3H0GK

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
b'MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 119
sequence length 119
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h0gK00
4A3GK 2JA6C 1WCMK 1ZYRA 3GTLK 2R7ZK 3GTJK 3HOYC 4LK1A 5FLMK 1I6HK 5C4JK 2PA8L 4NOIA 4QJVA 4G7ZA 4A93K 4A3BC 1Y1WC 2WB1L 4MEXA 3RZDC 5IYCK 3S1RK 3GTMK 5FJ8K 4OIRA 3S1QK 4Y7NC 2B63C 1K83C 4A3LC 2A68A 5TMFA 4C3IK 2JA6K 4GZYA 4QIWL 3HOUC 3H3VD 4BBSC 4OIQA 3HOYK 1Y1VC 2A6HA 4YFXA 4G7HA 4LJZA 4A3BK 1Y1WK 4JK1A 3S2DC 2E2HC 3PO3C 4G7OA 3RZDK 2NVTC 4Y7NK 2PA8D 1K83K 2B63K 4A3LK 5M3FK 2WB1D 3S16K 4YG2A 3HOUK 1YNNA 5M5WK 1HQMA 1TWHC 4Q4ZA 2PMZL 2NVXC 4BBSK 1Y1VK 4A3MC 3GTPC 4QIWD 4AYBL 3S2DK 2E2HK 2NVTK 1BDFA 3HOZC 4BBRC 1IW7A 3H0GC 2CW0A 4OINA 2O5JA 2BE5A 4A3KC 4Y52C 3I4MC 1TWFC 3S15C 2NVXK 1TWHK 5IYDC 3GTGC 1YNJA 5D4DA 4A3MK 3HOVC 3GTPK 4A3DC 2Y0SL 3DXJA 1TWCC 4MEYA 1SMYA 2NVYC 2PMZD 3S1MC 2WAQL 3HOZK 4LLGA 4BBRK 3H0GK 5M5YK 4X6AC 4AYBD 4Y52K 1R9TC 3I4MK 5C4XC 4KMUA 4C2MK 2JA8C 3GTGK 4OIOA 3EQLA 3GTOC 4KN7A 3S15K 5IYDK 4LK0A 3S14C 3HOVK 3GTQC 2A6EA 4A3DK 4A3JC 4Q5SA 1TWCK 3S1NC 4XLPA 3WODA 3HOXC 2NVYK 3CQZC 1TWAC 4ZH4A 5IP9C 4C3JK 3S1MK 4A3CC 2R93C 4OIPA 3PO3K 2Y0SD 4X6AK 4BY1C 2E2JC 4A3IC 3M4OC 1I3QC 1R9TK 4MQ9A 3HKZL 5C4XK 2WAQD 2JA8K 2R7ZC 3S17C 1TWGC 3M3YC 2A69A 2YU9C 3S14K 3GTQK 4A3JK 4XSXA 2PPBA 3I4NC 1I50C 4A93C 1XPPA 3CQZK 1TWAK 3GTKC 5IP9K 3PO2C 4A3CK 2E2IC 2R93K 5M3MK 4BY1K 2O5IA 5IYBC 2E2JK 4A3FC 4A3IK 4A3EC 1I3QK 3M4OK 4BXXC 2VUMC 4A3KK 5M5XK 3S17K 1TWGK 3M3YK 1TWFK 2YU9K 4XLNA 3RZOC 2R92C 3HKZD 3I4NK 1I50K 3S2HC 2JA5C 3GTKK 1I6VA 3PO2K 5C3EC 2E2IK 4BY7C 4C3HK 3K7AC 2JA7C 5IP7C 1SFOC 5IYBK 3FKIC 4A3FK 4BXXK 4A3EK 3S16C 4YFKA 5TMCA 5C44C 2VUMK 3HOWC 2NVQC 4A3GC 1WCMC 3GTLC 3GTOK 3RZOK 2R92K 3GTJC 3S2HK 4KN4A 5FLMC 2JA5K 1I6HC 5C4JC 5C3EK 3S1NK 3HOXK 4BY7K 4XSZA 3K7AK 2JA7K 5IP7K 1SFOK 3S1RC 3FKIK 4YFNA 5IYCC 3GTMC 4QJVB 3H3VL 3S1QC 5C44K 3HOWK 2NVQK
chains in the Genus database with same CATH superfamily
1ZBSA 2JA6C 3GTLK 2FQOA 3LAJA 2V6SA 4LK1A 5FLMK 3SZZA 4QJVA 2GAGC 4A93K 1ZXOA 5IYCK 3V4GA 4A3LC 2A68A 1O2BA 4C3IK 5E68A 4GT9A 3GTPA 4BBSC 1USMA 2V6UA 1EH1A 4G0WA 3L4JA 1XZQB 4JK1A 2RH6A 1ZQ1C 2B63K 1B4AA 1WQHA 4YG2A 1XXBA 1TWHC 4Q4ZA 1XZQA 1WSRA 1HI9A 2E2HK 1VGXA 3GEEA 1IW7A 2CW0A 1TWFC 3S15C 3GTGC 5D4DA 3DXJA 3GIRA 4WILA 2WAQL 3HOZK 1I3QA 2PHCB 3AD9C 4AYBD 4Y52K 5C4XC 5IYDK 2XCRB 1UV7A 4LK0A 3QX3A 4KASA 1TWCK 3S0XA 3CQZC 1TWAC 5IP9C 4AH6A 1X31C 4OIPA 2Y0SD 4X6AK 1JQWA 4GTDA 3IPJA 2JA8K 5JVOA 3N0CA 3T02A 1TWGC 1DCOA 4A3JK 3BP3A 4KMAA 4P9SA 3AQPA 1XPPA 1SFOA 3TFJA 3G4AA 2E2JK 4A3FC 4BXXC 4A3EC 4GTAA 3M4OK 3GTLA 3A8IA 3S17K 2YU9K 4GTBA 3LAPA 4GFQA 2R92C 3HKZD 3I4NK 1O27A 2JA5C 3GTKK 1O28A 1AB4A 5EGEA 4YFKA 5C44C 2NVQC 4GTCA 1WOPA 3GDZA 2CFAB 5C3EK 1F7UA 3GEIA 3K7AK 4XSZA 5IP7K 2B63A 3S1RC 3FKIK 3H3VL 3TFIA 4A3GK 1WCMK 3MMLB 2CFAA 3GTJK 4RMFA 5C4JK 2E2HA 2PA8L 3RZDC 3GTMK 4OIRA 3S1QK 1PJ5A 2JA6K 3HOUC 1VH2A 1Y1VC 2A6HA 4YFXA 1BJTA 3ERED 4G7OA 2NVTC 4WJ3M 3FOFA 4A3LK 4G0UA 1DD5A 5IOQA 5M3FK 2WB1D 2NVXC 4BBSK 2PMZL 1TWCA 4G0VA 1XXAA 4QIWD 5HL8A 1VLOA 4KDDA 4OINA 4KM9A 4A3KC 1BGWA 1WQFA 1TWHK 4XCHA 1IQ0A 4A3DC 4MEYA 2XCOA 4KM8A 4C3JC 2NVYC 2P8TA 4BLAA 1ZVUA 4LLGA 1XZPB 2R7ZA 1J6XA 1VJEA 2YU9A 3S15K 3GTOC 2GSNA 3GTGK 3Q3QA 4LR2A 3GTKA 4Q5SA 1XZPA 3WODA 3HOXC 4A3CC 2R93C 2GSOA 3PO3K 4BY1C 3FHZA 3N0BA 4A3IC 4MQ9A 5C4XK 2GSUA 3G4CA 3M3YC 1J6VA 3A8KA 5TJ3A 2PPBA 4A93C 1I50C 3CQZK 1TWAK 5IP9K 2E2IC 3FKIA 5M3MK 4P5BA 5IYBC 1BS2A 1O29A 1INNA 1WCMA 2VUMC 2W7VA 4BLBA 4GTFA 1TWGK 3GTJA 1IE0A 3RZOC 1DCHA 3S2HC 4GTLA 4BKWA 3GTMA 4BY7C 2JA7C 4LQYA 4A3FK 4BXXK 4A3EK 3S16C 1V5VA 5TMCA 2JA6A 3HOWC 4J3NA 1J98A 2R92K 4KN4A 2JA5K 1I6HC 3S1NK 5C44K 2NVQK 2GAHC 1ISEA 1WIHA 5IOTA 1F93A 2R7ZK 4ILDA 3HOYC 1PJ6A 4NOIA 4G7ZA 4A3BC 1Y1WC 4KMHA 3CAGA 3S1RK 2ZUFA 3AQOA 5FJ8K 4Y7NC 1K83C 5JFEA 3NUHA 1TWHA 3GSIA 2JH3A 2XCQA 4G7HA 4LJZA 3S2DC 5IORA 3RZDK 1WSVA 1TWFA 3BP8C 4KB2A 3GTGA 3HOUK 4LOWA 5M5WK 1HQMA 4O2DA 1I50A 1IBAA 4KAWX 3AD7C 1Y1VK 4A3MC 3GTPC 4GTEA 1F7VA 4AYBL 2NVTK 2VUMA 4KC6A 1IL2A 4BBRC 3H0GC 2O5JA 2BE5A 3OREA 1WORA 3I4MC 4C2MC 2NVXK 1YNJA 3HOVC 3CQZA 1TWAA 2Y0SL 1O25A 1GE9A 3A8JA 3S1MC 3SZYA 5M5YK 1O24A 1TWGA 1R9TC 4OIOA 3EQLA 3T00A 3S14C 3GTQC 4A3DK 2NVYK 4ZH4A 4C3JK 4C45A 3AH5A 1I3QC 3HKZL 2WAQD 1WOSA 1EFWA 2A69A 2R92A 2JA5A 4FZBA 1Y1WA 3ADAC 3PO2C 4A3CK 1K83A 2R93K 4C3HC 4BY1K 1O2AA 2KWAA 4A3IK 4PAAA 5M5XK 1J6WA 5CHPA 3M3YK 1TWFK 1EQRA 4PABA 1I50K 3OEPA 2E2IK 4WJ4A 1YCLA 1SFOC 5IYBK 3JSTA 3LPXA 2VUMK 3GTLC 1WQGA 3RZOK 3S2HK 5FLMC 3H0GA 1XXCA 4BY7K 2JA7K 5CJ9A 5IYCC 3S16K 3HOWK 3FOEA 4C3IC 1ZYRA 1Y1VA 1USOA 1I6HK 1JOEA 5EGHA 3GEHA 2V6TA 1WOOA 2WB1L 1R9TA 4MEXA 1G51A 2B63C 5TMFA 2NVXA 3GTQA 4GZYA 3HXAA 3AD8C 4QIWL 3H3VD 4OIQA 3HOYK 2D6FC 4A3BK 1Y1WK 2E2HC 3PO3C 5L46A 3OPFA 1C0AA 4Y7NK 2PA8D 1K83K 2P5MA 3VA7A 1YNNA 1O26A 2NVYA 3S2DK 1BDFA 3HOZC 3GTOA 4Y52C 5IYDC 4DDQA 4A3MK 3GTPK 1TWCC 2R93A 1SMYA 5IOSA 2PMZD 1F9NA 3N3YA 4BBRK 3H0GK 1VRQC 4X6AC 4P5AA 3I4MK 3T01A 4KMUA 4C2MK 2JA8C 3TTGA 4KN7A 3L4KA 3HOVK 2A6EA 4A3JC 2RGRA 2E2IA 3S1NC 4XLPA 3S1MK 1KQ4A 1O2FB 4FM9A 1IS1A 3TFHA 2FQTA 2E2JC 3M4OC 4KB4A 1R9TK 2R7ZC 3S17C 2YU9C 2ZFZA 3S14K 3GTQK 4XSXA 3I4NC 3GTKC 2JA7A 1DCPA 2O5IA 1I3QK 4KARA 4A3KK 4XLNA 2Y3PA 4M1XA 1I6VA 3PO2K 5C3EC 1JVIA 3K7AC 4C3HK 5IP7C 3FKIC 1PJ7A 4KMDA 4A3GC 1EK8A 1RU0A 1WCMC 3GTOK 1YX2A 4KATA 3GTJC 1B4BA 1L0WA 5C4JC 3HOXK 1SFOK 4YFNA 3GTMC 2EBBA 1EI6A 3BUEA 4QJVB 3S1QC 2ZUEA
chains in the Genus database with same CATH topology
4A3GK 2JA6C 1WCMK 1ZYRA 3GTLK 2R7ZK 3GTJK 3HOYC 4LK1A 5FLMK 1I6HK 5C4JK 2PA8L 4NOIA 4QJVA 4G7ZA 4A93K 4A3BC 1Y1WC 2WB1L 4MEXA 3RZDC 5IYCK 3S1RK 3GTMK 5FJ8K 4OIRA 3S1QK 4Y7NC 2B63C 1K83C 4A3LC 2A68A 5TMFA 4C3IK 2JA6K 4GZYA 4QIWL 3HOUC 3H3VD 4BBSC 4OIQA 3HOYK 1Y1VC 2A6HA 4YFXA 4G7HA 4LJZA 4A3BK 1Y1WK 4JK1A 3S2DC 2E2HC 3PO3C 4G7OA 3RZDK 2NVTC 4Y7NK 2PA8D 1K83K 2B63K 4A3LK 5M3FK 2WB1D 3S16K 4YG2A 3HOUK 1YNNA 5M5WK 1HQMA 1TWHC 4Q4ZA 2PMZL 2NVXC 4BBSK 1Y1VK 4A3MC 3GTPC 4QIWD 4AYBL 3S2DK 2E2HK 2NVTK 1BDFA 3HOZC 4BBRC 1IW7A 3H0GC 2CW0A 4OINA 2O5JA 2BE5A 4A3KC 4Y52C 3I4MC 1TWFC 3S15C 2NVXK 1TWHK 5IYDC 3GTGC 1YNJA 5D4DA 4A3MK 3HOVC 3GTPK 4A3DC 2Y0SL 3DXJA 1TWCC 4MEYA 1SMYA 2NVYC 2PMZD 3S1MC 2WAQL 3HOZK 4LLGA 4BBRK 3H0GK 5M5YK 4X6AC 4AYBD 4Y52K 1R9TC 3I4MK 5C4XC 4KMUA 4C2MK 2JA8C 3GTGK 4OIOA 3EQLA 3GTOC 4KN7A 3S15K 5IYDK 4LK0A 3S14C 3HOVK 3GTQC 2A6EA 4A3DK 4A3JC 4Q5SA 1TWCK 3S1NC 4XLPA 3WODA 3HOXC 2NVYK 3CQZC 1TWAC 4ZH4A 5IP9C 4C3JK 3S1MK 4A3CC 2R93C 4OIPA 3PO3K 2Y0SD 4X6AK 4BY1C 2E2JC 4A3IC 3M4OC 1I3QC 1R9TK 4MQ9A 3HKZL 5C4XK 2WAQD 2JA8K 2R7ZC 3S17C 1TWGC 3M3YC 2A69A 2YU9C 3S14K 3GTQK 4A3JK 4XSXA 2PPBA 3I4NC 1I50C 4A93C 1XPPA 3CQZK 1TWAK 3GTKC 5IP9K 3PO2C 4A3CK 2E2IC 2R93K 5M3MK 4BY1K 2O5IA 5IYBC 2E2JK 4A3FC 4A3IK 4A3EC 1I3QK 3M4OK 4BXXC 2VUMC 4A3KK 5M5XK 3S17K 1TWGK 3M3YK 1TWFK 2YU9K 4XLNA 3RZOC 2R92C 3HKZD 3I4NK 1I50K 3S2HC 2JA5C 3GTKK 1I6VA 3PO2K 5C3EC 2E2IK 4BY7C 4C3HK 3K7AC 2JA7C 5IP7C 1SFOC 5IYBK 3FKIC 4A3FK 4BXXK 4A3EK 3S16C 4YFKA 5TMCA 5C44C 2VUMK 3HOWC 2NVQC 4A3GC 1WCMC 3GTLC 3GTOK 3RZOK 2R92K 3GTJC 3S2HK 4KN4A 5FLMC 2JA5K 1I6HC 5C4JC 5C3EK 3S1NK 3HOXK 4BY7K 4XSZA 3K7AK 2JA7K 5IP7K 1SFOK 3S1RC 3FKIK 4YFNA 5IYCC 3GTMC 4QJVB 3H3VL 3S1QC 5C44K 3HOWK 2NVQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G K;  2JA6 C;  1WCM K;  1ZYR A;  3GTL K;  2R7Z K;  3GTJ K;  3HOY C;  4LK1 A;  5FLM K;  1I6H K;  5C4J K;  2PA8 L;  4NOI A;  4QJV A;  4G7Z A;  4A93 K;  4A3B C;  1Y1W C;  2WB1 L;  4MEX A;  3RZD C;  5IYC K;  3S1R K;  3GTM K;  5FJ8 K;  4OIR A;  3S1Q K;  4Y7N C;  2B63 C;  1K83 C;  4A3L C;  2A68 A;  5TMF A;  4C3I K;  2JA6 K;  4GZY A;  4QIW L;  3HOU C;  3H3V D;  4BBS C;  4OIQ A;  3HOY K;  1Y1V C;  2A6H A;  4YFX A;  4G7H A;  4LJZ A;  4A3B K;  1Y1W K;  4JK1 A;  3S2D C;  2E2H C;  3PO3 C;  4G7O A;  3RZD K;  2NVT C;  4Y7N K;  2PA8 D;  1K83 K;  2B63 K;  4A3L K;  5M3F K;  2WB1 D;  3S16 K;  4YG2 A;  3HOU K;  1YNN A;  5M5W K;  1HQM A;  1TWH C;  4Q4Z A;  2PMZ L;  2NVX C;  4BBS K;  1Y1V K;  4A3M C;  3GTP C;  4QIW D;  4AYB L;  3S2D K;  2E2H K;  2NVT K;  1BDF A;  3HOZ C;  4BBR C;  1IW7 A;  3H0G C;  2CW0 A;  4OIN A;  2O5J A;  2BE5 A;  4A3K C;  4Y52 C;  3I4M C;  1TWF C;  3S15 C;  2NVX K;  1TWH K;  5IYD C;  3GTG C;  1YNJ A;  5D4D A;  4A3M K;  3HOV C;  3GTP K;  4A3D C;  2Y0S L;  3DXJ A;  1TWC C;  4MEY A;  1SMY A;  2NVY C;  2PMZ D;  3S1M C;  2WAQ L;  3HOZ K;  4LLG A;  4BBR K;  3H0G K;  5M5Y K;  4X6A C;  4AYB D;  4Y52 K;  1R9T C;  3I4M K;  5C4X C;  4KMU A;  4C2M K;  2JA8 C;  3GTG K;  4OIO A;  3EQL A;  3GTO C;  4KN7 A;  3S15 K;  5IYD K;  4LK0 A;  3S14 C;  3HOV K;  3GTQ C;  2A6E A;  4A3D K;  4A3J C;  4Q5S A;  1TWC K;  3S1N C;  4XLP A;  3WOD A;  3HOX C;  2NVY K;  3CQZ C;  1TWA C;  4ZH4 A;  5IP9 C;  4C3J K;  3S1M K;  4A3C C;  2R93 C;  4OIP A;  3PO3 K;  2Y0S D;  4X6A K;  4BY1 C;  2E2J C;  4A3I C;  3M4O C;  1I3Q C;  1R9T K;  4MQ9 A;  3HKZ L;  5C4X K;  2WAQ D;  2JA8 K;  2R7Z C;  3S17 C;  1TWG C;  3M3Y C;  2A69 A;  2YU9 C;  3S14 K;  3GTQ K;  4A3J K;  4XSX A;  2PPB A;  3I4N C;  1I50 C;  4A93 C;  1XPP A;  3CQZ K;  1TWA K;  3GTK C;  5IP9 K;  3PO2 C;  4A3C K;  2E2I C;  2R93 K;  5M3M K;  4BY1 K;  2O5I A;  5IYB C;  2E2J K;  4A3F C;  4A3I K;  4A3E C;  1I3Q K;  3M4O K;  4BXX C;  2VUM C;  4A3K K;  5M5X K;  3S17 K;  1TWG K;  3M3Y K;  1TWF K;  2YU9 K;  4XLN A;  3RZO C;  2R92 C;  3HKZ D;  3I4N K;  1I50 K;  3S2H C;  2JA5 C;  3GTK K;  1I6V A;  3PO2 K;  5C3E C;  2E2I K;  4BY7 C;  4C3H K;  3K7A C;  2JA7 C;  5IP7 C;  1SFO C;  5IYB K;  3FKI C;  4A3F K;  4BXX K;  4A3E K;  3S16 C;  4YFK A;  5TMC A;  5C44 C;  2VUM K;  3HOW C;  2NVQ C;  4A3G C;  1WCM C;  3GTL C;  3GTO K;  3RZO K;  2R92 K;  3GTJ C;  3S2H K;  4KN4 A;  5FLM C;  2JA5 K;  1I6H C;  5C4J C;  5C3E K;  3S1N K;  3HOX K;  4BY7 K;  4XSZ A;  3K7A K;  2JA7 K;  5IP7 K;  1SFO K;  3S1R C;  3FKI K;  4YFN A;  5IYC C;  3GTM C;  4QJV B;  3H3V L;  3S1Q C;  5C44 K;  3HOW K;  2NVQ K; 
#chains in the Genus database with same CATH topology
 1ZBS A;  2JA6 C;  3GTL K;  2FQO A;  3LAJ A;  2V6S A;  4LK1 A;  5FLM K;  3SZZ A;  4QJV A;  2GAG C;  4A93 K;  1ZXO A;  5IYC K;  3V4G A;  4A3L C;  2A68 A;  1O2B A;  4C3I K;  5E68 A;  4GT9 A;  3GTP A;  4BBS C;  1USM A;  2V6U A;  1EH1 A;  4G0W A;  3L4J A;  1XZQ B;  4JK1 A;  2RH6 A;  1ZQ1 C;  2B63 K;  1B4A A;  1WQH A;  4YG2 A;  1XXB A;  1TWH C;  4Q4Z A;  1XZQ A;  1WSR A;  1HI9 A;  2E2H K;  1VGX A;  3GEE A;  1IW7 A;  2CW0 A;  1TWF C;  3S15 C;  3GTG C;  5D4D A;  3DXJ A;  3GIR A;  4WIL A;  2WAQ L;  3HOZ K;  1I3Q A;  2PHC B;  3AD9 C;  4AYB D;  4Y52 K;  5C4X C;  5IYD K;  2XCR B;  1UV7 A;  4LK0 A;  3QX3 A;  4KAS A;  1TWC K;  3S0X A;  3CQZ C;  1TWA C;  5IP9 C;  4AH6 A;  1X31 C;  4OIP A;  2Y0S D;  4X6A K;  1JQW A;  4GTD A;  3IPJ A;  2JA8 K;  5JVO A;  3N0C A;  3T02 A;  1TWG C;  1DCO A;  4A3J K;  3BP3 A;  4KMA A;  4P9S A;  3AQP A;  1XPP A;  1SFO A;  3TFJ A;  3G4A A;  2E2J K;  4A3F C;  4BXX C;  4A3E C;  4GTA A;  3M4O K;  3GTL A;  3A8I A;  3S17 K;  2YU9 K;  4GTB A;  3LAP A;  4GFQ A;  2R92 C;  3HKZ D;  3I4N K;  1O27 A;  2JA5 C;  3GTK K;  1O28 A;  1AB4 A;  5EGE A;  4YFK A;  5C44 C;  2NVQ C;  4GTC A;  1WOP A;  3GDZ A;  2CFA B;  5C3E K;  1F7U A;  3GEI A;  3K7A K;  4XSZ A;  5IP7 K;  2B63 A;  3S1R C;  3FKI K;  3H3V L;  3TFI A;  4A3G K;  1WCM K;  3MML B;  2CFA A;  3GTJ K;  4RMF A;  5C4J K;  2E2H A;  2PA8 L;  3RZD C;  3GTM K;  4OIR A;  3S1Q K;  1PJ5 A;  2JA6 K;  3HOU C;  1VH2 A;  1Y1V C;  2A6H A;  4YFX A;  1BJT A;  3ERE D;  4G7O A;  2NVT C;  4WJ3 M;  3FOF A;  4A3L K;  4G0U A;  1DD5 A;  5IOQ A;  5M3F K;  2WB1 D;  2NVX C;  4BBS K;  2PMZ L;  1TWC A;  4G0V A;  1XXA A;  4QIW D;  5HL8 A;  1VLO A;  4KDD A;  4OIN A;  4KM9 A;  4A3K C;  1BGW A;  1WQF A;  1TWH K;  4XCH A;  1IQ0 A;  4A3D C;  4MEY A;  2XCO A;  4KM8 A;  4C3J C;  2NVY C;  2P8T A;  4BLA A;  1ZVU A;  4LLG A;  1XZP B;  2R7Z A;  1J6X A;  1VJE A;  2YU9 A;  3S15 K;  3GTO C;  2GSN A;  3GTG K;  3Q3Q A;  4LR2 A;  3GTK A;  4Q5S A;  1XZP A;  3WOD A;  3HOX C;  4A3C C;  2R93 C;  2GSO A;  3PO3 K;  4BY1 C;  3FHZ A;  3N0B A;  4A3I C;  4MQ9 A;  5C4X K;  2GSU A;  3G4C A;  3M3Y C;  1J6V A;  3A8K A;  5TJ3 A;  2PPB A;  4A93 C;  1I50 C;  3CQZ K;  1TWA K;  5IP9 K;  2E2I C;  3FKI A;  5M3M K;  4P5B A;  5IYB C;  1BS2 A;  1O29 A;  1INN A;  1WCM A;  2VUM C;  2W7V A;  4BLB A;  4GTF A;  1TWG K;  3GTJ A;  1IE0 A;  3RZO C;  1DCH A;  3S2H C;  4GTL A;  4BKW A;  3GTM A;  4BY7 C;  2JA7 C;  4LQY A;  4A3F K;  4BXX K;  4A3E K;  3S16 C;  1V5V A;  5TMC A;  2JA6 A;  3HOW C;  4J3N A;  1J98 A;  2R92 K;  4KN4 A;  2JA5 K;  1I6H C;  3S1N K;  5C44 K;  2NVQ K;  2GAH C;  1ISE A;  1WIH A;  5IOT A;  1F93 A;  2R7Z K;  4ILD A;  3HOY C;  1PJ6 A;  4NOI A;  4G7Z A;  4A3B C;  1Y1W C;  4KMH A;  3CAG A;  3S1R K;  2ZUF A;  3AQO A;  5FJ8 K;  4Y7N C;  1K83 C;  5JFE A;  3NUH A;  1TWH A;  3GSI A;  2JH3 A;  2XCQ A;  4G7H A;  4LJZ A;  3S2D C;  5IOR A;  3RZD K;  1WSV A;  1TWF A;  3BP8 C;  4KB2 A;  3GTG A;  3HOU K;  4LOW A;  5M5W K;  1HQM A;  4O2D A;  1I50 A;  1IBA A;  4KAW X;  3AD7 C;  1Y1V K;  4A3M C;  3GTP C;  4GTE A;  1F7V A;  4AYB L;  2NVT K;  2VUM A;  4KC6 A;  1IL2 A;  4BBR C;  3H0G C;  2O5J A;  2BE5 A;  3ORE A;  1WOR A;  3I4M C;  4C2M C;  2NVX K;  1YNJ A;  3HOV C;  3CQZ A;  1TWA A;  2Y0S L;  1O25 A;  1GE9 A;  3A8J A;  3S1M C;  3SZY A;  5M5Y K;  1O24 A;  1TWG A;  1R9T C;  4OIO A;  3EQL A;  3T00 A;  3S14 C;  3GTQ C;  4A3D K;  2NVY K;  4ZH4 A;  4C3J K;  4C45 A;  3AH5 A;  1I3Q C;  3HKZ L;  2WAQ D;  1WOS A;  1EFW A;  2A69 A;  2R92 A;  2JA5 A;  4FZB A;  1Y1W A;  3ADA C;  3PO2 C;  4A3C K;  1K83 A;  2R93 K;  4C3H C;  4BY1 K;  1O2A A;  2KWA A;  4A3I K;  4PAA A;  5M5X K;  1J6W A;  5CHP A;  3M3Y K;  1TWF K;  1EQR A;  4PAB A;  1I50 K;  3OEP A;  2E2I K;  4WJ4 A;  1YCL A;  1SFO C;  5IYB K;  3JST A;  3LPX A;  2VUM K;  3GTL C;  1WQG A;  3RZO K;  3S2H K;  5FLM C;  3H0G A;  1XXC A;  4BY7 K;  2JA7 K;  5CJ9 A;  5IYC C;  3S16 K;  3HOW K;  3FOE A;  4C3I C;  1ZYR A;  1Y1V A;  1USO A;  1I6H K;  1JOE A;  5EGH A;  3GEH A;  2V6T A;  1WOO A;  2WB1 L;  1R9T A;  4MEX A;  1G51 A;  2B63 C;  5TMF A;  2NVX A;  3GTQ A;  4GZY A;  3HXA A;  3AD8 C;  4QIW L;  3H3V D;  4OIQ A;  3HOY K;  2D6F C;  4A3B K;  1Y1W K;  2E2H C;  3PO3 C;  5L46 A;  3OPF A;  1C0A A;  4Y7N K;  2PA8 D;  1K83 K;  2P5M A;  3VA7 A;  1YNN A;  1O26 A;  2NVY A;  3S2D K;  1BDF A;  3HOZ C;  3GTO A;  4Y52 C;  5IYD C;  4DDQ A;  4A3M K;  3GTP K;  1TWC C;  2R93 A;  1SMY A;  5IOS A;  2PMZ D;  1F9N A;  3N3Y A;  4BBR K;  3H0G K;  1VRQ C;  4X6A C;  4P5A A;  3I4M K;  3T01 A;  4KMU A;  4C2M K;  2JA8 C;  3TTG A;  4KN7 A;  3L4K A;  3HOV K;  2A6E A;  4A3J C;  2RGR A;  2E2I A;  3S1N C;  4XLP A;  3S1M K;  1KQ4 A;  1O2F B;  4FM9 A;  1IS1 A;  3TFH A;  2FQT A;  2E2J C;  3M4O C;  4KB4 A;  1R9T K;  2R7Z C;  3S17 C;  2YU9 C;  2ZFZ A;  3S14 K;  3GTQ K;  4XSX A;  3I4N C;  3GTK C;  2JA7 A;  1DCP A;  2O5I A;  1I3Q K;  4KAR A;  4A3K K;  4XLN A;  2Y3P A;  4M1X A;  1I6V A;  3PO2 K;  5C3E C;  1JVI A;  3K7A C;  4C3H K;  5IP7 C;  3FKI C;  1PJ7 A;  4KMD A;  4A3G C;  1EK8 A;  1RU0 A;  1WCM C;  3GTO K;  1YX2 A;  4KAT A;  3GTJ C;  1B4B A;  1L0W A;  5C4J C;  3HOX K;  1SFO K;  4YFN A;  3GTM C;  2EBB A;  1EI6 A;  3BUE A;  4QJV B;  3S1Q C;  2ZUE A; 
#chains in the Genus database with same CATH homology
 4A3G K;  2JA6 C;  1WCM K;  1ZYR A;  3GTL K;  2R7Z K;  3GTJ K;  3HOY C;  4LK1 A;  5FLM K;  1I6H K;  5C4J K;  2PA8 L;  4NOI A;  4QJV A;  4G7Z A;  4A93 K;  4A3B C;  1Y1W C;  2WB1 L;  4MEX A;  3RZD C;  5IYC K;  3S1R K;  3GTM K;  5FJ8 K;  4OIR A;  3S1Q K;  4Y7N C;  2B63 C;  1K83 C;  4A3L C;  2A68 A;  5TMF A;  4C3I K;  2JA6 K;  4GZY A;  4QIW L;  3HOU C;  3H3V D;  4BBS C;  4OIQ A;  3HOY K;  1Y1V C;  2A6H A;  4YFX A;  4G7H A;  4LJZ A;  4A3B K;  1Y1W K;  4JK1 A;  3S2D C;  2E2H C;  3PO3 C;  4G7O A;  3RZD K;  2NVT C;  4Y7N K;  2PA8 D;  1K83 K;  2B63 K;  4A3L K;  5M3F K;  2WB1 D;  3S16 K;  4YG2 A;  3HOU K;  1YNN A;  5M5W K;  1HQM A;  1TWH C;  4Q4Z A;  2PMZ L;  2NVX C;  4BBS K;  1Y1V K;  4A3M C;  3GTP C;  4QIW D;  4AYB L;  3S2D K;  2E2H K;  2NVT K;  1BDF A;  3HOZ C;  4BBR C;  1IW7 A;  3H0G C;  2CW0 A;  4OIN A;  2O5J A;  2BE5 A;  4A3K C;  4Y52 C;  3I4M C;  1TWF C;  3S15 C;  2NVX K;  1TWH K;  5IYD C;  3GTG C;  1YNJ A;  5D4D A;  4A3M K;  3HOV C;  3GTP K;  4A3D C;  2Y0S L;  3DXJ A;  1TWC C;  4MEY A;  1SMY A;  2NVY C;  2PMZ D;  3S1M C;  2WAQ L;  3HOZ K;  4LLG A;  4BBR K;  3H0G K;  5M5Y K;  4X6A C;  4AYB D;  4Y52 K;  1R9T C;  3I4M K;  5C4X C;  4KMU A;  4C2M K;  2JA8 C;  3GTG K;  4OIO A;  3EQL A;  3GTO C;  4KN7 A;  3S15 K;  5IYD K;  4LK0 A;  3S14 C;  3HOV K;  3GTQ C;  2A6E A;  4A3D K;  4A3J C;  4Q5S A;  1TWC K;  3S1N C;  4XLP A;  3WOD A;  3HOX C;  2NVY K;  3CQZ C;  1TWA C;  4ZH4 A;  5IP9 C;  4C3J K;  3S1M K;  4A3C C;  2R93 C;  4OIP A;  3PO3 K;  2Y0S D;  4X6A K;  4BY1 C;  2E2J C;  4A3I C;  3M4O C;  1I3Q C;  1R9T K;  4MQ9 A;  3HKZ L;  5C4X K;  2WAQ D;  2JA8 K;  2R7Z C;  3S17 C;  1TWG C;  3M3Y C;  2A69 A;  2YU9 C;  3S14 K;  3GTQ K;  4A3J K;  4XSX A;  2PPB A;  3I4N C;  1I50 C;  4A93 C;  1XPP A;  3CQZ K;  1TWA K;  3GTK C;  5IP9 K;  3PO2 C;  4A3C K;  2E2I C;  2R93 K;  5M3M K;  4BY1 K;  2O5I A;  5IYB C;  2E2J K;  4A3F C;  4A3I K;  4A3E C;  1I3Q K;  3M4O K;  4BXX C;  2VUM C;  4A3K K;  5M5X K;  3S17 K;  1TWG K;  3M3Y K;  1TWF K;  2YU9 K;  4XLN A;  3RZO C;  2R92 C;  3HKZ D;  3I4N K;  1I50 K;  3S2H C;  2JA5 C;  3GTK K;  1I6V A;  3PO2 K;  5C3E C;  2E2I K;  4BY7 C;  4C3H K;  3K7A C;  2JA7 C;  5IP7 C;  1SFO C;  5IYB K;  3FKI C;  4A3F K;  4BXX K;  4A3E K;  3S16 C;  4YFK A;  5TMC A;  5C44 C;  2VUM K;  3HOW C;  2NVQ C;  4A3G C;  1WCM C;  3GTL C;  3GTO K;  3RZO K;  2R92 K;  3GTJ C;  3S2H K;  4KN4 A;  5FLM C;  2JA5 K;  1I6H C;  5C4J C;  5C3E K;  3S1N K;  3HOX K;  4BY7 K;  4XSZ A;  3K7A K;  2JA7 K;  5IP7 K;  1SFO K;  3S1R C;  3FKI K;  4YFN A;  5IYC C;  3GTM C;  4QJV B;  3H3V L;  3S1Q C;  5C44 K;  3HOW K;  2NVQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...