3H0GK

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 119
sequence length 119
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h0gK00
3RZDK 3S1RK 1XPPA 3GTPK 4BBSK 4A3GC 3GTGC 3S17K 4G7ZA 4OIQA 4OINA 1ZYRA 1TWFC 3HKZD 4BBRC 3S2HC 1Y1VC 2JA7C 2A6EA 1K83K 5TMFA 2O5IA 3GTLK 5IP7C 3I4NK 4A3LK 4A3DK 2PA8D 4YFNA 2WB1L 3HOUC 4QJVA 4A3GK 3K7AC 2E2JC 3S16C 4LK0A 4KN4A 2E2HK 4BBRK 3HOWC 3S2HK 4X6AC 1Y1VK 2JA7K 5IP7K 4A3BC 3HOYC 4BXXK 3RZOC 3M3YK 4KMUA 1TWHK 2B63C 2WAQD 4C3HK 3S14C 4LLGA 2R93C 3HOXC 2E2JK 2NVQC 3S16K 4AYBD 3HOWK 3S1MC 4A3BK 3HOYK 3RZOK 4XLPA 5TMCA 4A93C 3S2DC 2R93K 5C4JK 1I6HC 5D4DA 5C4XC 4YFKA 5IYBC 3PO2C 3S1MK 4QIWD 1BDFA 1TWAC 3GTMC 2PMZD 2YU9K 3S2DK 4A93K 4A3CK 1I6HK 5C3EC 5C4XK 4NOIA 2Y0SD 4Q4ZA 5IYDC 4A3KC 2JA5C 4OIPA 1I3QC 3GTGK 3H3VD 3PO2K 4JK1A 4BY1C 1TWFK 5M5XK 5FLMC 3GTMK 4Q5SA 4MEYA 3HKZL 5M5WK 5IYCC 5C3EK 3S1QC 3HOUK 2A69A 4A3MC 4XSXA 2JA5K 2R7ZC 3K7AK 4A3KK 2WB1D 4YFXA 5IYDK 3WODA 4XLNA 4Y7NC 4BY1K 4X6AK 3S1NC 4QJVB 3HOVC 4A3IC 4BY7C 5IYCK 3GTKC 1R9TC 2B63K 3S1QK 3S14K 3HOXK 2R7ZK 2NVQK 4C2MK 4OIOA 2WAQL 4Y7NK 4MEXA 2VUMC 2A68A 3S1NK 4G7OA 3HOVK 4A3IK 1IW7A 1R9TK 2CW0A 2PPBA 2R92C 3GTKK 1TWCC 4A3EC 1Y1WC 1YNNA 2NVTC 4G7HA 5M5YK 1TWGC 3GTQC 4ZH4A 5IYBK 2JA8C 2O5JA 1TWAK 2R92K 4YG2A 4BBSC 1YNJA 1TWCK 3DXJA 2NVTK 3H0GC 2PMZL 3GTJC 1TWGK 2JA6C 1SFOC 2PA8L 4LJZA 3GTQK 3PO3C 1I3QK 3M4OC 4GZYA 2BE5A 4A3FC 4A3DC 4A3LC 2NVXC 2Y0SL 3H3VL 5FLMK 5C44C 3CQZC 5M3FK 3H0GK 4A3MK 3GTJK 2E2HC 2JA6K 1SFOK 3GTOC 3M4OK 2E2IC 3PO3K 4Y52C 4XSZA 4A3FK 5FJ8K 2NVXK 4LK1A 4A3JC 4KN7A 3M3YC 1TWHC 4BY7K 4C3IK 5C44K 4AYBL 3CQZK 4C3JK 2A6HA 3HOZC 5IP9C 3GTOK 2E2IK 4Y52K 1I50C 4MQ9A 4OIRA 3FKIC 4A3JK 2VUMK 2NVYC 1WCMC 3S15C 3I4MC 3EQLA 5C4JC 3RZDC 3S1RC 3HOZK 5IP9K 3GTPC 1I6VA 4QIWL 1HQMA 1SMYA 4A3EK 3I4MK 3S17C 1I50K 1Y1WK 3FKIK 2NVYK 5M3MK 1WCMK 3S15K 1K83C 4BXXC 3GTLC 2YU9C 2JA8K 3I4NC 4A3CC
chains in the Genus database with same CATH superfamily
1XPPA 4BBSK 1B4BA 1J6WA 3ADAC 4AH6A 3S17K 3BP3A 4OIQA 1ZYRA 4BXXK 4A3DK 4A3LK 3GTLK 5IOTA 3FOFA 4A3GK 2CFAA 2E2JC 3V4GA 4KN4A 3SZZA 2RGRA 3S2HK 4GTFA 2JH3A 5IP7K 3RZOC 3M3YK 1TWHK 2R93C 3HOXC 1KQ4A 2KWAA 4AYBD 3HOWK 2PHCB 3SZYA 4A3BK 3HOYK 2JA5A 3GIRA 3QX3A 5IYBC 3PO2C 1TWAC 1F7VA 2R7ZA 2PMZD 3S2DK 4DDQA 3GEEA 2Y0SD 1J6XA 4A3KC 1R9TA 4Q5SA 3L4KA 5C3EK 4A3MC 3MMLB 4XSXA 4C2MC 3S0XA 4BY1K 3S1NC 1EK8A 1Y1WA 5IYCK 3AD9C 3GTQA 3S1QK 2ZUEA 1ZXOA 3HOXK 1ISEA 2WAQL 1C0AA 4A3IK 3CAGA 2JA6A 1SFOA 2ZFZA 2NVTC 1TWGC 1PJ7A 5IYBK 3CQZA 2O5JA 1XZQB 4KDDA 1TWAK 3GTOA 1TWCK 4GZYA 4LJZA 3PO3C 1EI6A 2NVXC 1BJTA 5C44C 3FKIA 2NVYA 3H0GK 4A3MK 1ZQ1C 4A3JC 1O25A 4AYBL 1O29A 2YU9A 1I50C 1O2AA 3GTGA 3EQLA 2XCRB 3T01A 5CJ9A 4XCHA 5C4JC 1Y1VA 5IP9K 2JA7A 3S17C 4KMHA 4BXXC 3I4MK 3GTLC 4J3NA 3GTPK 4A3GC 2B63A 1TWFC 3S2HC 5TMFA 1K83K 5IP7C 1O2FB 3HOUC 2V6SA 4QJVA 3K7AC 1VJEA 2EBBA 4LK0A 4BBRK 3HOWC 4A3BC 3HOYC 1G51A 2WAQD 2W7VA 3TFJA 4PAAA 1J98A 3GTMA 2GAHC 4XLPA 1XXAA 3S2DC 5C4JK 1HI9A 1WQGA 1WOPA 1EQRA 1VH2A 4KM8A 3BP8C 4GT9A 1IBAA 1JOEA 4O2DA 5C3EC 4GTEA 5EGEA 1F7UA 1BGWA 4BKWA 1F9NA 1I3QC 3GTKA 4JK1A 4BY1C 1TWFK 5M5XK 1XXBA 4MEYA 3G4CA 3HKZL 5IYCC 3G4AA 3A8JA 3S1QC 3HOUK 2VUMA 4GFQA 2JA5K 3K7AK 4XLNA 2R92A 4QJVB 4A3IC 1JQWA 1DCPA 2R7ZK 1XZQA 4MEXA 3GEHA 4BLAA 3GTJA 1R9TK 1TWCC 4C45A 4BLBA 1DCHA 4G7HA 2FQTA 3FOEA 4KM9A 4YG2A 1X31C 4FM9A 2E2IA 1WSVA 1TWHA 3H0GC 3GTQK 2GAGC 1I3QK 1B4AA 3H3VL 1INNA 3LAJA 5M3FK 1WCMA 2E2HC 2JA6K 1SFOK 3M4OK 3AH5A 4KARA 4A3FK 3IPJA 4C3HC 4C3IK 3CQZK 5IP9C 2XCQA 3GTOK 4P9SA 4GTBA 3I4MC 2FQOA 4KAWX 3HOZK 4ILDA 3GTPC 1I6VA 1IQ0A 3FKIK 2NVYK 5M3MK 1K83C 1I6HC 1USMA 4A3CC 3RZDK 4KB4A 3AD8C 4OINA 4BBRC 3HKZD 2P5MA 2R93A 2O5IA 4YFNA 2E2HK 1Y1VK 4KMDA 2JA7K 1O28A 3GSIA 1EH1A 4C3HK 4G0VA 1WSRA 3AQPA 3S14C 2NVQC 3S16K 1TWAA 3HXAA 3N3YA 3TFIA 1EFWA 1WIHA 1O2BA 5TMCA 2RH6A 1JVIA 1IS1A 2GSOA 1WOSA 3S1MK 4QIWD 1VGXA 4G0WA 1BDFA 4A93K 1I6HK 1ZVUA 4A3CK 5C4XK 3LPXA 4NOIA 2JA5C 4Q4ZA 3BUEA 3H3VD 4OIPA 4KB2A 3GTMK 2P8TA 2R7ZC 5IYDK 4GTLA 2WB1D 4YFXA 3TTGA 4BY7C 1TWGA 1R9TC 3S14K 2NVQK 3N0CA 4Y7NK 4G7OA 4LR2A 3OREA 3HOVK 1V5VA 1IW7A 4RMFA 2CW0A 2PPBA 3GTKK 5L46A 2NVXA 1Y1WC 5CHPA 2GSUA 5M5YK 3GTQC 4ZH4A 2JA8C 1XXCA 2R92K 3OEPA 1YNJA 3JSTA 3DXJA 3T00A 5HL8A 4G0UA 2JA6C 1SFOC 3M4OC 4PABA 1XZPA 2BE5A 4A3FC 5IOQA 1WOOA 1I50A 2GSNA 4C3IC 3CQZC 3ERED 3GTJK 3GTOC 4GTDA 3LAPA 3N0BA 4KN7A 4KMAA 4BY7K 5TJ3A 4C3JK 2A6HA 3HOZC 3GTLA 2E2IK 4WJ3M 2ZUFA 4Y52K 1F93A 4OIRA 3FKIC 3GEIA 1O27A 2NVYC 3A8KA 3RZDC 1TWFA 4QIWL 1HQMA 1SMYA 4KATA 5JFEA 1Y1WK 1WCMK 3S15K 2YU9C 2JA8K 3S1RK 4GTAA 3GTGC 4G7ZA 1WORA 5EGHA 1Y1VC 2JA7C 2A6EA 3I4NK 2PA8D 1GE9A 2WB1L 1XZPB 1USOA 3S16C 1L0WA 1DD5A 4X6AC 4P5BA 4KMUA 2B63C 1RU0A 3Q3QA 4LLGA 3A8IA 4WILA 2E2JK 2CFAB 3S1MC 1UV7A 3RZOK 1I3QA 4A93C 2R93K 5D4DA 5C4XC 4YFKA 1J6VA 1PJ5A 3GTMC 2YU9K 1AB4A 3AD7C 3L4JA 5E68A 5IYDC 3GTGK 3T02A 3PO2K 5FLMC 1VLOA 5M5WK 1ZBSA 2A69A 4A3KK 4WJ4A 4KC6A 3WODA 4Y7NC 4X6AK 1TWCA 1IL2A 3HOVC 3GTKC 2V6UA 2B63K 4M1XA 4LQYA 4C2MK 5IOSA 4OIOA 2D6FC 1WQHA 2A68A 4KASA 2VUMC 3S1NK 3H0GA 1YX2A 1WQFA 2R92C 4A3EC 1YNNA 1O24A 5JVOA 4P5AA 2E2HA 4BBSC 1BS2A 2NVTK 2PMZL 3GTJC 1TWGK 2PA8L 4A3DC 4FZBA 4A3LC 2V6TA 2Y3PA 5IORA 2Y0SL 5FLMK 4C3JC 1DCOA 1IE0A 2E2IC 3PO3K 4Y52C 4XSZA 5FJ8K 2NVXK 4LK1A 3GTPA 3M3YC 1TWHC 5C44K 1K83A 4GTCA 4MQ9A 3FHZA 3TFHA 4A3JK 2VUMK 1WCMC 3S15C 1PJ6A 3OPFA 3S1RC 3NUHA 4A3EK 1O26A 4LOWA 1I50K 2XCOA 3VA7A 3AQOA 1VRQC 1YCLA 3I4NC 3GDZA
chains in the Genus database with same CATH topology
3RZDK 3S1RK 1XPPA 3GTPK 4BBSK 4A3GC 3GTGC 3S17K 4G7ZA 4OIQA 4OINA 1ZYRA 1TWFC 3HKZD 4BBRC 3S2HC 1Y1VC 2JA7C 2A6EA 1K83K 5TMFA 2O5IA 3GTLK 5IP7C 3I4NK 4A3LK 4A3DK 2PA8D 4YFNA 2WB1L 3HOUC 4QJVA 4A3GK 3K7AC 2E2JC 3S16C 4LK0A 4KN4A 2E2HK 4BBRK 3HOWC 3S2HK 4X6AC 1Y1VK 2JA7K 5IP7K 4A3BC 3HOYC 4BXXK 3RZOC 3M3YK 4KMUA 1TWHK 2B63C 2WAQD 4C3HK 3S14C 4LLGA 2R93C 3HOXC 2E2JK 2NVQC 3S16K 4AYBD 3HOWK 3S1MC 4A3BK 3HOYK 3RZOK 4XLPA 5TMCA 4A93C 3S2DC 2R93K 5C4JK 1I6HC 5D4DA 5C4XC 4YFKA 5IYBC 3PO2C 3S1MK 4QIWD 1BDFA 1TWAC 3GTMC 2PMZD 2YU9K 3S2DK 4A93K 4A3CK 1I6HK 5C3EC 5C4XK 4NOIA 2Y0SD 4Q4ZA 5IYDC 4A3KC 2JA5C 4OIPA 1I3QC 3GTGK 3H3VD 3PO2K 4JK1A 4BY1C 1TWFK 5M5XK 5FLMC 3GTMK 4Q5SA 4MEYA 3HKZL 5M5WK 5IYCC 5C3EK 3S1QC 3HOUK 2A69A 4A3MC 4XSXA 2JA5K 2R7ZC 3K7AK 4A3KK 2WB1D 4YFXA 5IYDK 3WODA 4XLNA 4Y7NC 4BY1K 4X6AK 3S1NC 4QJVB 3HOVC 4A3IC 4BY7C 5IYCK 3GTKC 1R9TC 2B63K 3S1QK 3S14K 3HOXK 2R7ZK 2NVQK 4C2MK 4OIOA 2WAQL 4Y7NK 4MEXA 2VUMC 2A68A 3S1NK 4G7OA 3HOVK 4A3IK 1IW7A 1R9TK 2CW0A 2PPBA 2R92C 3GTKK 1TWCC 4A3EC 1Y1WC 1YNNA 2NVTC 4G7HA 5M5YK 1TWGC 3GTQC 4ZH4A 5IYBK 2JA8C 2O5JA 1TWAK 2R92K 4YG2A 4BBSC 1YNJA 1TWCK 3DXJA 2NVTK 3H0GC 2PMZL 3GTJC 1TWGK 2JA6C 1SFOC 2PA8L 4LJZA 3GTQK 3PO3C 1I3QK 3M4OC 4GZYA 2BE5A 4A3FC 4A3DC 4A3LC 2NVXC 2Y0SL 3H3VL 5FLMK 5C44C 3CQZC 5M3FK 3H0GK 4A3MK 3GTJK 2E2HC 2JA6K 1SFOK 3GTOC 3M4OK 2E2IC 3PO3K 4Y52C 4XSZA 4A3FK 5FJ8K 2NVXK 4LK1A 4A3JC 4KN7A 3M3YC 1TWHC 4BY7K 4C3IK 5C44K 4AYBL 3CQZK 4C3JK 2A6HA 3HOZC 5IP9C 3GTOK 2E2IK 4Y52K 1I50C 4MQ9A 4OIRA 3FKIC 4A3JK 2VUMK 2NVYC 1WCMC 3S15C 3I4MC 3EQLA 5C4JC 3RZDC 3S1RC 3HOZK 5IP9K 3GTPC 1I6VA 4QIWL 1HQMA 1SMYA 4A3EK 3I4MK 3S17C 1I50K 1Y1WK 3FKIK 2NVYK 5M3MK 1WCMK 3S15K 1K83C 4BXXC 3GTLC 2YU9C 2JA8K 3I4NC 4A3CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD K;  3S1R K;  1XPP A;  3GTP K;  4BBS K;  4A3G C;  3GTG C;  3S17 K;  4G7Z A;  4OIQ A;  4OIN A;  1ZYR A;  1TWF C;  3HKZ D;  4BBR C;  3S2H C;  1Y1V C;  2JA7 C;  2A6E A;  1K83 K;  5TMF A;  2O5I A;  3GTL K;  5IP7 C;  3I4N K;  4A3L K;  4A3D K;  2PA8 D;  4YFN A;  2WB1 L;  3HOU C;  4QJV A;  4A3G K;  3K7A C;  2E2J C;  3S16 C;  4LK0 A;  4KN4 A;  2E2H K;  4BBR K;  3HOW C;  3S2H K;  4X6A C;  1Y1V K;  2JA7 K;  5IP7 K;  4A3B C;  3HOY C;  4BXX K;  3RZO C;  3M3Y K;  4KMU A;  1TWH K;  2B63 C;  2WAQ D;  4C3H K;  3S14 C;  4LLG A;  2R93 C;  3HOX C;  2E2J K;  2NVQ C;  3S16 K;  4AYB D;  3HOW K;  3S1M C;  4A3B K;  3HOY K;  3RZO K;  4XLP A;  5TMC A;  4A93 C;  3S2D C;  2R93 K;  5C4J K;  1I6H C;  5D4D A;  5C4X C;  4YFK A;  5IYB C;  3PO2 C;  3S1M K;  4QIW D;  1BDF A;  1TWA C;  3GTM C;  2PMZ D;  2YU9 K;  3S2D K;  4A93 K;  4A3C K;  1I6H K;  5C3E C;  5C4X K;  4NOI A;  2Y0S D;  4Q4Z A;  5IYD C;  4A3K C;  2JA5 C;  4OIP A;  1I3Q C;  3GTG K;  3H3V D;  3PO2 K;  4JK1 A;  4BY1 C;  1TWF K;  5M5X K;  5FLM C;  3GTM K;  4Q5S A;  4MEY A;  3HKZ L;  5M5W K;  5IYC C;  5C3E K;  3S1Q C;  3HOU K;  2A69 A;  4A3M C;  4XSX A;  2JA5 K;  2R7Z C;  3K7A K;  4A3K K;  2WB1 D;  4YFX A;  5IYD K;  3WOD A;  4XLN A;  4Y7N C;  4BY1 K;  4X6A K;  3S1N C;  4QJV B;  3HOV C;  4A3I C;  4BY7 C;  5IYC K;  3GTK C;  1R9T C;  2B63 K;  3S1Q K;  3S14 K;  3HOX K;  2R7Z K;  2NVQ K;  4C2M K;  4OIO A;  2WAQ L;  4Y7N K;  4MEX A;  2VUM C;  2A68 A;  3S1N K;  4G7O A;  3HOV K;  4A3I K;  1IW7 A;  1R9T K;  2CW0 A;  2PPB A;  2R92 C;  3GTK K;  1TWC C;  4A3E C;  1Y1W C;  1YNN A;  2NVT C;  4G7H A;  5M5Y K;  1TWG C;  3GTQ C;  4ZH4 A;  5IYB K;  2JA8 C;  2O5J A;  1TWA K;  2R92 K;  4YG2 A;  4BBS C;  1YNJ A;  1TWC K;  3DXJ A;  2NVT K;  3H0G C;  2PMZ L;  3GTJ C;  1TWG K;  2JA6 C;  1SFO C;  2PA8 L;  4LJZ A;  3GTQ K;  3PO3 C;  1I3Q K;  3M4O C;  4GZY A;  2BE5 A;  4A3F C;  4A3D C;  4A3L C;  2NVX C;  2Y0S L;  3H3V L;  5FLM K;  5C44 C;  3CQZ C;  5M3F K;  3H0G K;  4A3M K;  3GTJ K;  2E2H C;  2JA6 K;  1SFO K;  3GTO C;  3M4O K;  2E2I C;  3PO3 K;  4Y52 C;  4XSZ A;  4A3F K;  5FJ8 K;  2NVX K;  4LK1 A;  4A3J C;  4KN7 A;  3M3Y C;  1TWH C;  4BY7 K;  4C3I K;  5C44 K;  4AYB L;  3CQZ K;  4C3J K;  2A6H A;  3HOZ C;  5IP9 C;  3GTO K;  2E2I K;  4Y52 K;  1I50 C;  4MQ9 A;  4OIR A;  3FKI C;  4A3J K;  2VUM K;  2NVY C;  1WCM C;  3S15 C;  3I4M C;  3EQL A;  5C4J C;  3RZD C;  3S1R C;  3HOZ K;  5IP9 K;  3GTP C;  1I6V A;  4QIW L;  1HQM A;  1SMY A;  4A3E K;  3I4M K;  3S17 C;  1I50 K;  1Y1W K;  3FKI K;  2NVY K;  5M3M K;  1WCM K;  3S15 K;  1K83 C;  4BXX C;  3GTL C;  2YU9 C;  2JA8 K;  3I4N C;  4A3C C; 
#chains in the Genus database with same CATH topology
 1XPP A;  4BBS K;  1B4B A;  1J6W A;  3ADA C;  4AH6 A;  3S17 K;  3BP3 A;  4OIQ A;  1ZYR A;  4BXX K;  4A3D K;  4A3L K;  3GTL K;  5IOT A;  3FOF A;  4A3G K;  2CFA A;  2E2J C;  3V4G A;  4KN4 A;  3SZZ A;  2RGR A;  3S2H K;  4GTF A;  2JH3 A;  5IP7 K;  3RZO C;  3M3Y K;  1TWH K;  2R93 C;  3HOX C;  1KQ4 A;  2KWA A;  4AYB D;  3HOW K;  2PHC B;  3SZY A;  4A3B K;  3HOY K;  2JA5 A;  3GIR A;  3QX3 A;  5IYB C;  3PO2 C;  1TWA C;  1F7V A;  2R7Z A;  2PMZ D;  3S2D K;  4DDQ A;  3GEE A;  2Y0S D;  1J6X A;  4A3K C;  1R9T A;  4Q5S A;  3L4K A;  5C3E K;  4A3M C;  3MML B;  4XSX A;  4C2M C;  3S0X A;  4BY1 K;  3S1N C;  1EK8 A;  1Y1W A;  5IYC K;  3AD9 C;  3GTQ A;  3S1Q K;  2ZUE A;  1ZXO A;  3HOX K;  1ISE A;  2WAQ L;  1C0A A;  4A3I K;  3CAG A;  2JA6 A;  1SFO A;  2ZFZ A;  2NVT C;  1TWG C;  1PJ7 A;  5IYB K;  3CQZ A;  2O5J A;  1XZQ B;  4KDD A;  1TWA K;  3GTO A;  1TWC K;  4GZY A;  4LJZ A;  3PO3 C;  1EI6 A;  2NVX C;  1BJT A;  5C44 C;  3FKI A;  2NVY A;  3H0G K;  4A3M K;  1ZQ1 C;  4A3J C;  1O25 A;  4AYB L;  1O29 A;  2YU9 A;  1I50 C;  1O2A A;  3GTG A;  3EQL A;  2XCR B;  3T01 A;  5CJ9 A;  4XCH A;  5C4J C;  1Y1V A;  5IP9 K;  2JA7 A;  3S17 C;  4KMH A;  4BXX C;  3I4M K;  3GTL C;  4J3N A;  3GTP K;  4A3G C;  2B63 A;  1TWF C;  3S2H C;  5TMF A;  1K83 K;  5IP7 C;  1O2F B;  3HOU C;  2V6S A;  4QJV A;  3K7A C;  1VJE A;  2EBB A;  4LK0 A;  4BBR K;  3HOW C;  4A3B C;  3HOY C;  1G51 A;  2WAQ D;  2W7V A;  3TFJ A;  4PAA A;  1J98 A;  3GTM A;  2GAH C;  4XLP A;  1XXA A;  3S2D C;  5C4J K;  1HI9 A;  1WQG A;  1WOP A;  1EQR A;  1VH2 A;  4KM8 A;  3BP8 C;  4GT9 A;  1IBA A;  1JOE A;  4O2D A;  5C3E C;  4GTE A;  5EGE A;  1F7U A;  1BGW A;  4BKW A;  1F9N A;  1I3Q C;  3GTK A;  4JK1 A;  4BY1 C;  1TWF K;  5M5X K;  1XXB A;  4MEY A;  3G4C A;  3HKZ L;  5IYC C;  3G4A A;  3A8J A;  3S1Q C;  3HOU K;  2VUM A;  4GFQ A;  2JA5 K;  3K7A K;  4XLN A;  2R92 A;  4QJV B;  4A3I C;  1JQW A;  1DCP A;  2R7Z K;  1XZQ A;  4MEX A;  3GEH A;  4BLA A;  3GTJ A;  1R9T K;  1TWC C;  4C45 A;  4BLB A;  1DCH A;  4G7H A;  2FQT A;  3FOE A;  4KM9 A;  4YG2 A;  1X31 C;  4FM9 A;  2E2I A;  1WSV A;  1TWH A;  3H0G C;  3GTQ K;  2GAG C;  1I3Q K;  1B4A A;  3H3V L;  1INN A;  3LAJ A;  5M3F K;  1WCM A;  2E2H C;  2JA6 K;  1SFO K;  3M4O K;  3AH5 A;  4KAR A;  4A3F K;  3IPJ A;  4C3H C;  4C3I K;  3CQZ K;  5IP9 C;  2XCQ A;  3GTO K;  4P9S A;  4GTB A;  3I4M C;  2FQO A;  4KAW X;  3HOZ K;  4ILD A;  3GTP C;  1I6V A;  1IQ0 A;  3FKI K;  2NVY K;  5M3M K;  1K83 C;  1I6H C;  1USM A;  4A3C C;  3RZD K;  4KB4 A;  3AD8 C;  4OIN A;  4BBR C;  3HKZ D;  2P5M A;  2R93 A;  2O5I A;  4YFN A;  2E2H K;  1Y1V K;  4KMD A;  2JA7 K;  1O28 A;  3GSI A;  1EH1 A;  4C3H K;  4G0V A;  1WSR A;  3AQP A;  3S14 C;  2NVQ C;  3S16 K;  1TWA A;  3HXA A;  3N3Y A;  3TFI A;  1EFW A;  1WIH A;  1O2B A;  5TMC A;  2RH6 A;  1JVI A;  1IS1 A;  2GSO A;  1WOS A;  3S1M K;  4QIW D;  1VGX A;  4G0W A;  1BDF A;  4A93 K;  1I6H K;  1ZVU A;  4A3C K;  5C4X K;  3LPX A;  4NOI A;  2JA5 C;  4Q4Z A;  3BUE A;  3H3V D;  4OIP A;  4KB2 A;  3GTM K;  2P8T A;  2R7Z C;  5IYD K;  4GTL A;  2WB1 D;  4YFX A;  3TTG A;  4BY7 C;  1TWG A;  1R9T C;  3S14 K;  2NVQ K;  3N0C A;  4Y7N K;  4G7O A;  4LR2 A;  3ORE A;  3HOV K;  1V5V A;  1IW7 A;  4RMF A;  2CW0 A;  2PPB A;  3GTK K;  5L46 A;  2NVX A;  1Y1W C;  5CHP A;  2GSU A;  5M5Y K;  3GTQ C;  4ZH4 A;  2JA8 C;  1XXC A;  2R92 K;  3OEP A;  1YNJ A;  3JST A;  3DXJ A;  3T00 A;  5HL8 A;  4G0U A;  2JA6 C;  1SFO C;  3M4O C;  4PAB A;  1XZP A;  2BE5 A;  4A3F C;  5IOQ A;  1WOO A;  1I50 A;  2GSN A;  4C3I C;  3CQZ C;  3ERE D;  3GTJ K;  3GTO C;  4GTD A;  3LAP A;  3N0B A;  4KN7 A;  4KMA A;  4BY7 K;  5TJ3 A;  4C3J K;  2A6H A;  3HOZ C;  3GTL A;  2E2I K;  4WJ3 M;  2ZUF A;  4Y52 K;  1F93 A;  4OIR A;  3FKI C;  3GEI A;  1O27 A;  2NVY C;  3A8K A;  3RZD C;  1TWF A;  4QIW L;  1HQM A;  1SMY A;  4KAT A;  5JFE A;  1Y1W K;  1WCM K;  3S15 K;  2YU9 C;  2JA8 K;  3S1R K;  4GTA A;  3GTG C;  4G7Z A;  1WOR A;  5EGH A;  1Y1V C;  2JA7 C;  2A6E A;  3I4N K;  2PA8 D;  1GE9 A;  2WB1 L;  1XZP B;  1USO A;  3S16 C;  1L0W A;  1DD5 A;  4X6A C;  4P5B A;  4KMU A;  2B63 C;  1RU0 A;  3Q3Q A;  4LLG A;  3A8I A;  4WIL A;  2E2J K;  2CFA B;  3S1M C;  1UV7 A;  3RZO K;  1I3Q A;  4A93 C;  2R93 K;  5D4D A;  5C4X C;  4YFK A;  1J6V A;  1PJ5 A;  3GTM C;  2YU9 K;  1AB4 A;  3AD7 C;  3L4J A;  5E68 A;  5IYD C;  3GTG K;  3T02 A;  3PO2 K;  5FLM C;  1VLO A;  5M5W K;  1ZBS A;  2A69 A;  4A3K K;  4WJ4 A;  4KC6 A;  3WOD A;  4Y7N C;  4X6A K;  1TWC A;  1IL2 A;  3HOV C;  3GTK C;  2V6U A;  2B63 K;  4M1X A;  4LQY A;  4C2M K;  5IOS A;  4OIO A;  2D6F C;  1WQH A;  2A68 A;  4KAS A;  2VUM C;  3S1N K;  3H0G A;  1YX2 A;  1WQF A;  2R92 C;  4A3E C;  1YNN A;  1O24 A;  5JVO A;  4P5A A;  2E2H A;  4BBS C;  1BS2 A;  2NVT K;  2PMZ L;  3GTJ C;  1TWG K;  2PA8 L;  4A3D C;  4FZB A;  4A3L C;  2V6T A;  2Y3P A;  5IOR A;  2Y0S L;  5FLM K;  4C3J C;  1DCO A;  1IE0 A;  2E2I C;  3PO3 K;  4Y52 C;  4XSZ A;  5FJ8 K;  2NVX K;  4LK1 A;  3GTP A;  3M3Y C;  1TWH C;  5C44 K;  1K83 A;  4GTC A;  4MQ9 A;  3FHZ A;  3TFH A;  4A3J K;  2VUM K;  1WCM C;  3S15 C;  1PJ6 A;  3OPF A;  3S1R C;  3NUH A;  4A3E K;  1O26 A;  4LOW A;  1I50 K;  2XCO A;  3VA7 A;  3AQO A;  1VRQ C;  1YCL A;  3I4N C;  3GDZ A; 
#chains in the Genus database with same CATH homology
 3RZD K;  3S1R K;  1XPP A;  3GTP K;  4BBS K;  4A3G C;  3GTG C;  3S17 K;  4G7Z A;  4OIQ A;  4OIN A;  1ZYR A;  1TWF C;  3HKZ D;  4BBR C;  3S2H C;  1Y1V C;  2JA7 C;  2A6E A;  1K83 K;  5TMF A;  2O5I A;  3GTL K;  5IP7 C;  3I4N K;  4A3L K;  4A3D K;  2PA8 D;  4YFN A;  2WB1 L;  3HOU C;  4QJV A;  4A3G K;  3K7A C;  2E2J C;  3S16 C;  4LK0 A;  4KN4 A;  2E2H K;  4BBR K;  3HOW C;  3S2H K;  4X6A C;  1Y1V K;  2JA7 K;  5IP7 K;  4A3B C;  3HOY C;  4BXX K;  3RZO C;  3M3Y K;  4KMU A;  1TWH K;  2B63 C;  2WAQ D;  4C3H K;  3S14 C;  4LLG A;  2R93 C;  3HOX C;  2E2J K;  2NVQ C;  3S16 K;  4AYB D;  3HOW K;  3S1M C;  4A3B K;  3HOY K;  3RZO K;  4XLP A;  5TMC A;  4A93 C;  3S2D C;  2R93 K;  5C4J K;  1I6H C;  5D4D A;  5C4X C;  4YFK A;  5IYB C;  3PO2 C;  3S1M K;  4QIW D;  1BDF A;  1TWA C;  3GTM C;  2PMZ D;  2YU9 K;  3S2D K;  4A93 K;  4A3C K;  1I6H K;  5C3E C;  5C4X K;  4NOI A;  2Y0S D;  4Q4Z A;  5IYD C;  4A3K C;  2JA5 C;  4OIP A;  1I3Q C;  3GTG K;  3H3V D;  3PO2 K;  4JK1 A;  4BY1 C;  1TWF K;  5M5X K;  5FLM C;  3GTM K;  4Q5S A;  4MEY A;  3HKZ L;  5M5W K;  5IYC C;  5C3E K;  3S1Q C;  3HOU K;  2A69 A;  4A3M C;  4XSX A;  2JA5 K;  2R7Z C;  3K7A K;  4A3K K;  2WB1 D;  4YFX A;  5IYD K;  3WOD A;  4XLN A;  4Y7N C;  4BY1 K;  4X6A K;  3S1N C;  4QJV B;  3HOV C;  4A3I C;  4BY7 C;  5IYC K;  3GTK C;  1R9T C;  2B63 K;  3S1Q K;  3S14 K;  3HOX K;  2R7Z K;  2NVQ K;  4C2M K;  4OIO A;  2WAQ L;  4Y7N K;  4MEX A;  2VUM C;  2A68 A;  3S1N K;  4G7O A;  3HOV K;  4A3I K;  1IW7 A;  1R9T K;  2CW0 A;  2PPB A;  2R92 C;  3GTK K;  1TWC C;  4A3E C;  1Y1W C;  1YNN A;  2NVT C;  4G7H A;  5M5Y K;  1TWG C;  3GTQ C;  4ZH4 A;  5IYB K;  2JA8 C;  2O5J A;  1TWA K;  2R92 K;  4YG2 A;  4BBS C;  1YNJ A;  1TWC K;  3DXJ A;  2NVT K;  3H0G C;  2PMZ L;  3GTJ C;  1TWG K;  2JA6 C;  1SFO C;  2PA8 L;  4LJZ A;  3GTQ K;  3PO3 C;  1I3Q K;  3M4O C;  4GZY A;  2BE5 A;  4A3F C;  4A3D C;  4A3L C;  2NVX C;  2Y0S L;  3H3V L;  5FLM K;  5C44 C;  3CQZ C;  5M3F K;  3H0G K;  4A3M K;  3GTJ K;  2E2H C;  2JA6 K;  1SFO K;  3GTO C;  3M4O K;  2E2I C;  3PO3 K;  4Y52 C;  4XSZ A;  4A3F K;  5FJ8 K;  2NVX K;  4LK1 A;  4A3J C;  4KN7 A;  3M3Y C;  1TWH C;  4BY7 K;  4C3I K;  5C44 K;  4AYB L;  3CQZ K;  4C3J K;  2A6H A;  3HOZ C;  5IP9 C;  3GTO K;  2E2I K;  4Y52 K;  1I50 C;  4MQ9 A;  4OIR A;  3FKI C;  4A3J K;  2VUM K;  2NVY C;  1WCM C;  3S15 C;  3I4M C;  3EQL A;  5C4J C;  3RZD C;  3S1R C;  3HOZ K;  5IP9 K;  3GTP C;  1I6V A;  4QIW L;  1HQM A;  1SMY A;  4A3E K;  3I4M K;  3S17 C;  1I50 K;  1Y1W K;  3FKI K;  2NVY K;  5M3M K;  1WCM K;  3S15 K;  1K83 C;  4BXX C;  3GTL C;  2YU9 C;  2JA8 K;  3I4N C;  4A3C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...