3H0GJ

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
MIIPIRCFSCGKVIGDKWDTYLTLLQEDNTEGEALDKLGLQRYCCRRMILTHVDLIEKLLCYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
total genus 5
structure length 64
sequence length 64
chains with identical sequence V
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3h0gJ00
2E19A 1JT0A 3LOCA 3SFIA 4XRSA 3JRCA 4D7MA 2LR8A 4A93J 2XPWA 3BT9A 1RETA 3FIWA 2DA5A 1LE8B 2HDDA 2GLOA 4DYCA 1ZR2A 3OSGA 2AHQA 3D1NI 1UHSA 1R9TJ 2E2IJ 1Z77A 1G2HA 2K9NA 4C3JJ 2XB5A 3CCYA 3LSPA 1AU7A 2LVSA 2NVQJ 1ZKGA 2EZIA 1JKOC 1H89C 1X58A 4UUSB 2JA7J 4S0HB 1TWHJ 2HYJA 1NTCA 2Y31A 1AKHB 1VF9A 5EYRA 2XPUA 3MKLA 2K9QA 1A6IA 4HNVA 4A3KJ 5E3MA 3E7LA 4XRMA 4GFBA 2N8GA 1IG7A 2CRGA 1NK3P 2NVXJ 2VI6A 4I6ZA 4MFDA 2M9HA 1PUFB 1F36A 1YRNB 2Y9YA 1TC3C 2ID3A 1IC8A 3HGYA 4DYQA 3SDGA 3BTCA 3I4NJ 2Y2ZA 2MG4A 2I10A 2XSDC 1JKPC 5K7ZA 3PO2J 3CDLA 4A3JJ 3RQIA 3G1OA 3NARA 3GTKJ 2DMTA 3H3VK 5C4XJ 4L5EA 2OPTA 1U78A 4FE7A 1ITYA 4CYCA 1E3OC 3BR0A 5FJ8J 2HI3A 1HLVA 2E2JJ 2NS7A 2Y30A 4NDLA 1DU0A 2ELKA 2JMWA 1AHDP 4UUTA 1RKWA 4B3AA 1HDDC 3TP0A 4FTHA 1SANA 1HOMA 2ECBA 5C3EJ 2R92J 2PMZN 3IH4A 1MH3A 3FK6A 1ZGWA 3PO3J 2H8RA 4D7NA 2KT0A 3S1QJ 1FJLA 4ABZA 1NK2P 1ETYA 2E1OA 2JN6A 9ANTA 2G0EA 1DU6A 2XGDA 1POGA 4M3EA 2KDZA 2R5ZA 3ZOBA 2JK3A 1IUFA 5IOYA 2JWTA 5J1UA 1GV5A 4DZPA 4DZJA 1IDYA 5M3MJ 4BKXA 3JR9A 3S14J 4C2MJ 4XICA 2R5YA 4IHYA 5E3NA 5EEAA 5F0HA 3I4MJ 3S1RJ 5J1RA 3BTIA 4B1RA 2DJNA 5IP9J 2L0KA 5EDNA 1FIPA 1RKTA 1ETQA 1TWAJ 5C4JJ 4I76A 3JRAA 1O4XA 1MSEC 2R0QC 3S2HJ 3O8HA 2LKXA 3BR2A 1JUSA 1RPWA 2X48A 3BTLA 1ETXA 1GV2A 3S1MJ 1U9NA 5C44J 1WI3A 4J19A 4D5CA 1B8IA 5FLMJ 1MNMC 2Y0SN 5EGOA 3Q0VA 3ZQGA 2HOTA 2HQ5A 3GTPJ 2RAEA 2CU7A 2O9LA 3GTGJ 3K2AA 1JUPA 3HB9A 2HXOA 1MBJA 2EH3A 5F27A 5M5XJ 1FTZA 4LOCA 1X2NA 2XPVA 2DMUA 3BQYA 1MBKA 3OIOA 3GTOJ 2EBIA 2R5YB 1WPKA 1CQTA 3M3YJ 3ZQIA 4A3DJ 2OF7A 3O8GA 1Y1WJ 4W1UA 3Q3SA 3RZDJ 4CYCB 3JRGA 2HOAA 1YRNA 5F04A 2IEKA 3GTJJ 3GTQJ 3BR3A 4DW6A 1OCPA 4M3GA 1H88C 3WHCA 2LFBA 1MSFC 1ORKA 2X6OA 1MH4A 5FLVA 1OJLA 4QTRA 3BG5A 1Z0XA 3MVPA 1JJ6C 5FKLA 2NVYJ 1P7IA 1ETKA 4IEJA 4C3IJ 2R93J 2JJ7A 2H1KA 1IRZA 4AUXA 2XGCA 5M3FJ 5DS9A 2B63J 1BA5A 3DCFA 5DTDA 2LTPA 3S16J 3TW7A 2L7FP 1D5YA 2VUMJ 2XRLA 2DA6A 1JUMA 2HXIA 1U8BA 1PUFA 4IHVA 5F0CA 4XIDA 2E2HJ 2DTZA 2CQQA 2L9RA 4BY7J 1P7JA 3WHBA 2JA6J 3HGGA 5JLWA 1IGNA 2QCOA 3BR6A 1SFOJ 2FD5A 3TW6A 1UG2A 4AC0A 2FX0A 5FKMA 5IYCJ 1UMQA 4M3DA 4X1EA 1Y1VJ 3JRFA 4BXXJ 1IV6A 1JGGA 1QPIA 2VKVA 4A3LJ 4IHWA 4JX6A 3HDDA 5K7HA 1HCRA 1S7EA 4G12A 4D5FA 3TP3A 2DA4A 5IP6A 1WH5A 1X2MA 3HKZN 1JKRC 3PM1A 1QRYA 2O7OA 1TWCJ 1WGXA 3B6AA 4M3FA 1EF4A 4UUSA 3NAUA 2K40A 2M8GX 3G1MA 1B8IB 2JA8J 5EF6A 3BQZA 3ZQHA 4FCYA 4A3EJ 1W0TA 3S15J 3GTLJ 4DYRA 3HOVJ 1HDPA 1AKHA 1Q1VA 1ZK8A 3HEFA 1I6HJ 3HOYJ 4M6VA 3SJMA 3ZQFA 3HOZJ 3JREA 3VPRA 1B72A 5FKNA 5GPAA 2L7ZA 1LE8A 1BW5A 2R5ZB 1A5JA 1QVUA 1U9OA 2VKEA 3HBLA 2EZHA 3IH3A 2FJ1A 3BR5A 4IHXA 2TRTA 2GBYA 2IAIA 2NOGA 3RZOJ 5IYBJ 2QF7A 3F0CA 1FIAA 3A01A 3FISA 2DMPA 2W48A 1GVDA 2R7ZJ 1ETOA 2DA3A 3TEDA 3S17J 1XS9A 3HOXJ 3JRIA 1TWGJ 3A03A 3C2BA 3ZQLA 1ZR4A 1ENHA 2NS8A 3JRHA 5M5YJ 4FISA 4C3HJ 1MBEA 4MIMA 4A3FJ 5EZHA 5FKKA 5IPAA 5EGOB 2XB0X 2CUFA 2MGQA 3L1PA 2YU9J 2M0CA 2YS9A 1GT0C 4X6AJ 3S2DJ 2LY9A 2DMQA 5IOZA 1IDZA 2IBDA 5GPCA 1APLC 2M2EA 2XGEA 4W97A 4QSHA 3BG3A 2YUSA 2D5VA 1LFBA 3LSRA 2COBA 3FK7A 3CQZJ 1JTXA 2LD5A 5GP9A 1MBGA 3LSJA 3BR1A 1W0UA 4MLOA 5M5WJ 1JJ8C 5K7FA 2EZLA 1QVTA 4A69C 3HOUJ 4A3GJ 1ZTRA 4B4CA 1T56A 2X9DA 3OOUA 3RKQA 4EEFG 1F43A 1I50J 1H8AC 1T33A 3LSGA 1WCMJ 4BY1J 4MO7A 2DA7A 1B72B 1GUUA 1K61A 5E3OA 3FKIJ 2DMNA 1I3QJ 4JYKA 5JLXA 4BBRJ 1K83J 2CJJA 2L7MP 1XC5A 3H0GJ 3K7AJ 2WAQN 4JX5A 2P81A 5J3LA 2LLKA 2CQXA 3BG9A 4JX4A 2K9SA 5EZGA 5BNGA 3HOWJ 3IV5A 2GM4A 1OFCX 3Q0WA 1JTYA 3GBGA 3GTMJ 3B6CA 2WB1N 3QPSA 2WV1A 2LP0A 1MBFA 2DA2A 5HODA 1FTTA 3LNQA 4MFEA 1FEXA 3UKGA 2O8KA 1MBHA 2DN0A 3MN2A 3JRBA 4A3MJ 1GDTA 4A3BJ 1VFCA 3HM5A 2JA5J 3M4OJ 1BJZA 1TWFJ 3IH2A 5IP7J 2EQRA 5IYDJ 2CUEA 2EZKA 1HF0A 3A01B 1JKQC 5F08A 3QPLA 1RESA 2MSYA 3BTJA 1ETVA 2NVTJ 1OCTC 3Q0UA 2VPRA 2Y9ZA 5E3LA 4XRSG 3CMYA 1JT6A 2FQ4A 5J1YA 1VNDA 5EG0A 2HOSA 1ETWA 2ZB9A 4FE4A 3W6VA 1BW6A 5F0FA 4QIWN 3A02A 4A3IJ 1IJWC 4Y52J 4RDUA 3G1LA 2LK2A 4BBSJ 3ZQCA 4V2FA 4A3CJ 2ME6A 1ZQ3P 2DA1A 4Y7NJ 5EG0B 4JP0A 2MW8A 2ID6A 2AO9A 1XG1A 1WH7A 4XK4A 3QQAA 2M34A 4RBOA 2ME0A 4AYBN 5F1JA 3JRDA 1BL0A 1VI0A 3OSFA 3S1NJ 2ECCA 4M3BA 4V2GA 2TCTA 3DEWA 5FKOA 1LFUP 1RR7A
chains in the Genus database with same CATH superfamily
2X1EA 4MHGA 1JT0A 2QA4I 4XRSA 4RLFA 4D7MA 1U5TB 1RETA 2IA0A 3OV8A 2DA5A 1X3ZB 1ZR2A 3J81Z 3R6SA 3TGNA 2VBWA 2F4MB 2TDXA 2CWEA 1Z77A 2E1NA 1I6XA 1LKXA 1MGTA 4C3JJ 1MMAA 4PJ0C 4WXHA 5E1WA 2ZBKA 4GO1A 4I98B 4WCGA 3KE2A 4CHUA 3KP3A 2RGVA 4FETA 4G7HF 1H89C 4UUSB 2ISYA 2HYJA 3BLYA 1NTCA 1HSJA 3RPUD 2CGPA 2WADA 3OS0A 2WA0A 1XSVA 3LSKA 2E1CA 3OYBA 4JOMA 4HNTA 3K2ZA 4WXDA 2HKOA 4A6EA 3E7LA 3IKVA 4HV6A 4EJTA 3OYFA 1SAXA 5ED4A 3F8MA 4MFDA 2QKLB 3HHHA 4OMZA 1F36A 1YRNB 2Y9YA 4FQGA 4UV9A 4NBQA 2ID3A 4HX4A 3LAPA 4DYQA 1IN6A 2R7WA 4ESFA 2Y2ZA 2VBXA 4TV7A 1YW7A 1Z05A 3TQNA 4L0ZB 3BG7A 3E6CC 3CJNA 1K79A 2W4SA 3FXKA 2L9SA 4EVIA 2Y0MA 2DMTA 1O3TA 3V42A 4L5EA 2V1UA 3H3VK 5C4XJ 2XGXA 3BJ6A 4ZDLA 4KMUX 1ODDA 1E3OC 4IO9F 2VJ5A 5FJ8J 4CGZA 1BR4A 3K0LA 2OZ6A 2Y30A 2ZMEA 3CCVI 2ELKA 2JMWA 3QODA 4B3AA 1T39A 1HOMA 3FHZA 2R7SA 4A0YA 1P4WA 1MH3A 2FBHA 3FK6A 3GFMA 5L3BA 2YR2A 3S3MA 3S1QJ 1FJLA 1NK2P 4HV5A 4PCQA 4YELA 2X0LA 5DD4A 1R5ID 3R0AA 4PDKA 9ANTA 1DU6A 2Q1ZB 2D45A 3V7CA 2K4JA 1POGA 4HA8A 2KDZA 2L2OA 3ZOBA 4BU2A 3L00A 1TQMA 2R5ZA 1IUFA 2D2WA 5IOYA 2HTSA 2XAGA 3BCAA 2ZXWH 4DZPA 3LSHA 4QWQA 2DDAA 2CW0F 4BKXA 3S14J 3PFYA 4CZCA 4XICA 3K10A 5F0HA 4XN3A 4XLNF 3BP8A 2Q8KA 2Z99A 4B1RA 4PFPA 1VQ7I 2XAHA 3BOQA 1LQ1A 2L0KA 2NYXA 2VLAA 1TWAJ 2EIJH 3JRAA 3JSPA 3H9QA 2LKXA 2PI0A 2E1MB 3BTLA 2PJPA 4HBLA 4CSWA 1ETXA 1GV2A 1W4MA 4OIQF 5JFRA 1U9NA 2FA5A 1RC9A 2GOMA 4EM0B 3LWFA 3H92A 2Y0SN 2VQHA 4C2TA 2R7FA 3HPGA 3M1EA 5D5XB 3ZQGA 3EUKL 5TJJA 3GTPJ 1ZRCA 5DYMA 4BQNA 4OIOF 4J01A 4CA0A 2HXOA 1FP2A 2BVLA 5AONA 3FMSA 1MBKA 1IZ1A 1AOYA 4Q4ZF 2ZJPF 3K4BA 1BI0A 3DLLF 1WPKA 3FBNB 3ZQIA 2W84A 2BY3A 3O8GA 4FT8A 5FGMA 4UXNA 2QSFX 4CYCB 1YJ9I 5F04A 2IEKA 4N0BA 3G71I 3UR3C 5DCMB 1QPMA 3WHCA 2LFBA 3ISPA 2KIQA 4KA4A 1ORKA 2X6OA 1DGWY 3VB2A 3WE3A 4YIFA 1OJLA 4L0YB 3BG5A 3I3LA 1JJ6C 1GLNA 1ZLKA 2NVYJ 4N9HA 1ETKA 4C3IJ 2R93J 2KJBA 3HHGA 2UV1A 5M3FJ 5DS9A 1T6SA 2OCCH 1YW8A 2I5UA 3N4MA 1EA3A 4BE2A 3AAFA 3TW7A 3RKWA 1CGPA 2DA6A 1X1PA 3I71A 4KISA 1PUFA 2MFZA 5A2QZ 3L2VA 1KGSA 4BACA 1MMSA 5F0CA 2E1MC 1W36C 2CQNA 2DFHA 4CZZA 3A0HC 5E17F 2CS3A 2L9RA 4BY7J 1P7JA 3T8TA 3WHBA 4WWCA 4LMYA 1FZPB 2CV1A 3MZHA 2C6YA 3KLOA 5JLWA 2QQAA 3LFUA 1VZ0A 4BDZA 3I54A 3ABLH 1DP3A 2W00A 3TKYA 4AC0A 4IQ4A 5CVUA 1VTNC 4KIFA 1ACIA 3BZ6A 3U1DA 2R7RA 1BIAA 5AIPA 3LFKA 2VQLA 4S04A 3BWGA 2EB7A 2NOJB 4BXXJ 3OL4A 4XRFA 2VL8A 4K2EA 1T98A 1JGGA 1DDNA 1FSEA 3VFZA 4IHWA 1WSUA 2LY2A 1O3SA 4D5FA 3OS1A 1X2MA 1FNNA 4EMSA 1VQMI 2K02A 2XIGA 3G2BA 3HOSA 1JKRC 2WC2A 2HEOA 1QRYA 4JBAA 2O7OA 1WGXA 2M45A 2BW3B 3B6AA 5F64A 2JSPA 4UUSA 2K40A 2X1CA 3SZGA 3BPXA 3FXMA 1WI9A 4FCYA 3J7YJ 3JTHA 1JHFA 2K3PA 2QWWA 1OMIA 2DT6A 1HDPA 1AKHA 1K78B 1CF7B 1ZK8A 1REPC 1I6HJ 4AVPA 3QPHA 3K70D 2M7AA 2QM3A 1UCRA 3JREA 4NB5A 5GPAA 4HF2A 2JT1A 2M0MA 3KFWX 3ZMSA 4WX9A 3CF5F 2Z33A 3OYAA 2GWRA 4ENKA 2GXBA 3IH3A 1TNTA 1A36A 3BR5A 2P7VB 1WJCA 1TNSA 4DBRA 4DQ2A 2NOGA 4B09A 4I0BA 2HOEA 1J5YA 1OYIA 4KNYA 3D5LA 5EEGA 2FSWA 3DPUA 4PK4A 4MTEA 2DMPA 1OR7A 2WBMA 2ZFUA 4EJOA 2STWA 3WG9A 3OL3A 1WHUA 3MZ8A 3ZPLA 4IPAA 3A03A 3C2BA 3ESWB 3ZQLA 1ZR4A 1EKEA 1ENHA 3OYKA 4PJLA 4ENMA 5ILSA 2O5RA 2FRHA 5IPAA 3CUQC 1S6LA 2CUFA 2LBFA 4ZH4F 3K70C 1WVRA 3S2WA 3CMMA 3I53A 1T0FA 4X6AJ 3U21A 3S2DJ 4RAFA 3S8PA 2DMQA 3PQKA 3QPTA 2M2EA 1SC7A 2L4AA 2ADUA 1R71A 3MD2A 3CCMI 2D5VA 3LSRA 3FK7A 1W7PD 5JVTA 3BROA 3JCUC 2LD5A 5H2FC 1MBGA 2R4GA 5TISC 4G7ZF 2X6XA 3BR1A 1S3JA 3E6DA 1W0UA 1JJ8C 4HQMA 5E1ZB 4A69C 2RNGA 2E7XA 2EFPA 4B4CA 2G7UA 2VODA 3OOUA 2OQRA 5GAGJ 3HSEA 2KZGA 1I50J 3ABKH 3LSGA 1WCMJ 4BXUA 4NNJA 4WXCA 1GUUA 3GLXA 1IW7F 4HW0A 3GX4X 2DMNA 1JHHA 4XLFA 1Q1HA 2DBBA 2W24A 2K4BA 1G8XA 2W57A 1QO0D 4IQJA 1VQ8I 3WGHA 2LF8A 4NHJA 1FOXA 5CVJA 3FXOA 5EZGA 2XDVA 3HOWJ 4BJTA 3CLOA 4ZDPA 4A5MA 2RC4A 3OR2C 3RPQA 2Q0OA 2F5FA 5FD5A 2PQ8A 4KN4X 3ZP5A 3GBGA 1J75A 3B6CA 5DEQA 2EWNA 2ZKZA 2WV1A 3G4SI 2K7LA 1MBFA 5HODA 1L3LA 3LNQA 1SFXA 4BQOA 2KRFA 3H0DA 2O8KA 1MBHA 2J5OA 1MIJA 3MZYA 2JA5J 4A3BJ 2CQKA 3CCJI 5JVGF 4YG2F 1KQ9A 4CYDA 4AM3A 1B4AA 4L9TA 1BJZA 4ESJA 3S3OA 2EQRA 3AFHA 5IYDJ 2EZKA 4B8XA 5F08A 3WGGA 3CD6I 5J4YA 3W2VA 5H6RA 2JZYA 3BTJA 3EUHC 3DPLC 3KPHA 4KIBA 3IP4B 2FF4A 3BPVA 1K4TA 1HKQA 5E3LA 3DP7A 5GTHC 5CVIA 3L2QA 1DGRM 5EG0A 1VNDA 4HX7A 2Z5UA 2ZB9A 1X1AA 3WTVC 2M4KA 5F0FA 4A3IJ 4HZFA 3K4NA 3HOTA 4Y52J 1R6RA 3KX2A 1YHQI 3CZ6A 1X3WB 2DK5A 2DT5A 2FE3A 4BHBA 3VWBA 1WJAA 1ZGAA 1XSDA 2DJIA 4KDPA 3L2WA 2ID6A 1X1DA 2AO9A 2WAQA 1WH7A 1N78A 4II2A 4UUVA 2MBFA 2L4MA 5F1JA 2QENA 1J9IA 3OSFA 1MKMA 3S1NJ 3OYLA 4M3BA 4V2GA 2KRCA 1UHMA 1V54H 3VYTB 5CKTA 2W85A 1I3AA 3COAC 3DBRB 2LH9A 4IKFA 4L18B 2DCEA 3CF2A 1EH8A 3JW4A 1RR7A 4BYYA 2ESNA 5IT9Z 2F4IA 3OYIA 2IA1A 2CQ7A 3DPTA 3P5JA 3SFIA 2AS5F 3L9FA 3CP2A 3F23A 4MEXF 3C7JA 2EILH 2COMA 1OCOH 3NWTA 3QOEA 2HDDA 1LEAA 1ZHFA 2E60A 2H1LA 2RQPA 3H36A 1FT9A 2OD5A 2GXAA 3IWZA 2JRTA 1UHSA 1R9TJ 2NVUB 1UG0A 2K9NA 1SVOA 1P4AA 4OWRB 1KONA 2E71A 4EM1A 1SAUA 2LVSA 1B9NA 1ZKGA 2NVQJ 1TZLA 1PUEE 2GXGA 1W5SA 2JA7J 2QQ9A 2AXLA 3U1KA 1NG6A 1HW5A 4OINF 3IKTA 3MKWB 3FF5A 2BXYA 2XPUA 5AIQA 1B9MA 3J7ZI 1UFMA 5FD6A 5HS9A 5GTIC 3J81K 5E3MA 4A3KJ 2GA2A 4BE1A 2YX4A 3H3ZA 3HSFA 3KEYA 1XSXA 4RGXA 3N97A 1NK3P 2VI6A 4I6ZA 2KHMA 1EV7A 3PSFA 3A2KA 1SFKA 5D4SA 3GZ5A 4IOCF 3BTCA 3RDIA 3I4NJ 2DI3A 2IA2A 4V19K 1YG2A 2BY2A 3FWEA 5LGNA 5FRMA 2IRFG 2MG4A 3K6GA 3BC8A 3OYJA 5KAIC 2A6HF 3DTEA 3KP2A 1ZH5A 3CDLA 3G1OA 3V8KA 3NARA 2HVQA 5IT3A 3IL2A 1ZARA 3K4KA 4BJ5C 1U0JA 1YW9A 4LITA 4UHTA 4Y13A 1ITYA 2LMDA 1QHGA 3WTSC 2F5CA 2WTEA 5CLSA 2V1DA 2FMYA 2PFBA 3SXYA 1KU2A 3HPHA 2L3DA 4E7HA 1OCZH 2E2JJ 2NS7A 2BW3A 1J7KA 2VKHA 1PYVA 1Y8RB 1AHDP 1TTYA 1HDDC 1XMKA 1E3PA 1MNDA 2QYOA 3IAS2 4AIJA 5C3EJ 4P5OA 3CCLI 1ZGWA 2CSOA 4IRHA 3VEPA 4D7NA 3VYRB 3CJQB 1ETYA 2R7UA 3RCOA 2JN6A 2PX9A 2G0EA 4M3EA 3ZMVA 3ERED 2H8WA 1W5TA 1KYZA 3CTAA 1FY7A 4PJMA 1GV5A 1MNEA 1N75A 2XKPA 4L5IA 3T8RA 4DZJA 4RB2C 5HVQC 2Y69H 1MW7A 4IHYA 2K27A 5E3NA 5EEAA 1J2XA 1LNWA 1J0RA 4OAYA 5BOXA 1FP1D 1U5TC 2E5NA 4D1QA 2PEXA 2R7DA 2A05A 4HEA2 1FX7A 2CUJA 3GZ6A 1ZYRF 2DFEA 3KZYA 1MSEC 2HVSA 4I76A 1O4XA 3S2HJ 1G3YA 3O8HA 2M7BA 3BR2A 2ZNZA 3ZGKA 1NG7A 4P1WA 4B47A 1J09A 3ABTA 5B1BH 2Q2EA 2L54A 5TRDA 2EPFA 2BXZA 2CMPA 4KUMA 3SZPA 3CUOA 4D5CA 2O6GE 1B8IA 1UB9A 3J80Z 2CUZA 1MJ9A 3LQRA 4IVNA 5EGOA 2HQ5A 3HRMA 1D1CA 4II3A 4MQVA 4U87A 2V1XA 1OPCA 1ULYA 1X19A 2HPMA 3JAMK 2CU7A 2CO5A 3K2AA 2FQ3A 1JUPA 5M5XJ 1MBJA 2XAFA 3KZIC 3MWMA 1YJWI 1X2NA 2LKSA 2PG4A 1D1AA 2ZXJA 2XPVA 1SD7A 2D1HA 2I8DA 2XAJA 4BL0B 4KFCA 2DO7A 4LGWA 5J40A 2K3FA 2KJCA 3M3YJ 2G9WA 2OF7A 1Y1WJ 2VASA 2Z16A 1YITI 1BI3A 4YIRX 2FBIA 4LIUA 3SQNA 3H1CA 3E6MA 4LG0B 4YFNF 1M1EB 3NQOA 3I64A 4GGGA 4M3GA 2ZFWA 2E7WA 1H88C 4RM3A 1MSFC 2V9VA 5D6EA 3C18A 5GAEJ 2XVCA 1MH4A 1WJBA 3H3UA 5FLVA 4BHCA 4QTRA 3DEEA 1KA8A 5JR3A 2F6CA 5FKLA 2V9KA 5DUKA 2EJRA 5HLHA 2D1VA 1X4OA 1BR1A 2ZSHB 4IEJA 4IHSA 3E1SA 3F8FA 1IRZA 4AUXA 1XTAA 2CV2A 1X1BA 3DCFA 5DTDA 2VE8A 2IP2A 1D5YA 2VUMJ 2XRLA 1TBXA 5LRRA 4O6JA 1JUMA 3F22A 2HXIA 1U3EM 3OR1C 1XGMA 2W82A 5H6QA 1KU7A 2LF7A 1KZHA 4Q5SF 1XGNA 3VYUB 2JA6J 1OR7C 4F91B 5DUIA 1FBQA 3HGGA 4HG2A 5HS8A 2MABA 2CFXA 1FYKA 1BIBA 5L3EA 3PIOF 1ZGJA 1OCRH 1EJ9A 1VQ6I 1UG2A 3LSTA 1TT0A 3L2RA 2IPQX 2F2EA 5FKMA 1BI2A 3HYIA 4I02A 2P5KA 2KKOA 2PJRA 1IV6A 5BQTA 4NQWA 1QPIA 4A3LJ 1FMWA 4WF2A 1OISA 2XROA 4Y4RA 2E36A 1S8NA 1LVKA 3HKZN 5LFAA 5LHGA 3PM1A 1TQIA 1TW3A 2ZMEC 1V5GA 5D6FA 3RKYA 3BY6A 1VQPI 4Z2YA 2HVRA 5BPIA 3G1MA 4HF0A 5EF6A 3AG3H 2FOWA 3ABUA 3ASOH 1FSHA 4U0VA 3S15J 3A0BC 3R61A 3HOVJ 1Q1VA 3HEFA 3F72A 3WU0A 1O3RA 2PN6A 3ZXSA 2LYCA 1KQ8A 3IAM2 1B72A 3VPRA 5LHIA 3QRFF 2L7ZA 4IRIA 3OYDA 1LE8A 2M87A 1A5JA 3FM3A 4G6DA 3J7AY 5J6XA 3HBLA 4LLGF 2MYSA 3WTUC 2QSGX 1ZAOA 1JE8A 2TRTA 2GBYA 1IXCA 3SFZA 4EJUA 2QSHX 4GRIA 5IYBJ 3L2UA 1OYYA 1C0WA 2P0WA 3HRSA 1ZLJA 3KIOA 4PJJA 4KMFA 1RZ4A 4CH7A 2ZCWA 3FISA 5KCMA 4XOTA 1LDJA 3MEXA 5K5OA 1GVDA 3IRRA 3HIFA 3K1PA 2P8TA 2DA3A 3HOXJ 4E7JA 4HSTA 2B0LA 3I55I 3JRIA 1TWGJ 3DKYA 4M73A 4F7ZA 2LDUA 5M5YJ 3RSNA 1KU9A 4B48A 2XRNA 4C3HJ 2HDWA 4PJNA 5EZHA 4A3FJ 2DPUA 4O3MA 5FKKA 2XB0X 5J8FA 4I7HA 5L3CA 3A4CA 1XD7A 4YFXF 3B02A 1W7PA 2IS6A 5J4VA 2F5EA 2YS9A 1S5LC 1IDZA 3GW2A 1XCVA 1IN8A 3C2GA 3LL7A 4HSRA 3G73A 2XGEA 4W97A 2Z1DA 2EINH 3IWFA 3F9KA 3ZR8X 1OQYA 3S93A 1RNLA 1LFBA 3VSLA 3RQ4A 2HYFA 4G9YA 2DW4A 2COBA 2HNHA 1BOBA 1E3HA 3CQZJ 2A69F 1Z91A 1G6NA 1YO5C 2DQRA 2PMZA 4Q47A 1XMXA 4DBQA 4MLOA 4OOIA 3CC7I 4G7OF 5LBQA 1QVTA 2VQGA 4A3GJ 4HLXA 1IRXA 2OQGA 5ICEA 3RKQA 1XDUA 2R7OA 1I1SA 5HNHA 5L3GA 5LGUA 1H8AC 4BUPA 2IVMA 3FKIJ 2GQQA 4BEHB 4JYKA 3WE2A 2BYVE 4BBRJ 2FEZA 1EH7A 1Z67A 3GFIA 2FXAA 1R36A 1XC5A 4JQFA 3ERMA 2RNJA 1T38A 2JVGA 2P81A 3PQJA 1BI1A 1USTA 1V55H 2LLKA 4U0WA 5D5UB 3LSIA 3IV5A 1OFCX 3KETA 2BGCA 3H9JA 4HOBA 3GTMJ 5FO5A 2WB1N 3R4KA 2LP0A 4LB6B 4BHPA 3AL0B 1FTTA 2MH9A 2EFOA 3UKGA 1FEXA 4E4HA 1BBYA 3DV8A 5F6FA 1K7AA 4WK8F 1LJ9A 3DF8A 4GYGA 4J00A 4P96A 2J5PA 2CUEA 3LA7A 5E18F 1MMNA 2JQ7A 1JGSA 4MEYF 1JKQC 3O3KA 2DQLA 1RESA 1Z3XA 2X6WA 1ETVA 3AG4H 1D5VA 1T0FC 4XR6A 1B1BA 3Q0UA 3SZTA 3H5AA 2ETHA 1MMGA 2IJLA 2V4JC 1A35A 1VQOI 3CMYA 1B6AA 2FQ4A 4XLHA 1ETWA 3S3NA 4KITB 2K86A 1BW6A 4QIWN 2JPCA 1IJWC 5D8LB 4BBSJ 4DNCA 4JK1X 2ME6A 3ZMDA 3ZMTA 5E20A 1OLTA 2AQFA 4JP0A 1HKTA 3KYDB 3QYFA 4IZZA 3ONQA 2V26A 2ICWG 1I39A 3QQAA 2CYYA 2HTJA 1YOVB 4U7BA 1VI0A 1BL0A 4EGYA 1PDNC 1A31A 1IF1A 2M4GA 3FXLA 3M8JA 2QBYA 5DCFA 2TCTA 3DEWA 3NWSA 2MD0A 2H6CA 2NXNB 3RIRA 4P9UA 3FXQA 3R60A 4XONA 4C2UA 2HYGD 3LOCA 1XGOA 3JRCA 4Y33A 4ANJA 1FLIA 3UNGC 2LR8A 2ZSIB 2BE5F 1HXDA 1B59A 2YPRA 3ML6A 1FWZA 5K1YA 3FIWA 1H0MA 3W2AA 2VOPA 2GLOA 4BXFA 4DYCA 2F4OB 4OIRF 2AHQA 3D1NI 4LLNA 5BMZA 1FOWA 3K1NA 2E2IJ 1DP7P 3KYLA 5DCMA 3GYHX 5LRSA 4RAZA 2OC6A 3CCYA 3LSPA 2R7VA 4M72A 1AU7A 3CCRI 2ZC2A 2A07F 2JRMA 1JKOC 3KYCB 2NS0A 1XPXA 1TWHJ 1S29A 3NEUA 3CCQI 2Y31A 1Z6RA 5EYRA 3EETA 2KL4A 2Y48A 2JPBA 2K9QA 3OIPA 1QNTA 2E35A 4HNVA 1P9QC 1MD0A 3IHUA 1R23A 2N8GA 4XKBA 3H5NA 4RLQA 2ZXHA 4ITVA 1F9NA 3U9GA 2P5VA 3F6VA 1T95A 4RS8A 1V4RA 1ON2A 4Q48A 4QLCU 1TC3C 4XLAA 4XQFA 2CW8A 1QZYA 1IC8A 1ZELA 1YJNI 2MLGA 3OOPA 3SDGA 2MA3A 5ICCA 2BVMA 1VQ9I 1PVEA 4HF1A 1TLHB 3F21A 2I10A 1S7AA 2XSDC 1JKPC 4BNCA 2OCEA 5K7ZA 3PO2J 2IGKA 2DDBA 3RQIA 1WJ5A 3VSKA 4E6KG 5LD2C 3EPZA 2GIZA 4RGRA 1QBJA 2Z2SB 1KU3A 2EA2A 2OPTA 4M74A 4A0XA 1U78A 2E34A 4EV0A 1O7LA 1SFUA 4L9NA 4FE7A 3A1YA 4FX0A 1BR2A 2WB1A 3BR0A 3J80K 2VIXA 4ETSA 4NDLA 1DU0A 1RIOH 1R22A 3AL0C 1SANA 3W6JB 2HS5A 2ECBA 2R92J 3D5RC 2CW7A 5HOOA 3IH4A 3L09A 3QOPA 3PO3J 2H8RA 1TW2A 1F4KA 3P9CA 4XORA 4ZTFA 4I0AA 4ABZA 4YIIA 1K6OA 2ZJRF 4A5NA 2XGDA 3EYYA 2JK3A 2XAQA 3JTGA 2JWTA 2QQ8A 1LDKB 1WJDA 2K85A 4XLPF 1YX3A 4PFOA 1AWCA 2WWYA 1IDYA 5M3MJ 3JR9A 2R5YA 2M5WA 3S1RJ 2M8EA 3BTIA 4S05A 2IXSA 2UZKA 3HXLA 2EIKH 4UB6C 1W7PB 4HDVA 4ZDOA 5IP9J 1FIPA 1RKTA 1IRGA 1OYWA 3QYBA 4E70A 2R0QC 4HNUA 3CP8A 2VJJA 1JUSA 1RPWA 2X48A 4CXFA 2FMLA 2P7CB 1T08B 3FZVA 4P9FA 1W1WE 1V5EA 5B66C 3S1MJ 5DD8A 5LEKA 4XOPA 5C44J 4ZC3A 2O61A 1MNMC 3ROUA 2L9VA 3I4PA 4N4NB 4H0EA 4G6QA 2HOTA 3E3VA 3TOAA 4CCJA 1UELB 4FX4A 5B1AH 2M1BA 1R1VA 5H20A 1RR8C 3RPUA 3HB9A 5F27A 5GAHJ 3L7WA 1S7OA 5HLGA 3BQYA 2CH0A 3OIOA 1WZ2A 3GTOJ 2OJED 1ZG1A 3GCMA 2R5YB 3EQLF 1QHHD 1CQTA 4A3DJ 3AG2H 1XDSA 4R79A 3WODF 3PJRA 2V9PA 3RZDJ 3MCZA 1YRNA 5D4RA 3F3XA 1OCPA 1E2XA 2WAFA 5FLXK 4LIVA 2OA4A 4YEJA 1WRJA 2VBZA 4E7KA 1XCBA 1Z0XA 2WY7Q 4XLEA 2VKDA 3HSRA 1P2FA 5FFZA 3WTWC 2H1KA 2GA1A 4LK1F 2XGCA 4G8XA 2L7KA 2ZO4A 3CO6C 2B63J 1BA5A 2B7EA 3HG9A 3S16J 2EFWA 2EV5A 1FBSA 3HL2A 4UV8A 2VXDA 1U8BA 2B9SA 4IHVA 6PAXA 1TP4A 4AVZA 4LFUA 4RA2A 1HA8A 2CQQA 1N25A 2JUGA 3D5SC 4KJZA 2Y0SA 1V3FA 3NRVA 2H94A 1IGNA 4MGRA 1Z7UA 3BR6A 3HJEA 1QGPA 4KT6A 2R7XA 2FD5A 5K5QA 4Y15A 1P6RA 5FROA 2HQAA 3VYSB 1YIOA 3LMMA 4P55A 2FX0A 1DUXC 4AYBA 3HRUA 1I27A 2IS4A 4MTDA 1SMYF 1UMQA 1TL8A 3PUFA 4EGZA 2BHYA 1IRFA 4IHTA 3JRFA 1Y0NA 1YYVA 3H9GA 4B3XA 2KP6A 2VKVA 2H6BA 4ZJZA 3HDDA 5K7HA 1S7EA 2XF7A 3TP3A 2DA4A 5IP6A 1WH5A 3I59A 1NH3A 4A12A 4EJVA 2RN7A 5A2QK 1TWCJ 3DTIA 4M3FA 5CQEA 3F6OA 3O6BB 1DPRA 1EH6A 2JA2A 3NAUA 1B8IB 3GMEA 1ZRFA 3BQZA 3GLLA 4A3EJ 2EIMH 4IX7A 1W0TA 2ZJ2A 3JAMZ 2YX7A 3HC7A 3T1BA 4DYRA 4ENNA 4R8HA 2L02A 4BE0A 3CC2I 2R7QA 3SJMA 3ZQFA 4HRIA 3X2QH 3HOZJ 2IGOA 4AD9A 1WJFA 5FKNA 4XMYA 1BW5A 2R5ZB 1QVUA 2WAEA 2VKEA 3FDYA 2ZNYA 3ECHA 4AIDA 1K6YA 2EZHA 1IN4A 1GVJA 1Z3YA 2GIVA 3TO9A 3MKZA 2K9MA 3RZOJ 2KPMA 4BQAA 3F0CA 1KQ0A 2DLLA 3HZJA 4ASNA 3DU5A 1K78A 2HZDA 1CF7A 2XF6A 2QUFA 2HWVA 3WTZA 2W48A 2R7ZJ 1ETOA 1R00A 3AG1H 5J8CA 1P92A 3V8JA 1XMAA 2ISZA 2RDPA 2ZXIA 2DK8A 3GF2A 5IY5H 3CCEI 3JRHA 3QAHA 2LNBA 3V7RA 4FISA 1ON1A 2Z3YA 2BV6A 4PSWA 5J47A 4MIMA 2BEOA 4DGWB 2K5CA 2EK5A 2XV4S 2MC3A 3E5UA 3L1PA 1T8IA 2YU9J 3PL8A 1GT0C 5DV5A 2KIMA 2LY9A 2HFHA 2V7FA 5DDGA 4HQEA 1LVAA 4GDFA 1FYLA 3F8BA 5GADJ 1WWXA 2F5DA 1Y6IA 5KAFC 1I1GA 1D1BA 2KIFA 4BDYA 1ERDA 4XKWA 2QBYB 5KVRA 1YTYA 4UNOA 3ZMUA 4CICA 4YFKF 5GP9A 2BY1A 3LSJA 2A6TA 2UXNA 3DBHB 5M5WJ 2BY0A 3K9TA 5DM7F 4GYIA 3HOUJ 4IXAA 1WFXA 3GFJA 1MMDA 1ZTRA 3MKYB 1T56A 2O3FA 2YSRA 3CESA 4FHTA 1F43A 1PP7U 3GEZA 4CCNA 4ENJA 3J7AO 3ZRGA 2DA7A 1SVLA 1ZRDA 2EV0A 1K61A 5KK1A 1QZZA 4G6TB 2W7NA 5E1XA 1Z21A 1I3QJ 2IW5A 1MJBA 5JLXA 1UAAA 2O0YA 3GXOA 1K83J 1IO2A 1U6GA 4UVBA 4X0GA 3K7AJ 4AIHA 2ELJA 4JX5A 5J3LA 3OYNA 2OTLI 5EEHA 2CQXA 3BG9A 4JX4A 2OAZA 3CC4I 1O57A 1XGSA 1BC7C 2GM4A 4EM2A 4F3QA 3R0JA 3CMAI 1FOYA 3Q0WA 2QGUA 2VC1A 3E5XA 4RAGA 1G59A 5LEJA 2LRDA 4BAYA 2DA2A 2DFFA 1GHCA 1E17A 2KISA 3GO5A 3KP7A 2DN0A 3MN2A 3TOBA 3E0JB 3H35A 3IC7A 4KICA 4HLYA 4A3MJ 2JTVA 1VFCA 3HM5A 1S72I 1IN5A 3C3WA 2HQNA 3RJPA 3PNYA 4F92B 3LA3A 1R7JA 3QU6A 1MJAA 3A01B 3BZKA 1YI2I 3QWLA 3QPLA 4RGSA 3I9V2 1VQLI 2MSYA 3EDPA 1IUYA 2O03A 1OCTC 5ILVA 2ELHA 2VPRA 3FBIB 5BPDA 1ZG5A 2FNAA 2Y9ZA 3IRQA 2EFNA 3CDIA 1F1ZA 5L3FA 3PNTA 4XRSG 1R4NB 2A61A 4FE4A 3K1MA 4NC8A 3W6VA 3A02A 3TO7A 3E6BA 3ASNH 4RDUA 4CCKA 4M6XA 1G3TA 1OKRA 4A3CJ 1ZQ3P 4ON0A 2DA1A 4Y7NJ 5ERIA 5EG0B 3K69A 1D8KA 5JI6A 3TBIA 2RKHA 2XF5A 3WTYC 3WTTC 4OAZA 3K4MA 3DWLE 1A04A 1TQPA 1XG1A 3LSMA 2NNNA 2A5WA 3B73A 3M8EA 4XK4A 2M34A 4RBOA 2P6SA 2ME0A 2UWMA 2HDCA 3DLAA 2VPLA 3RKXA 4U88A 5HDGA 1QZEA 5FKOA 4IRGA 1LFUP 3I58A 1Z6TA 3GVAA 4FTHA 1JXSA 3LA2A 2E19A 2KMUA 4ESBA 2XKOA 2VOOA 3W2WA 4XNFA 1HW2A 5EJCA 2V79A 3OIQA 1Y39A 3RI4A 4A93J 2XPWA 3BT9A 2VT2A 1O3QA 1LE8B 2OTJI 2HZTA 2A6EF 1Y56A 2MLKA 4EJWA 3OSGA 1YFHA 1R5HA 1G2HA 3TL4X 3OYGA 1BC8C 2CG4A 2XB5A 4I01A 1IV8A 2OV7A 1SVMA 2PBIA 1RRJA 2EFQA 1ZN2A 2ZJQF 5LLQA 2EZIA 1G3SA 4DOZA 4RGUA 1X58A 4S0HB 3V7SA 1VQ5I 5KNLA 1AKHB 1VF9A 4XKCA 3MKLA 1USSA 2STTA 4KYWA 5LHHA 3K4LA 2VONA 3W3CA 1A6IA 4U0YA 1I5ZA 3W6KB 1FMVA 5HS7A 1RI7A 2QLZA 3QP5A 1R5GA 3ZMZA 4XRMA 4GFBA 5ICGA 4Y17A 2LSOA 1R49A 4H4KC 2QEXI 1IG7A 4XN0A 4ZZLA 2CRGA 2NVXJ 2HKXA 2M9HA 5ILUA 2A5YB 1UHWA 3GWZA 1PUFB 4OMYA 4BH9A 1NHAA 3TDZC 1P4XA 2GAUA 4HPQA 3HGYA 4M6YA 3FMRA 1D0XA 4A0ZA 1J59A 1VQNI 5FLXZ 1STZA 2NAZA 3CCUI 2FOKA 2DYRH 1IN7A 5TGTA 5LGTA 1E0EA 2DAOA 3SDBA 4A3JJ 5D8KB 2QQBA 1F5TA 3OYCA 4HYEA 3GTKJ 2KQRA 4E7ZA 3FM5A 4CYCA 3DKXA 4UY8I 2HI3A 4B44A 1HLVA 2X4HA 4E7SA 2KFDA 4NQWB 3U2RA 3BCBA 3L2CA 4UUTA 1RKWA 2QKMB 3TP0A 3E5QA 2LG4A 3RYRA 1L0OC 1G4DA 2PMZN 3WTXC 3E97A 3KP4A 2PLYA 1Y8QB 1BOAA 2X51A 2KT0A 2DOEA 3OMYA 2LKPA 2VQCA 3Q5FA 2E1OA 4GCVA 4C30A 2OBPA 4M71A 3I56I 2HR3A 4KT5C 2LREA 3OS2A 1MDMA 3M07A 3DKWA 3ZCOA 2ACJA 5FFXA 4DIQA 2BZTA 5J1UA 4D9JA 4CDGA 3K4CA 2V1NA 2VJIA 4PZJA 4C2MJ 4CCOA 3I4MJ 3CO7C 4MNUA 5J1RA 2KIUA 4PUSA 1IXSB 4R1HA 3KP5A 3M7GA 2DJNA 2K9LA 2RQQA 2RREA 4KN7X 5EDNA 1ETQA 5JHUA 2M3AA 5C4JJ 3KLNA 4RAYA 3SHFA 3VDXA 2F5VA 3BJAA 4Y3OA 5B5EC 1FPQA 4XSXF 4IL6C 1Z9CA 5FRNA 1XN7A 2P5LC 3DXJF 3ZQ7A 3HTUA 3KEOA 1WI3A 4BJ6C 4J19A 5FLMJ 2GOXB 1ZREA 1JI8A 3CLQA 3SEZA 3Q0VA 4D0PA 3PSIA 2RAEA 3DQVC 4ZZDA 3I0TA 3WG7H 2O9LA 3GTGJ 1GXPA 5E8GA 2EH3A 4BGDA 5K5RA 1FTZA 4LOCA 3HUGB 3REOA 3ZQQA 1YS6A 2DMUA 3SYTA 2VB6A 2X1DA 1HBXG 4NC6A 1U2WA 4CO8A 2EBIA 4ZYAA 4CCMA 3BJOA 3CUQB 3GZNB 4OIPF 2ESHA 2Z9OA 1DPUA 4DJAA 3ABMH 4W1UA 5BS6A 1X4PA 3Q3SA 4E7IA 3PIPF 3JRGA 2HOAA 1LUJB 4LB5A 4XL9A 3GTJJ 2VXZA 1D8JA 3GTQJ 3BR3A 4DW6A 3AKZA 3Q9VA 1SD5A 2ZMEB 3RYPA 4PGGA 2DTRA 4LJZF 3KEQA 3CJRB 4E7LA 3MVPA 3ULQB 3FMQA 4A6DA 3QYEA 1P7IA 1R1TA 2V6EA 2CFOA 2JJ7A 5E79C 4B43A 1XB4A 2P4WA 4ZTJA 1VQ4I 4G94A 2LTPA 1LPQA 2L7FP 2AXTC 4QPOA 3S32A 3BDDA 1YE9A 1S9HA 1LB2A 2UXXA 1R4MB 3KP6A 2DT7B 1UJ8A 4XBFA 2DOFA 3DU6A 2L9NA 2QZ8A 1N77A 2M30A 3H5RA 4XIDA 4L5JA 3EUAA 2DTZA 4IF4A 2E2HJ 5CQGA 4IOAF 1X3UA 3CCSI 1D3YA 1QA6A 2L5QA 2P6TA 3CUQA 3ECOA 2KRHA 2KLOA 4UVAA 1TT5B 1UZCA 2QCOA 1SD6A 3K4JA 2PMHA 3RTRA 2FUG2 3FKJA 1IXRC 2CV0A 1SFOJ 2XHKA 2XASA 3M8FA 1HKSA 3QP6A 3P9IA 3TW6A 3CDHA 2HU9A 3QU3A 3C1DA 3OYHA 3O2PE 2O8XA 5IYCJ 4M3DA 1ONVA 4X1EA 1Y1VJ 1Z7LA 3DEUA 1V5FA 2XAUA 3WGIA 1DQUA 2Y75A 3BZCA 4JX6A 1HCRA 4G12A 3ZN1A 3CJTB 4ZYDA 3GFLA 2DYSH 1IAWA 5HLIA 4NUBA 2IS1A 1WQ2A 2DXIA 2GZWA 2W1OA 2IT0A 1EF4A 4M9SA 3KCCA 2BBYA 3FXRA 3HRTA 2M8GX 4AWXB 2LBFB 2JA8J 1FC3A 2BHZA 3ZQHA 2IS2A 1MDMB 5E8IA 3GTLJ 4L9VA 1KYWA 4HDUA 4RM2A 3I59B 2DFIA 3HOYJ 1QU3A 4PSXA 4BEHA 1SD4A 4M6VA 1YLFA 3I5UA 5CJ9A 3TDUC 1U9OA 4I09A 4Z6YA 2V6CA 3OYMA 4F93B 3MFKA 1HSTA 2FJ1A 1G3WA 4PGHA 1HW1A 3TO6A 2A68F 4IHXA 1GXQA 3P7NA 4YRVA 2IAIA 5JHFA 5HLTA 3M9AA 2LY1A 3DTKA 3ELKA 5CVVA 2X85A 1HQCA 5CVRA 2QF7A 3EYIA 3OYEA 1FIAA 2IGNA 3OY9A 3A01A 4LG0A 3SEQA 2JUCA 1OCCH 1A6QA 2PMUA 2X6YA 4AIKA 3IUOA 4CUGA 3TEDA 2FNPA 1XS9A 3S17J 2JSCA 2NS8A 3M1CA 5DM6F 2JVHA 2NNYA 1BN5A 1MBEA 3MAJA 3N05A 2DPDA 3MMYB 2XUBA 5EGOB 3LQQA 2NRAC 2MD5A 2MGQA 2VBYA 1AA7A 2BOLA 3JSOA 2YU3A 4RMNA 1R58A 2M0CA 1FOKA 2OZUA 3HKZA 1BJAA 5IOZA 1WJEA 2XC7A 2IBDA 5GPCA 1APLC 3Q9SA 5IT9K 5B3SH 4QSHA 3DBLB 1SMTA 5HDKA 3BG3A 2YUSA 3BG6A 4LD5A 4U7DA 3TMOA 3ZN0A 2VN2A 4A2UA 5CYVA 2WY8Q 2WV0A 1JTXA 4C9YA 4CCLA 5D5VB 1YS7A 2RV8A 2MC4A 2KZVA 2XSJC 3HTSB 4ZYHA 4L9JA 1RUOA 1R1UA 2DODA 1VQKI 2A3SA 2E5ZA 2R3SA 4RB1A 5K7FA 2EZLA 2EV6A 2MH2A 4AU7A 2HGCA 2LC2A 1X1CA 2X9DA 1WKMA 1LDDA 3OWTA 2OU2A 4MQ9F 4EEFG 1BM9A 3MQ0A 4LLLA 3VODA 1T33A 2HPIA 3KZZA 4GXOA 4BY1J 4MO7A 1B72B 5E3OA 2Q2EB 3T0YA 4M9XA 3V8LA 4F55A 5F1RA 1H9TA 2CJJA 1W5CC 2L7MP 3PNVA 3H0GJ 4LK0F 2WAQN 3LAJA 3T5XA 4N4OB 1W36D 4BQQA 3G6EI 3FXUA 2K9SA 4KIGA 4OU0A 5BNGA 2VE9A 4FASD 4M9ZA 2OUMA 1YX5A 2R7TA 3WU1B 4HX8A 5FB2A 2VJ4A 2H27A 1JTYA 4RB3C 1LEBA 1Y0UA 2VT3A 3QPSA 3PFIA 2IGMA 1RUNA 4BS9A 1HC8A 4QPQA 5D5WB 4EQQA 4MFEA 1T2KA 2HQRA 4EATA 2VC0A 4I99C 3JRBA 4IJAA 3CMEI 1QQIA 1GDTA 1PJRA 2FU4A 3C2HA 5HNFA 3M4OJ 4ZYEA 2L01A 4HAMA 2H09A 4N9IA 2QVOA 3D0SA 1TWFJ 3IH2A 5CPRB 5IP7J 4I2OA 1LFPA 5KHDA 3FX3A 2UUZA 4XM3A 1HF0A 3G3ZA 2AQEA 4UVCA 2NVTJ 5ICFA 2EA4A 2LOOA 4F52A 2DOAA 3WU2C 1D0ZA 3FXJA 1U5TA 3VOEA 1PP8F 4LG3A 1JT6A 3EUHA 2KDOA 1YQAA 5J1YA 2HOSA 3GUDA 4NC7A 1U8RA 2RVCA 3HUGA 2W25A 1FYMA 2FBKA 4O5VA 3G1LA 2LK2A 4UB8C 3ZQCA 4V2FA 2PJRB 2G7HA 4XLCA 4XKVA 3PUBA 1H9GA 1YIJI 5L3DA 3F8CA 1FBUA 2MW8A 1ZG3A 4XSZF 1K4SA 4AYBN 3JRDA 1SEUA 5HDNA 1D0YA 2ECCA 1MZBA 3P9KA 2F48A 1XX5A 3V4GA 4ZYGA 3FHNA 1Z1DA 1SFEA 3F8NA 4RB0A 1O7FA 3DFGA 2DU9A
chains in the Genus database with same CATH topology
2E19A 1JT0A 3LOCA 3SFIA 4XRSA 3JRCA 4D7MA 2LR8A 4A93J 2XPWA 3BT9A 1RETA 3FIWA 2DA5A 1LE8B 2HDDA 2GLOA 4DYCA 1ZR2A 3OSGA 2AHQA 3D1NI 1UHSA 1R9TJ 2E2IJ 1Z77A 1G2HA 2K9NA 4C3JJ 2XB5A 3CCYA 3LSPA 1AU7A 2LVSA 2NVQJ 1ZKGA 2EZIA 1JKOC 1H89C 1X58A 4UUSB 2JA7J 4S0HB 1TWHJ 2HYJA 1NTCA 2Y31A 1AKHB 1VF9A 5EYRA 2XPUA 3MKLA 2K9QA 1A6IA 4HNVA 4A3KJ 5E3MA 3E7LA 4XRMA 4GFBA 2N8GA 1IG7A 2CRGA 1NK3P 2NVXJ 2VI6A 4I6ZA 4MFDA 2M9HA 1PUFB 1F36A 1YRNB 2Y9YA 1TC3C 2ID3A 1IC8A 3HGYA 4DYQA 3SDGA 3BTCA 3I4NJ 2Y2ZA 2MG4A 2I10A 2XSDC 1JKPC 5K7ZA 3PO2J 3CDLA 4A3JJ 3RQIA 3G1OA 3NARA 3GTKJ 2DMTA 3H3VK 5C4XJ 4L5EA 2OPTA 1U78A 4FE7A 1ITYA 4CYCA 1E3OC 3BR0A 5FJ8J 2HI3A 1HLVA 2E2JJ 2NS7A 2Y30A 4NDLA 1DU0A 2ELKA 2JMWA 1AHDP 4UUTA 1RKWA 4B3AA 1HDDC 3TP0A 4FTHA 1SANA 1HOMA 2ECBA 5C3EJ 2R92J 2PMZN 3IH4A 1MH3A 3FK6A 1ZGWA 3PO3J 2H8RA 4D7NA 2KT0A 3S1QJ 1FJLA 4ABZA 1NK2P 1ETYA 2E1OA 2JN6A 9ANTA 2G0EA 1DU6A 2XGDA 1POGA 4M3EA 2KDZA 2R5ZA 3ZOBA 2JK3A 1IUFA 5IOYA 2JWTA 5J1UA 1GV5A 4DZPA 4DZJA 1IDYA 5M3MJ 4BKXA 3JR9A 3S14J 4C2MJ 4XICA 2R5YA 4IHYA 5E3NA 5EEAA 5F0HA 3I4MJ 3S1RJ 5J1RA 3BTIA 4B1RA 2DJNA 5IP9J 2L0KA 5EDNA 1FIPA 1RKTA 1ETQA 1TWAJ 5C4JJ 4I76A 3JRAA 1O4XA 1MSEC 2R0QC 3S2HJ 3O8HA 2LKXA 3BR2A 1JUSA 1RPWA 2X48A 3BTLA 1ETXA 1GV2A 3S1MJ 1U9NA 5C44J 1WI3A 4J19A 4D5CA 1B8IA 5FLMJ 1MNMC 2Y0SN 5EGOA 3Q0VA 3ZQGA 2HOTA 2HQ5A 3GTPJ 2RAEA 2CU7A 2O9LA 3GTGJ 3K2AA 1JUPA 3HB9A 2HXOA 1MBJA 2EH3A 5F27A 5M5XJ 1FTZA 4LOCA 1X2NA 2XPVA 2DMUA 3BQYA 1MBKA 3OIOA 3GTOJ 2EBIA 2R5YB 1WPKA 1CQTA 3M3YJ 3ZQIA 4A3DJ 2OF7A 3O8GA 1Y1WJ 4W1UA 3Q3SA 3RZDJ 4CYCB 3JRGA 2HOAA 1YRNA 5F04A 2IEKA 3GTJJ 3GTQJ 3BR3A 4DW6A 1OCPA 4M3GA 1H88C 3WHCA 2LFBA 1MSFC 1ORKA 2X6OA 1MH4A 5FLVA 1OJLA 4QTRA 3BG5A 1Z0XA 3MVPA 1JJ6C 5FKLA 2NVYJ 1P7IA 1ETKA 4IEJA 4C3IJ 2R93J 2JJ7A 2H1KA 1IRZA 4AUXA 2XGCA 5M3FJ 5DS9A 2B63J 1BA5A 3DCFA 5DTDA 2LTPA 3S16J 3TW7A 2L7FP 1D5YA 2VUMJ 2XRLA 2DA6A 1JUMA 2HXIA 1U8BA 1PUFA 4IHVA 5F0CA 4XIDA 2E2HJ 2DTZA 2CQQA 2L9RA 4BY7J 1P7JA 3WHBA 2JA6J 3HGGA 5JLWA 1IGNA 2QCOA 3BR6A 1SFOJ 2FD5A 3TW6A 1UG2A 4AC0A 2FX0A 5FKMA 5IYCJ 1UMQA 4M3DA 4X1EA 1Y1VJ 3JRFA 4BXXJ 1IV6A 1JGGA 1QPIA 2VKVA 4A3LJ 4IHWA 4JX6A 3HDDA 5K7HA 1HCRA 1S7EA 4G12A 4D5FA 3TP3A 2DA4A 5IP6A 1WH5A 1X2MA 3HKZN 1JKRC 3PM1A 1QRYA 2O7OA 1TWCJ 1WGXA 3B6AA 4M3FA 1EF4A 4UUSA 3NAUA 2K40A 2M8GX 3G1MA 1B8IB 2JA8J 5EF6A 3BQZA 3ZQHA 4FCYA 4A3EJ 1W0TA 3S15J 3GTLJ 4DYRA 3HOVJ 1HDPA 1AKHA 1Q1VA 1ZK8A 3HEFA 1I6HJ 3HOYJ 4M6VA 3SJMA 3ZQFA 3HOZJ 3JREA 3VPRA 1B72A 5FKNA 5GPAA 2L7ZA 1LE8A 1BW5A 2R5ZB 1A5JA 1QVUA 1U9OA 2VKEA 3HBLA 2EZHA 3IH3A 2FJ1A 3BR5A 4IHXA 2TRTA 2GBYA 2IAIA 2NOGA 3RZOJ 5IYBJ 2QF7A 3F0CA 1FIAA 3A01A 3FISA 2DMPA 2W48A 1GVDA 2R7ZJ 1ETOA 2DA3A 3TEDA 3S17J 1XS9A 3HOXJ 3JRIA 1TWGJ 3A03A 3C2BA 3ZQLA 1ZR4A 1ENHA 2NS8A 3JRHA 5M5YJ 4FISA 4C3HJ 1MBEA 4MIMA 4A3FJ 5EZHA 5FKKA 5IPAA 5EGOB 2XB0X 2CUFA 2MGQA 3L1PA 2YU9J 2M0CA 2YS9A 1GT0C 4X6AJ 3S2DJ 2LY9A 2DMQA 5IOZA 1IDZA 2IBDA 5GPCA 1APLC 2M2EA 2XGEA 4W97A 4QSHA 3BG3A 2YUSA 2D5VA 1LFBA 3LSRA 2COBA 3FK7A 3CQZJ 1JTXA 2LD5A 5GP9A 1MBGA 3LSJA 3BR1A 1W0UA 4MLOA 5M5WJ 1JJ8C 5K7FA 2EZLA 1QVTA 4A69C 3HOUJ 4A3GJ 1ZTRA 4B4CA 1T56A 2X9DA 3OOUA 3RKQA 4EEFG 1F43A 1I50J 1H8AC 1T33A 3LSGA 1WCMJ 4BY1J 4MO7A 2DA7A 1B72B 1GUUA 1K61A 5E3OA 3FKIJ 2DMNA 1I3QJ 4JYKA 5JLXA 4BBRJ 1K83J 2CJJA 2L7MP 1XC5A 3H0GJ 3K7AJ 2WAQN 4JX5A 2P81A 5J3LA 2LLKA 2CQXA 3BG9A 4JX4A 2K9SA 5EZGA 5BNGA 3HOWJ 3IV5A 2GM4A 1OFCX 3Q0WA 1JTYA 3GBGA 3GTMJ 3B6CA 2WB1N 3QPSA 2WV1A 2LP0A 1MBFA 2DA2A 5HODA 1FTTA 3LNQA 4MFEA 1FEXA 3UKGA 2O8KA 1MBHA 2DN0A 3MN2A 3JRBA 4A3MJ 1GDTA 4A3BJ 1VFCA 3HM5A 2JA5J 3M4OJ 1BJZA 1TWFJ 3IH2A 5IP7J 2EQRA 5IYDJ 2CUEA 2EZKA 1HF0A 3A01B 1JKQC 5F08A 3QPLA 1RESA 2MSYA 3BTJA 1ETVA 2NVTJ 1OCTC 3Q0UA 2VPRA 2Y9ZA 5E3LA 4XRSG 3CMYA 1JT6A 2FQ4A 5J1YA 1VNDA 5EG0A 2HOSA 1ETWA 2ZB9A 4FE4A 3W6VA 1BW6A 5F0FA 4QIWN 3A02A 4A3IJ 1IJWC 4Y52J 4RDUA 3G1LA 2LK2A 4BBSJ 3ZQCA 4V2FA 4A3CJ 2ME6A 1ZQ3P 2DA1A 4Y7NJ 5EG0B 4JP0A 2MW8A 2ID6A 2AO9A 1XG1A 1WH7A 4XK4A 3QQAA 2M34A 4RBOA 2ME0A 4AYBN 5F1JA 3JRDA 1BL0A 1VI0A 3OSFA 3S1NJ 2ECCA 4M3BA 4V2GA 2TCTA 3DEWA 5FKOA 1LFUP 1RR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E19 A;  1JT0 A;  3LOC A;  3SFI A;  4XRS A;  3JRC A;  4D7M A;  2LR8 A;  4A93 J;  2XPW A;  3BT9 A;  1RET A;  3FIW A;  2DA5 A;  1LE8 B;  2HDD A;  2GLO A;  4DYC A;  1ZR2 A;  3OSG A;  2AHQ A;  3D1N I;  1UHS A;  1R9T J;  2E2I J;  1Z77 A;  1G2H A;  2K9N A;  4C3J J;  2XB5 A;  3CCY A;  3LSP A;  1AU7 A;  2LVS A;  2NVQ J;  1ZKG A;  2EZI A;  1JKO C;  1H89 C;  1X58 A;  4UUS B;  2JA7 J;  4S0H B;  1TWH J;  2HYJ A;  1NTC A;  2Y31 A;  1AKH B;  1VF9 A;  5EYR A;  2XPU A;  3MKL A;  2K9Q A;  1A6I A;  4HNV A;  4A3K J;  5E3M A;  3E7L A;  4XRM A;  4GFB A;  2N8G A;  1IG7 A;  2CRG A;  1NK3 P;  2NVX J;  2VI6 A;  4I6Z A;  4MFD A;  2M9H A;  1PUF B;  1F36 A;  1YRN B;  2Y9Y A;  1TC3 C;  2ID3 A;  1IC8 A;  3HGY A;  4DYQ A;  3SDG A;  3BTC A;  3I4N J;  2Y2Z A;  2MG4 A;  2I10 A;  2XSD C;  1JKP C;  5K7Z A;  3PO2 J;  3CDL A;  4A3J J;  3RQI A;  3G1O A;  3NAR A;  3GTK J;  2DMT A;  3H3V K;  5C4X J;  4L5E A;  2OPT A;  1U78 A;  4FE7 A;  1ITY A;  4CYC A;  1E3O C;  3BR0 A;  5FJ8 J;  2HI3 A;  1HLV A;  2E2J J;  2NS7 A;  2Y30 A;  4NDL A;  1DU0 A;  2ELK A;  2JMW A;  1AHD P;  4UUT A;  1RKW A;  4B3A A;  1HDD C;  3TP0 A;  4FTH A;  1SAN A;  1HOM A;  2ECB A;  5C3E J;  2R92 J;  2PMZ N;  3IH4 A;  1MH3 A;  3FK6 A;  1ZGW A;  3PO3 J;  2H8R A;  4D7N A;  2KT0 A;  3S1Q J;  1FJL A;  4ABZ A;  1NK2 P;  1ETY A;  2E1O A;  2JN6 A;  9ANT A;  2G0E A;  1DU6 A;  2XGD A;  1POG A;  4M3E A;  2KDZ A;  2R5Z A;  3ZOB A;  2JK3 A;  1IUF A;  5IOY A;  2JWT A;  5J1U A;  1GV5 A;  4DZP A;  4DZJ A;  1IDY A;  5M3M J;  4BKX A;  3JR9 A;  3S14 J;  4C2M J;  4XIC A;  2R5Y A;  4IHY A;  5E3N A;  5EEA A;  5F0H A;  3I4M J;  3S1R J;  5J1R A;  3BTI A;  4B1R A;  2DJN A;  5IP9 J;  2L0K A;  5EDN A;  1FIP A;  1RKT A;  1ETQ A;  1TWA J;  5C4J J;  4I76 A;  3JRA A;  1O4X A;  1MSE C;  2R0Q C;  3S2H J;  3O8H A;  2LKX A;  3BR2 A;  1JUS A;  1RPW A;  2X48 A;  3BTL A;  1ETX A;  1GV2 A;  3S1M J;  1U9N A;  5C44 J;  1WI3 A;  4J19 A;  4D5C A;  1B8I A;  5FLM J;  1MNM C;  2Y0S N;  5EGO A;  3Q0V A;  3ZQG A;  2HOT A;  2HQ5 A;  3GTP J;  2RAE A;  2CU7 A;  2O9L A;  3GTG J;  3K2A A;  1JUP A;  3HB9 A;  2HXO A;  1MBJ A;  2EH3 A;  5F27 A;  5M5X J;  1FTZ A;  4LOC A;  1X2N A;  2XPV A;  2DMU A;  3BQY A;  1MBK A;  3OIO A;  3GTO J;  2EBI A;  2R5Y B;  1WPK A;  1CQT A;  3M3Y J;  3ZQI A;  4A3D J;  2OF7 A;  3O8G A;  1Y1W J;  4W1U A;  3Q3S A;  3RZD J;  4CYC B;  3JRG A;  2HOA A;  1YRN A;  5F04 A;  2IEK A;  3GTJ J;  3GTQ J;  3BR3 A;  4DW6 A;  1OCP A;  4M3G A;  1H88 C;  3WHC A;  2LFB A;  1MSF C;  1ORK A;  2X6O A;  1MH4 A;  5FLV A;  1OJL A;  4QTR A;  3BG5 A;  1Z0X A;  3MVP A;  1JJ6 C;  5FKL A;  2NVY J;  1P7I A;  1ETK A;  4IEJ A;  4C3I J;  2R93 J;  2JJ7 A;  2H1K A;  1IRZ A;  4AUX A;  2XGC A;  5M3F J;  5DS9 A;  2B63 J;  1BA5 A;  3DCF A;  5DTD A;  2LTP A;  3S16 J;  3TW7 A;  2L7F P;  1D5Y A;  2VUM J;  2XRL A;  2DA6 A;  1JUM A;  2HXI A;  1U8B A;  1PUF A;  4IHV A;  5F0C A;  4XID A;  2E2H J;  2DTZ A;  2CQQ A;  2L9R A;  4BY7 J;  1P7J A;  3WHB A;  2JA6 J;  3HGG A;  5JLW A;  1IGN A;  2QCO A;  3BR6 A;  1SFO J;  2FD5 A;  3TW6 A;  1UG2 A;  4AC0 A;  2FX0 A;  5FKM A;  5IYC J;  1UMQ A;  4M3D A;  4X1E A;  1Y1V J;  3JRF A;  4BXX J;  1IV6 A;  1JGG A;  1QPI A;  2VKV A;  4A3L J;  4IHW A;  4JX6 A;  3HDD A;  5K7H A;  1HCR A;  1S7E A;  4G12 A;  4D5F A;  3TP3 A;  2DA4 A;  5IP6 A;  1WH5 A;  1X2M A;  3HKZ N;  1JKR C;  3PM1 A;  1QRY A;  2O7O A;  1TWC J;  1WGX A;  3B6A A;  4M3F A;  1EF4 A;  4UUS A;  3NAU A;  2K40 A;  2M8G X;  3G1M A;  1B8I B;  2JA8 J;  5EF6 A;  3BQZ A;  3ZQH A;  4FCY A;  4A3E J;  1W0T A;  3S15 J;  3GTL J;  4DYR A;  3HOV J;  1HDP A;  1AKH A;  1Q1V A;  1ZK8 A;  3HEF A;  1I6H J;  3HOY J;  4M6V A;  3SJM A;  3ZQF A;  3HOZ J;  3JRE A;  3VPR A;  1B72 A;  5FKN A;  5GPA A;  2L7Z A;  1LE8 A;  1BW5 A;  2R5Z B;  1A5J A;  1QVU A;  1U9O A;  2VKE A;  3HBL A;  2EZH A;  3IH3 A;  2FJ1 A;  3BR5 A;  4IHX A;  2TRT A;  2GBY A;  2IAI A;  2NOG A;  3RZO J;  5IYB J;  2QF7 A;  3F0C A;  1FIA A;  3A01 A;  3FIS A;  2DMP A;  2W48 A;  1GVD A;  2R7Z J;  1ETO A;  2DA3 A;  3TED A;  3S17 J;  1XS9 A;  3HOX J;  3JRI A;  1TWG J;  3A03 A;  3C2B A;  3ZQL A;  1ZR4 A;  1ENH A;  2NS8 A;  3JRH A;  5M5Y J;  4FIS A;  4C3H J;  1MBE A;  4MIM A;  4A3F J;  5EZH A;  5FKK A;  5IPA A;  5EGO B;  2XB0 X;  2CUF A;  2MGQ A;  3L1P A;  2YU9 J;  2M0C A;  2YS9 A;  1GT0 C;  4X6A J;  3S2D J;  2LY9 A;  2DMQ A;  5IOZ A;  1IDZ A;  2IBD A;  5GPC A;  1APL C;  2M2E A;  2XGE A;  4W97 A;  4QSH A;  3BG3 A;  2YUS A;  2D5V A;  1LFB A;  3LSR A;  2COB A;  3FK7 A;  3CQZ J;  1JTX A;  2LD5 A;  5GP9 A;  1MBG A;  3LSJ A;  3BR1 A;  1W0U A;  4MLO A;  5M5W J;  1JJ8 C;  5K7F A;  2EZL A;  1QVT A;  4A69 C;  3HOU J;  4A3G J;  1ZTR A;  4B4C A;  1T56 A;  2X9D A;  3OOU A;  3RKQ A;  4EEF G;  1F43 A;  1I50 J;  1H8A C;  1T33 A;  3LSG A;  1WCM J;  4BY1 J;  4MO7 A;  2DA7 A;  1B72 B;  1GUU A;  1K61 A;  5E3O A;  3FKI J;  2DMN A;  1I3Q J;  4JYK A;  5JLX A;  4BBR J;  1K83 J;  2CJJ A;  2L7M P;  1XC5 A;  3H0G J;  3K7A J;  2WAQ N;  4JX5 A;  2P81 A;  5J3L A;  2LLK A;  2CQX A;  3BG9 A;  4JX4 A;  2K9S A;  5EZG A;  5BNG A;  3HOW J;  3IV5 A;  2GM4 A;  1OFC X;  3Q0W A;  1JTY A;  3GBG A;  3GTM J;  3B6C A;  2WB1 N;  3QPS A;  2WV1 A;  2LP0 A;  1MBF A;  2DA2 A;  5HOD A;  1FTT A;  3LNQ A;  4MFE A;  1FEX A;  3UKG A;  2O8K A;  1MBH A;  2DN0 A;  3MN2 A;  3JRB A;  4A3M J;  1GDT A;  4A3B J;  1VFC A;  3HM5 A;  2JA5 J;  3M4O J;  1BJZ A;  1TWF J;  3IH2 A;  5IP7 J;  2EQR A;  5IYD J;  2CUE A;  2EZK A;  1HF0 A;  3A01 B;  1JKQ C;  5F08 A;  3QPL A;  1RES A;  2MSY A;  3BTJ A;  1ETV A;  2NVT J;  1OCT C;  3Q0U A;  2VPR A;  2Y9Z A;  5E3L A;  4XRS G;  3CMY A;  1JT6 A;  2FQ4 A;  5J1Y A;  1VND A;  5EG0 A;  2HOS A;  1ETW A;  2ZB9 A;  4FE4 A;  3W6V A;  1BW6 A;  5F0F A;  4QIW N;  3A02 A;  4A3I J;  1IJW C;  4Y52 J;  4RDU A;  3G1L A;  2LK2 A;  4BBS J;  3ZQC A;  4V2F A;  4A3C J;  2ME6 A;  1ZQ3 P;  2DA1 A;  4Y7N J;  5EG0 B;  4JP0 A;  2MW8 A;  2ID6 A;  2AO9 A;  1XG1 A;  1WH7 A;  4XK4 A;  3QQA A;  2M34 A;  4RBO A;  2ME0 A;  4AYB N;  5F1J A;  3JRD A;  1BL0 A;  1VI0 A;  3OSF A;  3S1N J;  2ECC A;  4M3B A;  4V2G A;  2TCT A;  3DEW A;  5FKO A;  1LFU P;  1RR7 A; 
#chains in the Genus database with same CATH topology
 2X1E A;  4MHG A;  1JT0 A;  2QA4 I;  4XRS A;  4RLF A;  4D7M A;  1U5T B;  1RET A;  2IA0 A;  3OV8 A;  2DA5 A;  1X3Z B;  1ZR2 A;  3J81 Z;  3R6S A;  3TGN A;  2VBW A;  2F4M B;  2TDX A;  2CWE A;  1Z77 A;  2E1N A;  1I6X A;  1LKX A;  1MGT A;  4C3J J;  1MMA A;  4PJ0 C;  4WXH A;  5E1W A;  2ZBK A;  4GO1 A;  4I98 B;  4WCG A;  3KE2 A;  4CHU A;  3KP3 A;  2RGV A;  4FET A;  4G7H F;  1H89 C;  4UUS B;  2ISY A;  2HYJ A;  3BLY A;  1NTC A;  1HSJ A;  3RPU D;  2CGP A;  2WAD A;  3OS0 A;  2WA0 A;  1XSV A;  3LSK A;  2E1C A;  3OYB A;  4JOM A;  4HNT A;  3K2Z A;  4WXD A;  2HKO A;  4A6E A;  3E7L A;  3IKV A;  4HV6 A;  4EJT A;  3OYF A;  1SAX A;  5ED4 A;  3F8M A;  4MFD A;  2QKL B;  3HHH A;  4OMZ A;  1F36 A;  1YRN B;  2Y9Y A;  4FQG A;  4UV9 A;  4NBQ A;  2ID3 A;  4HX4 A;  3LAP A;  4DYQ A;  1IN6 A;  2R7W A;  4ESF A;  2Y2Z A;  2VBX A;  4TV7 A;  1YW7 A;  1Z05 A;  3TQN A;  4L0Z B;  3BG7 A;  3E6C C;  3CJN A;  1K79 A;  2W4S A;  3FXK A;  2L9S A;  4EVI A;  2Y0M A;  2DMT A;  1O3T A;  3V42 A;  4L5E A;  2V1U A;  3H3V K;  5C4X J;  2XGX A;  3BJ6 A;  4ZDL A;  4KMU X;  1ODD A;  1E3O C;  4IO9 F;  2VJ5 A;  5FJ8 J;  4CGZ A;  1BR4 A;  3K0L A;  2OZ6 A;  2Y30 A;  2ZME A;  3CCV I;  2ELK A;  2JMW A;  3QOD A;  4B3A A;  1T39 A;  1HOM A;  3FHZ A;  2R7S A;  4A0Y A;  1P4W A;  1MH3 A;  2FBH A;  3FK6 A;  3GFM A;  5L3B A;  2YR2 A;  3S3M A;  3S1Q J;  1FJL A;  1NK2 P;  4HV5 A;  4PCQ A;  4YEL A;  2X0L A;  5DD4 A;  1R5I D;  3R0A A;  4PDK A;  9ANT A;  1DU6 A;  2Q1Z B;  2D45 A;  3V7C A;  2K4J A;  1POG A;  4HA8 A;  2KDZ A;  2L2O A;  3ZOB A;  4BU2 A;  3L00 A;  1TQM A;  2R5Z A;  1IUF A;  2D2W A;  5IOY A;  2HTS A;  2XAG A;  3BCA A;  2ZXW H;  4DZP A;  3LSH A;  4QWQ A;  2DDA A;  2CW0 F;  4BKX A;  3S14 J;  3PFY A;  4CZC A;  4XIC A;  3K10 A;  5F0H A;  4XN3 A;  4XLN F;  3BP8 A;  2Q8K A;  2Z99 A;  4B1R A;  4PFP A;  1VQ7 I;  2XAH A;  3BOQ A;  1LQ1 A;  2L0K A;  2NYX A;  2VLA A;  1TWA J;  2EIJ H;  3JRA A;  3JSP A;  3H9Q A;  2LKX A;  2PI0 A;  2E1M B;  3BTL A;  2PJP A;  4HBL A;  4CSW A;  1ETX A;  1GV2 A;  1W4M A;  4OIQ F;  5JFR A;  1U9N A;  2FA5 A;  1RC9 A;  2GOM A;  4EM0 B;  3LWF A;  3H92 A;  2Y0S N;  2VQH A;  4C2T A;  2R7F A;  3HPG A;  3M1E A;  5D5X B;  3ZQG A;  3EUK L;  5TJJ A;  3GTP J;  1ZRC A;  5DYM A;  4BQN A;  4OIO F;  4J01 A;  4CA0 A;  2HXO A;  1FP2 A;  2BVL A;  5AON A;  3FMS A;  1MBK A;  1IZ1 A;  1AOY A;  4Q4Z F;  2ZJP F;  3K4B A;  1BI0 A;  3DLL F;  1WPK A;  3FBN B;  3ZQI A;  2W84 A;  2BY3 A;  3O8G A;  4FT8 A;  5FGM A;  4UXN A;  2QSF X;  4CYC B;  1YJ9 I;  5F04 A;  2IEK A;  4N0B A;  3G71 I;  3UR3 C;  5DCM B;  1QPM A;  3WHC A;  2LFB A;  3ISP A;  2KIQ A;  4KA4 A;  1ORK A;  2X6O A;  1DGW Y;  3VB2 A;  3WE3 A;  4YIF A;  1OJL A;  4L0Y B;  3BG5 A;  3I3L A;  1JJ6 C;  1GLN A;  1ZLK A;  2NVY J;  4N9H A;  1ETK A;  4C3I J;  2R93 J;  2KJB A;  3HHG A;  2UV1 A;  5M3F J;  5DS9 A;  1T6S A;  2OCC H;  1YW8 A;  2I5U A;  3N4M A;  1EA3 A;  4BE2 A;  3AAF A;  3TW7 A;  3RKW A;  1CGP A;  2DA6 A;  1X1P A;  3I71 A;  4KIS A;  1PUF A;  2MFZ A;  5A2Q Z;  3L2V A;  1KGS A;  4BAC A;  1MMS A;  5F0C A;  2E1M C;  1W36 C;  2CQN A;  2DFH A;  4CZZ A;  3A0H C;  5E17 F;  2CS3 A;  2L9R A;  4BY7 J;  1P7J A;  3T8T A;  3WHB A;  4WWC A;  4LMY A;  1FZP B;  2CV1 A;  3MZH A;  2C6Y A;  3KLO A;  5JLW A;  2QQA A;  3LFU A;  1VZ0 A;  4BDZ A;  3I54 A;  3ABL H;  1DP3 A;  2W00 A;  3TKY A;  4AC0 A;  4IQ4 A;  5CVU A;  1VTN C;  4KIF A;  1ACI A;  3BZ6 A;  3U1D A;  2R7R A;  1BIA A;  5AIP A;  3LFK A;  2VQL A;  4S04 A;  3BWG A;  2EB7 A;  2NOJ B;  4BXX J;  3OL4 A;  4XRF A;  2VL8 A;  4K2E A;  1T98 A;  1JGG A;  1DDN A;  1FSE A;  3VFZ A;  4IHW A;  1WSU A;  2LY2 A;  1O3S A;  4D5F A;  3OS1 A;  1X2M A;  1FNN A;  4EMS A;  1VQM I;  2K02 A;  2XIG A;  3G2B A;  3HOS A;  1JKR C;  2WC2 A;  2HEO A;  1QRY A;  4JBA A;  2O7O A;  1WGX A;  2M45 A;  2BW3 B;  3B6A A;  5F64 A;  2JSP A;  4UUS A;  2K40 A;  2X1C A;  3SZG A;  3BPX A;  3FXM A;  1WI9 A;  4FCY A;  3J7Y J;  3JTH A;  1JHF A;  2K3P A;  2QWW A;  1OMI A;  2DT6 A;  1HDP A;  1AKH A;  1K78 B;  1CF7 B;  1ZK8 A;  1REP C;  1I6H J;  4AVP A;  3QPH A;  3K70 D;  2M7A A;  2QM3 A;  1UCR A;  3JRE A;  4NB5 A;  5GPA A;  4HF2 A;  2JT1 A;  2M0M A;  3KFW X;  3ZMS A;  4WX9 A;  3CF5 F;  2Z33 A;  3OYA A;  2GWR A;  4ENK A;  2GXB A;  3IH3 A;  1TNT A;  1A36 A;  3BR5 A;  2P7V B;  1WJC A;  1TNS A;  4DBR A;  4DQ2 A;  2NOG A;  4B09 A;  4I0B A;  2HOE A;  1J5Y A;  1OYI A;  4KNY A;  3D5L A;  5EEG A;  2FSW A;  3DPU A;  4PK4 A;  4MTE A;  2DMP A;  1OR7 A;  2WBM A;  2ZFU A;  4EJO A;  2STW A;  3WG9 A;  3OL3 A;  1WHU A;  3MZ8 A;  3ZPL A;  4IPA A;  3A03 A;  3C2B A;  3ESW B;  3ZQL A;  1ZR4 A;  1EKE A;  1ENH A;  3OYK A;  4PJL A;  4ENM A;  5ILS A;  2O5R A;  2FRH A;  5IPA A;  3CUQ C;  1S6L A;  2CUF A;  2LBF A;  4ZH4 F;  3K70 C;  1WVR A;  3S2W A;  3CMM A;  3I53 A;  1T0F A;  4X6A J;  3U21 A;  3S2D J;  4RAF A;  3S8P A;  2DMQ A;  3PQK A;  3QPT A;  2M2E A;  1SC7 A;  2L4A A;  2ADU A;  1R71 A;  3MD2 A;  3CCM I;  2D5V A;  3LSR A;  3FK7 A;  1W7P D;  5JVT A;  3BRO A;  3JCU C;  2LD5 A;  5H2F C;  1MBG A;  2R4G A;  5TIS C;  4G7Z F;  2X6X A;  3BR1 A;  1S3J A;  3E6D A;  1W0U A;  1JJ8 C;  4HQM A;  5E1Z B;  4A69 C;  2RNG A;  2E7X A;  2EFP A;  4B4C A;  2G7U A;  2VOD A;  3OOU A;  2OQR A;  5GAG J;  3HSE A;  2KZG A;  1I50 J;  3ABK H;  3LSG A;  1WCM J;  4BXU A;  4NNJ A;  4WXC A;  1GUU A;  3GLX A;  1IW7 F;  4HW0 A;  3GX4 X;  2DMN A;  1JHH A;  4XLF A;  1Q1H A;  2DBB A;  2W24 A;  2K4B A;  1G8X A;  2W57 A;  1QO0 D;  4IQJ A;  1VQ8 I;  3WGH A;  2LF8 A;  4NHJ A;  1FOX A;  5CVJ A;  3FXO A;  5EZG A;  2XDV A;  3HOW J;  4BJT A;  3CLO A;  4ZDP A;  4A5M A;  2RC4 A;  3OR2 C;  3RPQ A;  2Q0O A;  2F5F A;  5FD5 A;  2PQ8 A;  4KN4 X;  3ZP5 A;  3GBG A;  1J75 A;  3B6C A;  5DEQ A;  2EWN A;  2ZKZ A;  2WV1 A;  3G4S I;  2K7L A;  1MBF A;  5HOD A;  1L3L A;  3LNQ A;  1SFX A;  4BQO A;  2KRF A;  3H0D A;  2O8K A;  1MBH A;  2J5O A;  1MIJ A;  3MZY A;  2JA5 J;  4A3B J;  2CQK A;  3CCJ I;  5JVG F;  4YG2 F;  1KQ9 A;  4CYD A;  4AM3 A;  1B4A A;  4L9T A;  1BJZ A;  4ESJ A;  3S3O A;  2EQR A;  3AFH A;  5IYD J;  2EZK A;  4B8X A;  5F08 A;  3WGG A;  3CD6 I;  5J4Y A;  3W2V A;  5H6R A;  2JZY A;  3BTJ A;  3EUH C;  3DPL C;  3KPH A;  4KIB A;  3IP4 B;  2FF4 A;  3BPV A;  1K4T A;  1HKQ A;  5E3L A;  3DP7 A;  5GTH C;  5CVI A;  3L2Q A;  1DGR M;  5EG0 A;  1VND A;  4HX7 A;  2Z5U A;  2ZB9 A;  1X1A A;  3WTV C;  2M4K A;  5F0F A;  4A3I J;  4HZF A;  3K4N A;  3HOT A;  4Y52 J;  1R6R A;  3KX2 A;  1YHQ I;  3CZ6 A;  1X3W B;  2DK5 A;  2DT5 A;  2FE3 A;  4BHB A;  3VWB A;  1WJA A;  1ZGA A;  1XSD A;  2DJI A;  4KDP A;  3L2W A;  2ID6 A;  1X1D A;  2AO9 A;  2WAQ A;  1WH7 A;  1N78 A;  4II2 A;  4UUV A;  2MBF A;  2L4M A;  5F1J A;  2QEN A;  1J9I A;  3OSF A;  1MKM A;  3S1N J;  3OYL A;  4M3B A;  4V2G A;  2KRC A;  1UHM A;  1V54 H;  3VYT B;  5CKT A;  2W85 A;  1I3A A;  3COA C;  3DBR B;  2LH9 A;  4IKF A;  4L18 B;  2DCE A;  3CF2 A;  1EH8 A;  3JW4 A;  1RR7 A;  4BYY A;  2ESN A;  5IT9 Z;  2F4I A;  3OYI A;  2IA1 A;  2CQ7 A;  3DPT A;  3P5J A;  3SFI A;  2AS5 F;  3L9F A;  3CP2 A;  3F23 A;  4MEX F;  3C7J A;  2EIL H;  2COM A;  1OCO H;  3NWT A;  3QOE A;  2HDD A;  1LEA A;  1ZHF A;  2E60 A;  2H1L A;  2RQP A;  3H36 A;  1FT9 A;  2OD5 A;  2GXA A;  3IWZ A;  2JRT A;  1UHS A;  1R9T J;  2NVU B;  1UG0 A;  2K9N A;  1SVO A;  1P4A A;  4OWR B;  1KON A;  2E71 A;  4EM1 A;  1SAU A;  2LVS A;  1B9N A;  1ZKG A;  2NVQ J;  1TZL A;  1PUE E;  2GXG A;  1W5S A;  2JA7 J;  2QQ9 A;  2AXL A;  3U1K A;  1NG6 A;  1HW5 A;  4OIN F;  3IKT A;  3MKW B;  3FF5 A;  2BXY A;  2XPU A;  5AIQ A;  1B9M A;  3J7Z I;  1UFM A;  5FD6 A;  5HS9 A;  5GTI C;  3J81 K;  5E3M A;  4A3K J;  2GA2 A;  4BE1 A;  2YX4 A;  3H3Z A;  3HSF A;  3KEY A;  1XSX A;  4RGX A;  3N97 A;  1NK3 P;  2VI6 A;  4I6Z A;  2KHM A;  1EV7 A;  3PSF A;  3A2K A;  1SFK A;  5D4S A;  3GZ5 A;  4IOC F;  3BTC A;  3RDI A;  3I4N J;  2DI3 A;  2IA2 A;  4V19 K;  1YG2 A;  2BY2 A;  3FWE A;  5LGN A;  5FRM A;  2IRF G;  2MG4 A;  3K6G A;  3BC8 A;  3OYJ A;  5KAI C;  2A6H F;  3DTE A;  3KP2 A;  1ZH5 A;  3CDL A;  3G1O A;  3V8K A;  3NAR A;  2HVQ A;  5IT3 A;  3IL2 A;  1ZAR A;  3K4K A;  4BJ5 C;  1U0J A;  1YW9 A;  4LIT A;  4UHT A;  4Y13 A;  1ITY A;  2LMD A;  1QHG A;  3WTS C;  2F5C A;  2WTE A;  5CLS A;  2V1D A;  2FMY A;  2PFB A;  3SXY A;  1KU2 A;  3HPH A;  2L3D A;  4E7H A;  1OCZ H;  2E2J J;  2NS7 A;  2BW3 A;  1J7K A;  2VKH A;  1PYV A;  1Y8R B;  1AHD P;  1TTY A;  1HDD C;  1XMK A;  1E3P A;  1MND A;  2QYO A;  3IAS 2;  4AIJ A;  5C3E J;  4P5O A;  3CCL I;  1ZGW A;  2CSO A;  4IRH A;  3VEP A;  4D7N A;  3VYR B;  3CJQ B;  1ETY A;  2R7U A;  3RCO A;  2JN6 A;  2PX9 A;  2G0E A;  4M3E A;  3ZMV A;  3ERE D;  2H8W A;  1W5T A;  1KYZ A;  3CTA A;  1FY7 A;  4PJM A;  1GV5 A;  1MNE A;  1N75 A;  2XKP A;  4L5I A;  3T8R A;  4DZJ A;  4RB2 C;  5HVQ C;  2Y69 H;  1MW7 A;  4IHY A;  2K27 A;  5E3N A;  5EEA A;  1J2X A;  1LNW A;  1J0R A;  4OAY A;  5BOX A;  1FP1 D;  1U5T C;  2E5N A;  4D1Q A;  2PEX A;  2R7D A;  2A05 A;  4HEA 2;  1FX7 A;  2CUJ A;  3GZ6 A;  1ZYR F;  2DFE A;  3KZY A;  1MSE C;  2HVS A;  4I76 A;  1O4X A;  3S2H J;  1G3Y A;  3O8H A;  2M7B A;  3BR2 A;  2ZNZ A;  3ZGK A;  1NG7 A;  4P1W A;  4B47 A;  1J09 A;  3ABT A;  5B1B H;  2Q2E A;  2L54 A;  5TRD A;  2EPF A;  2BXZ A;  2CMP A;  4KUM A;  3SZP A;  3CUO A;  4D5C A;  2O6G E;  1B8I A;  1UB9 A;  3J80 Z;  2CUZ A;  1MJ9 A;  3LQR A;  4IVN A;  5EGO A;  2HQ5 A;  3HRM A;  1D1C A;  4II3 A;  4MQV A;  4U87 A;  2V1X A;  1OPC A;  1ULY A;  1X19 A;  2HPM A;  3JAM K;  2CU7 A;  2CO5 A;  3K2A A;  2FQ3 A;  1JUP A;  5M5X J;  1MBJ A;  2XAF A;  3KZI C;  3MWM A;  1YJW I;  1X2N A;  2LKS A;  2PG4 A;  1D1A A;  2ZXJ A;  2XPV A;  1SD7 A;  2D1H A;  2I8D A;  2XAJ A;  4BL0 B;  4KFC A;  2DO7 A;  4LGW A;  5J40 A;  2K3F A;  2KJC A;  3M3Y J;  2G9W A;  2OF7 A;  1Y1W J;  2VAS A;  2Z16 A;  1YIT I;  1BI3 A;  4YIR X;  2FBI A;  4LIU A;  3SQN A;  3H1C A;  3E6M A;  4LG0 B;  4YFN F;  1M1E B;  3NQO A;  3I64 A;  4GGG A;  4M3G A;  2ZFW A;  2E7W A;  1H88 C;  4RM3 A;  1MSF C;  2V9V A;  5D6E A;  3C18 A;  5GAE J;  2XVC A;  1MH4 A;  1WJB A;  3H3U A;  5FLV A;  4BHC A;  4QTR A;  3DEE A;  1KA8 A;  5JR3 A;  2F6C A;  5FKL A;  2V9K A;  5DUK A;  2EJR A;  5HLH A;  2D1V A;  1X4O A;  1BR1 A;  2ZSH B;  4IEJ A;  4IHS A;  3E1S A;  3F8F A;  1IRZ A;  4AUX A;  1XTA A;  2CV2 A;  1X1B A;  3DCF A;  5DTD A;  2VE8 A;  2IP2 A;  1D5Y A;  2VUM J;  2XRL A;  1TBX A;  5LRR A;  4O6J A;  1JUM A;  3F22 A;  2HXI A;  1U3E M;  3OR1 C;  1XGM A;  2W82 A;  5H6Q A;  1KU7 A;  2LF7 A;  1KZH A;  4Q5S F;  1XGN A;  3VYU B;  2JA6 J;  1OR7 C;  4F91 B;  5DUI A;  1FBQ A;  3HGG A;  4HG2 A;  5HS8 A;  2MAB A;  2CFX A;  1FYK A;  1BIB A;  5L3E A;  3PIO F;  1ZGJ A;  1OCR H;  1EJ9 A;  1VQ6 I;  1UG2 A;  3LST A;  1TT0 A;  3L2R A;  2IPQ X;  2F2E A;  5FKM A;  1BI2 A;  3HYI A;  4I02 A;  2P5K A;  2KKO A;  2PJR A;  1IV6 A;  5BQT A;  4NQW A;  1QPI A;  4A3L J;  1FMW A;  4WF2 A;  1OIS A;  2XRO A;  4Y4R A;  2E36 A;  1S8N A;  1LVK A;  3HKZ N;  5LFA A;  5LHG A;  3PM1 A;  1TQI A;  1TW3 A;  2ZME C;  1V5G A;  5D6F A;  3RKY A;  3BY6 A;  1VQP I;  4Z2Y A;  2HVR A;  5BPI A;  3G1M A;  4HF0 A;  5EF6 A;  3AG3 H;  2FOW A;  3ABU A;  3ASO H;  1FSH A;  4U0V A;  3S15 J;  3A0B C;  3R61 A;  3HOV J;  1Q1V A;  3HEF A;  3F72 A;  3WU0 A;  1O3R A;  2PN6 A;  3ZXS A;  2LYC A;  1KQ8 A;  3IAM 2;  1B72 A;  3VPR A;  5LHI A;  3QRF F;  2L7Z A;  4IRI A;  3OYD A;  1LE8 A;  2M87 A;  1A5J A;  3FM3 A;  4G6D A;  3J7A Y;  5J6X A;  3HBL A;  4LLG F;  2MYS A;  3WTU C;  2QSG X;  1ZAO A;  1JE8 A;  2TRT A;  2GBY A;  1IXC A;  3SFZ A;  4EJU A;  2QSH X;  4GRI A;  5IYB J;  3L2U A;  1OYY A;  1C0W A;  2P0W A;  3HRS A;  1ZLJ A;  3KIO A;  4PJJ A;  4KMF A;  1RZ4 A;  4CH7 A;  2ZCW A;  3FIS A;  5KCM A;  4XOT A;  1LDJ A;  3MEX A;  5K5O A;  1GVD A;  3IRR A;  3HIF A;  3K1P A;  2P8T A;  2DA3 A;  3HOX J;  4E7J A;  4HST A;  2B0L A;  3I55 I;  3JRI A;  1TWG J;  3DKY A;  4M73 A;  4F7Z A;  2LDU A;  5M5Y J;  3RSN A;  1KU9 A;  4B48 A;  2XRN A;  4C3H J;  2HDW A;  4PJN A;  5EZH A;  4A3F J;  2DPU A;  4O3M A;  5FKK A;  2XB0 X;  5J8F A;  4I7H A;  5L3C A;  3A4C A;  1XD7 A;  4YFX F;  3B02 A;  1W7P A;  2IS6 A;  5J4V A;  2F5E A;  2YS9 A;  1S5L C;  1IDZ A;  3GW2 A;  1XCV A;  1IN8 A;  3C2G A;  3LL7 A;  4HSR A;  3G73 A;  2XGE A;  4W97 A;  2Z1D A;  2EIN H;  3IWF A;  3F9K A;  3ZR8 X;  1OQY A;  3S93 A;  1RNL A;  1LFB A;  3VSL A;  3RQ4 A;  2HYF A;  4G9Y A;  2DW4 A;  2COB A;  2HNH A;  1BOB A;  1E3H A;  3CQZ J;  2A69 F;  1Z91 A;  1G6N A;  1YO5 C;  2DQR A;  2PMZ A;  4Q47 A;  1XMX A;  4DBQ A;  4MLO A;  4OOI A;  3CC7 I;  4G7O F;  5LBQ A;  1QVT A;  2VQG A;  4A3G J;  4HLX A;  1IRX A;  2OQG A;  5ICE A;  3RKQ A;  1XDU A;  2R7O A;  1I1S A;  5HNH A;  5L3G A;  5LGU A;  1H8A C;  4BUP A;  2IVM A;  3FKI J;  2GQQ A;  4BEH B;  4JYK A;  3WE2 A;  2BYV E;  4BBR J;  2FEZ A;  1EH7 A;  1Z67 A;  3GFI A;  2FXA A;  1R36 A;  1XC5 A;  4JQF A;  3ERM A;  2RNJ A;  1T38 A;  2JVG A;  2P81 A;  3PQJ A;  1BI1 A;  1UST A;  1V55 H;  2LLK A;  4U0W A;  5D5U B;  3LSI A;  3IV5 A;  1OFC X;  3KET A;  2BGC A;  3H9J A;  4HOB A;  3GTM J;  5FO5 A;  2WB1 N;  3R4K A;  2LP0 A;  4LB6 B;  4BHP A;  3AL0 B;  1FTT A;  2MH9 A;  2EFO A;  3UKG A;  1FEX A;  4E4H A;  1BBY A;  3DV8 A;  5F6F A;  1K7A A;  4WK8 F;  1LJ9 A;  3DF8 A;  4GYG A;  4J00 A;  4P96 A;  2J5P A;  2CUE A;  3LA7 A;  5E18 F;  1MMN A;  2JQ7 A;  1JGS A;  4MEY F;  1JKQ C;  3O3K A;  2DQL A;  1RES A;  1Z3X A;  2X6W A;  1ETV A;  3AG4 H;  1D5V A;  1T0F C;  4XR6 A;  1B1B A;  3Q0U A;  3SZT A;  3H5A A;  2ETH A;  1MMG A;  2IJL A;  2V4J C;  1A35 A;  1VQO I;  3CMY A;  1B6A A;  2FQ4 A;  4XLH A;  1ETW A;  3S3N A;  4KIT B;  2K86 A;  1BW6 A;  4QIW N;  2JPC A;  1IJW C;  5D8L B;  4BBS J;  4DNC A;  4JK1 X;  2ME6 A;  3ZMD A;  3ZMT A;  5E20 A;  1OLT A;  2AQF A;  4JP0 A;  1HKT A;  3KYD B;  3QYF A;  4IZZ A;  3ONQ A;  2V26 A;  2ICW G;  1I39 A;  3QQA A;  2CYY A;  2HTJ A;  1YOV B;  4U7B A;  1VI0 A;  1BL0 A;  4EGY A;  1PDN C;  1A31 A;  1IF1 A;  2M4G A;  3FXL A;  3M8J A;  2QBY A;  5DCF A;  2TCT A;  3DEW A;  3NWS A;  2MD0 A;  2H6C A;  2NXN B;  3RIR A;  4P9U A;  3FXQ A;  3R60 A;  4XON A;  4C2U A;  2HYG D;  3LOC A;  1XGO A;  3JRC A;  4Y33 A;  4ANJ A;  1FLI A;  3UNG C;  2LR8 A;  2ZSI B;  2BE5 F;  1HXD A;  1B59 A;  2YPR A;  3ML6 A;  1FWZ A;  5K1Y A;  3FIW A;  1H0M A;  3W2A A;  2VOP A;  2GLO A;  4BXF A;  4DYC A;  2F4O B;  4OIR F;  2AHQ A;  3D1N I;  4LLN A;  5BMZ A;  1FOW A;  3K1N A;  2E2I J;  1DP7 P;  3KYL A;  5DCM A;  3GYH X;  5LRS A;  4RAZ A;  2OC6 A;  3CCY A;  3LSP A;  2R7V A;  4M72 A;  1AU7 A;  3CCR I;  2ZC2 A;  2A07 F;  2JRM A;  1JKO C;  3KYC B;  2NS0 A;  1XPX A;  1TWH J;  1S29 A;  3NEU A;  3CCQ I;  2Y31 A;  1Z6R A;  5EYR A;  3EET A;  2KL4 A;  2Y48 A;  2JPB A;  2K9Q A;  3OIP A;  1QNT A;  2E35 A;  4HNV A;  1P9Q C;  1MD0 A;  3IHU A;  1R23 A;  2N8G A;  4XKB A;  3H5N A;  4RLQ A;  2ZXH A;  4ITV A;  1F9N A;  3U9G A;  2P5V A;  3F6V A;  1T95 A;  4RS8 A;  1V4R A;  1ON2 A;  4Q48 A;  4QLC U;  1TC3 C;  4XLA A;  4XQF A;  2CW8 A;  1QZY A;  1IC8 A;  1ZEL A;  1YJN I;  2MLG A;  3OOP A;  3SDG A;  2MA3 A;  5ICC A;  2BVM A;  1VQ9 I;  1PVE A;  4HF1 A;  1TLH B;  3F21 A;  2I10 A;  1S7A A;  2XSD C;  1JKP C;  4BNC A;  2OCE A;  5K7Z A;  3PO2 J;  2IGK A;  2DDB A;  3RQI A;  1WJ5 A;  3VSK A;  4E6K G;  5LD2 C;  3EPZ A;  2GIZ A;  4RGR A;  1QBJ A;  2Z2S B;  1KU3 A;  2EA2 A;  2OPT A;  4M74 A;  4A0X A;  1U78 A;  2E34 A;  4EV0 A;  1O7L A;  1SFU A;  4L9N A;  4FE7 A;  3A1Y A;  4FX0 A;  1BR2 A;  2WB1 A;  3BR0 A;  3J80 K;  2VIX A;  4ETS A;  4NDL A;  1DU0 A;  1RIO H;  1R22 A;  3AL0 C;  1SAN A;  3W6J B;  2HS5 A;  2ECB A;  2R92 J;  3D5R C;  2CW7 A;  5HOO A;  3IH4 A;  3L09 A;  3QOP A;  3PO3 J;  2H8R A;  1TW2 A;  1F4K A;  3P9C A;  4XOR A;  4ZTF A;  4I0A A;  4ABZ A;  4YII A;  1K6O A;  2ZJR F;  4A5N A;  2XGD A;  3EYY A;  2JK3 A;  2XAQ A;  3JTG A;  2JWT A;  2QQ8 A;  1LDK B;  1WJD A;  2K85 A;  4XLP F;  1YX3 A;  4PFO A;  1AWC A;  2WWY A;  1IDY A;  5M3M J;  3JR9 A;  2R5Y A;  2M5W A;  3S1R J;  2M8E A;  3BTI A;  4S05 A;  2IXS A;  2UZK A;  3HXL A;  2EIK H;  4UB6 C;  1W7P B;  4HDV A;  4ZDO A;  5IP9 J;  1FIP A;  1RKT A;  1IRG A;  1OYW A;  3QYB A;  4E70 A;  2R0Q C;  4HNU A;  3CP8 A;  2VJJ A;  1JUS A;  1RPW A;  2X48 A;  4CXF A;  2FML A;  2P7C B;  1T08 B;  3FZV A;  4P9F A;  1W1W E;  1V5E A;  5B66 C;  3S1M J;  5DD8 A;  5LEK A;  4XOP A;  5C44 J;  4ZC3 A;  2O61 A;  1MNM C;  3ROU A;  2L9V A;  3I4P A;  4N4N B;  4H0E A;  4G6Q A;  2HOT A;  3E3V A;  3TOA A;  4CCJ A;  1UEL B;  4FX4 A;  5B1A H;  2M1B A;  1R1V A;  5H20 A;  1RR8 C;  3RPU A;  3HB9 A;  5F27 A;  5GAH J;  3L7W A;  1S7O A;  5HLG A;  3BQY A;  2CH0 A;  3OIO A;  1WZ2 A;  3GTO J;  2OJE D;  1ZG1 A;  3GCM A;  2R5Y B;  3EQL F;  1QHH D;  1CQT A;  4A3D J;  3AG2 H;  1XDS A;  4R79 A;  3WOD F;  3PJR A;  2V9P A;  3RZD J;  3MCZ A;  1YRN A;  5D4R A;  3F3X A;  1OCP A;  1E2X A;  2WAF A;  5FLX K;  4LIV A;  2OA4 A;  4YEJ A;  1WRJ A;  2VBZ A;  4E7K A;  1XCB A;  1Z0X A;  2WY7 Q;  4XLE A;  2VKD A;  3HSR A;  1P2F A;  5FFZ A;  3WTW C;  2H1K A;  2GA1 A;  4LK1 F;  2XGC A;  4G8X A;  2L7K A;  2ZO4 A;  3CO6 C;  2B63 J;  1BA5 A;  2B7E A;  3HG9 A;  3S16 J;  2EFW A;  2EV5 A;  1FBS A;  3HL2 A;  4UV8 A;  2VXD A;  1U8B A;  2B9S A;  4IHV A;  6PAX A;  1TP4 A;  4AVZ A;  4LFU A;  4RA2 A;  1HA8 A;  2CQQ A;  1N25 A;  2JUG A;  3D5S C;  4KJZ A;  2Y0S A;  1V3F A;  3NRV A;  2H94 A;  1IGN A;  4MGR A;  1Z7U A;  3BR6 A;  3HJE A;  1QGP A;  4KT6 A;  2R7X A;  2FD5 A;  5K5Q A;  4Y15 A;  1P6R A;  5FRO A;  2HQA A;  3VYS B;  1YIO A;  3LMM A;  4P55 A;  2FX0 A;  1DUX C;  4AYB A;  3HRU A;  1I27 A;  2IS4 A;  4MTD A;  1SMY F;  1UMQ A;  1TL8 A;  3PUF A;  4EGZ A;  2BHY A;  1IRF A;  4IHT A;  3JRF A;  1Y0N A;  1YYV A;  3H9G A;  4B3X A;  2KP6 A;  2VKV A;  2H6B A;  4ZJZ A;  3HDD A;  5K7H A;  1S7E A;  2XF7 A;  3TP3 A;  2DA4 A;  5IP6 A;  1WH5 A;  3I59 A;  1NH3 A;  4A12 A;  4EJV A;  2RN7 A;  5A2Q K;  1TWC J;  3DTI A;  4M3F A;  5CQE A;  3F6O A;  3O6B B;  1DPR A;  1EH6 A;  2JA2 A;  3NAU A;  1B8I B;  3GME A;  1ZRF A;  3BQZ A;  3GLL A;  4A3E J;  2EIM H;  4IX7 A;  1W0T A;  2ZJ2 A;  3JAM Z;  2YX7 A;  3HC7 A;  3T1B A;  4DYR A;  4ENN A;  4R8H A;  2L02 A;  4BE0 A;  3CC2 I;  2R7Q A;  3SJM A;  3ZQF A;  4HRI A;  3X2Q H;  3HOZ J;  2IGO A;  4AD9 A;  1WJF A;  5FKN A;  4XMY A;  1BW5 A;  2R5Z B;  1QVU A;  2WAE A;  2VKE A;  3FDY A;  2ZNY A;  3ECH A;  4AID A;  1K6Y A;  2EZH A;  1IN4 A;  1GVJ A;  1Z3Y A;  2GIV A;  3TO9 A;  3MKZ A;  2K9M A;  3RZO J;  2KPM A;  4BQA A;  3F0C A;  1KQ0 A;  2DLL A;  3HZJ A;  4ASN A;  3DU5 A;  1K78 A;  2HZD A;  1CF7 A;  2XF6 A;  2QUF A;  2HWV A;  3WTZ A;  2W48 A;  2R7Z J;  1ETO A;  1R00 A;  3AG1 H;  5J8C A;  1P92 A;  3V8J A;  1XMA A;  2ISZ A;  2RDP A;  2ZXI A;  2DK8 A;  3GF2 A;  5IY5 H;  3CCE I;  3JRH A;  3QAH A;  2LNB A;  3V7R A;  4FIS A;  1ON1 A;  2Z3Y A;  2BV6 A;  4PSW A;  5J47 A;  4MIM A;  2BEO A;  4DGW B;  2K5C A;  2EK5 A;  2XV4 S;  2MC3 A;  3E5U A;  3L1P A;  1T8I A;  2YU9 J;  3PL8 A;  1GT0 C;  5DV5 A;  2KIM A;  2LY9 A;  2HFH A;  2V7F A;  5DDG A;  4HQE A;  1LVA A;  4GDF A;  1FYL A;  3F8B A;  5GAD J;  1WWX A;  2F5D A;  1Y6I A;  5KAF C;  1I1G A;  1D1B A;  2KIF A;  4BDY A;  1ERD A;  4XKW A;  2QBY B;  5KVR A;  1YTY A;  4UNO A;  3ZMU A;  4CIC A;  4YFK F;  5GP9 A;  2BY1 A;  3LSJ A;  2A6T A;  2UXN A;  3DBH B;  5M5W J;  2BY0 A;  3K9T A;  5DM7 F;  4GYI A;  3HOU J;  4IXA A;  1WFX A;  3GFJ A;  1MMD A;  1ZTR A;  3MKY B;  1T56 A;  2O3F A;  2YSR A;  3CES A;  4FHT A;  1F43 A;  1PP7 U;  3GEZ A;  4CCN A;  4ENJ A;  3J7A O;  3ZRG A;  2DA7 A;  1SVL A;  1ZRD A;  2EV0 A;  1K61 A;  5KK1 A;  1QZZ A;  4G6T B;  2W7N A;  5E1X A;  1Z21 A;  1I3Q J;  2IW5 A;  1MJB A;  5JLX A;  1UAA A;  2O0Y A;  3GXO A;  1K83 J;  1IO2 A;  1U6G A;  4UVB A;  4X0G A;  3K7A J;  4AIH A;  2ELJ A;  4JX5 A;  5J3L A;  3OYN A;  2OTL I;  5EEH A;  2CQX A;  3BG9 A;  4JX4 A;  2OAZ A;  3CC4 I;  1O57 A;  1XGS A;  1BC7 C;  2GM4 A;  4EM2 A;  4F3Q A;  3R0J A;  3CMA I;  1FOY A;  3Q0W A;  2QGU A;  2VC1 A;  3E5X A;  4RAG A;  1G59 A;  5LEJ A;  2LRD A;  4BAY A;  2DA2 A;  2DFF A;  1GHC A;  1E17 A;  2KIS A;  3GO5 A;  3KP7 A;  2DN0 A;  3MN2 A;  3TOB A;  3E0J B;  3H35 A;  3IC7 A;  4KIC A;  4HLY A;  4A3M J;  2JTV A;  1VFC A;  3HM5 A;  1S72 I;  1IN5 A;  3C3W A;  2HQN A;  3RJP A;  3PNY A;  4F92 B;  3LA3 A;  1R7J A;  3QU6 A;  1MJA A;  3A01 B;  3BZK A;  1YI2 I;  3QWL A;  3QPL A;  4RGS A;  3I9V 2;  1VQL I;  2MSY A;  3EDP A;  1IUY A;  2O03 A;  1OCT C;  5ILV A;  2ELH A;  2VPR A;  3FBI B;  5BPD A;  1ZG5 A;  2FNA A;  2Y9Z A;  3IRQ A;  2EFN A;  3CDI A;  1F1Z A;  5L3F A;  3PNT A;  4XRS G;  1R4N B;  2A61 A;  4FE4 A;  3K1M A;  4NC8 A;  3W6V A;  3A02 A;  3TO7 A;  3E6B A;  3ASN H;  4RDU A;  4CCK A;  4M6X A;  1G3T A;  1OKR A;  4A3C J;  1ZQ3 P;  4ON0 A;  2DA1 A;  4Y7N J;  5ERI A;  5EG0 B;  3K69 A;  1D8K A;  5JI6 A;  3TBI A;  2RKH A;  2XF5 A;  3WTY C;  3WTT C;  4OAZ A;  3K4M A;  3DWL E;  1A04 A;  1TQP A;  1XG1 A;  3LSM A;  2NNN A;  2A5W A;  3B73 A;  3M8E A;  4XK4 A;  2M34 A;  4RBO A;  2P6S A;  2ME0 A;  2UWM A;  2HDC A;  3DLA A;  2VPL A;  3RKX A;  4U88 A;  5HDG A;  1QZE A;  5FKO A;  4IRG A;  1LFU P;  3I58 A;  1Z6T A;  3GVA A;  4FTH A;  1JXS A;  3LA2 A;  2E19 A;  2KMU A;  4ESB A;  2XKO A;  2VOO A;  3W2W A;  4XNF A;  1HW2 A;  5EJC A;  2V79 A;  3OIQ A;  1Y39 A;  3RI4 A;  4A93 J;  2XPW A;  3BT9 A;  2VT2 A;  1O3Q A;  1LE8 B;  2OTJ I;  2HZT A;  2A6E F;  1Y56 A;  2MLK A;  4EJW A;  3OSG A;  1YFH A;  1R5H A;  1G2H A;  3TL4 X;  3OYG A;  1BC8 C;  2CG4 A;  2XB5 A;  4I01 A;  1IV8 A;  2OV7 A;  1SVM A;  2PBI A;  1RRJ A;  2EFQ A;  1ZN2 A;  2ZJQ F;  5LLQ A;  2EZI A;  1G3S A;  4DOZ A;  4RGU A;  1X58 A;  4S0H B;  3V7S A;  1VQ5 I;  5KNL A;  1AKH B;  1VF9 A;  4XKC A;  3MKL A;  1USS A;  2STT A;  4KYW A;  5LHH A;  3K4L A;  2VON A;  3W3C A;  1A6I A;  4U0Y A;  1I5Z A;  3W6K B;  1FMV A;  5HS7 A;  1RI7 A;  2QLZ A;  3QP5 A;  1R5G A;  3ZMZ A;  4XRM A;  4GFB A;  5ICG A;  4Y17 A;  2LSO A;  1R49 A;  4H4K C;  2QEX I;  1IG7 A;  4XN0 A;  4ZZL A;  2CRG A;  2NVX J;  2HKX A;  2M9H A;  5ILU A;  2A5Y B;  1UHW A;  3GWZ A;  1PUF B;  4OMY A;  4BH9 A;  1NHA A;  3TDZ C;  1P4X A;  2GAU A;  4HPQ A;  3HGY A;  4M6Y A;  3FMR A;  1D0X A;  4A0Z A;  1J59 A;  1VQN I;  5FLX Z;  1STZ A;  2NAZ A;  3CCU I;  2FOK A;  2DYR H;  1IN7 A;  5TGT A;  5LGT A;  1E0E A;  2DAO A;  3SDB A;  4A3J J;  5D8K B;  2QQB A;  1F5T A;  3OYC A;  4HYE A;  3GTK J;  2KQR A;  4E7Z A;  3FM5 A;  4CYC A;  3DKX A;  4UY8 I;  2HI3 A;  4B44 A;  1HLV A;  2X4H A;  4E7S A;  2KFD A;  4NQW B;  3U2R A;  3BCB A;  3L2C A;  4UUT A;  1RKW A;  2QKM B;  3TP0 A;  3E5Q A;  2LG4 A;  3RYR A;  1L0O C;  1G4D A;  2PMZ N;  3WTX C;  3E97 A;  3KP4 A;  2PLY A;  1Y8Q B;  1BOA A;  2X51 A;  2KT0 A;  2DOE A;  3OMY A;  2LKP A;  2VQC A;  3Q5F A;  2E1O A;  4GCV A;  4C30 A;  2OBP A;  4M71 A;  3I56 I;  2HR3 A;  4KT5 C;  2LRE A;  3OS2 A;  1MDM A;  3M07 A;  3DKW A;  3ZCO A;  2ACJ A;  5FFX A;  4DIQ A;  2BZT A;  5J1U A;  4D9J A;  4CDG A;  3K4C A;  2V1N A;  2VJI A;  4PZJ A;  4C2M J;  4CCO A;  3I4M J;  3CO7 C;  4MNU A;  5J1R A;  2KIU A;  4PUS A;  1IXS B;  4R1H A;  3KP5 A;  3M7G A;  2DJN A;  2K9L A;  2RQQ A;  2RRE A;  4KN7 X;  5EDN A;  1ETQ A;  5JHU A;  2M3A A;  5C4J J;  3KLN A;  4RAY A;  3SHF A;  3VDX A;  2F5V A;  3BJA A;  4Y3O A;  5B5E C;  1FPQ A;  4XSX F;  4IL6 C;  1Z9C A;  5FRN A;  1XN7 A;  2P5L C;  3DXJ F;  3ZQ7 A;  3HTU A;  3KEO A;  1WI3 A;  4BJ6 C;  4J19 A;  5FLM J;  2GOX B;  1ZRE A;  1JI8 A;  3CLQ A;  3SEZ A;  3Q0V A;  4D0P A;  3PSI A;  2RAE A;  3DQV C;  4ZZD A;  3I0T A;  3WG7 H;  2O9L A;  3GTG J;  1GXP A;  5E8G A;  2EH3 A;  4BGD A;  5K5R A;  1FTZ A;  4LOC A;  3HUG B;  3REO A;  3ZQQ A;  1YS6 A;  2DMU A;  3SYT A;  2VB6 A;  2X1D A;  1HBX G;  4NC6 A;  1U2W A;  4CO8 A;  2EBI A;  4ZYA A;  4CCM A;  3BJO A;  3CUQ B;  3GZN B;  4OIP F;  2ESH A;  2Z9O A;  1DPU A;  4DJA A;  3ABM H;  4W1U A;  5BS6 A;  1X4P A;  3Q3S A;  4E7I A;  3PIP F;  3JRG A;  2HOA A;  1LUJ B;  4LB5 A;  4XL9 A;  3GTJ J;  2VXZ A;  1D8J A;  3GTQ J;  3BR3 A;  4DW6 A;  3AKZ A;  3Q9V A;  1SD5 A;  2ZME B;  3RYP A;  4PGG A;  2DTR A;  4LJZ F;  3KEQ A;  3CJR B;  4E7L A;  3MVP A;  3ULQ B;  3FMQ A;  4A6D A;  3QYE A;  1P7I A;  1R1T A;  2V6E A;  2CFO A;  2JJ7 A;  5E79 C;  4B43 A;  1XB4 A;  2P4W A;  4ZTJ A;  1VQ4 I;  4G94 A;  2LTP A;  1LPQ A;  2L7F P;  2AXT C;  4QPO A;  3S32 A;  3BDD A;  1YE9 A;  1S9H A;  1LB2 A;  2UXX A;  1R4M B;  3KP6 A;  2DT7 B;  1UJ8 A;  4XBF A;  2DOF A;  3DU6 A;  2L9N A;  2QZ8 A;  1N77 A;  2M30 A;  3H5R A;  4XID A;  4L5J A;  3EUA A;  2DTZ A;  4IF4 A;  2E2H J;  5CQG A;  4IOA F;  1X3U A;  3CCS I;  1D3Y A;  1QA6 A;  2L5Q A;  2P6T A;  3CUQ A;  3ECO A;  2KRH A;  2KLO A;  4UVA A;  1TT5 B;  1UZC A;  2QCO A;  1SD6 A;  3K4J A;  2PMH A;  3RTR A;  2FUG 2;  3FKJ A;  1IXR C;  2CV0 A;  1SFO J;  2XHK A;  2XAS A;  3M8F A;  1HKS A;  3QP6 A;  3P9I A;  3TW6 A;  3CDH A;  2HU9 A;  3QU3 A;  3C1D A;  3OYH A;  3O2P E;  2O8X A;  5IYC J;  4M3D A;  1ONV A;  4X1E A;  1Y1V J;  1Z7L A;  3DEU A;  1V5F A;  2XAU A;  3WGI A;  1DQU A;  2Y75 A;  3BZC A;  4JX6 A;  1HCR A;  4G12 A;  3ZN1 A;  3CJT B;  4ZYD A;  3GFL A;  2DYS H;  1IAW A;  5HLI A;  4NUB A;  2IS1 A;  1WQ2 A;  2DXI A;  2GZW A;  2W1O A;  2IT0 A;  1EF4 A;  4M9S A;  3KCC A;  2BBY A;  3FXR A;  3HRT A;  2M8G X;  4AWX B;  2LBF B;  2JA8 J;  1FC3 A;  2BHZ A;  3ZQH A;  2IS2 A;  1MDM B;  5E8I A;  3GTL J;  4L9V A;  1KYW A;  4HDU A;  4RM2 A;  3I59 B;  2DFI A;  3HOY J;  1QU3 A;  4PSX A;  4BEH A;  1SD4 A;  4M6V A;  1YLF A;  3I5U A;  5CJ9 A;  3TDU C;  1U9O A;  4I09 A;  4Z6Y A;  2V6C A;  3OYM A;  4F93 B;  3MFK A;  1HST A;  2FJ1 A;  1G3W A;  4PGH A;  1HW1 A;  3TO6 A;  2A68 F;  4IHX A;  1GXQ A;  3P7N A;  4YRV A;  2IAI A;  5JHF A;  5HLT A;  3M9A A;  2LY1 A;  3DTK A;  3ELK A;  5CVV A;  2X85 A;  1HQC A;  5CVR A;  2QF7 A;  3EYI A;  3OYE A;  1FIA A;  2IGN A;  3OY9 A;  3A01 A;  4LG0 A;  3SEQ A;  2JUC A;  1OCC H;  1A6Q A;  2PMU A;  2X6Y A;  4AIK A;  3IUO A;  4CUG A;  3TED A;  2FNP A;  1XS9 A;  3S17 J;  2JSC A;  2NS8 A;  3M1C A;  5DM6 F;  2JVH A;  2NNY A;  1BN5 A;  1MBE A;  3MAJ A;  3N05 A;  2DPD A;  3MMY B;  2XUB A;  5EGO B;  3LQQ A;  2NRA C;  2MD5 A;  2MGQ A;  2VBY A;  1AA7 A;  2BOL A;  3JSO A;  2YU3 A;  4RMN A;  1R58 A;  2M0C A;  1FOK A;  2OZU A;  3HKZ A;  1BJA A;  5IOZ A;  1WJE A;  2XC7 A;  2IBD A;  5GPC A;  1APL C;  3Q9S A;  5IT9 K;  5B3S H;  4QSH A;  3DBL B;  1SMT A;  5HDK A;  3BG3 A;  2YUS A;  3BG6 A;  4LD5 A;  4U7D A;  3TMO A;  3ZN0 A;  2VN2 A;  4A2U A;  5CYV A;  2WY8 Q;  2WV0 A;  1JTX A;  4C9Y A;  4CCL A;  5D5V B;  1YS7 A;  2RV8 A;  2MC4 A;  2KZV A;  2XSJ C;  3HTS B;  4ZYH A;  4L9J A;  1RUO A;  1R1U A;  2DOD A;  1VQK I;  2A3S A;  2E5Z A;  2R3S A;  4RB1 A;  5K7F A;  2EZL A;  2EV6 A;  2MH2 A;  4AU7 A;  2HGC A;  2LC2 A;  1X1C A;  2X9D A;  1WKM A;  1LDD A;  3OWT A;  2OU2 A;  4MQ9 F;  4EEF G;  1BM9 A;  3MQ0 A;  4LLL A;  3VOD A;  1T33 A;  2HPI A;  3KZZ A;  4GXO A;  4BY1 J;  4MO7 A;  1B72 B;  5E3O A;  2Q2E B;  3T0Y A;  4M9X A;  3V8L A;  4F55 A;  5F1R A;  1H9T A;  2CJJ A;  1W5C C;  2L7M P;  3PNV A;  3H0G J;  4LK0 F;  2WAQ N;  3LAJ A;  3T5X A;  4N4O B;  1W36 D;  4BQQ A;  3G6E I;  3FXU A;  2K9S A;  4KIG A;  4OU0 A;  5BNG A;  2VE9 A;  4FAS D;  4M9Z A;  2OUM A;  1YX5 A;  2R7T A;  3WU1 B;  4HX8 A;  5FB2 A;  2VJ4 A;  2H27 A;  1JTY A;  4RB3 C;  1LEB A;  1Y0U A;  2VT3 A;  3QPS A;  3PFI A;  2IGM A;  1RUN A;  4BS9 A;  1HC8 A;  4QPQ A;  5D5W B;  4EQQ A;  4MFE A;  1T2K A;  2HQR A;  4EAT A;  2VC0 A;  4I99 C;  3JRB A;  4IJA A;  3CME I;  1QQI A;  1GDT A;  1PJR A;  2FU4 A;  3C2H A;  5HNF A;  3M4O J;  4ZYE A;  2L01 A;  4HAM A;  2H09 A;  4N9I A;  2QVO A;  3D0S A;  1TWF J;  3IH2 A;  5CPR B;  5IP7 J;  4I2O A;  1LFP A;  5KHD A;  3FX3 A;  2UUZ A;  4XM3 A;  1HF0 A;  3G3Z A;  2AQE A;  4UVC A;  2NVT J;  5ICF A;  2EA4 A;  2LOO A;  4F52 A;  2DOA A;  3WU2 C;  1D0Z A;  3FXJ A;  1U5T A;  3VOE A;  1PP8 F;  4LG3 A;  1JT6 A;  3EUH A;  2KDO A;  1YQA A;  5J1Y A;  2HOS A;  3GUD A;  4NC7 A;  1U8R A;  2RVC A;  3HUG A;  2W25 A;  1FYM A;  2FBK A;  4O5V A;  3G1L A;  2LK2 A;  4UB8 C;  3ZQC A;  4V2F A;  2PJR B;  2G7H A;  4XLC A;  4XKV A;  3PUB A;  1H9G A;  1YIJ I;  5L3D A;  3F8C A;  1FBU A;  2MW8 A;  1ZG3 A;  4XSZ F;  1K4S A;  4AYB N;  3JRD A;  1SEU A;  5HDN A;  1D0Y A;  2ECC A;  1MZB A;  3P9K A;  2F48 A;  1XX5 A;  3V4G A;  4ZYG A;  3FHN A;  1Z1D A;  1SFE A;  3F8N A;  4RB0 A;  1O7F A;  3DFG A;  2DU9 A; 
#chains in the Genus database with same CATH homology
 2E19 A;  1JT0 A;  3LOC A;  3SFI A;  4XRS A;  3JRC A;  4D7M A;  2LR8 A;  4A93 J;  2XPW A;  3BT9 A;  1RET A;  3FIW A;  2DA5 A;  1LE8 B;  2HDD A;  2GLO A;  4DYC A;  1ZR2 A;  3OSG A;  2AHQ A;  3D1N I;  1UHS A;  1R9T J;  2E2I J;  1Z77 A;  1G2H A;  2K9N A;  4C3J J;  2XB5 A;  3CCY A;  3LSP A;  1AU7 A;  2LVS A;  2NVQ J;  1ZKG A;  2EZI A;  1JKO C;  1H89 C;  1X58 A;  4UUS B;  2JA7 J;  4S0H B;  1TWH J;  2HYJ A;  1NTC A;  2Y31 A;  1AKH B;  1VF9 A;  5EYR A;  2XPU A;  3MKL A;  2K9Q A;  1A6I A;  4HNV A;  4A3K J;  5E3M A;  3E7L A;  4XRM A;  4GFB A;  2N8G A;  1IG7 A;  2CRG A;  1NK3 P;  2NVX J;  2VI6 A;  4I6Z A;  4MFD A;  2M9H A;  1PUF B;  1F36 A;  1YRN B;  2Y9Y A;  1TC3 C;  2ID3 A;  1IC8 A;  3HGY A;  4DYQ A;  3SDG A;  3BTC A;  3I4N J;  2Y2Z A;  2MG4 A;  2I10 A;  2XSD C;  1JKP C;  5K7Z A;  3PO2 J;  3CDL A;  4A3J J;  3RQI A;  3G1O A;  3NAR A;  3GTK J;  2DMT A;  3H3V K;  5C4X J;  4L5E A;  2OPT A;  1U78 A;  4FE7 A;  1ITY A;  4CYC A;  1E3O C;  3BR0 A;  5FJ8 J;  2HI3 A;  1HLV A;  2E2J J;  2NS7 A;  2Y30 A;  4NDL A;  1DU0 A;  2ELK A;  2JMW A;  1AHD P;  4UUT A;  1RKW A;  4B3A A;  1HDD C;  3TP0 A;  4FTH A;  1SAN A;  1HOM A;  2ECB A;  5C3E J;  2R92 J;  2PMZ N;  3IH4 A;  1MH3 A;  3FK6 A;  1ZGW A;  3PO3 J;  2H8R A;  4D7N A;  2KT0 A;  3S1Q J;  1FJL A;  4ABZ A;  1NK2 P;  1ETY A;  2E1O A;  2JN6 A;  9ANT A;  2G0E A;  1DU6 A;  2XGD A;  1POG A;  4M3E A;  2KDZ A;  2R5Z A;  3ZOB A;  2JK3 A;  1IUF A;  5IOY A;  2JWT A;  5J1U A;  1GV5 A;  4DZP A;  4DZJ A;  1IDY A;  5M3M J;  4BKX A;  3JR9 A;  3S14 J;  4C2M J;  4XIC A;  2R5Y A;  4IHY A;  5E3N A;  5EEA A;  5F0H A;  3I4M J;  3S1R J;  5J1R A;  3BTI A;  4B1R A;  2DJN A;  5IP9 J;  2L0K A;  5EDN A;  1FIP A;  1RKT A;  1ETQ A;  1TWA J;  5C4J J;  4I76 A;  3JRA A;  1O4X A;  1MSE C;  2R0Q C;  3S2H J;  3O8H A;  2LKX A;  3BR2 A;  1JUS A;  1RPW A;  2X48 A;  3BTL A;  1ETX A;  1GV2 A;  3S1M J;  1U9N A;  5C44 J;  1WI3 A;  4J19 A;  4D5C A;  1B8I A;  5FLM J;  1MNM C;  2Y0S N;  5EGO A;  3Q0V A;  3ZQG A;  2HOT A;  2HQ5 A;  3GTP J;  2RAE A;  2CU7 A;  2O9L A;  3GTG J;  3K2A A;  1JUP A;  3HB9 A;  2HXO A;  1MBJ A;  2EH3 A;  5F27 A;  5M5X J;  1FTZ A;  4LOC A;  1X2N A;  2XPV A;  2DMU A;  3BQY A;  1MBK A;  3OIO A;  3GTO J;  2EBI A;  2R5Y B;  1WPK A;  1CQT A;  3M3Y J;  3ZQI A;  4A3D J;  2OF7 A;  3O8G A;  1Y1W J;  4W1U A;  3Q3S A;  3RZD J;  4CYC B;  3JRG A;  2HOA A;  1YRN A;  5F04 A;  2IEK A;  3GTJ J;  3GTQ J;  3BR3 A;  4DW6 A;  1OCP A;  4M3G A;  1H88 C;  3WHC A;  2LFB A;  1MSF C;  1ORK A;  2X6O A;  1MH4 A;  5FLV A;  1OJL A;  4QTR A;  3BG5 A;  1Z0X A;  3MVP A;  1JJ6 C;  5FKL A;  2NVY J;  1P7I A;  1ETK A;  4IEJ A;  4C3I J;  2R93 J;  2JJ7 A;  2H1K A;  1IRZ A;  4AUX A;  2XGC A;  5M3F J;  5DS9 A;  2B63 J;  1BA5 A;  3DCF A;  5DTD A;  2LTP A;  3S16 J;  3TW7 A;  2L7F P;  1D5Y A;  2VUM J;  2XRL A;  2DA6 A;  1JUM A;  2HXI A;  1U8B A;  1PUF A;  4IHV A;  5F0C A;  4XID A;  2E2H J;  2DTZ A;  2CQQ A;  2L9R A;  4BY7 J;  1P7J A;  3WHB A;  2JA6 J;  3HGG A;  5JLW A;  1IGN A;  2QCO A;  3BR6 A;  1SFO J;  2FD5 A;  3TW6 A;  1UG2 A;  4AC0 A;  2FX0 A;  5FKM A;  5IYC J;  1UMQ A;  4M3D A;  4X1E A;  1Y1V J;  3JRF A;  4BXX J;  1IV6 A;  1JGG A;  1QPI A;  2VKV A;  4A3L J;  4IHW A;  4JX6 A;  3HDD A;  5K7H A;  1HCR A;  1S7E A;  4G12 A;  4D5F A;  3TP3 A;  2DA4 A;  5IP6 A;  1WH5 A;  1X2M A;  3HKZ N;  1JKR C;  3PM1 A;  1QRY A;  2O7O A;  1TWC J;  1WGX A;  3B6A A;  4M3F A;  1EF4 A;  4UUS A;  3NAU A;  2K40 A;  2M8G X;  3G1M A;  1B8I B;  2JA8 J;  5EF6 A;  3BQZ A;  3ZQH A;  4FCY A;  4A3E J;  1W0T A;  3S15 J;  3GTL J;  4DYR A;  3HOV J;  1HDP A;  1AKH A;  1Q1V A;  1ZK8 A;  3HEF A;  1I6H J;  3HOY J;  4M6V A;  3SJM A;  3ZQF A;  3HOZ J;  3JRE A;  3VPR A;  1B72 A;  5FKN A;  5GPA A;  2L7Z A;  1LE8 A;  1BW5 A;  2R5Z B;  1A5J A;  1QVU A;  1U9O A;  2VKE A;  3HBL A;  2EZH A;  3IH3 A;  2FJ1 A;  3BR5 A;  4IHX A;  2TRT A;  2GBY A;  2IAI A;  2NOG A;  3RZO J;  5IYB J;  2QF7 A;  3F0C A;  1FIA A;  3A01 A;  3FIS A;  2DMP A;  2W48 A;  1GVD A;  2R7Z J;  1ETO A;  2DA3 A;  3TED A;  3S17 J;  1XS9 A;  3HOX J;  3JRI A;  1TWG J;  3A03 A;  3C2B A;  3ZQL A;  1ZR4 A;  1ENH A;  2NS8 A;  3JRH A;  5M5Y J;  4FIS A;  4C3H J;  1MBE A;  4MIM A;  4A3F J;  5EZH A;  5FKK A;  5IPA A;  5EGO B;  2XB0 X;  2CUF A;  2MGQ A;  3L1P A;  2YU9 J;  2M0C A;  2YS9 A;  1GT0 C;  4X6A J;  3S2D J;  2LY9 A;  2DMQ A;  5IOZ A;  1IDZ A;  2IBD A;  5GPC A;  1APL C;  2M2E A;  2XGE A;  4W97 A;  4QSH A;  3BG3 A;  2YUS A;  2D5V A;  1LFB A;  3LSR A;  2COB A;  3FK7 A;  3CQZ J;  1JTX A;  2LD5 A;  5GP9 A;  1MBG A;  3LSJ A;  3BR1 A;  1W0U A;  4MLO A;  5M5W J;  1JJ8 C;  5K7F A;  2EZL A;  1QVT A;  4A69 C;  3HOU J;  4A3G J;  1ZTR A;  4B4C A;  1T56 A;  2X9D A;  3OOU A;  3RKQ A;  4EEF G;  1F43 A;  1I50 J;  1H8A C;  1T33 A;  3LSG A;  1WCM J;  4BY1 J;  4MO7 A;  2DA7 A;  1B72 B;  1GUU A;  1K61 A;  5E3O A;  3FKI J;  2DMN A;  1I3Q J;  4JYK A;  5JLX A;  4BBR J;  1K83 J;  2CJJ A;  2L7M P;  1XC5 A;  3H0G J;  3K7A J;  2WAQ N;  4JX5 A;  2P81 A;  5J3L A;  2LLK A;  2CQX A;  3BG9 A;  4JX4 A;  2K9S A;  5EZG A;  5BNG A;  3HOW J;  3IV5 A;  2GM4 A;  1OFC X;  3Q0W A;  1JTY A;  3GBG A;  3GTM J;  3B6C A;  2WB1 N;  3QPS A;  2WV1 A;  2LP0 A;  1MBF A;  2DA2 A;  5HOD A;  1FTT A;  3LNQ A;  4MFE A;  1FEX A;  3UKG A;  2O8K A;  1MBH A;  2DN0 A;  3MN2 A;  3JRB A;  4A3M J;  1GDT A;  4A3B J;  1VFC A;  3HM5 A;  2JA5 J;  3M4O J;  1BJZ A;  1TWF J;  3IH2 A;  5IP7 J;  2EQR A;  5IYD J;  2CUE A;  2EZK A;  1HF0 A;  3A01 B;  1JKQ C;  5F08 A;  3QPL A;  1RES A;  2MSY A;  3BTJ A;  1ETV A;  2NVT J;  1OCT C;  3Q0U A;  2VPR A;  2Y9Z A;  5E3L A;  4XRS G;  3CMY A;  1JT6 A;  2FQ4 A;  5J1Y A;  1VND A;  5EG0 A;  2HOS A;  1ETW A;  2ZB9 A;  4FE4 A;  3W6V A;  1BW6 A;  5F0F A;  4QIW N;  3A02 A;  4A3I J;  1IJW C;  4Y52 J;  4RDU A;  3G1L A;  2LK2 A;  4BBS J;  3ZQC A;  4V2F A;  4A3C J;  2ME6 A;  1ZQ3 P;  2DA1 A;  4Y7N J;  5EG0 B;  4JP0 A;  2MW8 A;  2ID6 A;  2AO9 A;  1XG1 A;  1WH7 A;  4XK4 A;  3QQA A;  2M34 A;  4RBO A;  2ME0 A;  4AYB N;  5F1J A;  3JRD A;  1BL0 A;  1VI0 A;  3OSF A;  3S1N J;  2ECC A;  4M3B A;  4V2G A;  2TCT A;  3DEW A;  5FKO A;  1LFU P;  1RR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...