3H02A

2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
266
Chain Sequence
DETMLYAPVEWHDCSEGYTDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNVGVIILTGEGDKAFCAGGDQHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.15 Angstrom Resolution Crystal Structure of Naphthoate Synthase from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Naphthoate synthase
total genus 91
structure length 266
sequence length 281
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2009-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3h02A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3h02A01
3R6HA 3R9QA 3ZW8A 4JCRA 3DORA 4L8KA 5DU6A 2A81A 4HNKA 3P2LA 3TDCA 1YG6A 3N6RB 1Q52A 3WG5A 1HNOA 5JBWA 2ZQQA 1W2XA 2GTRA 1X0UA 5KJPA 5JBXA 3BPPA 4Q0GA 3BF0A 2VSSA 3Q7HA 4U0HA 1Q51A 4ELSA 5G1SA 4ASIA 2VSUC 5DKPA 4QIIA 4ZDBA 2F6IA 4JCTA 4KNPA 4I4ZA 2VSUE 5DZKA 1JXZA 3KTJA 3BEZA 3P85A 3LAOA 3QXZA 5DL1A 3M6NA 5INFA 5DUFA 5INIA 3R9TA 5CTCA 3QMJA 3HLN1 3MFMA 3U9TB 3Q0GA 4G2RA 3GLMA 1SZOA 3GF7A 4B3JA 4KD6A 3H81A 3RSIA 3JU1A 3QWDA 2FBMA 3HINA 2HW5A 1FC6A 3DJAA 2ZL3A 1WDKA 3KTIA 1WDMA 4K29A 3R0OA 4I42A 4NNQA 2BZRA 1NZYB 2DUBA 4MXIA 1XNWA 2WTBA 3G64A 4GHNA 1XNVA 4U18A 3L3SA 3Q0JA 4JSBA 4MOUA 4IZDA 3TZ3A 3K50A 4JYJA 4OG1A 3TT6A 2UZFA 3T88A 3PGQA 2QQ3A 4JWVA 3K8XA 4JOTA 3ZWCA 5CTBA 5INGA 2F9YB 1XNYA 1SG4A 2CE3A 1WDLA 3RRVA 2PG8A 3SLLA 2VSSF 1K39A 2Q35A 3H0UA 3SWXA 3NJDA 3FF6A 1NZYA 1YG8A 4FNBA 1OD2A 2X58A 2VREA 4FNDA 3ISAA 3T3WA 3R9SA 4QFEA 4RYFH 3OC7A 2PPYA 3KTGA 2J5IA 4U0GA 3HP0A 4Q1IA 1N6DA 2DEOA 5DTPA 4GM2A 3QK8A 3PE8A 1EF9A 4YLHA 2J5II 3FDUA 1FC9A 4QIJA 2F9IA 2VSSE 2J5SA 1FCFA 3PEAA 1FC7A 2FW2A 2J5GD 4FB8A 3GMAA 4U0GH 1TG6A 1ON3A 2EJ5A 2NP9A 1UYTA 5DU8A 2A7KA 3OMEA 3QYRA 5KDRB 5DU4A 1OD4A 4ZDDA 3H0QA 4JCQA 2IEXA 1PIXA 1XX4A 5E0SA 2ZL2A 2F9IB 4IZBA 4KPKA 4F47A 1UYSA 4FZWC 4I52A 1J7XA 4L6WA 2FZSA 4FN8A 3IB9A 3T89A 4EMPA 2VSUF 4IZCA 4OMRA 3ST9A 3T8AA 1DCIA 1WZ8A 3GKBA 3TLFA 1O8UA 4RCNA 1N6EA 2W3PA 4KWBA 3QKAA 5DUCA 3MT6A 3QREA 3PZKA 1K32A 4FZWA 3MOYA 5FUSA 1VRGA 1HZDA 4FJWD 3I47A 5DTWA 3ZW9A 3P5MA 2ZQRA 3KQFA 1UIYA 1DUBA 3TRRA 3H0SA 3HRXA 2J5GA 3OT6A 1XO6A 3NJBA 3ZWBA 4MI2A 4WZ8B 5E0NX 3U9SB 2Q2XA 4EMMA 4U19A 4ELXA 4WCZA 3Q1TA 5MGBA 2ZL0A 3U9RB 4B3IA 3KTKA 4JYLA 4JCSA 5DZKH 4Z0MA 1HNUA 1TYFA 4ZDFA 4JVTA 4EMLA 2J5IB 5FIFA 2F6QA 3H02A 1EF8A 1Y7OA 4OLQA 2D3TA 3IBBA 1PJHA 2VX2A 3M6MA 1RJNA 2ZL4A 4WYOB 4LK5A 3RSTA 4ELWA 5E0SH 3T8BA 4NEKA 3TVWA 4K3WA 4FN7A 4U1AA 3TVUA 2PBPA 1MJ3A 3KTHA 4K2NA 4RYFA 4DI1A 3TT7A 5IKLB 2F9YA 2VSUA 3LKEA 5C9GA 3H0JA 4ZDCA 1N6FA 3GF3A 4ZDEA 3ZWAA 3VIVA 3IAVA 2CBYA 5G1QA 3TV5A 3MYBA 4ZU2A 1ON9A 5G1RA 5KDRA 4JJTA 3V5EA 2X24A 1RJMA 3QXIA 3STAA 1UYRA 2C8TA 4B3HA 4JFCA 3HE2A 5C90A 1UYVA 2A7SA 4HC8A 3V5IA 1EY3A 2Q34A
chains in the Genus database with same CATH superfamily
3R6HA 3R9QA 3ZW8A 4JCRA 3DORA 4L8KA 5DU6A 2A81A 4HNKA 3P2LA 3TDCA 1YG6A 3N6RB 1Q52A 3WG5A 1HNOA 5JBWA 2ZQQA 1W2XA 2GTRA 1X0UA 5KJPA 5JBXA 3BPPA 4Q0GA 3BF0A 2VSSA 3Q7HA 4U0HA 1Q51A 4ELSA 5G1SA 4ASIA 2VSUC 5DKPA 4QIIA 4ZDBA 2F6IA 4JCTA 4KNPA 4I4ZA 2VSUE 3W8IB 3A4NA 5DZKA 1JXZA 3KTJA 3BEZA 3P85A 3W8HB 3LAOA 4NARA 3QXZA 5DL1A 3M6NA 5INFA 5DUFA 5INIA 3R9TA 5CTCA 3QMJA 3HLN1 1Y64B 3MFMA 3U9TB 3AM1A 3Q0GA 4G2RA 3GLMA 1SZOA 3GF7A 4B3JA 4KD6A 3H81A 3RSIA 3JU1A 3ADDA 3QWDA 2FBMA 3HINA 2HW5A 1FC6A 3DJAA 2ZL3A 1WDKA 3KTIA 1WDMA 4K29A 2YJGA 3R0OA 4I42A 4NNQA 2BZRA 1NZYB 2DUBA 4MXIA 1XNWA 3IRBA 3G64A 2WTBA 4GHNA 1XNVA 4U18A 3L3SA 3Q0JA 4JSBA 4MOUA 1UX4A 4IZDA 3TZ3A 3K50A 4JYJA 4OG1A 3TT6A 2UZFA 3T88A 3PGQA 2QQ3A 4JWVA 3K8XA 4JOTA 3ZWCA 5CTBA 5INGA 2F9YB 1XNYA 1SG4A 2CE3A 1WDLA 3RRVA 2PG8A 3SLLA 2VSSF 1K39A 2Q35A 3A4MA 3A4LA 3H0UA 3SWXA 3NJDA 3FF6A 1NZYA 1YG8A 4FNBA 1OD2A 2X58A 2VREA 4FNDA 3O4XE 3ADBA 3AJMA 3ISAA 3T3WA 3ADCA 3R9SA 4QFEA 4RYFH 3OC7A 2PPYA 3KTGA 2J5IA 4U0GA 3HP0A 4Q1IA 1N6DA 2DEOA 5DTPA 4GM2A 3QK8A 3PE8A 1EF9A 4YLHA 2J5II 3FDUA 1FC9A 3BPTA 4QIJA 2F9IA 2VSSE 2J5SA 1FCFA 3PEAA 1FC7A 2FW2A 2J5GD 4FB8A 3GMAA 4U0GH 1TG6A 1ON3A 2EJ5A 2NP9A 1UYTA 5DU8A 2A7KA 3OMEA 4J2UA 3QYRA 5KDRB 5DU4A 1OD4A 4ZDDA 3H0QA 4JCQA 2IEXA 2P63A 5HUQA 1PIXA 1XX4A 5E0SA 2ZL2A 2F9IB 4IZBA 4KPKA 4F47A 1UYSA 4FZWC 4I52A 1J7XA 4L6WA 2FZSA 4FN8A 3IB9A 3T89A 4EMPA 2VSUF 4IZCA 4OMRA 3ST9A 4GEHB 3T8AA 1DCIA 1WZ8A 3GKBA 3TLFA 1O8UA 4RCNA 1N6EA 2W3PA 3L8IA 4KWBA 3QKAA 5DUCA 3MT6A 3QREA 3PZKA 1K32A 4HDTA 4FZWA 3MOYA 5FUSA 1VRGA 1HZDA 4FJWD 3I47A 5DTWA 3ZW9A 3P5MA 2ZQRA 3KQFA 1UIYA 1DUBA 3TRRA 3H0SA 3HRXA 2J5GA 3OT6A 1XO6A 3NJBA 3ZWBA 3L8JA 4MI2A 4WZ8B 5E0NX 3U9SB 2Q2XA 4EMMA 4U19A 4ELXA 4WCZA 3Q1TA 5MGBA 2ZL0A 3U9RB 4B3IA 3RQGA 3KTKA 4JYLA 4JCSA 5DZKH 4Z0MA 1HNUA 1TYFA 4ZDFA 4JVTA 4EMLA 2J5IB 5FIFA 2F6QA 3RQEA 3H02A 1EF8A 1Y7OA 4OLQA 2D3TA 3IBBA 1PJHA 2VX2A 3M6MA 1RJNA 2ZL4A 4WYOB 4LK5A 3RSTA 4ELWA 5E0SH 3T8BA 4NEKA 3TVWA 4K3WA 4FN7A 4U1AA 3TVUA 2PBPA 1MJ3A 3KTHA 4K2NA 4RYFA 4DI1A 3TT7A 5IKLB 2F9YA 2VSUA 3LKEA 5C9GA 3H0JA 4ZDCA 1N6FA 3GF3A 4ZDEA 3ZWAA 3VIVA 3IAVA 2CBYA 5G1QA 3TV5A 3MYBA 4ZU2A 1ON9A 5G1RA 5KDRA 4JJTA 3V5EA 2X24A 1RJMA 1UX5A 3QXIA 3STAA 1UYRA 2C8TA 4B3HA 4JFCA 3HE2A 5C90A 1UYVA 2A7SA 4HC8A 3V5IA 1EY3A 2Q34A 3RQFA
chains in the Genus database with same CATH topology
3R6HA 3R9QA 3ZW8A 4JCRA 3DORA 4L8KA 5DU6A 2A81A 4HNKA 3P2LA 3TDCA 1YG6A 3N6RB 1Q52A 3WG5A 1HNOA 5JBWA 2ZQQA 1W2XA 2GTRA 1X0UA 5KJPA 5JBXA 3BPPA 4Q0GA 3BF0A 2VSSA 3Q7HA 4U0HA 1Q51A 4ELSA 5G1SA 4ASIA 2VSUC 5DKPA 4QIIA 4ZDBA 2F6IA 4JCTA 4KNPA 4I4ZA 2VSUE 5DZKA 1JXZA 3KTJA 3BEZA 3P85A 3LAOA 4NARA 3QXZA 5DL1A 3M6NA 5INFA 5DUFA 5INIA 3R9TA 5CTCA 3QMJA 3HLN1 3MFMA 3U9TB 3Q0GA 4G2RA 3GLMA 1SZOA 3GF7A 4B3JA 4KD6A 3H81A 3RSIA 3JU1A 3QWDA 2FBMA 3HINA 2HW5A 1FC6A 3DJAA 2ZL3A 1WDKA 3KTIA 1WDMA 4K29A 2YJGA 3R0OA 4I42A 4NNQA 2BZRA 1NZYB 2DUBA 4MXIA 1XNWA 2WTBA 3G64A 4GHNA 1XNVA 4U18A 3L3SA 3Q0JA 4JSBA 4MOUA 4IZDA 3TZ3A 3K50A 4JYJA 4OG1A 3TT6A 2UZFA 3T88A 3PGQA 2QQ3A 4JWVA 3K8XA 4JOTA 3ZWCA 5CTBA 5INGA 2F9YB 1XNYA 1SG4A 2CE3A 1WDLA 3RRVA 2PG8A 3SLLA 2VSSF 1K39A 2Q35A 3H0UA 3SWXA 3NJDA 3FF6A 1NZYA 1YG8A 4FNBA 1OD2A 2X58A 2VREA 4FNDA 3ISAA 3T3WA 3R9SA 4QFEA 4RYFH 3OC7A 2PPYA 3KTGA 2J5IA 4U0GA 3HP0A 4Q1IA 1N6DA 2DEOA 5DTPA 4GM2A 3QK8A 3PE8A 1EF9A 4YLHA 2J5II 3FDUA 1FC9A 3BPTA 4QIJA 2F9IA 2VSSE 2J5SA 1FCFA 3PEAA 1FC7A 2FW2A 2J5GD 4FB8A 3GMAA 4U0GH 1TG6A 1ON3A 2EJ5A 2NP9A 1UYTA 5DU8A 2A7KA 3OMEA 4J2UA 3QYRA 5KDRB 5DU4A 1OD4A 4ZDDA 3H0QA 4JCQA 2IEXA 5HUQA 1PIXA 1XX4A 5E0SA 2ZL2A 2F9IB 4IZBA 4KPKA 4F47A 1UYSA 4FZWC 4I52A 1J7XA 4L6WA 2FZSA 4FN8A 3IB9A 3T89A 4EMPA 2VSUF 4IZCA 4OMRA 3ST9A 3T8AA 1DCIA 1WZ8A 3GKBA 3TLFA 1O8UA 4RCNA 1N6EA 2W3PA 4KWBA 3QKAA 5DUCA 3MT6A 3QREA 3PZKA 1K32A 4HDTA 4FZWA 3MOYA 5FUSA 1VRGA 1HZDA 4FJWD 3I47A 5DTWA 3ZW9A 3P5MA 2ZQRA 3KQFA 1UIYA 1DUBA 3TRRA 3H0SA 3HRXA 2J5GA 3OT6A 1XO6A 3NJBA 3ZWBA 4MI2A 4WZ8B 5E0NX 3U9SB 2Q2XA 4EMMA 4U19A 4ELXA 4WCZA 3Q1TA 5MGBA 2ZL0A 3U9RB 4B3IA 3KTKA 4JYLA 4JCSA 5DZKH 4Z0MA 1HNUA 1TYFA 4ZDFA 4JVTA 4EMLA 2J5IB 5FIFA 2F6QA 3H02A 1EF8A 1Y7OA 4OLQA 2D3TA 3IBBA 1PJHA 2VX2A 3M6MA 1RJNA 2ZL4A 4WYOB 4LK5A 3RSTA 4ELWA 5E0SH 3T8BA 4NEKA 3TVWA 4K3WA 4FN7A 4U1AA 3TVUA 2PBPA 1MJ3A 3KTHA 4K2NA 4RYFA 4DI1A 3TT7A 5IKLB 2F9YA 2VSUA 3LKEA 5C9GA 3H0JA 4ZDCA 1N6FA 3GF3A 4ZDEA 3ZWAA 3VIVA 3IAVA 2CBYA 5G1QA 3TV5A 3MYBA 4ZU2A 1ON9A 5G1RA 5KDRA 4JJTA 3V5EA 2X24A 1RJMA 3QXIA 3STAA 1UYRA 2C8TA 4B3HA 4JFCA 3HE2A 5C90A 1UYVA 2A7SA 4HC8A 3V5IA 1EY3A 2Q34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6H A;  3R9Q A;  3ZW8 A;  4JCR A;  3DOR A;  4L8K A;  5DU6 A;  2A81 A;  4HNK A;  3P2L A;  3TDC A;  1YG6 A;  3N6R B;  1Q52 A;  3WG5 A;  1HNO A;  5JBW A;  2ZQQ A;  1W2X A;  2GTR A;  1X0U A;  5KJP A;  5JBX A;  3BPP A;  4Q0G A;  3BF0 A;  2VSS A;  3Q7H A;  4U0H A;  1Q51 A;  4ELS A;  5G1S A;  4ASI A;  2VSU C;  5DKP A;  4QII A;  4ZDB A;  2F6I A;  4JCT A;  4KNP A;  4I4Z A;  2VSU E;  5DZK A;  1JXZ A;  3KTJ A;  3BEZ A;  3P85 A;  3LAO A;  3QXZ A;  5DL1 A;  3M6N A;  5INF A;  5DUF A;  5INI A;  3R9T A;  5CTC A;  3QMJ A;  3HLN 1;  3MFM A;  3U9T B;  3Q0G A;  4G2R A;  3GLM A;  1SZO A;  3GF7 A;  4B3J A;  4KD6 A;  3H81 A;  3RSI A;  3JU1 A;  3QWD A;  2FBM A;  3HIN A;  2HW5 A;  1FC6 A;  3DJA A;  2ZL3 A;  1WDK A;  3KTI A;  1WDM A;  4K29 A;  3R0O A;  4I42 A;  4NNQ A;  2BZR A;  1NZY B;  2DUB A;  4MXI A;  1XNW A;  2WTB A;  3G64 A;  4GHN A;  1XNV A;  4U18 A;  3L3S A;  3Q0J A;  4JSB A;  4MOU A;  4IZD A;  3TZ3 A;  3K50 A;  4JYJ A;  4OG1 A;  3TT6 A;  2UZF A;  3T88 A;  3PGQ A;  2QQ3 A;  4JWV A;  3K8X A;  4JOT A;  3ZWC A;  5CTB A;  5ING A;  2F9Y B;  1XNY A;  1SG4 A;  2CE3 A;  1WDL A;  3RRV A;  2PG8 A;  3SLL A;  2VSS F;  1K39 A;  2Q35 A;  3H0U A;  3SWX A;  3NJD A;  3FF6 A;  1NZY A;  1YG8 A;  4FNB A;  1OD2 A;  2X58 A;  2VRE A;  4FND A;  3ISA A;  3T3W A;  3R9S A;  4QFE A;  4RYF H;  3OC7 A;  2PPY A;  3KTG A;  2J5I A;  4U0G A;  3HP0 A;  4Q1I A;  1N6D A;  2DEO A;  5DTP A;  4GM2 A;  3QK8 A;  3PE8 A;  1EF9 A;  4YLH A;  2J5I I;  3FDU A;  1FC9 A;  4QIJ A;  2F9I A;  2VSS E;  2J5S A;  1FCF A;  3PEA A;  1FC7 A;  2FW2 A;  2J5G D;  4FB8 A;  3GMA A;  4U0G H;  1TG6 A;  1ON3 A;  2EJ5 A;  2NP9 A;  1UYT A;  5DU8 A;  2A7K A;  3OME A;  3QYR A;  5KDR B;  5DU4 A;  1OD4 A;  4ZDD A;  3H0Q A;  4JCQ A;  2IEX A;  1PIX A;  1XX4 A;  5E0S A;  2ZL2 A;  2F9I B;  4IZB A;  4KPK A;  4F47 A;  1UYS A;  4FZW C;  4I52 A;  1J7X A;  4L6W A;  2FZS A;  4FN8 A;  3IB9 A;  3T89 A;  4EMP A;  2VSU F;  4IZC A;  4OMR A;  3ST9 A;  3T8A A;  1DCI A;  1WZ8 A;  3GKB A;  3TLF A;  1O8U A;  4RCN A;  1N6E A;  2W3P A;  4KWB A;  3QKA A;  5DUC A;  3MT6 A;  3QRE A;  3PZK A;  1K32 A;  4FZW A;  3MOY A;  5FUS A;  1VRG A;  1HZD A;  4FJW D;  3I47 A;  5DTW A;  3ZW9 A;  3P5M A;  2ZQR A;  3KQF A;  1UIY A;  1DUB A;  3TRR A;  3H0S A;  3HRX A;  2J5G A;  3OT6 A;  1XO6 A;  3NJB A;  3ZWB A;  4MI2 A;  4WZ8 B;  5E0N X;  3U9S B;  2Q2X A;  4EMM A;  4U19 A;  4ELX A;  4WCZ A;  3Q1T A;  5MGB A;  2ZL0 A;  3U9R B;  4B3I A;  3KTK A;  4JYL A;  4JCS A;  5DZK H;  4Z0M A;  1HNU A;  1TYF A;  4ZDF A;  4JVT A;  4EML A;  2J5I B;  5FIF A;  2F6Q A;  3H02 A;  1EF8 A;  1Y7O A;  4OLQ A;  2D3T A;  3IBB A;  1PJH A;  2VX2 A;  3M6M A;  1RJN A;  2ZL4 A;  4WYO B;  4LK5 A;  3RST A;  4ELW A;  5E0S H;  3T8B A;  4NEK A;  3TVW A;  4K3W A;  4FN7 A;  4U1A A;  3TVU A;  2PBP A;  1MJ3 A;  3KTH A;  4K2N A;  4RYF A;  4DI1 A;  3TT7 A;  5IKL B;  2F9Y A;  2VSU A;  3LKE A;  5C9G A;  3H0J A;  4ZDC A;  1N6F A;  3GF3 A;  4ZDE A;  3ZWA A;  3VIV A;  3IAV A;  2CBY A;  5G1Q A;  3TV5 A;  3MYB A;  4ZU2 A;  1ON9 A;  5G1R A;  5KDR A;  4JJT A;  3V5E A;  2X24 A;  1RJM A;  3QXI A;  3STA A;  1UYR A;  2C8T A;  4B3H A;  4JFC A;  3HE2 A;  5C90 A;  1UYV A;  2A7S A;  4HC8 A;  3V5I A;  1EY3 A;  2Q34 A; 
#chains in the Genus database with same CATH topology
 3R6H A;  3R9Q A;  3ZW8 A;  4JCR A;  3DOR A;  4L8K A;  5DU6 A;  2A81 A;  4HNK A;  3P2L A;  3TDC A;  1YG6 A;  3N6R B;  1Q52 A;  3WG5 A;  1HNO A;  5JBW A;  2ZQQ A;  1W2X A;  2GTR A;  1X0U A;  5KJP A;  5JBX A;  3BPP A;  4Q0G A;  3BF0 A;  2VSS A;  3Q7H A;  4U0H A;  1Q51 A;  4ELS A;  5G1S A;  4ASI A;  2VSU C;  5DKP A;  4QII A;  4ZDB A;  2F6I A;  4JCT A;  4KNP A;  4I4Z A;  2VSU E;  3W8I B;  3A4N A;  5DZK A;  1JXZ A;  3KTJ A;  3BEZ A;  3P85 A;  3W8H B;  3LAO A;  4NAR A;  3QXZ A;  5DL1 A;  3M6N A;  5INF A;  5DUF A;  5INI A;  3R9T A;  5CTC A;  3QMJ A;  3HLN 1;  1Y64 B;  3MFM A;  3U9T B;  3AM1 A;  3Q0G A;  4G2R A;  3GLM A;  1SZO A;  3GF7 A;  4B3J A;  4KD6 A;  3H81 A;  3RSI A;  3JU1 A;  3ADD A;  3QWD A;  2FBM A;  3HIN A;  2HW5 A;  1FC6 A;  3DJA A;  2ZL3 A;  1WDK A;  3KTI A;  1WDM A;  4K29 A;  2YJG A;  3R0O A;  4I42 A;  4NNQ A;  2BZR A;  1NZY B;  2DUB A;  4MXI A;  1XNW A;  3IRB A;  3G64 A;  2WTB A;  4GHN A;  1XNV A;  4U18 A;  3L3S A;  3Q0J A;  4JSB A;  4MOU A;  1UX4 A;  4IZD A;  3TZ3 A;  3K50 A;  4JYJ A;  4OG1 A;  3TT6 A;  2UZF A;  3T88 A;  3PGQ A;  2QQ3 A;  4JWV A;  3K8X A;  4JOT A;  3ZWC A;  5CTB A;  5ING A;  2F9Y B;  1XNY A;  1SG4 A;  2CE3 A;  1WDL A;  3RRV A;  2PG8 A;  3SLL A;  2VSS F;  1K39 A;  2Q35 A;  3A4M A;  3A4L A;  3H0U A;  3SWX A;  3NJD A;  3FF6 A;  1NZY A;  1YG8 A;  4FNB A;  1OD2 A;  2X58 A;  2VRE A;  4FND A;  3O4X E;  3ADB A;  3AJM A;  3ISA A;  3T3W A;  3ADC A;  3R9S A;  4QFE A;  4RYF H;  3OC7 A;  2PPY A;  3KTG A;  2J5I A;  4U0G A;  3HP0 A;  4Q1I A;  1N6D A;  2DEO A;  5DTP A;  4GM2 A;  3QK8 A;  3PE8 A;  1EF9 A;  4YLH A;  2J5I I;  3FDU A;  1FC9 A;  3BPT A;  4QIJ A;  2F9I A;  2VSS E;  2J5S A;  1FCF A;  3PEA A;  1FC7 A;  2FW2 A;  2J5G D;  4FB8 A;  3GMA A;  4U0G H;  1TG6 A;  1ON3 A;  2EJ5 A;  2NP9 A;  1UYT A;  5DU8 A;  2A7K A;  3OME A;  4J2U A;  3QYR A;  5KDR B;  5DU4 A;  1OD4 A;  4ZDD A;  3H0Q A;  4JCQ A;  2IEX A;  2P63 A;  5HUQ A;  1PIX A;  1XX4 A;  5E0S A;  2ZL2 A;  2F9I B;  4IZB A;  4KPK A;  4F47 A;  1UYS A;  4FZW C;  4I52 A;  1J7X A;  4L6W A;  2FZS A;  4FN8 A;  3IB9 A;  3T89 A;  4EMP A;  2VSU F;  4IZC A;  4OMR A;  3ST9 A;  4GEH B;  3T8A A;  1DCI A;  1WZ8 A;  3GKB A;  3TLF A;  1O8U A;  4RCN A;  1N6E A;  2W3P A;  3L8I A;  4KWB A;  3QKA A;  5DUC A;  3MT6 A;  3QRE A;  3PZK A;  1K32 A;  4HDT A;  4FZW A;  3MOY A;  5FUS A;  1VRG A;  1HZD A;  4FJW D;  3I47 A;  5DTW A;  3ZW9 A;  3P5M A;  2ZQR A;  3KQF A;  1UIY A;  1DUB A;  3TRR A;  3H0S A;  3HRX A;  2J5G A;  3OT6 A;  1XO6 A;  3NJB A;  3ZWB A;  3L8J A;  4MI2 A;  4WZ8 B;  5E0N X;  3U9S B;  2Q2X A;  4EMM A;  4U19 A;  4ELX A;  4WCZ A;  3Q1T A;  5MGB A;  2ZL0 A;  3U9R B;  4B3I A;  3RQG A;  3KTK A;  4JYL A;  4JCS A;  5DZK H;  4Z0M A;  1HNU A;  1TYF A;  4ZDF A;  4JVT A;  4EML A;  2J5I B;  5FIF A;  2F6Q A;  3RQE A;  3H02 A;  1EF8 A;  1Y7O A;  4OLQ A;  2D3T A;  3IBB A;  1PJH A;  2VX2 A;  3M6M A;  1RJN A;  2ZL4 A;  4WYO B;  4LK5 A;  3RST A;  4ELW A;  5E0S H;  3T8B A;  4NEK A;  3TVW A;  4K3W A;  4FN7 A;  4U1A A;  3TVU A;  2PBP A;  1MJ3 A;  3KTH A;  4K2N A;  4RYF A;  4DI1 A;  3TT7 A;  5IKL B;  2F9Y A;  2VSU A;  3LKE A;  5C9G A;  3H0J A;  4ZDC A;  1N6F A;  3GF3 A;  4ZDE A;  3ZWA A;  3VIV A;  3IAV A;  2CBY A;  5G1Q A;  3TV5 A;  3MYB A;  4ZU2 A;  1ON9 A;  5G1R A;  5KDR A;  4JJT A;  3V5E A;  2X24 A;  1RJM A;  1UX5 A;  3QXI A;  3STA A;  1UYR A;  2C8T A;  4B3H A;  4JFC A;  3HE2 A;  5C90 A;  1UYV A;  2A7S A;  4HC8 A;  3V5I A;  1EY3 A;  2Q34 A;  3RQF A; 
#chains in the Genus database with same CATH homology
 3R6H A;  3R9Q A;  3ZW8 A;  4JCR A;  3DOR A;  4L8K A;  5DU6 A;  2A81 A;  4HNK A;  3P2L A;  3TDC A;  1YG6 A;  3N6R B;  1Q52 A;  3WG5 A;  1HNO A;  5JBW A;  2ZQQ A;  1W2X A;  2GTR A;  1X0U A;  5KJP A;  5JBX A;  3BPP A;  4Q0G A;  3BF0 A;  2VSS A;  3Q7H A;  4U0H A;  1Q51 A;  4ELS A;  5G1S A;  4ASI A;  2VSU C;  5DKP A;  4QII A;  4ZDB A;  2F6I A;  4JCT A;  4KNP A;  4I4Z A;  2VSU E;  5DZK A;  1JXZ A;  3KTJ A;  3BEZ A;  3P85 A;  3LAO A;  4NAR A;  3QXZ A;  5DL1 A;  3M6N A;  5INF A;  5DUF A;  5INI A;  3R9T A;  5CTC A;  3QMJ A;  3HLN 1;  3MFM A;  3U9T B;  3Q0G A;  4G2R A;  3GLM A;  1SZO A;  3GF7 A;  4B3J A;  4KD6 A;  3H81 A;  3RSI A;  3JU1 A;  3QWD A;  2FBM A;  3HIN A;  2HW5 A;  1FC6 A;  3DJA A;  2ZL3 A;  1WDK A;  3KTI A;  1WDM A;  4K29 A;  2YJG A;  3R0O A;  4I42 A;  4NNQ A;  2BZR A;  1NZY B;  2DUB A;  4MXI A;  1XNW A;  2WTB A;  3G64 A;  4GHN A;  1XNV A;  4U18 A;  3L3S A;  3Q0J A;  4JSB A;  4MOU A;  4IZD A;  3TZ3 A;  3K50 A;  4JYJ A;  4OG1 A;  3TT6 A;  2UZF A;  3T88 A;  3PGQ A;  2QQ3 A;  4JWV A;  3K8X A;  4JOT A;  3ZWC A;  5CTB A;  5ING A;  2F9Y B;  1XNY A;  1SG4 A;  2CE3 A;  1WDL A;  3RRV A;  2PG8 A;  3SLL A;  2VSS F;  1K39 A;  2Q35 A;  3H0U A;  3SWX A;  3NJD A;  3FF6 A;  1NZY A;  1YG8 A;  4FNB A;  1OD2 A;  2X58 A;  2VRE A;  4FND A;  3ISA A;  3T3W A;  3R9S A;  4QFE A;  4RYF H;  3OC7 A;  2PPY A;  3KTG A;  2J5I A;  4U0G A;  3HP0 A;  4Q1I A;  1N6D A;  2DEO A;  5DTP A;  4GM2 A;  3QK8 A;  3PE8 A;  1EF9 A;  4YLH A;  2J5I I;  3FDU A;  1FC9 A;  3BPT A;  4QIJ A;  2F9I A;  2VSS E;  2J5S A;  1FCF A;  3PEA A;  1FC7 A;  2FW2 A;  2J5G D;  4FB8 A;  3GMA A;  4U0G H;  1TG6 A;  1ON3 A;  2EJ5 A;  2NP9 A;  1UYT A;  5DU8 A;  2A7K A;  3OME A;  4J2U A;  3QYR A;  5KDR B;  5DU4 A;  1OD4 A;  4ZDD A;  3H0Q A;  4JCQ A;  2IEX A;  5HUQ A;  1PIX A;  1XX4 A;  5E0S A;  2ZL2 A;  2F9I B;  4IZB A;  4KPK A;  4F47 A;  1UYS A;  4FZW C;  4I52 A;  1J7X A;  4L6W A;  2FZS A;  4FN8 A;  3IB9 A;  3T89 A;  4EMP A;  2VSU F;  4IZC A;  4OMR A;  3ST9 A;  3T8A A;  1DCI A;  1WZ8 A;  3GKB A;  3TLF A;  1O8U A;  4RCN A;  1N6E A;  2W3P A;  4KWB A;  3QKA A;  5DUC A;  3MT6 A;  3QRE A;  3PZK A;  1K32 A;  4HDT A;  4FZW A;  3MOY A;  5FUS A;  1VRG A;  1HZD A;  4FJW D;  3I47 A;  5DTW A;  3ZW9 A;  3P5M A;  2ZQR A;  3KQF A;  1UIY A;  1DUB A;  3TRR A;  3H0S A;  3HRX A;  2J5G A;  3OT6 A;  1XO6 A;  3NJB A;  3ZWB A;  4MI2 A;  4WZ8 B;  5E0N X;  3U9S B;  2Q2X A;  4EMM A;  4U19 A;  4ELX A;  4WCZ A;  3Q1T A;  5MGB A;  2ZL0 A;  3U9R B;  4B3I A;  3KTK A;  4JYL A;  4JCS A;  5DZK H;  4Z0M A;  1HNU A;  1TYF A;  4ZDF A;  4JVT A;  4EML A;  2J5I B;  5FIF A;  2F6Q A;  3H02 A;  1EF8 A;  1Y7O A;  4OLQ A;  2D3T A;  3IBB A;  1PJH A;  2VX2 A;  3M6M A;  1RJN A;  2ZL4 A;  4WYO B;  4LK5 A;  3RST A;  4ELW A;  5E0S H;  3T8B A;  4NEK A;  3TVW A;  4K3W A;  4FN7 A;  4U1A A;  3TVU A;  2PBP A;  1MJ3 A;  3KTH A;  4K2N A;  4RYF A;  4DI1 A;  3TT7 A;  5IKL B;  2F9Y A;  2VSU A;  3LKE A;  5C9G A;  3H0J A;  4ZDC A;  1N6F A;  3GF3 A;  4ZDE A;  3ZWA A;  3VIV A;  3IAV A;  2CBY A;  5G1Q A;  3TV5 A;  3MYB A;  4ZU2 A;  1ON9 A;  5G1R A;  5KDR A;  4JJT A;  3V5E A;  2X24 A;  1RJM A;  3QXI A;  3STA A;  1UYR A;  2C8T A;  4B3H A;  4JFC A;  3HE2 A;  5C90 A;  1UYV A;  2A7S A;  4HC8 A;  3V5I A;  1EY3 A;  2Q34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...