4ACOA 4QZ9A 3FC4A 3PO4A 3TARA 5AK3A 1LV5A 4PZNA 5AIBA 2BQRA 5J2CA 1DRGA 3HRDD 1YZ7A 5DLGA 1P7DA 4UB4A 2DBYA 3BQ2A 8ICXA 5AM2A 4IC9A 4YMMA 2ES6A 4KLFA 3OJSA 2WF7A 5HR7A 4F50A 5EWFA 3ALRA 5ALZA 4ECRA 4QWDA 4DSJA 3KHHA 1L8LA 4KLQA 3BS5B 2A1AA 5J8YC 3RBDA 5KFEA 3HP6A 3OHBA 1S0OA 2I6XA 1KW4A 1ZQZA 1ZRMA 2W9CA 4LJXA 4F71A 4Q45A 5ALUA 1URJA 3PW7A 4QWCA 8ICLA 3BQ0A 9ICJA 2W3SA 3KFUF 4US8A 4CCHA 1ZQJA 1X40A 2OM6A 5KL1B 2K4EA
chains in the Genus database with same CATH topology
4OO1J 2G09A 2YB1A 4U6PA 3PSIA 2G5IB 1WUDA 1ZQ1C 4C0ZA 3KZXA 4CRXA 4FZMA 2KEYA 4AYBF 1MA7A 5CRXA 4QNLA 2ZIXB 2DGZA 3PSPA 3SMVA 4FE3A 3AQEA 3D2NA 3H0RB 2LKYA 2RP5A 2W04A 3M6KA 1TAMA 2KVCA 2RRDA 2F76X 2DF4B 1OUQA 5KL8B 2HBMA 2ZG6A 2KD1A 2G08A 2LYBA 4BUGA 2K89A 1ED1A 3ICXA 2Y0SF 3PSTA 3SAFA 2VJ5A 3NRWA 4P0QA 4KX5A 2ZIUA 2YB4A 4PL2A 1D8BA 3N7PD 2E1EA 2MRLA 2WB1F 2ZXHA 3F5AA 2GH1A 3OPXA 4BX9C 3C28A 1XO0A 4O3MA 2K8AA 3CP8A 4P0QB 2H3IA 3H0LB 2K8BB 3RFAA 2ZIUB 3O0FA 2GOLA 3D2SA 2CN1A 4QJFB 2ZIWA 2N1RA 3CYMA 3AL0B 4CGZA 1PVPA 2KHVA 1HIWA 3RF9A 3LVVA 4KMOB 3F2DA 4OJ5A 1SZHA 2H3ZA 1Z19A 1A6SA 2KHQA 2Q4TA 3F53A 2H3QA 3N7SC 5HR6A 2MA1A 3HKZF 3N7RC 3VCBA 2NV3A 5KL1B 2H3VA 4NV0A 2HOFA 1A0PA 2Z7JA 2KKVA 2XI9A 3T79A 5C0YA 3E0FA 2K8CB 2HBJA 2F8LA 2VIXA 4NLBA 2BDUA 2VJ4A 2W7PA 4OJPA 2OXOA 3DEEA 3GU3A 4BJQA 2KKPA 2XIDA 1F44A 1UPHA 2HMXA 4PL1A 4ACOA 2WAQC 2PMZF 3LVWA 2HBLA 3MGVA 2DQNB 1NZBA 3IG5A 2HOIA 3C29A 2XVTA 4OJLA 2H3FA 2RHFA 3D2QA 2ZXIA 3AQFA 3F5EA 4FZNA 4NWIA 1DRGA 4P0PA 4WJ3B 4A8EA 3H0MB 2R18A 3IP4B 1P7DA 2XICA 2KNJA 3SAGA 2KJ8A 1XNSA 2F2AB 5T14A 3IN5A 2VKQA 2Y0SC 2A3VA 4QIWC 2JHDA 4P0PB 2OYYA 1CRXA 2HBKA 2M0NA 4IC9A 4U7CA 2ZIWB 3IG8A 4KX3A 2WB1C 2W7OA 1PVRA 3CRXA 2G07A 2LHTA 3F2CA 2JMGA 3M6ZA 4JMUA 2KIWA 2OH2A 2G0AA 1ECWA 4AYBC 5HR7A 2ZIXA 2CRXA 1KBUA 1L6NA 3GZFA 5A0LA 3ALRA 1PVQA 1Z1BA 2LBOA 3L3FX 4OJOA 3PZPA 2KJ5A 3SAHA 1YT3A 4FZLA 2HOQA 2E1FA 2LYAA 3PSFA 2F77X 2G06A 4GFJA 3VC8A 2KICA 3ONNA 2YX8A 2D6FC 2G5HB 3HKZC 4ICAA 1Q3VA 2WAQF 3K1ZA 3LYSA 2JGAA 1HEKA 2CPRA 2KV2A 2ZIVA 1GO3F 1URJA 2E5SA 3F2BA 2JH1A 2KJ9A 3KFUF 1Q3UA 2ZIVB 2K4HA 1IIPA 2JH7A 3M7DA 2PMZC 4NLCA 4QIWF 2W03A 1T94A 3SQIA 4OJ6A 2OM6A 3NUQA 2KOBA 4CDGA 2K4EA 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZF A;  3VC8 A;  3VCB A; 
#chains in the Genus database with same CATH topology
 3ZDC A;  2PXI A;  4G3I A;  9ICX A;  4ECV A;  4EEN A;  2VAN A;  4DL2 A;  4M0A A;  8ICY A;  3G6X A;  1UT5 A;  3EPG A;  2LKY A;  1TAM A;  5AK5 A;  2RRD A;  5L9X A;  9ICT A;  3SAF A;  2ZUD A;  1B43 A;  5KT5 A;  5AM3 A;  4P4M A;  7ICF A;  1ZQU A;  1TVA A;  1RG6 A;  3GIM A;  5B66 U;  1NZP A;  1XO0 A;  3RJJ A;  5JUM A;  3HIL A;  3UMB A;  1ZQE A;  1SWV A;  4I2H A;  1X9S A;  3N7S C;  2DKZ A;  3N7R C;  4KLH A;  1RYS A;  2MUT B;  2Z7J A;  3T79 A;  1U4B A;  1KFD A;  1O08 A;  3M9O B;  2EAM A;  3H4B A;  4PL1 A;  2KMD A;  2YMM A;  3UM9 A;  3ISD A;  2PMZ F;  3IG5 A;  4UAS A;  2MU2 A;  3FYH A;  1XSP A;  3HJE A;  4UQG A;  4I2C A;  4JV0 A;  5ALI A;  4J9M A;  2NRW A;  5BPC A;  4O3Q A;  1FIQ A;  1X6I A;  4ED1 A;  2XC9 A;  1T3Q A;  5J2J A;  5AI9 A;  4BGD A;  2PI4 A;  3TAC B;  2V4Q A;  5KFG A;  3M8S A;  1ZJM A;  1X42 A;  1N5W A;  4PHE A;  1SL1 A;  2VA3 A;  2R8I A;  1L3T A;  2W03 A;  5ALJ A;  4HYK A;  4CDG A;  2KG5 A;  3OHA A;  1ZRN A;  2G09 A;  3RB0 A;  4UAY A;  2DL0 A;  3JPS A;  2HDO A;  2XGP A;  3QYP A;  3V7L A;  5AM4 A;  3GV5 B;  1MA7 A;  2W11 A;  2H5X A;  3Q8K A;  2RP5 A;  2AQ0 A;  7ICP A;  3WK4 A;  3TAD A;  5AKL A;  5III A;  4C8O A;  4KX5 A;  4TUS A;  3OPX A;  1V85 A;  4UAT A;  2N1R A;  3HWT A;  3RF9 A;  3WK7 A;  3F2D A;  5IIM A;  5AHX A;  3SYZ A;  2HHU A;  1D8L A;  5AK6 A;  4DSI A;  2MA1 A;  4F4K A;  5AI8 A;  1ZQM A;  4LZG A;  3SV3 A;  3SR6 A;  3HW8 A;  4NXZ A;  5DG8 A;  3BS7 A;  4ED2 A;  4M6W B;  5AKJ A;  4IRC A;  3F5E A;  1U9L A;  3FAH A;  3SAG A;  1XNS A;  2DWQ A;  2XCP A;  4I2D A;  8ICI A;  5F9L A;  7ICU A;  2M0N A;  1K5O A;  4PHA A;  3UMG A;  3G6Y A;  1L8O A;  4MF2 A;  2OH2 A;  5TZV A;  3BZK A;  2HVI A;  1ECW A;  4XQ8 A;  2BCS A;  3NVW A;  4IRK A;  3V6K A;  2YMQ A;  4YR0 A;  1RM6 C;  1DK2 A;  4O5C A;  3SEI A;  2G5H B;  4QW9 A;  4ED7 A;  2YMP A;  3UXP A;  4Y2J A;  2JGA A;  3PNC A;  4O3N A;  3NAS A;  3RJE A;  2KTQ A;  8ICF A;  2QLT A;  2D8C A;  4NLC A;  5KG5 A;  2F44 A;  4OJ6 A;  3UPQ A;  4C80 A;  3MR2 A;  7ICO A;  4C0Z A;  3KZX A;  1UCV A;  1A76 A;  4RQ0 A;  5CRX A;  3RH5 A;  4M9N A;  3ZDB A;  1ZQI A;  2UVV A;  2BPF A;  4EEY A;  3D2N A;  3AM9 A;  5EE3 A;  4DLE A;  1VDV A;  1L3U A;  5DB9 A;  1SL0 A;  4RPZ A;  3GQC A;  2G08 A;  1D9F A;  9ICF A;  2VJ5 A;  5J2K A;  3MDA A;  3WKB A;  1S0M A;  2ISO A;  2W9B A;  5AI6 A;  5KG3 A;  3C28 A;  5JU5 A;  1X66 A;  1K1S A;  1DXS A;  4JWN A;  2F3N A;  4PHP A;  3C5F A;  5AKX A;  1ZD5 A;  4AP9 A;  5J2A A;  4RT2 A;  3TKA A;  5DBA A;  1UT8 A;  8ICR A;  3T3F A;  1KFT A;  2K8C B;  5HML A;  8ICJ A;  1FO4 A;  8ICT A;  1EXN A;  1ZQA A;  1UPH A;  3HX0 A;  3K4G A;  3NTU A;  2RHF A;  2W55 A;  3FDS A;  1SV4 A;  5DB6 A;  2KJ8 A;  1KN5 A;  3JPT A;  1BPE A;  4P2H A;  5KNI A;  4P0P B;  5EWE A;  3C5G A;  1CRX A;  4MFF A;  1ZYQ A;  1Z4O A;  2BCR A;  2WB1 C;  1U47 A;  3Q8P B;  3WK8 A;  4RQ1 A;  4DFM A;  2V9W A;  1NJZ A;  3GZF A;  3QUQ A;  5F3X B;  2FPK A;  4RPX A;  3PZP A;  1SKW A;  1YT3 A;  1CI4 A;  2IA6 A;  5J2I A;  1ZQB A;  4QZC A;  1MQ2 A;  3I76 A;  3MC1 A;  3EW9 A;  4B9M A;  2LMR A;  4YR2 A;  1PUZ A;  5KG7 A;  3NUQ A;  2ZUB A;  1HUO A;  1NI3 A;  1SXD A;  2W9M A;  1S97 A;  4ECS A;  4YCX A;  3V6J A;  5DB8 A;  3MGI A;  1S77 D;  4AYB F;  4TUQ A;  3JPQ A;  1S76 D;  1XU4 A;  5KFX A;  2W8L A;  3EZ5 A;  4ELV A;  3L4P A;  4Y2P A;  1Y88 A;  5AKZ A;  4ED0 A;  5FP0 A;  4I27 A;  5AIC A;  4Q43 A;  5AK4 A;  2A1J A;  4OCZ A;  4DF4 A;  4RQN A;  3M9M B;  4O3M A;  3RFA A;  3TI0 A;  2C2D A;  1KTQ A;  4NY8 A;  4ED6 A;  5KG0 A;  2PFN A;  2ZUC A;  1V97 A;  4KMO B;  1RXV A;  1ZQH A;  2JR5 A;  2KVS A;  9ICW A;  3Q8L A;  5ALD A;  1QQ7 A;  2E8N A;  3QNM A;  3C2K A;  4GIB A;  1BPD A;  3QU2 A;  1NNL A;  3OSP A;  4TUP A;  4KTQ A;  2F1H A;  3RJH A;  3H0M B;  2R18 A;  4CF4 A;  3QU4 A;  9ICL A;  2KSO B;  2EH9 A;  2OEH A;  2HBK A;  5L1M A;  2ZIW B;  5J0U A;  2FMS A;  9ICQ A;  2JZB A;  2HHW A;  1KKX A;  3AEV A;  8ICA A;  4Z6E A;  2D3D A;  1PK3 A;  1D9D A;  5KFA A;  3J81 j;  1HEK A;  4Z6C A;  4MFC A;  4FBU A;  2HSZ A;  2YML A;  2BHN A;  3HPO A;  1RYU A;  4DQQ A;  1SV0 A;  2IOF K;  2WHE A;  4IQV A;  4K4I A;  1NKE A;  1B0X A;  2P35 A;  4QNL A;  3PY8 A;  4J03 A;  3PSP A;  5J0P A;  2AQ4 A;  3H0R B;  2KVC A;  3QUT A;  4EBC A;  2EDU A;  2XGQ A;  4BXO A;  1C20 A;  5DGA A;  4O3O A;  4UAW A;  3ZD9 A;  5DBC A;  4QZE A;  1TKD A;  4JK1 A;  4R8U B;  3PX4 A;  4RPY A;  2CN1 A;  4M9H A;  1KEJ A;  4R65 A;  1KSP A;  1A6S A;  1ZQF A;  2B0C A;  4NL9 A;  1U49 A;  2H3V A;  3IRU A;  5DB7 A;  3S6J A;  2AU0 A;  5KFU A;  1ZQC A;  2VIX A;  4OJP A;  3I28 A;  3B0Y A;  3MGV A;  3NS1 A;  3EUB 2;  5J2G A;  2MSN A;  5J2F A;  4EBD A;  2XIC A;  9ICB A;  1H38 A;  1MQ3 A;  5DKW A;  9ICV A;  2C28 A;  4U7C A;  1JX4 A;  3D6J A;  1WYG A;  3K1R B;  3CRX A;  3NGD A;  1Z3E B;  4AYB C;  2DPI A;  3V7K A;  1V38 A;  3RTV A;  2KJ5 A;  2HOQ A;  5CP2 A;  2Q0Z X;  4F5R A;  3GV8 B;  1IM4 A;  4ICA A;  4NL9 C;  3Q8S B;  2IMW P;  4F8R A;  1L5U A;  3RR7 A;  1NK9 A;  2P6U A;  9ICR A;  3AU2 A;  5AM5 A;  1ZQY A;  2BKE A;  2W9C B;  5DDM A;  1CUK A;  5J2E A;  4RNO A;  4PJ0 U;  4NM2 A;  1UA1 A;  4UAR A;  2PI5 A;  3GDX A;  5KFY A;  3SZ2 A;  3WU2 U;  2EAP A;  2ZJ5 A;  3H8S A;  1ZQT A;  1VJ5 A;  2DF4 B;  4Q8E A;  4JV2 A;  1ZD3 A;  4F5O A;  1LB2 B;  2K89 A;  5L1I A;  5ALP A;  4IRD A;  3R9K A;  1JAL A;  7ICI A;  4CF3 A;  2B6G A;  4DSE A;  2GH1 A;  2FLP A;  3CP8 A;  4X5V A;  2GOL A;  1RQN A;  2QAR A;  5KG2 A;  2AGO A;  3JPN A;  9ICC A;  1OXJ A;  2KHV A;  3LVV A;  2AH5 A;  2H3Z A;  5DDY A;  2KHQ A;  2LI6 A;  3C2M A;  1NK7 A;  2UVW A;  4JB3 A;  4NV0 A;  1NK5 A;  1Q8K A;  4F72 A;  2XI9 A;  1Z1V A;  4NLB A;  1ZQG A;  4IQW A;  3DEE A;  3IV6 A;  3GIL A;  1O03 A;  1DOQ A;  3M1Y A;  5CR0 A;  2IHN A;  4MHV A;  3CNH A;  7ICL A;  2ZXI A;  1WWU A;  4EEK A;  3SV4 A;  1L7P A;  3ZDA A;  4MFA A;  3T5K A;  2F2A B;  3WK5 A;  3MR3 A;  2Y0S C;  2JHD A;  2W43 A;  3TQ1 A;  3ZDE A;  4F2S A;  3IG8 A;  3MFI A;  5EE1 A;  3AU6 A;  5J0Y A;  2CRX A;  7ICQ A;  1SXE A;  5AM0 A;  4RQ7 A;  5KFB A;  1ZQS A;  4EX6 A;  7ICS A;  5KFP A;  2EAO A;  5DQI A;  5EE9 A;  5JTI A;  2IHM A;  2ZIV A;  1BVS A;  2NYV A;  5ALG A;  1ZD4 A;  1ZQV A;  1K1Q A;  4EBE A;  1QCK A;  2KFZ A;  3QE9 Y;  2PFO A;  4NJ8 A;  1T3N A;  2O6K A;  5AKY A;  5IIL A;  3G6V A;  2OCE A;  5KT6 A;  5AKI A;  5KT2 A;  2J6U A;  3SMV A;  5KFZ A;  2MUT A;  1WCN A;  2AJQ A;  1OUQ A;  2KD1 A;  4ELT A;  4DEZ A;  1ED1 A;  3ICX A;  3NRW A;  4DL6 A;  4P0Q A;  2JRZ A;  4DLG A;  4UW9 A;  4RUA A;  3SI8 A;  3WK6 A;  2GLE A;  3N7P D;  2WB1 F;  4P4O A;  3THV A;  3PX6 A;  1SWW A;  2V4R A;  1RXW A;  3MBY A;  2QKQ A;  7ICN A;  4GXI A;  5AIA A;  4KLU A;  3VCB A;  4O3S A;  3C23 A;  1SL2 A;  4E0D A;  3AMZ A;  4CF5 A;  3DV9 A;  2KKP A;  2WTF A;  1IV8 A;  5ALF A;  4KMU A;  4EYH B;  1TK8 A;  2AXT U;  4KIT B;  1PK1 B;  4P4P A;  2ZJ8 A;  2ALZ A;  5AKE A;  5DBB A;  4C7Z A;  2FLL A;  2LHT A;  3F2C A;  3IHQ B;  2GO7 A;  2G0A A;  3BQ1 A;  1KL9 A;  2ZJA A;  5A0L A;  2QB1 A;  2P6R A;  4B6J A;  4J9O A;  1XO1 A;  2A19 A;  5AKG A;  4J9P A;  2YN4 A;  4B9T A;  3LYS A;  2CPR A;  3MR5 A;  4RT3 A;  1GO3 F;  1X6J A;  3TAD C;  5ALL A;  3MDC A;  1L3S A;  1QSS A;  4F93 B;  3M7D A;  4ECY A;  1S5L U;  4KLJ A;  7ICE A;  3MAB A;  5KL8 B;  2AGQ A;  4XUS A;  4F91 B;  1SZP A;  3RJI A;  4NM1 A;  5HHH A;  2ZIX B;  2E8O A;  3PVX A;  1TAQ A;  5ALM A;  1Z4N A;  9ICE A;  3AQE A;  3RAQ A;  3H4D A;  3GIJ A;  4GXK A;  1Z00 A;  2ZG6 A;  3EPI A;  4M6W A;  4Y2U A;  4BUG A;  3PST A;  3K75 D;  3PML A;  7ICH A;  1X9W A;  3UXO A;  2E8P A;  3RR8 A;  2A3V A;  5CJ7 A;  2QB0 A;  5IIN A;  4PGQ A;  1SB3 C;  4UBC A;  8ICW A;  5CA7 A;  2W9B B;  1BPX A;  3WKD A;  8ICO A;  4UB8 U;  1NK8 A;  4OJ5 A;  1JI7 A;  1WCL A;  3F53 A;  4PGX A;  2H3Q A;  4DQS A;  1ZET A;  4DSL A;  1MN8 A;  2HCF A;  4DOB A;  5ALY A;  8ICE A;  2HBL A;  1NZB A;  3QXG A;  5L1J A;  4QZG A;  4OJL A;  4K4H A;  1KLN A;  1ZOL A;  4WJ3 B;  5HNK A;  4A8E A;  3PR5 B;  5AI0 A;  1A77 A;  2VKQ A;  2W9A A;  4F5Q A;  4NLK A;  4KLS A;  1QTM A;  3KHL A;  4DL3 A;  4C7Y A;  4KX3 A;  2JMG A;  1UA0 A;  4PZO A;  2XO7 A;  1KBU A;  3JPR A;  4RNN A;  2FMP A;  4DOC A;  1N60 A;  5AI4 A;  4B9N A;  4NLN A;  4M2Y A;  1MC8 A;  4LVS A;  1T4G A;  5KG6 A;  1X9X A;  1V9P A;  3ZD8 A;  4MEX A;  5J2B A;  8ICM A;  2WF9 A;  4O5E A;  5KFL A;  2ZTC A;  2E5S A;  3KTQ A;  4RQ4 A;  2AHO B;  4ECZ A;  3SQI A;  1ZXI A;  1DGS A;  8ICP A;  1PVR A;  4DO9 A;  9ICH A;  3NVY A;  3RB4 A;  1NK4 A;  3KKA A;  4CRX A;  4KLM A;  3E2E A;  9ICO A;  3H8W A;  4B9V A;  4DL4 A;  2Y1J A;  4RNM A;  4UB1 A;  1TAU A;  3KBB A;  3RAX A;  1WG8 A;  4YXJ A;  3TFR A;  4R63 A;  4Q8F A;  8ICK A;  2LYB A;  5DQG A;  4YG2 A;  9ICP A;  2RQ5 A;  5EWG A;  1C7Y A;  3ZDD A;  3V72 A;  2K4P A;  2ASL A;  1UHU A;  2UVR A;  2F1J A;  2A1J B;  2K8A A;  3H0L B;  3B9J A;  4QJF B;  3CYM A;  1PVP A;  1BPY A;  3GFK B;  5HR6 A;  2JEI A;  1NJX A;  1XSN A;  2UVU A;  3KKA C;  2MAX A;  3QUC A;  1ZQK A;  5C0Y A;  3E0F A;  5F9N A;  4RQ6 A;  2I5H A;  3N4M B;  2VJ4 A;  3FM9 A;  2OXO A;  3GU3 A;  2XID A;  4YVZ A;  4Y2S A;  3C29 A;  4M9J A;  1JMS A;  1S0V A;  2WF8 A;  4F2R A;  3ETR A;  3H8J A;  1N48 A;  2DPJ A;  2C22 A;  4PH5 A;  1ZJN A;  2R8H A;  4PGY A;  4UB6 U;  1JIH A;  4O9M A;  3M8R A;  4YXM A;  4EX7 A;  4J9L A;  4BWM A;  1X9M A;  4Y2V A;  4Y2T A;  3LWM A;  2KIC A;  5ALV A;  5J2D A;  1KQQ A;  4O0I A;  2KP7 A;  5ALS A;  4B9U A;  5ALW A;  1TE2 A;  1IG6 A;  4J9S A;  1Q3U A;  1T7P A;  3ED5 A;  1XSL A;  2KOB A;  9ICG A;  3U26 A;  4ED3 A;  2KN7 A;  2YB1 A;  4DQR A;  2WF5 A;  5KT3 A;  4I2F A;  1ZQ1 C;  1CEZ A;  4Z6F A;  4Z6D A;  2M9N A;  1JXL A;  4CNQ A;  4I2G A;  4BWJ A;  5C5J A;  3WKC A;  4ECU A;  5GTI U;  5G5H A;  4LZD A;  4UB3 A;  1J2N A;  8ICB A;  5ALQ A;  1OW5 A;  4DWI A;  3RH4 A;  1YZ6 A;  4FS2 A;  2Y0S F;  2F1I A;  2FLN A;  5KFV A;  3KOO A;  4OD0 A;  4BXO B;  1IXR A;  1D8B A;  2MRL A;  2ZXH A;  3NVZ A;  2R8G A;  5CHG A;  1TV9 A;  1QH9 A;  5GTH U;  3D2S A;  2ZIW A;  3RB6 A;  2HI0 A;  3KHG A;  5ALK A;  1Z19 A;  8ICS A;  3MFH A;  5KFK A;  4DOA A;  3PMN A;  1NKC A;  2ODG A;  5B5E U;  2KIV A;  1U48 A;  4J9K A;  2GWS A;  3LDA A;  2JEF A;  4UAV A;  4TQS A;  2LM1 A;  4UB2 A;  2DQN B;  4KLE A;  2VA8 A;  3AQF A;  4NWI A;  4J9R A;  1DK3 A;  3OJU A;  4NLZ A;  3IP4 B;  1QLN A;  5ALR A;  2RDI A;  1BPZ A;  8ICZ A;  1SV0 C;  2HHV A;  4O5K A;  3QX7 A;  3QZ7 A;  5KTQ A;  4KLT A;  1BNP A;  5HHI A;  3C2L A;  3TAP A;  2BDP A;  4DFJ A;  2YTU A;  2HHQ A;  2OWO A;  3SEN A;  3H8M A;  5HMM A;  4F5P A;  2LYA A;  1NJY A;  3ONN A;  8ICC A;  7ICT A;  3ISC A;  2FMQ A;  5AI5 A;  4ECX A;  2CXY A;  2C2E A;  2KJ9 A;  2K4H A;  7ICG A;  4DL5 A;  4KLL A;  4DQP A;  9ICK A;  1XS9 D;  5ALH A;  1NK6 A;  4DS5 A;  4RQ3 A;  1WUD A;  3V6H A;  5KFF A;  4BDP A;  4I2A A;  4FZM A;  2DUY A;  4C8N A;  2W54 A;  4I29 A;  1LKY A;  1COO A;  1JRP A;  5DLF A;  3PW0 A;  1MSW D;  3B0X A;  4EZ6 A;  2F76 X;  7ICM A;  1NKB A;  3RBE A;  4EZ9 A;  2LYH A;  1QSY A;  2ZIU A;  4IL6 U;  7ICR A;  2IBK A;  4KLI A;  3MR6 A;  2H3I A;  3C1Y A;  1ZQN A;  3QU7 A;  4DFK A;  1SKR A;  4MEY A;  5AKH A;  4QZB A;  2QAR B;  2HVH A;  4O3R A;  2EZZ A;  1BPB A;  2BQ3 A;  4J9N A;  3PR4 A;  4UAU A;  4YD1 A;  4QWE A;  5IIO A;  1F44 A;  4I2I A;  3ETL A;  3LVW A;  3A0H U;  3QEB Z;  2ZTE A;  1BGX T;  5IIJ A;  1WWV A;  3LWL A;  4CE6 A;  4JV1 A;  2R8K A;  5IIK A;  2BCU A;  1S9F A;  7ICV A;  1TFR A;  3UXN A;  5L1K A;  3Q8R B;  3BS5 A;  1D8Y A;  2FE9 A;  3PW4 A;  2ASD A;  4EEL A;  1FFV A;  1PVQ A;  2HHT A;  3I1Y A;  4ZOH C;  4FZL A;  3UQ2 A;  2E1F A;  5KFC A;  4RU9 A;  5KT4 A;  5DG9 A;  4O3P A;  3TAN A;  4R64 A;  4PPX A;  3K1Z A;  4ECW A;  3C21 A;  4IQT A;  3SD7 A;  1RDF A;  3PO5 A;  1RQL A;  2JH1 A;  1UQV A;  2E3T A;  2ZIV B;  4ELU A;  2ASJ A;  4DSK A;  2KK0 A;  3IDW A;  2F8K A;  3AN1 A;  4QZI A;  9ICA A;  2HW3 A;  3NVV A;  1SKS A;  2DGZ A;  2FI1 A;  3M6K A;  1F5S A;  4Y2Y A;  5D46 A;  1U45 A;  3BJY A;  1KRP A;  4DQI A;  4PHD A;  2HBM A;  1JN3 A;  1KDH A;  5DG7 A;  3F5A A;  5KFR A;  2R8J A;  4K4G A;  5BOM A;  4P0Q B;  3PV8 A;  5D49 A;  5ALE A;  4FBT A;  1N61 A;  4EYI B;  3RJK A;  5HP4 A;  5KFO A;  2W8K A;  2NV3 A;  2KKV A;  2BPG A;  4M9L A;  4FFD A;  2F8L A;  4US9 A;  5AKK A;  2NO5 A;  2JEJ A;  3PX0 A;  4C4T A;  2BZF A;  2KZZ A;  1S10 A;  1ZQL A;  4FZN A;  1ZD2 P;  3A0B U;  5KFD A;  2C2R A;  2EQY A;  2BGW A;  2BCQ A;  4C4S A;  3PW5 A;  2G07 A;  2XY6 A;  4JMU A;  4F5N A;  3N28 A;  4F4Y A;  2LBO A;  3SAH A;  3PSF A;  3VC8 A;  3BDP A;  2YX8 A;  4MF8 A;  4QW8 A;  3HKZ C;  1Q3V A;  5J0X A;  2LM4 A;  2KV2 A;  5G5G A;  3F2B A;  5AM1 A;  2FPM A;  4Q44 A;  5TIS U;  1B4F A;  3LK9 A;  1IIP A;  3BQ7 A;  4QIW F;  2EZY A;  1T94 A;  2EZX A;  1RYR A;  3BQT A;  2K4I A;  3EYZ A;  2J6S A;  3GV7 B;  2G5I B;  4YD2 A;  4YN4 A;  5KAI U;  2P66 A;  2KEY A;  3L5K A;  3TAQ A;  4F92 B;  4C8K A;  4TQR A;  4B9S A;  3ZI4 A;  4NLG A;  2DKX A;  1Z00 B;  4YQW A;  2XY7 A;  1PK1 A;  4RZR A;  3M9N B;  4YR3 A;  4ECQ A;  2PFP A;  2VA2 A;  2BPC A;  1F0M A;  2QB0 B;  3N97 B;  9ICN A;  5J0S A;  2WF6 A;  1NK0 A;  3KHR A;  4YMN A;  3TFS A;  2ATL A;  4DCC A;  3QEA Z;  2HBJ A;  2ISP A;  2BDU A;  5KFS A;  2KZM A;  5H2F U;  3ISB A;  4BJQ A;  2HMX A;  3WKE A;  4TUR A;  3T5J A;  2H3F A;  5KAF U;  3KD3 A;  5DGB A;  1JRO A;  3H40 A;  7ICJ A;  5T14 A;  4C4R A;  5KFI A;  8ICG A;  2BQU A;  2Y1I A;  2B21 A;  4Y2Q A;  5DQH A;  2XCA A;  1Q46 A;  5KT7 A;  1N56 A;  4HAI A;  2I9G A;  2ZIX A;  2J6T A;  9ICM A;  5J0R A;  1Z1B A;  3L3F X;  4OJO A;  1NOM A;  4GFJ A;  2F77 X;  5KFQ A;  2YQE A;  2WAQ F;  3QU9 A;  3UMC A;  4I28 A;  1QSL A;  2PMZ C;  3OGU A;  5D4B A;  1TK0 A;  2ZTD A;  4OO1 J;  1ZQP A;  4U6P A;  4UAZ A;  4JWM A;  3PSI A;  4F4Z A;  1N5X A;  4I2J A;  1LVH A;  5K4L A;  4FE3 A;  1N2X A;  2BCV A;  1QQ5 A;  2IOH A;  2NRT A;  1L7N A;  2LPE A;  3QU5 A;  2KFN A;  4KN4 A;  4ED8 A;  8ICU A;  2NRZ A;  2E1E A;  4BX9 C;  1X2I A;  1ZQQ A;  3EWA A;  5E79 U;  9ICS A;  3E58 A;  3AL0 B;  4GXJ A;  5J2H A;  1NJW A;  2NRX A;  3RH6 A;  2JV3 A;  8ICQ A;  2L5Y A;  4GLX A;  3Q8M A;  2HOF A;  5KFN A;  2IOF A;  5KG1 A;  1DGJ A;  4DSF A;  2PKE A;  5KFM A;  3JPO A;  4GC6 A;  4C8M A;  2XVT A;  3D2Q A;  4P0P A;  1B22 A;  1L3V A;  1VLB A;  4DFD A;  4KLG A;  2DFL A;  3CW2 C;  3KZI U;  4YP3 A;  1ARO P;  3IN5 A;  4QWB A;  4QIW C;  1HJP A;  2HHS A;  1XC9 A;  3M6Z A;  2FDR A;  4R66 A;  5EOZ A;  4M47 A;  1RPL A;  9ICI A;  2I1Q A;  1BNO A;  3HT3 A;  2FJ6 A;  3OTQ A;  2RLT A;  4I2E A;  3NRZ A;  2D6F C;  3IM1 A;  2EAN A;  4DS4 A;  4IQU A;  2K60 A;  3BZC A;  3V7J A;  4USA A;  3UQ0 A;  2ESE A;  3C1Z A;  1N63 A;  2YY6 A;  3GII A;  3DDH A;  4Y2X A;  8ICH A;  1S8O A;  4XRH A;  4F4W A;  2OHF A;  2JZB B;  1ZQX A;  4QZF A;  1SIJ A;  5J29 A;  8ICN A;  3ORY A;  2W04 A;  2KE7 A;  2JEG A;  4M9G A;  5ALX A;  1AQ6 A;  1ZQR A;  4UBB A;  2E8M A;  4IS7 A;  5KFT A;  3MGH A;  2YB4 A;  5BOL A;  4KN7 A;  5KFJ A;  2K8B B;  1SGG A;  4DL7 A;  5J0O A;  4JUZ A;  1SZH A;  3RRG A;  2Q4T A;  2XY5 A;  4ECT A;  2W3R A;  3GIK A;  3Q8Q B;  2AGP A;  4YMO A;  5EE0 A;  4GC7 A;  4ZH4 A;  4Y2R A;  5JRT A;  4DFP A;  2W7P A;  2JXJ A;  3PW2 A;  2KZ3 A;  2WAQ C;  2HOI A;  1FEZ A;  2KSO A;  1J97 A;  2WFA A;  4C8L A;  1JUD A;  2KNJ A;  4B9L A;  3T5L A;  3RJG A;  2OYY A;  1ZQD A;  3OSN A;  4M04 A;  2W7O A;  1ZQW A;  1COK A;  1J2M A;  1XWL A;  4QWA A;  2KIW A;  1L6N A;  4QZA A;  2G06 A;  2HHX A;  4YFK A;  4QZD A;  3RRH A;  4F4X A;  3QUB A;  3RB3 A;  5ALN A;  5J0W A;  1T8E A;  4RUC A;  9ICU A;  3WK9 A;  2RDJ A;  4QZ8 A;  5KG4 A;  2JH7 A;  8ICV A;  4RQM A;  4G9B A;  3WKA A;  3QZ8 A;  4J9Q A;  3RJF A;  1ZQO A;  3T5H A;  2Y9T A;  4FS1 A;  2NO4 A;  1LKY B;  1JXE A;  4KLO A;  5CEH A;  2PFQ A;  4KLD A;  4RQ8 A;  4DF8 A;  2FPL A;  4R8U A;  3JPP A;  2BR0 A;  2Y9U A;  5ALT A;  1FFU A;  4PL2 A;  4RQ2 A;  1M6Y A;  1RZT A;  5ALO A;  1L7O A;  5J0Q A;  5L1L A;  4I2B A;  5KFW A;  1HUZ A;  2ZIU B;  3O0F A;  1N62 A;  1L7M A;  4CGZ A;  5CB1 A;  1HIW A;  3H7I A;  1PZN A;  5J8Y A;  4IR1 A;  1S0N A;  3HKZ F;  4UB5 A;  5J0T A;  3AUO A;  1TK5 A;  1A0P A;  1KFS A;  7ICK A;  4F3O A;  4QZH A;  5KFH A;  2NRV A;  4RQ5 A;  4IR9 A;  5CWR A;  4FO6 A;  1QQ6 A;  4XA5 A;  4ACO A;  4QZ9 A;  3FC4 A;  3PO4 A;  3TAR A;  5AK3 A;  1LV5 A;  4PZN A;  5AIB A;  2BQR A;  5J2C A;  1DRG A;  3HRD D;  1YZ7 A;  5DLG A;  1P7D A;  4UB4 A;  2DBY A;  3BQ2 A;  8ICX A;  5AM2 A;  4IC9 A;  4YMM A;  2ES6 A;  4KLF A;  3OJS A;  2WF7 A;  5HR7 A;  4F50 A;  5EWF A;  3ALR A;  5ALZ A;  4ECR A;  4QWD A;  4DSJ A;  3KHH A;  1L8L A;  4KLQ A;  3BS5 B;  2A1A A;  5J8Y C;  3RBD A;  5KFE A;  3HP6 A;  3OHB A;  1S0O A;  2I6X A;  1KW4 A;  1ZQZ A;  1ZRM A;  2W9C A;  4LJX A;  4F71 A;  4Q45 A;  5ALU A;  1URJ A;  3PW7 A;  4QWC A;  8ICL A;  3BQ0 A;  9ICJ A;  2W3S A;  3KFU F;  4US8 A;  4CCH A;  1ZQJ A;  1X40 A;  2OM6 A;  5KL1 B;  2K4E A; 
#chains in the Genus database with same CATH homology
 4OO1 J;  2G09 A;  2YB1 A;  4U6P A;  3PSI A;  2G5I B;  1WUD A;  1ZQ1 C;  4C0Z A;  3KZX A;  4CRX A;  4FZM A;  2KEY A;  4AYB F;  1MA7 A;  5CRX A;  4QNL A;  2ZIX B;  2DGZ A;  3PSP A;  3SMV A;  4FE3 A;  3AQE A;  3D2N A;  3H0R B;  2LKY A;  2RP5 A;  2W04 A;  3M6K A;  1TAM A;  2KVC A;  2RRD A;  2F76 X;  2DF4 B;  1OUQ A;  5KL8 B;  2HBM A;  2ZG6 A;  2KD1 A;  2G08 A;  2LYB A;  4BUG A;  2K89 A;  1ED1 A;  3ICX A;  2Y0S F;  3PST A;  3SAF A;  2VJ5 A;  3NRW A;  4P0Q A;  4KX5 A;  2ZIU A;  2YB4 A;  4PL2 A;  1D8B A;  3N7P D;  2E1E A;  2MRL A;  2WB1 F;  2ZXH A;  3F5A A;  2GH1 A;  3OPX A;  4BX9 C;  3C28 A;  1XO0 A;  4O3M A;  2K8A A;  3CP8 A;  4P0Q B;  2H3I A;  3H0L B;  2K8B B;  3RFA A;  2ZIU B;  3O0F A;  2GOL A;  3D2S A;  2CN1 A;  4QJF B;  2ZIW A;  2N1R A;  3CYM A;  3AL0 B;  4CGZ A;  1PVP A;  2KHV A;  1HIW A;  3RF9 A;  3LVV A;  4KMO B;  3F2D A;  4OJ5 A;  1SZH A;  2H3Z A;  1Z19 A;  1A6S A;  2KHQ A;  2Q4T A;  3F53 A;  2H3Q A;  3N7S C;  5HR6 A;  2MA1 A;  3HKZ F;  3N7R C;  3VCB A;  2NV3 A;  5KL1 B;  2H3V A;  4NV0 A;  2HOF A;  1A0P A;  2Z7J A;  2KKV A;  2XI9 A;  3T79 A;  5C0Y A;  3E0F A;  2K8C B;  2HBJ A;  2F8L A;  2VIX A;  4NLB A;  2BDU A;  2VJ4 A;  2W7P A;  4OJP A;  2OXO A;  3DEE A;  3GU3 A;  4BJQ A;  2KKP A;  2XID A;  1F44 A;  1UPH A;  2HMX A;  4PL1 A;  4ACO A;  2WAQ C;  2PMZ F;  3LVW A;  2HBL A;  3MGV A;  2DQN B;  1NZB A;  3IG5 A;  2HOI A;  3C29 A;  2XVT A;  4OJL A;  2H3F A;  2RHF A;  3D2Q A;  2ZXI A;  3AQF A;  3F5E A;  4FZN A;  4NWI A;  1DRG A;  4P0P A;  4WJ3 B;  4A8E A;  3H0M B;  2R18 A;  3IP4 B;  1P7D A;  2XIC A;  2KNJ A;  3SAG A;  2KJ8 A;  1XNS A;  2F2A B;  5T14 A;  3IN5 A;  2VKQ A;  2Y0S C;  2A3V A;  4QIW C;  2JHD A;  4P0P B;  2OYY A;  1CRX A;  2HBK A;  2M0N A;  4IC9 A;  4U7C A;  2ZIW B;  3IG8 A;  4KX3 A;  2WB1 C;  2W7O A;  1PVR A;  3CRX A;  2G07 A;  2LHT A;  3F2C A;  2JMG A;  3M6Z A;  4JMU A;  2KIW A;  2OH2 A;  2G0A A;  1ECW A;  4AYB C;  5HR7 A;  2ZIX A;  2CRX A;  1KBU A;  1L6N A;  3GZF A;  5A0L A;  3ALR A;  1PVQ A;  1Z1B A;  2LBO A;  3L3F X;  4OJO A;  3PZP A;  2KJ5 A;  3SAH A;  1YT3 A;  4FZL A;  2HOQ A;  2E1F A;  2LYA A;  3PSF A;  2F77 X;  2G06 A;  4GFJ A;  3VC8 A;  2KIC A;  3ONN A;  2YX8 A;  2D6F C;  2G5H B;  3HKZ C;  4ICA A;  1Q3V A;  2WAQ F;  3K1Z A;  3LYS A;  2JGA A;  1HEK A;  2CPR A;  2KV2 A;  2ZIV A;  1GO3 F;  1URJ A;  2E5S A;  3F2B A;  2JH1 A;  2KJ9 A;  3KFU F;  1Q3U A;  2ZIV B;  2K4H A;  1IIP A;  2JH7 A;  3M7D A;  2PMZ C;  4NLC A;  4QIW F;  2W03 A;  1T94 A;  3SQI A;  4OJ6 A;  2OM6 A;  3NUQ A;  2KOB A;  4CDG A;  2K4E A;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...