3H0GK

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
total genus 20
structure length 119
sequence length 119
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h0gK00
2Y0SL 4LK1A 4OIOA 4A3DK 4QIWD 4Y52K 3PO2K 4A3BK 3K7AK 4JK1A 5IYCK 5FLMK 3S15K 4A3EC 2E2IC 4A3KK 1TWCK 4BY1K 4Y52C 2R92K 1BDFA 1K83C 5IYCC 5FLMC 4Q4ZA 3H3VD 3HOWC 3HOZC 3M3YC 2B63K 2NVTK 4LLGA 5M3FK 3I4MK 4NOIA 3HOWK 1TWCC 4BY1C 2WB1D 3GTJC 2R92C 5C4JK 2NVTC 3M4OC 3GTMK 4OIQA 2B63C 3PO3C 3S1QC 4BBSK 3S16C 4LK0A 5C4JC 4X6AC 4Y7NC 4MEXA 4AYBL 1TWHK 4A3GC 2JA8C 2PMZL 4X6AK 3FKIC 3H0GK 5M5YK 3HOXK 2O5IA 3S17K 1HQMA 3HKZL 3I4NC 2O5JA 3H0GC 3FKIK 1TWGC 2WAQD 3GTQC 3HOVC 2JA8K 1SMYA 4A3LK 4QJVA 2E2HK 3RZDK 3RZOK 4YFKA 3WODA 4C2MK 5C4XK 2VUMK 2E2HC 4LJZA 2JA6K 3HOVK 1SFOK 4A3IC 2PPBA 4G7OA 3DXJA 3S15C 3RZOC 4YFXA 5C4XC 2PA8D 3PO3K 3S1QK 4BBSC 3H3VL 4C3JK 3S2DK 3HOZK 3M3YK 4KMUA 4XLPA 4A3IK 1SFOC 3S1MK 4BY7K 1TWAK 2CW0A 3I4MC 4A3JC 3S2DC 3I4NK 1TWFK 2WB1L 4G7HA 3M4OK 2A6HA 3HOUC 4BY7C 1XPPA 5TMCA 1Y1WC 1TWGK 3GTQK 3GTKK 4A3GK 4A3LC 3S16K 1I6HK 4Y7NK 4XSXA 4G7ZA 4A93C 1YNNA 5IYDC 5M5WK 2VUMC 3GTKC 2A6EA 2YU9K 2JA6C 3HKZD 5D4DA 2Y0SD 1I50C 2WAQL 1WCMC 4YFNA 5IP7K 3S1RC 2JA5K 3S14K 3S1MC 5IP7C 2A68A 3S14C 3GTPC 1WCMK 2BE5A 5C44C 2JA5C 4OINA 2R93K 3GTGC 5IP9K 1IW7A 1Y1WK 5C3EC 1I6HC 4YG2A 4BXXC 4MQ9A 1ZYRA 3GTGK 5C44K 4A93K 5C3EK 1TWAC 4A3JK 5IP9C 2PMZD 2YU9C 2E2JK 4OIRA 1Y1VK 1I3QK 1TWFC 4ZH4A 5M3MK 2NVXC 3HOUK 1I50K 4QIWL 4A3DC 5TMFA 2E2JC 3HOYC 3PO2C 4A3BC 4GZYA 3K7AC 5IYBK 2R7ZK 3CQZK 3S1NC 4A3EK 4A3FK 4A3MC 2E2IK 3HOYK 4BBRK 2NVYC 4A3FC 4A3MK 3CQZC 3GTLC 3S1NK 3S2HC 4QJVB 2JA7C 3EQLA 3S1RK 4BBRC 1R9TK 1I6VA 3GTOC 4C3HK 3GTMC 4A3CC 4KN7A 2PA8L 2JA7K 4A3KC 2NVQK 3GTLK 5FJ8K 3S2HK 1K83K 4XSZA 4C3IK 4KN4A 4AYBD 1R9TC 4A3CK 4Q5SA 2R93C 3GTOK 4BXXK 3HOXC 2NVQC 3S17C 3GTJK 5IYBC 2R7ZC 3GTPK 2A69A 4OIPA 5IYDK 2NVYK 3RZDC 1Y1VC 1I3QC 4MEYA 2NVXK 5M5XK 1TWHC 4XLNA 1YNJA
chains in the Genus database with same CATH superfamily
1ISEA 4OIOA 1K83A 5FLMK 1AB4A 3JSTA 2FQTA 1F93A 3HOWC 2B63K 3GTPA 5CHPA 3HOWK 2R92C 1WORA 3GTJC 3BUEA 4WJ4A 5IORA 3M4OC 5EGHA 3PO3C 3S1QC 3S16C 4C45A 4DDQA 1O2FB 4C3IC 2W7VA 4AYBL 3TFHA 2O5IA 5M5YK 1HQMA 4AH6A 3FKIK 2EBBA 2WAQD 3H0GC 4A3LK 2JA8K 1SMYA 4GTEA 5C4XK 4GTDA 4G7OA 4GTFA 2E2HC 2PPBA 4ILDA 3FHZA 2PA8D 1WQHA 4C3JK 3M3YK 4A3IK 1TWFA 2CW0A 1O24A 4GTAA 1IQ0A 1TWAA 2P5MA 3M4OK 4G0UA 2KWAA 1TWGK 1DCOA 4P5AA 3T02A 2JA7A 1BS2A 4KM8A 4Y7NK 4G7ZA 1EH1A 3GEEA 1VLOA 2NVYA 1F7VA 4PABA 2CFAB 1J98A 1WQFA 2Y0SD 1I50C 1DCPA 5D4DA 2WAQL 2JA5K 3S1RC 2V6SA 1GE9A 4C3HC 3S1MC 1WCMK 2BE5A 2R93K 1Y1WK 1B4BA 1ZYRA 1VJEA 5C44K 1F9NA 3GTGA 2GSNA 2PMZD 2YU9C 4ZH4A 1G51A 3CAGA 4QIWL 3VA7A 1WIHA 2R7ZK 4A3MC 3GDZA 4A3FC 3TFIA 3EQLA 3GTQA 3GTOC 4C3HK 3GTMC 4A3CC 2NVQK 3S2HK 4XSZA 2R93C 3GTOK 1VH2A 4J3NA 4M1XA 2NVQC 2R7ZC 3GTPK 2B63A 4OIPA 4FM9A 3GTJA 2ZUEA 1O25A 2V6UA 1Y1VC 5M5XK 4XLNA 4QIWD 3PO2K 4A3BK 4JK1A 5IYCK 3AQPA 2R92K 3H3VD 1K83C 5IYCC 3M3YC 3TFJA 4LLGA 5M3FK 4NOIA 4KM9A 1EFWA 3FOFA 5C4JK 4LR2A 2NVTC 1O27A 4OIQA 1TWCA 4MEXA 2JA8C 3LAJA 3FKIC 3H0GK 3HKZL 3GTMA 1RU0A 3HOVC 3AD9C 3RZDK 3WODA 4C2MK 1VRQC 1BGWA 1SFOK 4A3IC 4GT9A 3RZOC 4YFXA 1ZQ1C 2JH3A 3GEIA 4C2MC 1KQ4A 5JFEA 2RGRA 3PO3K 3H3VL 3S1QK 4C3JC 1USMA 2XCOA 3OREA 1XPPA 5TMCA 1Y1WC 3GTKK 4A3LC 1I6HK 1EQRA 4XCHA 5IYDC 2A6EA 1O28A 3HKZD 3ERED 1WCMC 4P9SA 2A68A 3AD8C 3LPXA 1ZXOA 2JA5C 3GEHA 4FZBA 3GTGC 5IP9K 5C3EC 4BXXC 3GTGK 3A8JA 3G4CA 3NUHA 1EK8A 5IP9C 5CJ9A 1I3QK 1TWFC 2NVXC 4LQYA 2E2JC 3HOYC 3PO2C 4A3BC 4GZYA 3CQZK 4WJ3M 3SZYA 3BP8C 3GTKA 4P5BA 3S1NK 1WOPA 3GTLC 4QJVB 2JA7C 3S1RK 3H0GA 1X31C 4KN7A 2PA8L 2JA7K 4A3KC 3GTLK 4C3IK 4A3CK 1SFOA 3T00A 3GTJK 3G4AA 4GTLA 1DD5A 1DCHA 1V5VA 2NVYK 3Q3QA 3RZDC 1B4AA 1TWHC 1YNJA 4Y52K 4A3DK 3T01A 1TWGA 4KASA 3OEPA 4A3EC 2GAGC 2E2IC 4A3KK 1TWCK 1WQGA 1BDFA 5FLMC 1JVIA 2NVTK 1JQWA 1I3QA 3GIRA 4BY1C 2WB1D 3N0BA 4O2DA 3GTMK 1VGXA 4BBSK 2R7ZA 2R92A 4LK0A 4A3GC 3N0CA 1R9TA 2PMZL 5IOQA 3HOXK 3S17K 2O5JA 4BKWA 1XXAA 3GTQC 3RZOK 4YFKA 2V6TA 4BLBA 3AQOA 1IE0A 2VUMK 2JA6K 3DXJA 5C4XC 2P8TA 2ZFZA 3S2DK 1XZPB 3HOZK 1SFOC 5E68A 4KB4A 3I4MC 4A3JC 1XZQB 3L4JA 3TTGA 4KATA 2WB1L 2A6HA 3HOUC 4BY7C 5IYDK 1BJTA 2Y3PA 3GTLA 1PJ5A 4A93C 3GTKC 5M5WK 1O2AA 2JA6C 5IP7K 4YFNA 3S14K 1J6XA 3FOEA 5C44C 5JVOA 4OINA 2ZUFA 1L0WA 3LAPA 1PJ7A 4YG2A 4MQ9A 1C0AA 5C3EK 1TWAC 4A3JK 2JA5A 2GSOA 4KMAA 1Y1VK 5M3MK 5TMFA 3K7AC 4KARA 1I50A 5IYBK 3S1NC 4A3EK 1XXCA 2E2IK 2JA6A 2VUMA 1YCLA 3CQZC 1JOEA 3S2HC 1J6WA 4GTCA 3A8IA 1R9TK 1I6VA 2XCRB 5FJ8K 1K83K 4PAAA 4KN4A 1R9TC 1IL2A 4BXXK 1XZPA 3QX3A 5IYBC 1INNA 2A69A 1USOA 3L4KA 4A3GK 3GTPC 2Y0SL 4LK1A 4LOWA 5EGEA 2XCQA 3K7AK 4KMHA 1WOOA 1J6VA 3S15K 3V4GA 4BY1K 3IPJA 4Y52C 1YX2A 4Q4ZA 2CFAA 3OPFA 3HOZC 3I4MK 1EI6A 1TWCC 1XZQA 2B63C 3MMLB 5C4JC 4X6AC 4Y7NC 5IOSA 1TWHK 2R93A 4X6AK 1O29A 3AH5A 3I4NC 2E2IA 4KMDA 3A8KA 1TWGC 3SZZA 4QJVA 2RH6A 1IS1A 2E2HK 3CQZA 1TWHA 1WSVA 1Y1VA 4LJZA 1ZBSA 3HOVK 1O26A 3AD7C 3S15C 4BBSC 4KAWX 4KMUA 4XLPA 4BY7K 3S1MK 1IBAA 1TWAK 2NVXA 4G0VA 3S2DC 2YU9A 3I4NK 1TWFK 4G7HA 3GTOA 4BLAA 3GTQK 1XXBA 3S16K 4KC6A 1PJ6A 3HXAA 2GSUA 4XSXA 1YNNA 1WSRA 4WILA 2VUMC 2FQOA 2YU9K 3S0XA 1HI9A 1ZVUA 5TJ3A 5IP7C 5L46A 1WOSA 5HL8A 3S14C 1F7UA 1IW7A 1I6HC 1Y1WA 4A93K 3GSIA 2E2JK 4OIRA 3HOUK 4KB2A 1I50K 3BP3A 4A3DC 1WCMA 3ADAC 4GTBA 4A3FK 3HOYK 4BBRK 2NVYC 1O2BA 2E2HA 4A3MK 4BBRC 1UV7A 4GFQA 3FKIA 5IOTA 4AYBD 3N3YA 4Q5SA 4RMFA 3HOXC 2GAHC 2D6FC 3S17C 4KDDA 4G0WA 2PHCB 1I3QC 4MEYA 2NVXK
chains in the Genus database with same CATH topology
2Y0SL 4LK1A 4OIOA 4A3DK 4QIWD 4Y52K 3PO2K 4A3BK 3K7AK 4JK1A 5IYCK 5FLMK 3S15K 4A3EC 2E2IC 4A3KK 1TWCK 4BY1K 4Y52C 2R92K 1BDFA 1K83C 5IYCC 5FLMC 4Q4ZA 3H3VD 3HOWC 3HOZC 3M3YC 2B63K 2NVTK 4LLGA 5M3FK 3I4MK 4NOIA 3HOWK 1TWCC 4BY1C 2WB1D 3GTJC 2R92C 5C4JK 2NVTC 3M4OC 3GTMK 4OIQA 2B63C 3PO3C 3S1QC 4BBSK 3S16C 4LK0A 5C4JC 4X6AC 4Y7NC 4MEXA 4AYBL 1TWHK 4A3GC 2JA8C 2PMZL 4X6AK 3FKIC 3H0GK 5M5YK 3HOXK 2O5IA 3S17K 1HQMA 3HKZL 3I4NC 2O5JA 3H0GC 3FKIK 1TWGC 2WAQD 3GTQC 3HOVC 2JA8K 1SMYA 4A3LK 4QJVA 2E2HK 3RZDK 3RZOK 4YFKA 3WODA 4C2MK 5C4XK 2VUMK 2E2HC 4LJZA 2JA6K 3HOVK 1SFOK 4A3IC 2PPBA 4G7OA 3DXJA 3S15C 3RZOC 4YFXA 5C4XC 2PA8D 3PO3K 3S1QK 4BBSC 3H3VL 4C3JK 3S2DK 3HOZK 3M3YK 4KMUA 4XLPA 4A3IK 1SFOC 3S1MK 4BY7K 1TWAK 2CW0A 3I4MC 4A3JC 3S2DC 3I4NK 1TWFK 2WB1L 4G7HA 3M4OK 2A6HA 3HOUC 4BY7C 1XPPA 5TMCA 1Y1WC 1TWGK 3GTQK 3GTKK 4A3GK 4A3LC 3S16K 1I6HK 4Y7NK 4XSXA 4G7ZA 4A93C 1YNNA 5IYDC 5M5WK 2VUMC 3GTKC 2A6EA 2YU9K 2JA6C 3HKZD 5D4DA 2Y0SD 1I50C 2WAQL 1WCMC 4YFNA 5IP7K 3S1RC 2JA5K 3S14K 3S1MC 5IP7C 2A68A 3S14C 3GTPC 1WCMK 2BE5A 5C44C 2JA5C 4OINA 2R93K 3GTGC 5IP9K 1IW7A 1Y1WK 5C3EC 1I6HC 4YG2A 4BXXC 4MQ9A 1ZYRA 3GTGK 5C44K 4A93K 5C3EK 1TWAC 4A3JK 5IP9C 2PMZD 2YU9C 2E2JK 4OIRA 1Y1VK 1I3QK 1TWFC 4ZH4A 5M3MK 2NVXC 3HOUK 1I50K 4QIWL 4A3DC 5TMFA 2E2JC 3HOYC 3PO2C 4A3BC 4GZYA 3K7AC 5IYBK 2R7ZK 3CQZK 3S1NC 4A3EK 4A3FK 4A3MC 2E2IK 3HOYK 4BBRK 2NVYC 4A3FC 4A3MK 3CQZC 3GTLC 3S1NK 3S2HC 4QJVB 2JA7C 3EQLA 3S1RK 4BBRC 1R9TK 1I6VA 3GTOC 4C3HK 3GTMC 4A3CC 4KN7A 2PA8L 2JA7K 4A3KC 2NVQK 3GTLK 5FJ8K 3S2HK 1K83K 4XSZA 4C3IK 4KN4A 4AYBD 1R9TC 4A3CK 4Q5SA 2R93C 3GTOK 4BXXK 3HOXC 2NVQC 3S17C 3GTJK 5IYBC 2R7ZC 3GTPK 2A69A 4OIPA 5IYDK 2NVYK 3RZDC 1Y1VC 1I3QC 4MEYA 2NVXK 5M5XK 1TWHC 4XLNA 1YNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S L;  4LK1 A;  4OIO A;  4A3D K;  4QIW D;  4Y52 K;  3PO2 K;  4A3B K;  3K7A K;  4JK1 A;  5IYC K;  5FLM K;  3S15 K;  4A3E C;  2E2I C;  4A3K K;  1TWC K;  4BY1 K;  4Y52 C;  2R92 K;  1BDF A;  1K83 C;  5IYC C;  5FLM C;  4Q4Z A;  3H3V D;  3HOW C;  3HOZ C;  3M3Y C;  2B63 K;  2NVT K;  4LLG A;  5M3F K;  3I4M K;  4NOI A;  3HOW K;  1TWC C;  4BY1 C;  2WB1 D;  3GTJ C;  2R92 C;  5C4J K;  2NVT C;  3M4O C;  3GTM K;  4OIQ A;  2B63 C;  3PO3 C;  3S1Q C;  4BBS K;  3S16 C;  4LK0 A;  5C4J C;  4X6A C;  4Y7N C;  4MEX A;  4AYB L;  1TWH K;  4A3G C;  2JA8 C;  2PMZ L;  4X6A K;  3FKI C;  3H0G K;  5M5Y K;  3HOX K;  2O5I A;  3S17 K;  1HQM A;  3HKZ L;  3I4N C;  2O5J A;  3H0G C;  3FKI K;  1TWG C;  2WAQ D;  3GTQ C;  3HOV C;  2JA8 K;  1SMY A;  4A3L K;  4QJV A;  2E2H K;  3RZD K;  3RZO K;  4YFK A;  3WOD A;  4C2M K;  5C4X K;  2VUM K;  2E2H C;  4LJZ A;  2JA6 K;  3HOV K;  1SFO K;  4A3I C;  2PPB A;  4G7O A;  3DXJ A;  3S15 C;  3RZO C;  4YFX A;  5C4X C;  2PA8 D;  3PO3 K;  3S1Q K;  4BBS C;  3H3V L;  4C3J K;  3S2D K;  3HOZ K;  3M3Y K;  4KMU A;  4XLP A;  4A3I K;  1SFO C;  3S1M K;  4BY7 K;  1TWA K;  2CW0 A;  3I4M C;  4A3J C;  3S2D C;  3I4N K;  1TWF K;  2WB1 L;  4G7H A;  3M4O K;  2A6H A;  3HOU C;  4BY7 C;  1XPP A;  5TMC A;  1Y1W C;  1TWG K;  3GTQ K;  3GTK K;  4A3G K;  4A3L C;  3S16 K;  1I6H K;  4Y7N K;  4XSX A;  4G7Z A;  4A93 C;  1YNN A;  5IYD C;  5M5W K;  2VUM C;  3GTK C;  2A6E A;  2YU9 K;  2JA6 C;  3HKZ D;  5D4D A;  2Y0S D;  1I50 C;  2WAQ L;  1WCM C;  4YFN A;  5IP7 K;  3S1R C;  2JA5 K;  3S14 K;  3S1M C;  5IP7 C;  2A68 A;  3S14 C;  3GTP C;  1WCM K;  2BE5 A;  5C44 C;  2JA5 C;  4OIN A;  2R93 K;  3GTG C;  5IP9 K;  1IW7 A;  1Y1W K;  5C3E C;  1I6H C;  4YG2 A;  4BXX C;  4MQ9 A;  1ZYR A;  3GTG K;  5C44 K;  4A93 K;  5C3E K;  1TWA C;  4A3J K;  5IP9 C;  2PMZ D;  2YU9 C;  2E2J K;  4OIR A;  1Y1V K;  1I3Q K;  1TWF C;  4ZH4 A;  5M3M K;  2NVX C;  3HOU K;  1I50 K;  4QIW L;  4A3D C;  5TMF A;  2E2J C;  3HOY C;  3PO2 C;  4A3B C;  4GZY A;  3K7A C;  5IYB K;  2R7Z K;  3CQZ K;  3S1N C;  4A3E K;  4A3F K;  4A3M C;  2E2I K;  3HOY K;  4BBR K;  2NVY C;  4A3F C;  4A3M K;  3CQZ C;  3GTL C;  3S1N K;  3S2H C;  4QJV B;  2JA7 C;  3EQL A;  3S1R K;  4BBR C;  1R9T K;  1I6V A;  3GTO C;  4C3H K;  3GTM C;  4A3C C;  4KN7 A;  2PA8 L;  2JA7 K;  4A3K C;  2NVQ K;  3GTL K;  5FJ8 K;  3S2H K;  1K83 K;  4XSZ A;  4C3I K;  4KN4 A;  4AYB D;  1R9T C;  4A3C K;  4Q5S A;  2R93 C;  3GTO K;  4BXX K;  3HOX C;  2NVQ C;  3S17 C;  3GTJ K;  5IYB C;  2R7Z C;  3GTP K;  2A69 A;  4OIP A;  5IYD K;  2NVY K;  3RZD C;  1Y1V C;  1I3Q C;  4MEY A;  2NVX K;  5M5X K;  1TWH C;  4XLN A;  1YNJ A; 
#chains in the Genus database with same CATH topology
 1ISE A;  4OIO A;  1K83 A;  5FLM K;  1AB4 A;  3JST A;  2FQT A;  1F93 A;  3HOW C;  2B63 K;  3GTP A;  5CHP A;  3HOW K;  2R92 C;  1WOR A;  3GTJ C;  3BUE A;  4WJ4 A;  5IOR A;  3M4O C;  5EGH A;  3PO3 C;  3S1Q C;  3S16 C;  4C45 A;  4DDQ A;  1O2F B;  4C3I C;  2W7V A;  4AYB L;  3TFH A;  2O5I A;  5M5Y K;  1HQM A;  4AH6 A;  3FKI K;  2EBB A;  2WAQ D;  3H0G C;  4A3L K;  2JA8 K;  1SMY A;  4GTE A;  5C4X K;  4GTD A;  4G7O A;  4GTF A;  2E2H C;  2PPB A;  4ILD A;  3FHZ A;  2PA8 D;  1WQH A;  4C3J K;  3M3Y K;  4A3I K;  1TWF A;  2CW0 A;  1O24 A;  4GTA A;  1IQ0 A;  1TWA A;  2P5M A;  3M4O K;  4G0U A;  2KWA A;  1TWG K;  1DCO A;  4P5A A;  3T02 A;  2JA7 A;  1BS2 A;  4KM8 A;  4Y7N K;  4G7Z A;  1EH1 A;  3GEE A;  1VLO A;  2NVY A;  1F7V A;  4PAB A;  2CFA B;  1J98 A;  1WQF A;  2Y0S D;  1I50 C;  1DCP A;  5D4D A;  2WAQ L;  2JA5 K;  3S1R C;  2V6S A;  1GE9 A;  4C3H C;  3S1M C;  1WCM K;  2BE5 A;  2R93 K;  1Y1W K;  1B4B A;  1ZYR A;  1VJE A;  5C44 K;  1F9N A;  3GTG A;  2GSN A;  2PMZ D;  2YU9 C;  4ZH4 A;  1G51 A;  3CAG A;  4QIW L;  3VA7 A;  1WIH A;  2R7Z K;  4A3M C;  3GDZ A;  4A3F C;  3TFI A;  3EQL A;  3GTQ A;  3GTO C;  4C3H K;  3GTM C;  4A3C C;  2NVQ K;  3S2H K;  4XSZ A;  2R93 C;  3GTO K;  1VH2 A;  4J3N A;  4M1X A;  2NVQ C;  2R7Z C;  3GTP K;  2B63 A;  4OIP A;  4FM9 A;  3GTJ A;  2ZUE A;  1O25 A;  2V6U A;  1Y1V C;  5M5X K;  4XLN A;  4QIW D;  3PO2 K;  4A3B K;  4JK1 A;  5IYC K;  3AQP A;  2R92 K;  3H3V D;  1K83 C;  5IYC C;  3M3Y C;  3TFJ A;  4LLG A;  5M3F K;  4NOI A;  4KM9 A;  1EFW A;  3FOF A;  5C4J K;  4LR2 A;  2NVT C;  1O27 A;  4OIQ A;  1TWC A;  4MEX A;  2JA8 C;  3LAJ A;  3FKI C;  3H0G K;  3HKZ L;  3GTM A;  1RU0 A;  3HOV C;  3AD9 C;  3RZD K;  3WOD A;  4C2M K;  1VRQ C;  1BGW A;  1SFO K;  4A3I C;  4GT9 A;  3RZO C;  4YFX A;  1ZQ1 C;  2JH3 A;  3GEI A;  4C2M C;  1KQ4 A;  5JFE A;  2RGR A;  3PO3 K;  3H3V L;  3S1Q K;  4C3J C;  1USM A;  2XCO A;  3ORE A;  1XPP A;  5TMC A;  1Y1W C;  3GTK K;  4A3L C;  1I6H K;  1EQR A;  4XCH A;  5IYD C;  2A6E A;  1O28 A;  3HKZ D;  3ERE D;  1WCM C;  4P9S A;  2A68 A;  3AD8 C;  3LPX A;  1ZXO A;  2JA5 C;  3GEH A;  4FZB A;  3GTG C;  5IP9 K;  5C3E C;  4BXX C;  3GTG K;  3A8J A;  3G4C A;  3NUH A;  1EK8 A;  5IP9 C;  5CJ9 A;  1I3Q K;  1TWF C;  2NVX C;  4LQY A;  2E2J C;  3HOY C;  3PO2 C;  4A3B C;  4GZY A;  3CQZ K;  4WJ3 M;  3SZY A;  3BP8 C;  3GTK A;  4P5B A;  3S1N K;  1WOP A;  3GTL C;  4QJV B;  2JA7 C;  3S1R K;  3H0G A;  1X31 C;  4KN7 A;  2PA8 L;  2JA7 K;  4A3K C;  3GTL K;  4C3I K;  4A3C K;  1SFO A;  3T00 A;  3GTJ K;  3G4A A;  4GTL A;  1DD5 A;  1DCH A;  1V5V A;  2NVY K;  3Q3Q A;  3RZD C;  1B4A A;  1TWH C;  1YNJ A;  4Y52 K;  4A3D K;  3T01 A;  1TWG A;  4KAS A;  3OEP A;  4A3E C;  2GAG C;  2E2I C;  4A3K K;  1TWC K;  1WQG A;  1BDF A;  5FLM C;  1JVI A;  2NVT K;  1JQW A;  1I3Q A;  3GIR A;  4BY1 C;  2WB1 D;  3N0B A;  4O2D A;  3GTM K;  1VGX A;  4BBS K;  2R7Z A;  2R92 A;  4LK0 A;  4A3G C;  3N0C A;  1R9T A;  2PMZ L;  5IOQ A;  3HOX K;  3S17 K;  2O5J A;  4BKW A;  1XXA A;  3GTQ C;  3RZO K;  4YFK A;  2V6T A;  4BLB A;  3AQO A;  1IE0 A;  2VUM K;  2JA6 K;  3DXJ A;  5C4X C;  2P8T A;  2ZFZ A;  3S2D K;  1XZP B;  3HOZ K;  1SFO C;  5E68 A;  4KB4 A;  3I4M C;  4A3J C;  1XZQ B;  3L4J A;  3TTG A;  4KAT A;  2WB1 L;  2A6H A;  3HOU C;  4BY7 C;  5IYD K;  1BJT A;  2Y3P A;  3GTL A;  1PJ5 A;  4A93 C;  3GTK C;  5M5W K;  1O2A A;  2JA6 C;  5IP7 K;  4YFN A;  3S14 K;  1J6X A;  3FOE A;  5C44 C;  5JVO A;  4OIN A;  2ZUF A;  1L0W A;  3LAP A;  1PJ7 A;  4YG2 A;  4MQ9 A;  1C0A A;  5C3E K;  1TWA C;  4A3J K;  2JA5 A;  2GSO A;  4KMA A;  1Y1V K;  5M3M K;  5TMF A;  3K7A C;  4KAR A;  1I50 A;  5IYB K;  3S1N C;  4A3E K;  1XXC A;  2E2I K;  2JA6 A;  2VUM A;  1YCL A;  3CQZ C;  1JOE A;  3S2H C;  1J6W A;  4GTC A;  3A8I A;  1R9T K;  1I6V A;  2XCR B;  5FJ8 K;  1K83 K;  4PAA A;  4KN4 A;  1R9T C;  1IL2 A;  4BXX K;  1XZP A;  3QX3 A;  5IYB C;  1INN A;  2A69 A;  1USO A;  3L4K A;  4A3G K;  3GTP C;  2Y0S L;  4LK1 A;  4LOW A;  5EGE A;  2XCQ A;  3K7A K;  4KMH A;  1WOO A;  1J6V A;  3S15 K;  3V4G A;  4BY1 K;  3IPJ A;  4Y52 C;  1YX2 A;  4Q4Z A;  2CFA A;  3OPF A;  3HOZ C;  3I4M K;  1EI6 A;  1TWC C;  1XZQ A;  2B63 C;  3MML B;  5C4J C;  4X6A C;  4Y7N C;  5IOS A;  1TWH K;  2R93 A;  4X6A K;  1O29 A;  3AH5 A;  3I4N C;  2E2I A;  4KMD A;  3A8K A;  1TWG C;  3SZZ A;  4QJV A;  2RH6 A;  1IS1 A;  2E2H K;  3CQZ A;  1TWH A;  1WSV A;  1Y1V A;  4LJZ A;  1ZBS A;  3HOV K;  1O26 A;  3AD7 C;  3S15 C;  4BBS C;  4KAW X;  4KMU A;  4XLP A;  4BY7 K;  3S1M K;  1IBA A;  1TWA K;  2NVX A;  4G0V A;  3S2D C;  2YU9 A;  3I4N K;  1TWF K;  4G7H A;  3GTO A;  4BLA A;  3GTQ K;  1XXB A;  3S16 K;  4KC6 A;  1PJ6 A;  3HXA A;  2GSU A;  4XSX A;  1YNN A;  1WSR A;  4WIL A;  2VUM C;  2FQO A;  2YU9 K;  3S0X A;  1HI9 A;  1ZVU A;  5TJ3 A;  5IP7 C;  5L46 A;  1WOS A;  5HL8 A;  3S14 C;  1F7U A;  1IW7 A;  1I6H C;  1Y1W A;  4A93 K;  3GSI A;  2E2J K;  4OIR A;  3HOU K;  4KB2 A;  1I50 K;  3BP3 A;  4A3D C;  1WCM A;  3ADA C;  4GTB A;  4A3F K;  3HOY K;  4BBR K;  2NVY C;  1O2B A;  2E2H A;  4A3M K;  4BBR C;  1UV7 A;  4GFQ A;  3FKI A;  5IOT A;  4AYB D;  3N3Y A;  4Q5S A;  4RMF A;  3HOX C;  2GAH C;  2D6F C;  3S17 C;  4KDD A;  4G0W A;  2PHC B;  1I3Q C;  4MEY A;  2NVX K; 
#chains in the Genus database with same CATH homology
 2Y0S L;  4LK1 A;  4OIO A;  4A3D K;  4QIW D;  4Y52 K;  3PO2 K;  4A3B K;  3K7A K;  4JK1 A;  5IYC K;  5FLM K;  3S15 K;  4A3E C;  2E2I C;  4A3K K;  1TWC K;  4BY1 K;  4Y52 C;  2R92 K;  1BDF A;  1K83 C;  5IYC C;  5FLM C;  4Q4Z A;  3H3V D;  3HOW C;  3HOZ C;  3M3Y C;  2B63 K;  2NVT K;  4LLG A;  5M3F K;  3I4M K;  4NOI A;  3HOW K;  1TWC C;  4BY1 C;  2WB1 D;  3GTJ C;  2R92 C;  5C4J K;  2NVT C;  3M4O C;  3GTM K;  4OIQ A;  2B63 C;  3PO3 C;  3S1Q C;  4BBS K;  3S16 C;  4LK0 A;  5C4J C;  4X6A C;  4Y7N C;  4MEX A;  4AYB L;  1TWH K;  4A3G C;  2JA8 C;  2PMZ L;  4X6A K;  3FKI C;  3H0G K;  5M5Y K;  3HOX K;  2O5I A;  3S17 K;  1HQM A;  3HKZ L;  3I4N C;  2O5J A;  3H0G C;  3FKI K;  1TWG C;  2WAQ D;  3GTQ C;  3HOV C;  2JA8 K;  1SMY A;  4A3L K;  4QJV A;  2E2H K;  3RZD K;  3RZO K;  4YFK A;  3WOD A;  4C2M K;  5C4X K;  2VUM K;  2E2H C;  4LJZ A;  2JA6 K;  3HOV K;  1SFO K;  4A3I C;  2PPB A;  4G7O A;  3DXJ A;  3S15 C;  3RZO C;  4YFX A;  5C4X C;  2PA8 D;  3PO3 K;  3S1Q K;  4BBS C;  3H3V L;  4C3J K;  3S2D K;  3HOZ K;  3M3Y K;  4KMU A;  4XLP A;  4A3I K;  1SFO C;  3S1M K;  4BY7 K;  1TWA K;  2CW0 A;  3I4M C;  4A3J C;  3S2D C;  3I4N K;  1TWF K;  2WB1 L;  4G7H A;  3M4O K;  2A6H A;  3HOU C;  4BY7 C;  1XPP A;  5TMC A;  1Y1W C;  1TWG K;  3GTQ K;  3GTK K;  4A3G K;  4A3L C;  3S16 K;  1I6H K;  4Y7N K;  4XSX A;  4G7Z A;  4A93 C;  1YNN A;  5IYD C;  5M5W K;  2VUM C;  3GTK C;  2A6E A;  2YU9 K;  2JA6 C;  3HKZ D;  5D4D A;  2Y0S D;  1I50 C;  2WAQ L;  1WCM C;  4YFN A;  5IP7 K;  3S1R C;  2JA5 K;  3S14 K;  3S1M C;  5IP7 C;  2A68 A;  3S14 C;  3GTP C;  1WCM K;  2BE5 A;  5C44 C;  2JA5 C;  4OIN A;  2R93 K;  3GTG C;  5IP9 K;  1IW7 A;  1Y1W K;  5C3E C;  1I6H C;  4YG2 A;  4BXX C;  4MQ9 A;  1ZYR A;  3GTG K;  5C44 K;  4A93 K;  5C3E K;  1TWA C;  4A3J K;  5IP9 C;  2PMZ D;  2YU9 C;  2E2J K;  4OIR A;  1Y1V K;  1I3Q K;  1TWF C;  4ZH4 A;  5M3M K;  2NVX C;  3HOU K;  1I50 K;  4QIW L;  4A3D C;  5TMF A;  2E2J C;  3HOY C;  3PO2 C;  4A3B C;  4GZY A;  3K7A C;  5IYB K;  2R7Z K;  3CQZ K;  3S1N C;  4A3E K;  4A3F K;  4A3M C;  2E2I K;  3HOY K;  4BBR K;  2NVY C;  4A3F C;  4A3M K;  3CQZ C;  3GTL C;  3S1N K;  3S2H C;  4QJV B;  2JA7 C;  3EQL A;  3S1R K;  4BBR C;  1R9T K;  1I6V A;  3GTO C;  4C3H K;  3GTM C;  4A3C C;  4KN7 A;  2PA8 L;  2JA7 K;  4A3K C;  2NVQ K;  3GTL K;  5FJ8 K;  3S2H K;  1K83 K;  4XSZ A;  4C3I K;  4KN4 A;  4AYB D;  1R9T C;  4A3C K;  4Q5S A;  2R93 C;  3GTO K;  4BXX K;  3HOX C;  2NVQ C;  3S17 C;  3GTJ K;  5IYB C;  2R7Z C;  3GTP K;  2A69 A;  4OIP A;  5IYD K;  2NVY K;  3RZD C;  1Y1V C;  1I3Q C;  4MEY A;  2NVX K;  5M5X K;  1TWH C;  4XLN A;  1YNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...