3H0GK

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
total genus 20
structure length 119
sequence length 119
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h0gK00
4A3JK 4JK1A 3DXJA 4QJVA 4BBRC 5IP7C 2O5IA 1ZYRA 4LK1A 2E2JC 1I3QK 1WCMK 1XPPA 3HOYK 1I50K 1IW7A 4Y52C 3S1RK 4A3LK 4A3EK 5C44C 5M3FK 3S2HK 1I6HK 2WB1D 5C4JK 1TWCK 4YFKA 1TWGC 4XSZA 1TWHC 2E2HK 3GTQC 3I4MC 4BXXC 2NVTK 5C3EK 5D4DA 2JA8C 2A68A 4BY1K 4A3GK 5C4XK 2A69A 4LJZA 5IP7K 4OIOA 2E2IC 4XLNA 3GTJC 2E2JK 2JA5K 2R7ZC 3GTKK 5IYBK 2VUMC 5FJ8K 2PA8L 3S1RC 4Y52K 2R92C 2WB1L 3CQZC 4A3CK 4A93K 5M5WK 5C4JC 3HOXK 1TWCC 4BXXK 5M3MK 1TWHK 4C3IK 2E2HC 2WAQL 4YG2A 3GTQK 4A3DC 3PO2C 3FKIC 2NVQC 4AYBD 4OIQA 4A3MC 1SFOK 3S1NK 2Y0SD 1HQMA 3S16C 3S15C 2PA8D 4KN7A 4C3HK 5IP9K 3M4OC 4Q5SA 3RZDK 3HOUK 5FLMK 1SMYA 5IYBC 2VUMK 3H3VL 4YFXA 2B63C 1Y1VC 2R92K 2O5JA 3GTGC 3HOYC 5IYCC 3HOVC 3HOXC 4A3FK 4QIWL 2Y0SL 4A3EC 1I6HC 3GTPK 3FKIK 2NVQK 2NVXK 3I4NK 4A3MK 4NOIA 1SFOC 3HOZC 5C3EC 5IYDC 3H3VD 3S1MC 4X6AK 3GTMK 4BBSC 2YU9C 1YNJA 1R9TK 2JA7K 3RZDC 4A3GC 1K83K 4C2MK 4OIRA 4QIWD 5C4XC 5FLMC 1YNNA 2B63K 3GTJK 4A3BK 2R7ZK 3HOVK 1TWFC 3S1QC 4A3FC 4A3KK 3HOWC 4XSXA 2R93K 2PMZL 3HKZD 4A3CC 3M3YC 2NVXC 3RZOK 3S2DK 2JA6C 4A3DK 2NVYK 4X6AC 2WAQD 4LLGA 3GTMC 4AYBL 4KN4A 2YU9K 4BBSK 1R9TC 3S1NC 1TWAK 3K7AK 3GTOC 3S16K 4A3JC 3S15K 3M4OK 3EQLA 3GTLK 3WODA 3HOUC 1I3QC 1WCMC 3H0GC 4Q4ZA 3S14C 4Y7NK 3S1QK 4A3KC 1Y1VK 2A6HA 2BE5A 4LK0A 3HKZL 4OIPA 1Y1WK 3GTGK 5IYCK 3M3YK 4MEYA 3RZOC 3S2DC 4G7HA 4OINA 4A3IC 2JA6K 2NVYC 3GTPC 2NVTC 3I4MK 4XLPA 3I4NC 4YFNA 3PO3C 4BY7K 4KMUA 4BY1C 1TWAC 2CW0A 3K7AC 3GTOK 5M5YK 3HOZK 3S1MK 5IYDK 3GTLC 3S17C 4MEXA 2JA7C 4G7ZA 2E2IK 1K83C 2JA5C 1I6VA 3GTKC 4BBRK 3H0GK 3S14K 4Y7NC 5TMFA 5M5XK 1Y1WC 4A3BC 1BDFA 4MQ9A 4ZH4A 2A6EA 3CQZK 5TMCA 2PPBA 1I50C 1TWFK 4A93C 4QJVB 4A3LC 3HOWK 5C44K 4A3IK 3S2HC 4GZYA 2R93C 2PMZD 3PO2K 4G7OA 1TWGK 4C3JK 3PO3K 4BY7C 2JA8K 5IP9C 3S17K
chains in the Genus database with same CATH superfamily
3DXJA 3GTKA 4BBRC 5IP7C 1ZVUA 4GTAA 2O5IA 1EK8A 1XPPA 3HOYK 1I50K 1O28A 2WB1D 1DCOA 4YFKA 1TWCK 1TWGC 4C3JC 1TWHC 3GTQC 1TWGA 5D4DA 2JA8C 3QX3A 1BGWA 4BY1K 4P5BA 4A3GK 5CHPA 2A69A 4LJZA 1WSVA 5IP7K 3GTKK 3GTJC 2XCQA 2D6FC 1EI6A 1USMA 3BP8C 3ERED 4A3CK 5M5WK 3HOXK 4FM9A 1TWCC 5M3MK 1TWHK 3GTQK 4A3DC 2WAQL 4YG2A 2NVQC 2RGRA 4KAWX 4AYBD 1G51A 1ISEA 5IP9K 3M4OC 1J6WA 3HOUK 3GTMA 2B63A 5FLMK 3H3VL 2B63C 1Y1VC 1TWHA 3GTQA 4GT9A 3HOXC 4QIWL 4A3EC 2XCOA 1TWAA 2NVQK 2JH3A 4NOIA 4P9SA 4KB4A 5IYDC 3H3VD 1VLOA 3GTMK 4BBSC 2YU9C 1JVIA 4WILA 4QIWD 5C4XC 1O25A 5FLMC 1IQ0A 1YNNA 2B63K 4GTLA 1XXCA 3HOWC 4XSXA 3M3YC 2JA6C 1O26A 3GTMC 4WJ4A 4BBSK 1PJ7A 2YU9K 3K7AK 4A3JC 3S15K 2P5MA 1O2FB 3A8IA 3WODA 4PAAA 1WCMC 2KWAA 3H0GC 2BE5A 2E2HA 5IYCK 4ILDA 3M3YK 4G7HA 4OINA 4A3IC 2JA6K 2NVXA 2GSUA 1PJ6A 4BY7K 1XZQB 3HOZK 3K7AC 3FKIA 1I50A 4KM8A 2JA7C 1K83C 1ZQ1C 3H0GK 1WQGA 4A3BC 2JA6A 4A93C 5TMCA 1F7VA 4RMFA 5IORA 3S2HC 4A3IK 1X31C 2GAGC 3FOEA 4BY7C 1Y1WA 3N0BA 1WQHA 2ZUEA 4QJVA 1WOOA 1ZYRA 2E2JC 3T01A 4FZBA 4Y52C 2ZUFA 3S2HK 4AH6A 2Y3PA 1I6HK 3A8JA 3AQOA 1F93A 4XSZA 4GFQA 3I4MC 1JQWA 4KATA 4G0VA 4C2MC 4XLNA 2E2JK 1XXAA 2VUMC 2PA8L 3AD9C 4Y52K 2CFAB 3CQZC 1I3QA 1ZXOA 3TTGA 3S1NK 1ZBSA 1WOPA 2PA8D 1WQFA 4Q5SA 2VUMK 4BLBA 2YU9A 4KMHA 3HOVC 1BS2A 3GTPK 3I4NK 4KASA 2R93A 3S1MC 5C3EC 3TFIA 3AQPA 1R9TK 3L4KA 1B4AA 3BP3A 4OIRA 1SFOA 2R7ZK 5JVOA 1DCPA 3HOVK 1TWFC 3S1QC 3ADAC 2R93K 3IPJA 3OEPA 3GTPA 3OPFA 2FQTA 3H0GA 1R9TC 1GE9A 3S16K 3GEEA 4BKWA 4M1XA 1RU0A 4Q4ZA 4Y7NK 1J98A 1EQRA 3S1QK 1Y1WK 3GTGK 3AH5A 3BUEA 1K83A 1J6XA 4MEYA 4XLPA 4YFNA 3G4CA 4KMUA 4BY1C 2CW0A 1WIHA 5IOTA 4G7ZA 3GTKC 1I6VA 2ZFZA 4Y7NC 5TMFA 5M5XK 1Y1WC 1BDFA 4MQ9A 2FQOA 4QJVB 4LR2A 2PMZD 3JSTA 1IBAA 5IP9C 4OIQA 3M4OK 4JK1A 3GTLA 3FHZA 4LK1A 1I3QK 3S1RK 4A3EK 5M3FK 5C4JK 3GTOA 4GTFA 4BXXC 2P8TA 2E2HK 2NVTK 4KDDA 3CQZA 5C4XK 4C3HC 2E2IA 1TWFA 2E2IC 5TJ3A 2JA5K 3S1RC 2R92C 2V6SA 3HXAA 1L0WA 5C4JC 4KC6A 4LOWA 4BXXK 3GDZA 3SZZA 2E2HC 1WCMA 2XCRB 5EGEA 3PO2C 5JFEA 2V6TA 1SFOK 2GSNA 4XCHA 3S15C 1VRQC 4KN7A 4C3HK 4KMDA 3CAGA 3RZDK 1HI9A 3GEIA 1SMYA 1O24A 1F9NA 4YFXA 2R92K 2JA7A 3LAPA 3HOYC 5IYCC 4A3FK 1BJTA 2NVXK 1SFOC 3HOZC 3GTGA 1XXBA 1O27A 1YNJA 3GIRA 2JA7K 3RZDC 4A3GC 1K83K 3Q3QA 3GTJK 4A3BK 3T02A 4A3FC 2GAHC 4A3CC 3GEHA 3A8KA 2NVXC 1XZQA 4BLAA 4A3DK 2WAQD 3FOFA 4LLGA 4G0UA 2PHCB 4AYBL 4KN4A 3GSIA 3HOUC 1DD5A 1Y1VK 4LK0A 3HKZL 2V6UA 3I4MK 3G4AA 3PO3C 3TFJA 5IYDK 5M5YK 2EBBA 1AB4A 1USOA 2NVYA 3NUHA 1O29A 1O2AA 1IE0A 3AD7C 3CQZK 3L4JA 2PPBA 4GTEA 1JOEA 1KQ4A 4A3LC 3HOWK 5C44K 2R7ZA 2RH6A 4GTDA 3TFHA 3PO3K 2GSOA 4A3JK 3T00A 4C45A 1WORA 1WCMK 3AD8C 1IW7A 5EGHA 1YX2A 4A3LK 5C44C 4J3NA 4C3IC 2R92A 5C3EK 4O2DA 2A68A 1B4BA 3MMLB 5IOSA 1VH2A 1XZPB 4OIOA 2R7ZC 4KMAA 4GTCA 5IYBK 5FJ8K 2WB1L 4A93K 1EFWA 4C3IK 1WSRA 4WJ3M 1WOSA 3FKIC 1VGXA 3SZYA 4A3MC 3GTJA 2Y0SD 1HQMA 3S16C 4PABA 1IL2A 1J6VA 1TWCA 5IYBC 4P5AA 4DDQA 2O5JA 3GTGC 5E68A 2Y0SL 1VJEA 1I6HC 3FKIK 4KB2A 1PJ5A 2W7VA 1YCLA 4A3MK 4X6AK 5IOQA 3V4GA 1Y1VA 1INNA 4LQYA 3LPXA 4C2MK 1DCHA 2CFAA 5L46A 1V5VA 4A3KK 3LAJA 2PMZL 1IS1A 3HKZD 3RZOK 3S2DK 2NVYK 4X6AC 3OREA 3N0CA 3S1NC 1TWAK 1O2BA 3GTOC 2VUMA 3EQLA 3GTLK 4GTBA 1I3QC 5CJ9A 5HL8A 3S14C 4A3KC 2A6HA 4OIPA 4KM9A 3RZOC 3S2DC 1XZPA 2NVYC 3GTPC 2NVTC 3N3YA 3I4NC 3S1MK 1TWAC 3GTOK 1F7UA 1R9TA 3GTLC 3S17C 4MEXA 2E2IK 2JA5C 1UV7A 4BBRK 3S14K 2JA5A 4ZH4A 2A6EA 1I50C 1TWFK 2R93C 4GZYA 3PO2K 4G7OA 1TWGK 4C3JK 1EH1A 4KARA 1C0AA 3VA7A 4G0WA 2JA8K 3S0XA 3S17K
chains in the Genus database with same CATH topology
4A3JK 4JK1A 3DXJA 4QJVA 4BBRC 5IP7C 2O5IA 1ZYRA 4LK1A 2E2JC 1I3QK 1WCMK 1XPPA 3HOYK 1I50K 1IW7A 4Y52C 3S1RK 4A3LK 4A3EK 5C44C 5M3FK 3S2HK 1I6HK 2WB1D 5C4JK 1TWCK 4YFKA 1TWGC 4XSZA 1TWHC 2E2HK 3GTQC 3I4MC 4BXXC 2NVTK 5C3EK 5D4DA 2JA8C 2A68A 4BY1K 4A3GK 5C4XK 2A69A 4LJZA 5IP7K 4OIOA 2E2IC 4XLNA 3GTJC 2E2JK 2JA5K 2R7ZC 3GTKK 5IYBK 2VUMC 5FJ8K 2PA8L 3S1RC 4Y52K 2R92C 2WB1L 3CQZC 4A3CK 4A93K 5M5WK 5C4JC 3HOXK 1TWCC 4BXXK 5M3MK 1TWHK 4C3IK 2E2HC 2WAQL 4YG2A 3GTQK 4A3DC 3PO2C 3FKIC 2NVQC 4AYBD 4OIQA 4A3MC 1SFOK 3S1NK 2Y0SD 1HQMA 3S16C 3S15C 2PA8D 4KN7A 4C3HK 5IP9K 3M4OC 4Q5SA 3RZDK 3HOUK 5FLMK 1SMYA 5IYBC 2VUMK 3H3VL 4YFXA 2B63C 1Y1VC 2R92K 2O5JA 3GTGC 3HOYC 5IYCC 3HOVC 3HOXC 4A3FK 4QIWL 2Y0SL 4A3EC 1I6HC 3GTPK 3FKIK 2NVQK 2NVXK 3I4NK 4A3MK 4NOIA 1SFOC 3HOZC 5C3EC 5IYDC 3H3VD 3S1MC 4X6AK 3GTMK 4BBSC 2YU9C 1YNJA 1R9TK 2JA7K 3RZDC 4A3GC 1K83K 4C2MK 4OIRA 4QIWD 5C4XC 5FLMC 1YNNA 2B63K 3GTJK 4A3BK 2R7ZK 3HOVK 1TWFC 3S1QC 4A3FC 4A3KK 3HOWC 4XSXA 2R93K 2PMZL 3HKZD 4A3CC 3M3YC 2NVXC 3RZOK 3S2DK 2JA6C 4A3DK 2NVYK 4X6AC 2WAQD 4LLGA 3GTMC 4AYBL 4KN4A 2YU9K 4BBSK 1R9TC 3S1NC 1TWAK 3K7AK 3GTOC 3S16K 4A3JC 3S15K 3M4OK 3EQLA 3GTLK 3WODA 3HOUC 1I3QC 1WCMC 3H0GC 4Q4ZA 3S14C 4Y7NK 3S1QK 4A3KC 1Y1VK 2A6HA 2BE5A 4LK0A 3HKZL 4OIPA 1Y1WK 3GTGK 5IYCK 3M3YK 4MEYA 3RZOC 3S2DC 4G7HA 4OINA 4A3IC 2JA6K 2NVYC 3GTPC 2NVTC 3I4MK 4XLPA 3I4NC 4YFNA 3PO3C 4BY7K 4KMUA 4BY1C 1TWAC 2CW0A 3K7AC 3GTOK 5M5YK 3HOZK 3S1MK 5IYDK 3GTLC 3S17C 4MEXA 2JA7C 4G7ZA 2E2IK 1K83C 2JA5C 1I6VA 3GTKC 4BBRK 3H0GK 3S14K 4Y7NC 5TMFA 5M5XK 1Y1WC 4A3BC 1BDFA 4MQ9A 4ZH4A 2A6EA 3CQZK 5TMCA 2PPBA 1I50C 1TWFK 4A93C 4QJVB 4A3LC 3HOWK 5C44K 4A3IK 3S2HC 4GZYA 2R93C 2PMZD 3PO2K 4G7OA 1TWGK 4C3JK 3PO3K 4BY7C 2JA8K 5IP9C 3S17K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J K;  4JK1 A;  3DXJ A;  4QJV A;  4BBR C;  5IP7 C;  2O5I A;  1ZYR A;  4LK1 A;  2E2J C;  1I3Q K;  1WCM K;  1XPP A;  3HOY K;  1I50 K;  1IW7 A;  4Y52 C;  3S1R K;  4A3L K;  4A3E K;  5C44 C;  5M3F K;  3S2H K;  1I6H K;  2WB1 D;  5C4J K;  1TWC K;  4YFK A;  1TWG C;  4XSZ A;  1TWH C;  2E2H K;  3GTQ C;  3I4M C;  4BXX C;  2NVT K;  5C3E K;  5D4D A;  2JA8 C;  2A68 A;  4BY1 K;  4A3G K;  5C4X K;  2A69 A;  4LJZ A;  5IP7 K;  4OIO A;  2E2I C;  4XLN A;  3GTJ C;  2E2J K;  2JA5 K;  2R7Z C;  3GTK K;  5IYB K;  2VUM C;  5FJ8 K;  2PA8 L;  3S1R C;  4Y52 K;  2R92 C;  2WB1 L;  3CQZ C;  4A3C K;  4A93 K;  5M5W K;  5C4J C;  3HOX K;  1TWC C;  4BXX K;  5M3M K;  1TWH K;  4C3I K;  2E2H C;  2WAQ L;  4YG2 A;  3GTQ K;  4A3D C;  3PO2 C;  3FKI C;  2NVQ C;  4AYB D;  4OIQ A;  4A3M C;  1SFO K;  3S1N K;  2Y0S D;  1HQM A;  3S16 C;  3S15 C;  2PA8 D;  4KN7 A;  4C3H K;  5IP9 K;  3M4O C;  4Q5S A;  3RZD K;  3HOU K;  5FLM K;  1SMY A;  5IYB C;  2VUM K;  3H3V L;  4YFX A;  2B63 C;  1Y1V C;  2R92 K;  2O5J A;  3GTG C;  3HOY C;  5IYC C;  3HOV C;  3HOX C;  4A3F K;  4QIW L;  2Y0S L;  4A3E C;  1I6H C;  3GTP K;  3FKI K;  2NVQ K;  2NVX K;  3I4N K;  4A3M K;  4NOI A;  1SFO C;  3HOZ C;  5C3E C;  5IYD C;  3H3V D;  3S1M C;  4X6A K;  3GTM K;  4BBS C;  2YU9 C;  1YNJ A;  1R9T K;  2JA7 K;  3RZD C;  4A3G C;  1K83 K;  4C2M K;  4OIR A;  4QIW D;  5C4X C;  5FLM C;  1YNN A;  2B63 K;  3GTJ K;  4A3B K;  2R7Z K;  3HOV K;  1TWF C;  3S1Q C;  4A3F C;  4A3K K;  3HOW C;  4XSX A;  2R93 K;  2PMZ L;  3HKZ D;  4A3C C;  3M3Y C;  2NVX C;  3RZO K;  3S2D K;  2JA6 C;  4A3D K;  2NVY K;  4X6A C;  2WAQ D;  4LLG A;  3GTM C;  4AYB L;  4KN4 A;  2YU9 K;  4BBS K;  1R9T C;  3S1N C;  1TWA K;  3K7A K;  3GTO C;  3S16 K;  4A3J C;  3S15 K;  3M4O K;  3EQL A;  3GTL K;  3WOD A;  3HOU C;  1I3Q C;  1WCM C;  3H0G C;  4Q4Z A;  3S14 C;  4Y7N K;  3S1Q K;  4A3K C;  1Y1V K;  2A6H A;  2BE5 A;  4LK0 A;  3HKZ L;  4OIP A;  1Y1W K;  3GTG K;  5IYC K;  3M3Y K;  4MEY A;  3RZO C;  3S2D C;  4G7H A;  4OIN A;  4A3I C;  2JA6 K;  2NVY C;  3GTP C;  2NVT C;  3I4M K;  4XLP A;  3I4N C;  4YFN A;  3PO3 C;  4BY7 K;  4KMU A;  4BY1 C;  1TWA C;  2CW0 A;  3K7A C;  3GTO K;  5M5Y K;  3HOZ K;  3S1M K;  5IYD K;  3GTL C;  3S17 C;  4MEX A;  2JA7 C;  4G7Z A;  2E2I K;  1K83 C;  2JA5 C;  1I6V A;  3GTK C;  4BBR K;  3H0G K;  3S14 K;  4Y7N C;  5TMF A;  5M5X K;  1Y1W C;  4A3B C;  1BDF A;  4MQ9 A;  4ZH4 A;  2A6E A;  3CQZ K;  5TMC A;  2PPB A;  1I50 C;  1TWF K;  4A93 C;  4QJV B;  4A3L C;  3HOW K;  5C44 K;  4A3I K;  3S2H C;  4GZY A;  2R93 C;  2PMZ D;  3PO2 K;  4G7O A;  1TWG K;  4C3J K;  3PO3 K;  4BY7 C;  2JA8 K;  5IP9 C;  3S17 K; 
#chains in the Genus database with same CATH topology
 3DXJ A;  3GTK A;  4BBR C;  5IP7 C;  1ZVU A;  4GTA A;  2O5I A;  1EK8 A;  1XPP A;  3HOY K;  1I50 K;  1O28 A;  2WB1 D;  1DCO A;  4YFK A;  1TWC K;  1TWG C;  4C3J C;  1TWH C;  3GTQ C;  1TWG A;  5D4D A;  2JA8 C;  3QX3 A;  1BGW A;  4BY1 K;  4P5B A;  4A3G K;  5CHP A;  2A69 A;  4LJZ A;  1WSV A;  5IP7 K;  3GTK K;  3GTJ C;  2XCQ A;  2D6F C;  1EI6 A;  1USM A;  3BP8 C;  3ERE D;  4A3C K;  5M5W K;  3HOX K;  4FM9 A;  1TWC C;  5M3M K;  1TWH K;  3GTQ K;  4A3D C;  2WAQ L;  4YG2 A;  2NVQ C;  2RGR A;  4KAW X;  4AYB D;  1G51 A;  1ISE A;  5IP9 K;  3M4O C;  1J6W A;  3HOU K;  3GTM A;  2B63 A;  5FLM K;  3H3V L;  2B63 C;  1Y1V C;  1TWH A;  3GTQ A;  4GT9 A;  3HOX C;  4QIW L;  4A3E C;  2XCO A;  1TWA A;  2NVQ K;  2JH3 A;  4NOI A;  4P9S A;  4KB4 A;  5IYD C;  3H3V D;  1VLO A;  3GTM K;  4BBS C;  2YU9 C;  1JVI A;  4WIL A;  4QIW D;  5C4X C;  1O25 A;  5FLM C;  1IQ0 A;  1YNN A;  2B63 K;  4GTL A;  1XXC A;  3HOW C;  4XSX A;  3M3Y C;  2JA6 C;  1O26 A;  3GTM C;  4WJ4 A;  4BBS K;  1PJ7 A;  2YU9 K;  3K7A K;  4A3J C;  3S15 K;  2P5M A;  1O2F B;  3A8I A;  3WOD A;  4PAA A;  1WCM C;  2KWA A;  3H0G C;  2BE5 A;  2E2H A;  5IYC K;  4ILD A;  3M3Y K;  4G7H A;  4OIN A;  4A3I C;  2JA6 K;  2NVX A;  2GSU A;  1PJ6 A;  4BY7 K;  1XZQ B;  3HOZ K;  3K7A C;  3FKI A;  1I50 A;  4KM8 A;  2JA7 C;  1K83 C;  1ZQ1 C;  3H0G K;  1WQG A;  4A3B C;  2JA6 A;  4A93 C;  5TMC A;  1F7V A;  4RMF A;  5IOR A;  3S2H C;  4A3I K;  1X31 C;  2GAG C;  3FOE A;  4BY7 C;  1Y1W A;  3N0B A;  1WQH A;  2ZUE A;  4QJV A;  1WOO A;  1ZYR A;  2E2J C;  3T01 A;  4FZB A;  4Y52 C;  2ZUF A;  3S2H K;  4AH6 A;  2Y3P A;  1I6H K;  3A8J A;  3AQO A;  1F93 A;  4XSZ A;  4GFQ A;  3I4M C;  1JQW A;  4KAT A;  4G0V A;  4C2M C;  4XLN A;  2E2J K;  1XXA A;  2VUM C;  2PA8 L;  3AD9 C;  4Y52 K;  2CFA B;  3CQZ C;  1I3Q A;  1ZXO A;  3TTG A;  3S1N K;  1ZBS A;  1WOP A;  2PA8 D;  1WQF A;  4Q5S A;  2VUM K;  4BLB A;  2YU9 A;  4KMH A;  3HOV C;  1BS2 A;  3GTP K;  3I4N K;  4KAS A;  2R93 A;  3S1M C;  5C3E C;  3TFI A;  3AQP A;  1R9T K;  3L4K A;  1B4A A;  3BP3 A;  4OIR A;  1SFO A;  2R7Z K;  5JVO A;  1DCP A;  3HOV K;  1TWF C;  3S1Q C;  3ADA C;  2R93 K;  3IPJ A;  3OEP A;  3GTP A;  3OPF A;  2FQT A;  3H0G A;  1R9T C;  1GE9 A;  3S16 K;  3GEE A;  4BKW A;  4M1X A;  1RU0 A;  4Q4Z A;  4Y7N K;  1J98 A;  1EQR A;  3S1Q K;  1Y1W K;  3GTG K;  3AH5 A;  3BUE A;  1K83 A;  1J6X A;  4MEY A;  4XLP A;  4YFN A;  3G4C A;  4KMU A;  4BY1 C;  2CW0 A;  1WIH A;  5IOT A;  4G7Z A;  3GTK C;  1I6V A;  2ZFZ A;  4Y7N C;  5TMF A;  5M5X K;  1Y1W C;  1BDF A;  4MQ9 A;  2FQO A;  4QJV B;  4LR2 A;  2PMZ D;  3JST A;  1IBA A;  5IP9 C;  4OIQ A;  3M4O K;  4JK1 A;  3GTL A;  3FHZ A;  4LK1 A;  1I3Q K;  3S1R K;  4A3E K;  5M3F K;  5C4J K;  3GTO A;  4GTF A;  4BXX C;  2P8T A;  2E2H K;  2NVT K;  4KDD A;  3CQZ A;  5C4X K;  4C3H C;  2E2I A;  1TWF A;  2E2I C;  5TJ3 A;  2JA5 K;  3S1R C;  2R92 C;  2V6S A;  3HXA A;  1L0W A;  5C4J C;  4KC6 A;  4LOW A;  4BXX K;  3GDZ A;  3SZZ A;  2E2H C;  1WCM A;  2XCR B;  5EGE A;  3PO2 C;  5JFE A;  2V6T A;  1SFO K;  2GSN A;  4XCH A;  3S15 C;  1VRQ C;  4KN7 A;  4C3H K;  4KMD A;  3CAG A;  3RZD K;  1HI9 A;  3GEI A;  1SMY A;  1O24 A;  1F9N A;  4YFX A;  2R92 K;  2JA7 A;  3LAP A;  3HOY C;  5IYC C;  4A3F K;  1BJT A;  2NVX K;  1SFO C;  3HOZ C;  3GTG A;  1XXB A;  1O27 A;  1YNJ A;  3GIR A;  2JA7 K;  3RZD C;  4A3G C;  1K83 K;  3Q3Q A;  3GTJ K;  4A3B K;  3T02 A;  4A3F C;  2GAH C;  4A3C C;  3GEH A;  3A8K A;  2NVX C;  1XZQ A;  4BLA A;  4A3D K;  2WAQ D;  3FOF A;  4LLG A;  4G0U A;  2PHC B;  4AYB L;  4KN4 A;  3GSI A;  3HOU C;  1DD5 A;  1Y1V K;  4LK0 A;  3HKZ L;  2V6U A;  3I4M K;  3G4A A;  3PO3 C;  3TFJ A;  5IYD K;  5M5Y K;  2EBB A;  1AB4 A;  1USO A;  2NVY A;  3NUH A;  1O29 A;  1O2A A;  1IE0 A;  3AD7 C;  3CQZ K;  3L4J A;  2PPB A;  4GTE A;  1JOE A;  1KQ4 A;  4A3L C;  3HOW K;  5C44 K;  2R7Z A;  2RH6 A;  4GTD A;  3TFH A;  3PO3 K;  2GSO A;  4A3J K;  3T00 A;  4C45 A;  1WOR A;  1WCM K;  3AD8 C;  1IW7 A;  5EGH A;  1YX2 A;  4A3L K;  5C44 C;  4J3N A;  4C3I C;  2R92 A;  5C3E K;  4O2D A;  2A68 A;  1B4B A;  3MML B;  5IOS A;  1VH2 A;  1XZP B;  4OIO A;  2R7Z C;  4KMA A;  4GTC A;  5IYB K;  5FJ8 K;  2WB1 L;  4A93 K;  1EFW A;  4C3I K;  1WSR A;  4WJ3 M;  1WOS A;  3FKI C;  1VGX A;  3SZY A;  4A3M C;  3GTJ A;  2Y0S D;  1HQM A;  3S16 C;  4PAB A;  1IL2 A;  1J6V A;  1TWC A;  5IYB C;  4P5A A;  4DDQ A;  2O5J A;  3GTG C;  5E68 A;  2Y0S L;  1VJE A;  1I6H C;  3FKI K;  4KB2 A;  1PJ5 A;  2W7V A;  1YCL A;  4A3M K;  4X6A K;  5IOQ A;  3V4G A;  1Y1V A;  1INN A;  4LQY A;  3LPX A;  4C2M K;  1DCH A;  2CFA A;  5L46 A;  1V5V A;  4A3K K;  3LAJ A;  2PMZ L;  1IS1 A;  3HKZ D;  3RZO K;  3S2D K;  2NVY K;  4X6A C;  3ORE A;  3N0C A;  3S1N C;  1TWA K;  1O2B A;  3GTO C;  2VUM A;  3EQL A;  3GTL K;  4GTB A;  1I3Q C;  5CJ9 A;  5HL8 A;  3S14 C;  4A3K C;  2A6H A;  4OIP A;  4KM9 A;  3RZO C;  3S2D C;  1XZP A;  2NVY C;  3GTP C;  2NVT C;  3N3Y A;  3I4N C;  3S1M K;  1TWA C;  3GTO K;  1F7U A;  1R9T A;  3GTL C;  3S17 C;  4MEX A;  2E2I K;  2JA5 C;  1UV7 A;  4BBR K;  3S14 K;  2JA5 A;  4ZH4 A;  2A6E A;  1I50 C;  1TWF K;  2R93 C;  4GZY A;  3PO2 K;  4G7O A;  1TWG K;  4C3J K;  1EH1 A;  4KAR A;  1C0A A;  3VA7 A;  4G0W A;  2JA8 K;  3S0X A;  3S17 K; 
#chains in the Genus database with same CATH homology
 4A3J K;  4JK1 A;  3DXJ A;  4QJV A;  4BBR C;  5IP7 C;  2O5I A;  1ZYR A;  4LK1 A;  2E2J C;  1I3Q K;  1WCM K;  1XPP A;  3HOY K;  1I50 K;  1IW7 A;  4Y52 C;  3S1R K;  4A3L K;  4A3E K;  5C44 C;  5M3F K;  3S2H K;  1I6H K;  2WB1 D;  5C4J K;  1TWC K;  4YFK A;  1TWG C;  4XSZ A;  1TWH C;  2E2H K;  3GTQ C;  3I4M C;  4BXX C;  2NVT K;  5C3E K;  5D4D A;  2JA8 C;  2A68 A;  4BY1 K;  4A3G K;  5C4X K;  2A69 A;  4LJZ A;  5IP7 K;  4OIO A;  2E2I C;  4XLN A;  3GTJ C;  2E2J K;  2JA5 K;  2R7Z C;  3GTK K;  5IYB K;  2VUM C;  5FJ8 K;  2PA8 L;  3S1R C;  4Y52 K;  2R92 C;  2WB1 L;  3CQZ C;  4A3C K;  4A93 K;  5M5W K;  5C4J C;  3HOX K;  1TWC C;  4BXX K;  5M3M K;  1TWH K;  4C3I K;  2E2H C;  2WAQ L;  4YG2 A;  3GTQ K;  4A3D C;  3PO2 C;  3FKI C;  2NVQ C;  4AYB D;  4OIQ A;  4A3M C;  1SFO K;  3S1N K;  2Y0S D;  1HQM A;  3S16 C;  3S15 C;  2PA8 D;  4KN7 A;  4C3H K;  5IP9 K;  3M4O C;  4Q5S A;  3RZD K;  3HOU K;  5FLM K;  1SMY A;  5IYB C;  2VUM K;  3H3V L;  4YFX A;  2B63 C;  1Y1V C;  2R92 K;  2O5J A;  3GTG C;  3HOY C;  5IYC C;  3HOV C;  3HOX C;  4A3F K;  4QIW L;  2Y0S L;  4A3E C;  1I6H C;  3GTP K;  3FKI K;  2NVQ K;  2NVX K;  3I4N K;  4A3M K;  4NOI A;  1SFO C;  3HOZ C;  5C3E C;  5IYD C;  3H3V D;  3S1M C;  4X6A K;  3GTM K;  4BBS C;  2YU9 C;  1YNJ A;  1R9T K;  2JA7 K;  3RZD C;  4A3G C;  1K83 K;  4C2M K;  4OIR A;  4QIW D;  5C4X C;  5FLM C;  1YNN A;  2B63 K;  3GTJ K;  4A3B K;  2R7Z K;  3HOV K;  1TWF C;  3S1Q C;  4A3F C;  4A3K K;  3HOW C;  4XSX A;  2R93 K;  2PMZ L;  3HKZ D;  4A3C C;  3M3Y C;  2NVX C;  3RZO K;  3S2D K;  2JA6 C;  4A3D K;  2NVY K;  4X6A C;  2WAQ D;  4LLG A;  3GTM C;  4AYB L;  4KN4 A;  2YU9 K;  4BBS K;  1R9T C;  3S1N C;  1TWA K;  3K7A K;  3GTO C;  3S16 K;  4A3J C;  3S15 K;  3M4O K;  3EQL A;  3GTL K;  3WOD A;  3HOU C;  1I3Q C;  1WCM C;  3H0G C;  4Q4Z A;  3S14 C;  4Y7N K;  3S1Q K;  4A3K C;  1Y1V K;  2A6H A;  2BE5 A;  4LK0 A;  3HKZ L;  4OIP A;  1Y1W K;  3GTG K;  5IYC K;  3M3Y K;  4MEY A;  3RZO C;  3S2D C;  4G7H A;  4OIN A;  4A3I C;  2JA6 K;  2NVY C;  3GTP C;  2NVT C;  3I4M K;  4XLP A;  3I4N C;  4YFN A;  3PO3 C;  4BY7 K;  4KMU A;  4BY1 C;  1TWA C;  2CW0 A;  3K7A C;  3GTO K;  5M5Y K;  3HOZ K;  3S1M K;  5IYD K;  3GTL C;  3S17 C;  4MEX A;  2JA7 C;  4G7Z A;  2E2I K;  1K83 C;  2JA5 C;  1I6V A;  3GTK C;  4BBR K;  3H0G K;  3S14 K;  4Y7N C;  5TMF A;  5M5X K;  1Y1W C;  4A3B C;  1BDF A;  4MQ9 A;  4ZH4 A;  2A6E A;  3CQZ K;  5TMC A;  2PPB A;  1I50 C;  1TWF K;  4A93 C;  4QJV B;  4A3L C;  3HOW K;  5C44 K;  4A3I K;  3S2H C;  4GZY A;  2R93 C;  2PMZ D;  3PO2 K;  4G7O A;  1TWG K;  4C3J K;  3PO3 K;  4BY7 C;  2JA8 K;  5IP9 C;  3S17 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...