3H0GK

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
119
structure length
119
Chain Sequence
b'MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit rpb1
molecule tags Transcription
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
total genus 20
structure length 119
sequence length 119
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3h0gK00
5M3MK 4OIPA 3I4MC 4Y52K 3M3YK 1Y1VK 4YG2A 4KMUA 4C2MK 5M5YK 5IYDC 2BE5A 3GTOC 4A3GK 3RZOK 1R9TK 3CQZC 3S16C 4LJZA 4LK0A 4Y7NC 2YU9C 2JA6K 3S2HC 4Q5SA 2PA8L 5C4JK 4BY7C 3GTQC 2A6EA 4A3DC 3PO3C 3GTKK 5FLMC 3S1MC 2PA8D 4XSXA 1TWHC 1TWFC 3GTJK 1I50C 3HOYK 3S17K 5C44C 3S1QK 2E2HK 5C4XK 3HKZD 5M3FK 2WB1L 3GTGK 4A3CC 4QJVB 2E2IC 3GTPC 2WAQD 4A93C 2NVXC 3HOWC 2JA7K 3PO2K 4GZYA 2NVTK 2A68A 3HOXK 5IP7K 4KN4A 3S1RC 3HOVK 5IYDK 3RZOC 5C3EC 1TWGK 3GTOK 3HOZC 3K7AK 4AYBL 4LLGA 3I4NK 4A3LK 2O5JA 4A3KK 2JA7C 2Y0SL 4OIRA 4A3EC 3HOVC 4G7OA 3EQLA 4LK1A 1SFOK 4OINA 1I6HK 1I3QK 2JA5K 1TWHK 3HOYC 2E2JC 2R92K 4QJVA 3S2DC 5C44K 4BXXC 3GTKC 1K83C 2R93K 1TWFK 5M5XK 5IYBK 3GTJC 4AYBD 4A3FC 5IYCK 3S1QC 1SMYA 2E2HC 1I6VA 4A3LC 4BBRC 4QIWL 4A3IK 4C3HK 4A3BK 2JA6C 3HOWK 3S2HK 4MEYA 3GTLK 4C3JK 5C4JC 5M5WK 3RZDK 4X6AK 4A3FK 3HKZL 3HOZK 1TWGC 2PMZL 4JK1A 3CQZK 3HOUC 3S14K 4BBSK 4XLPA 4ZH4A 2YU9K 1I6HC 4KN7A 4A93K 2E2JK 4BY1K 4A3JC 3FKIC 3S1NK 3S15C 3H3VL 5IP7C 2NVQK 2VUMK 3S14C 3I4NC 1XPPA 1I50K 2CW0A 4OIOA 4G7HA 5C3EK 3S17C 1WCMK 4NOIA 3M3YC 2O5IA 2A6HA 2JA8K 3GTLC 2A69A 2B63K 3H0GC 4XSZA 4MEXA 3PO2C 2R7ZK 3RZDC 2NVTC 3GTMC 4X6AC 4XLNA 5IYCC 4YFXA 1TWCC 1Y1WC 4A3BC 4A3IC 1TWAK 4A3MC 2PPBA 1Y1VC 4BBRK 2NVYK 2Y0SD 4A3DK 4A3JK 4A3EK 3S1MK 1YNNA 1SFOC 3FKIK 1R9TC 1I3QC 2JA5C 3S16K 4BXXK 3S2DK 4A3GC 3M4OK 3S15K 5IP9K 3S1NC 4Y7NK 4BBSC 3H3VD 1TWAC 5FJ8K 4C3IK 4A3MK 4Y52C 3I4MK 3HOUK 4OIQA 1HQMA 2WAQL 4YFKA 3HOXC 3DXJA 3S1RK 3GTMK 2R7ZC 5IP9C 5TMCA 1TWCK 1Y1WK 4QIWD 3GTGC 4A3CK 2E2IK 4YFNA 1YNJA 5C4XC 2NVXK 1ZYRA 1WCMC 3GTPK 2JA8C 2WB1D 5D4DA 2NVYC 3WODA 3H0GK 2R92C 2B63C 3GTQK 5FLMK 1K83K 2R93C 1BDFA 3PO3K 5IYBC 4G7ZA 4BY7K 4BY1C 1IW7A 4MQ9A 5TMFA 4Q4ZA 3M4OC 2NVQC 3K7AC 2VUMC 2PMZD 4A3KC
chains in the Genus database with same CATH superfamily
3OREA 4KB4A 5JVOA 4KB2A 3M3YK 4KMUA 5IOSA 3S16C 2P5MA 3GEEA 4LJZA 4LK0A 4GTLA 3S2HC 4C3HC 1O27A 4KM9A 3PO3C 3LPXA 4BLAA 2PA8D 3S17K 5C44C 3FOEA 4QJVB 1O29A 2WAQD 3HOWC 2A68A 3HOXK 5IP7K 3S1RC 5IYDK 1PJ6A 3ADAC 3K7AK 2O5JA 4LLGA 1BJTA 4OIRA 3HOVC 4LK1A 1SFOK 1I6HK 1TWFK 3GTJC 4AYBD 1I6VA 4A3IK 4A3BK 3GTLK 1BS2A 5C4JC 1O24A 1EI6A 1VGXA 1TWGC 2NVXA 2PMZL 4KM8A 1PJ5A 1J6XA 3HXAA 4A93K 4WILA 3S15C 5IP7C 2CW0A 4OIOA 2O5IA 2A6HA 2JA8K 4GTDA 1EK8A 3H0GC 4XSZA 4C3JC 2NVTC 1VJEA 1USOA 3SZYA 2NVYA 5IYCC 4O2DA 1Y1WC 1J6WA 1Y1VC 2Y0SD 4J3NA 1O2FB 1JVIA 1YNNA 2FQTA 1DCOA 4A3GC 3S1NC 4Y7NK 4A3MK 5FJ8K 4C3IK 4YFKA 1F9NA 2CFAA 3S1RK 3GTMK 2R7ZC 1TWCK 4QIWD 4A3CK 3GTOA 2JH3A 1YCLA 1ZYRA 1XXBA 1WCMC 2JA8C 1RU0A 5EGHA 1DCHA 1WIHA 2PHCB 3BP3A 3H0GK 2R92C 5FLMK 3TFHA 3PO3K 1J6VA 1F93A 3M4OC 1UV7A 2ZFZA 3AD8C 2XCQA 1WQHA 3I4MC 2E2IA 4Y52K 3QX3A 1O28A 4KATA 4C2MK 5IYDC 3GTOC 3RZOK 4C3IC 5IOTA 4Y7NC 5C4JK 4BY7C 2R93A 4A3DC 2ZUEA 1J98A 1TWHC 1TWFC 3GTJK 1I50C 5M3FK 3ERED 4BKWA 3GTGK 2E2IC 4KC6A 4KAWX 4GZYA 2JA7K 3OEPA 2GAHC 2NVTK 2GSNA 4KN4A 4GFQA 5C3EC 3HOZC 1WQGA 1XZPA 3I4NK 4A3LK 5JFEA 2JA7C 2E2HA 3EQLA 4XCHA 2JA5K 3LAPA 3HOYC 5C44K 4P5BA 3GTKC 5IYCK 2E2HC 4BBRC 3S2HK 3HOWK 3AQPA 4MEYA 1G51A 5M5WK 4X6AK 4A3FK 3A8KA 3A8IA 3HKZL 1KQ4A 3GTJA 1O26A 4JK1A 4BBSK 3S14K 4XLPA 2XCRB 3OPFA 4P9SA 4BY1K 2JA7A 2NVQK 2VUMK 3S14C 3I4NC 4A3LC 5C3EK 4GT9A 1HI9A 3GTLC 1X31C 4ILDA 2B63K 3PO2C 1WQFA 3SZZA 1IQ0A 4BLBA 4A3IC 1TWAK 2PPBA 4BBRK 2CFAB 4A3DK 3L4KA 3Q3QA 3S1MK 1EFWA 5HL8A 3FKIK 2GSUA 1I3QC 1USMA 1R9TC 4BXXK 4BBSC 1TWAC 1AB4A 3HOUK 3BP8C 1SFOA 4C45A 1DCPA 3T02A 1ZBSA 4KASA 3LAJA 5C4XC 1ZXOA 2EBBA 1K83K 1BDFA 1WSRA 1EQRA 4MQ9A 5TMFA 3T01A 2RGRA 2KWAA 3K7AC 4FZBA 2PMZD 3CQZA 1IL2A 3HOVK 1Y1WA 2D6FC 4PABA 3CAGA 1TWAA 3N3YA 3AH5A 1O2BA 4YG2A 1PJ7A 5M5YK 1R9TK 3CQZC 4WJ3M 1VLOA 5IOQA 5CJ9A 4LR2A 4Q5SA 1V5VA 3GDZA 1EH1A 1ZVUA 2JA6A 3N0BA 4XSXA 3HOYK 5C4XK 3HKZD 2WB1L 3GIRA 4KARA 4A93C 1TWGA 2NVXC 3PO2K 3L4JA 1O25A 3RZOC 4PAAA 1TWGK 1TWHA 4A3KK 3TTGA 1JOEA 1WOPA 3AD7C 4OINA 1I3QK 2Y3PA 1TWHK 4BXXC 2E2JC 2R92K 4QJVA 3S2DC 3VA7A 1XZQB 4P5AA 3TFJA 5M5XK 5IYBK 3S1QC 2R93K 1SMYA 1XZPB 1L0WA 4QIWL 1XXAA 4C3HK 5E68A 2JA6C 4C3JK 3RZDK 1INNA 1Y1VA 3HOZK 2RH6A 4ZH4A 2YU9K 1I6HC 3FKIC 1VH2A 2JA5A 3S1NK 3H3VL 1XPPA 1I50K 4G7HA 2R7ZA 5TJ3A 4NOIA 3M3YC 3FOFA 4LOWA 2A69A 3IPJA 1WCMA 3NUHA 4GTCA 1F7VA 4MEXA 3RZDC 2R7ZK 1IBAA 1GE9A 2R92A 4GTBA 1XZQA 4KMAA 4GTEA 4G0VA 4A3BC 1WOOA 4A3MC 3GTQA 3GEHA 3A8JA 4A3JK 4A3EK 4KDDA 2JA5C 4C2MC 4GTAA 3M4OK 3S15K 5IP9K 1IS1A 3H3VD 2VUMA 4Y52C 3I4MK 3HOXC 4AH6A 1C0AA 2B63A 5IP9C 3GTGC 4KMHA 2E2IK 4YFNA 1I50A 1WSVA 2GAGC 5D4DA 1ZQ1C 2NVYC 3WODA 2B63C 2R93C 5IYBC 4G7ZA 4BY1C 1IW7A 3T00A 1JQWA 4Q4ZA 2NVQC 2VUMC 4A3KC 1TWCA 3S0XA 5M3MK 4OIPA 2ZUFA 1Y1VK 2V6TA 4A3GK 3H0GA 2BE5A 3GTGA 3BUEA 4WJ4A 3GTKA 1VRQC 3JSTA 2YU9C 2JA6K 4G0WA 3TFIA 2PA8L 3GTQC 2A6EA 1IE0A 2FQOA 5FLMC 3G4CA 3GTKK 3S1MC 3S1QK 2E2HK 3GEIA 4A3CC 3GTLA 3GTPC 4KMDA 2XCOA 3FKIA 1DD5A 4DDQA 4M1XA 5EGEA 2W7VA 3GTOK 4AYBL 1XXCA 2Y0SL 3G4AA 4A3EC 4GTFA 4G7OA 2GSOA 1K83C 4A3FC 1WOSA 1TWFA 2P8TA 1K83A 1B4BA 1O2AA 1WORA 2YU9A 3MMLB 3CQZK 3HOUC 1BGWA 4KN7A 3FHZA 2E2JK 4A3JC 3GSIA 1ISEA 3N0CA 1I3QA 3S17C 3GTPA 1WCMK 2V6UA 5L46A 4X6AC 3GTMC 4G0UA 5CHPA 4XLNA 4YFXA 3AD9C 1TWCC 2NVYK 1SFOC 3S16K 4FM9A 5IORA 3S2DK 3V4GA 1B4AA 4OIQA 1HQMA 2WAQL 1F7UA 3DXJA 5TMCA 1Y1WK 3GTMA 1YNJA 2NVXK 3GTPK 2WB1D 3GTQK 1R9TA 3AQOA 4RMFA 4BY7K 1YX2A 4LQYA 2V6SA
chains in the Genus database with same CATH topology
5M3MK 4OIPA 3I4MC 4Y52K 3M3YK 1Y1VK 4YG2A 4KMUA 4C2MK 5M5YK 5IYDC 2BE5A 3GTOC 4A3GK 3RZOK 1R9TK 3CQZC 3S16C 4LJZA 4LK0A 4Y7NC 2YU9C 2JA6K 3S2HC 4Q5SA 2PA8L 5C4JK 4BY7C 3GTQC 2A6EA 4A3DC 3PO3C 3GTKK 5FLMC 3S1MC 2PA8D 4XSXA 1TWHC 1TWFC 3GTJK 1I50C 3HOYK 3S17K 5C44C 3S1QK 2E2HK 5C4XK 3HKZD 5M3FK 2WB1L 3GTGK 4A3CC 4QJVB 2E2IC 3GTPC 2WAQD 4A93C 2NVXC 3HOWC 2JA7K 3PO2K 4GZYA 2NVTK 2A68A 3HOXK 5IP7K 4KN4A 3S1RC 3HOVK 5IYDK 3RZOC 5C3EC 1TWGK 3GTOK 3HOZC 3K7AK 4AYBL 4LLGA 3I4NK 4A3LK 2O5JA 4A3KK 2JA7C 2Y0SL 4OIRA 4A3EC 3HOVC 4G7OA 3EQLA 4LK1A 1SFOK 4OINA 1I6HK 1I3QK 2JA5K 1TWHK 3HOYC 2E2JC 2R92K 4QJVA 3S2DC 5C44K 4BXXC 3GTKC 1K83C 2R93K 1TWFK 5M5XK 5IYBK 3GTJC 4AYBD 4A3FC 5IYCK 3S1QC 1SMYA 2E2HC 1I6VA 4A3LC 4BBRC 4QIWL 4A3IK 4C3HK 4A3BK 2JA6C 3HOWK 3S2HK 4MEYA 3GTLK 4C3JK 5C4JC 5M5WK 3RZDK 4X6AK 4A3FK 3HKZL 3HOZK 1TWGC 2PMZL 4JK1A 3CQZK 3HOUC 3S14K 4BBSK 4XLPA 4ZH4A 2YU9K 1I6HC 4KN7A 4A93K 2E2JK 4BY1K 4A3JC 3FKIC 3S1NK 3S15C 3H3VL 5IP7C 2NVQK 2VUMK 3S14C 3I4NC 1XPPA 1I50K 2CW0A 4OIOA 4G7HA 5C3EK 3S17C 1WCMK 4NOIA 3M3YC 2O5IA 2A6HA 2JA8K 3GTLC 2A69A 2B63K 3H0GC 4XSZA 4MEXA 3PO2C 2R7ZK 3RZDC 2NVTC 3GTMC 4X6AC 4XLNA 5IYCC 4YFXA 1TWCC 1Y1WC 4A3BC 4A3IC 1TWAK 4A3MC 2PPBA 1Y1VC 4BBRK 2NVYK 2Y0SD 4A3DK 4A3JK 4A3EK 3S1MK 1YNNA 1SFOC 3FKIK 1R9TC 1I3QC 2JA5C 3S16K 4BXXK 3S2DK 4A3GC 3M4OK 3S15K 5IP9K 3S1NC 4Y7NK 4BBSC 3H3VD 1TWAC 5FJ8K 4C3IK 4A3MK 4Y52C 3I4MK 3HOUK 4OIQA 1HQMA 2WAQL 4YFKA 3HOXC 3DXJA 3S1RK 3GTMK 2R7ZC 5IP9C 5TMCA 1TWCK 1Y1WK 4QIWD 3GTGC 4A3CK 2E2IK 4YFNA 1YNJA 5C4XC 2NVXK 1ZYRA 1WCMC 3GTPK 2JA8C 2WB1D 5D4DA 2NVYC 3WODA 3H0GK 2R92C 2B63C 3GTQK 5FLMK 1K83K 2R93C 1BDFA 3PO3K 5IYBC 4G7ZA 4BY7K 4BY1C 1IW7A 4MQ9A 5TMFA 4Q4ZA 3M4OC 2NVQC 3K7AC 2VUMC 2PMZD 4A3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M K;  4OIP A;  3I4M C;  4Y52 K;  3M3Y K;  1Y1V K;  4YG2 A;  4KMU A;  4C2M K;  5M5Y K;  5IYD C;  2BE5 A;  3GTO C;  4A3G K;  3RZO K;  1R9T K;  3CQZ C;  3S16 C;  4LJZ A;  4LK0 A;  4Y7N C;  2YU9 C;  2JA6 K;  3S2H C;  4Q5S A;  2PA8 L;  5C4J K;  4BY7 C;  3GTQ C;  2A6E A;  4A3D C;  3PO3 C;  3GTK K;  5FLM C;  3S1M C;  2PA8 D;  4XSX A;  1TWH C;  1TWF C;  3GTJ K;  1I50 C;  3HOY K;  3S17 K;  5C44 C;  3S1Q K;  2E2H K;  5C4X K;  3HKZ D;  5M3F K;  2WB1 L;  3GTG K;  4A3C C;  4QJV B;  2E2I C;  3GTP C;  2WAQ D;  4A93 C;  2NVX C;  3HOW C;  2JA7 K;  3PO2 K;  4GZY A;  2NVT K;  2A68 A;  3HOX K;  5IP7 K;  4KN4 A;  3S1R C;  3HOV K;  5IYD K;  3RZO C;  5C3E C;  1TWG K;  3GTO K;  3HOZ C;  3K7A K;  4AYB L;  4LLG A;  3I4N K;  4A3L K;  2O5J A;  4A3K K;  2JA7 C;  2Y0S L;  4OIR A;  4A3E C;  3HOV C;  4G7O A;  3EQL A;  4LK1 A;  1SFO K;  4OIN A;  1I6H K;  1I3Q K;  2JA5 K;  1TWH K;  3HOY C;  2E2J C;  2R92 K;  4QJV A;  3S2D C;  5C44 K;  4BXX C;  3GTK C;  1K83 C;  2R93 K;  1TWF K;  5M5X K;  5IYB K;  3GTJ C;  4AYB D;  4A3F C;  5IYC K;  3S1Q C;  1SMY A;  2E2H C;  1I6V A;  4A3L C;  4BBR C;  4QIW L;  4A3I K;  4C3H K;  4A3B K;  2JA6 C;  3HOW K;  3S2H K;  4MEY A;  3GTL K;  4C3J K;  5C4J C;  5M5W K;  3RZD K;  4X6A K;  4A3F K;  3HKZ L;  3HOZ K;  1TWG C;  2PMZ L;  4JK1 A;  3CQZ K;  3HOU C;  3S14 K;  4BBS K;  4XLP A;  4ZH4 A;  2YU9 K;  1I6H C;  4KN7 A;  4A93 K;  2E2J K;  4BY1 K;  4A3J C;  3FKI C;  3S1N K;  3S15 C;  3H3V L;  5IP7 C;  2NVQ K;  2VUM K;  3S14 C;  3I4N C;  1XPP A;  1I50 K;  2CW0 A;  4OIO A;  4G7H A;  5C3E K;  3S17 C;  1WCM K;  4NOI A;  3M3Y C;  2O5I A;  2A6H A;  2JA8 K;  3GTL C;  2A69 A;  2B63 K;  3H0G C;  4XSZ A;  4MEX A;  3PO2 C;  2R7Z K;  3RZD C;  2NVT C;  3GTM C;  4X6A C;  4XLN A;  5IYC C;  4YFX A;  1TWC C;  1Y1W C;  4A3B C;  4A3I C;  1TWA K;  4A3M C;  2PPB A;  1Y1V C;  4BBR K;  2NVY K;  2Y0S D;  4A3D K;  4A3J K;  4A3E K;  3S1M K;  1YNN A;  1SFO C;  3FKI K;  1R9T C;  1I3Q C;  2JA5 C;  3S16 K;  4BXX K;  3S2D K;  4A3G C;  3M4O K;  3S15 K;  5IP9 K;  3S1N C;  4Y7N K;  4BBS C;  3H3V D;  1TWA C;  5FJ8 K;  4C3I K;  4A3M K;  4Y52 C;  3I4M K;  3HOU K;  4OIQ A;  1HQM A;  2WAQ L;  4YFK A;  3HOX C;  3DXJ A;  3S1R K;  3GTM K;  2R7Z C;  5IP9 C;  5TMC A;  1TWC K;  1Y1W K;  4QIW D;  3GTG C;  4A3C K;  2E2I K;  4YFN A;  1YNJ A;  5C4X C;  2NVX K;  1ZYR A;  1WCM C;  3GTP K;  2JA8 C;  2WB1 D;  5D4D A;  2NVY C;  3WOD A;  3H0G K;  2R92 C;  2B63 C;  3GTQ K;  5FLM K;  1K83 K;  2R93 C;  1BDF A;  3PO3 K;  5IYB C;  4G7Z A;  4BY7 K;  4BY1 C;  1IW7 A;  4MQ9 A;  5TMF A;  4Q4Z A;  3M4O C;  2NVQ C;  3K7A C;  2VUM C;  2PMZ D;  4A3K C; 
#chains in the Genus database with same CATH topology
 3ORE A;  4KB4 A;  5JVO A;  4KB2 A;  3M3Y K;  4KMU A;  5IOS A;  3S16 C;  2P5M A;  3GEE A;  4LJZ A;  4LK0 A;  4GTL A;  3S2H C;  4C3H C;  1O27 A;  4KM9 A;  3PO3 C;  3LPX A;  4BLA A;  2PA8 D;  3S17 K;  5C44 C;  3FOE A;  4QJV B;  1O29 A;  2WAQ D;  3HOW C;  2A68 A;  3HOX K;  5IP7 K;  3S1R C;  5IYD K;  1PJ6 A;  3ADA C;  3K7A K;  2O5J A;  4LLG A;  1BJT A;  4OIR A;  3HOV C;  4LK1 A;  1SFO K;  1I6H K;  1TWF K;  3GTJ C;  4AYB D;  1I6V A;  4A3I K;  4A3B K;  3GTL K;  1BS2 A;  5C4J C;  1O24 A;  1EI6 A;  1VGX A;  1TWG C;  2NVX A;  2PMZ L;  4KM8 A;  1PJ5 A;  1J6X A;  3HXA A;  4A93 K;  4WIL A;  3S15 C;  5IP7 C;  2CW0 A;  4OIO A;  2O5I A;  2A6H A;  2JA8 K;  4GTD A;  1EK8 A;  3H0G C;  4XSZ A;  4C3J C;  2NVT C;  1VJE A;  1USO A;  3SZY A;  2NVY A;  5IYC C;  4O2D A;  1Y1W C;  1J6W A;  1Y1V C;  2Y0S D;  4J3N A;  1O2F B;  1JVI A;  1YNN A;  2FQT A;  1DCO A;  4A3G C;  3S1N C;  4Y7N K;  4A3M K;  5FJ8 K;  4C3I K;  4YFK A;  1F9N A;  2CFA A;  3S1R K;  3GTM K;  2R7Z C;  1TWC K;  4QIW D;  4A3C K;  3GTO A;  2JH3 A;  1YCL A;  1ZYR A;  1XXB A;  1WCM C;  2JA8 C;  1RU0 A;  5EGH A;  1DCH A;  1WIH A;  2PHC B;  3BP3 A;  3H0G K;  2R92 C;  5FLM K;  3TFH A;  3PO3 K;  1J6V A;  1F93 A;  3M4O C;  1UV7 A;  2ZFZ A;  3AD8 C;  2XCQ A;  1WQH A;  3I4M C;  2E2I A;  4Y52 K;  3QX3 A;  1O28 A;  4KAT A;  4C2M K;  5IYD C;  3GTO C;  3RZO K;  4C3I C;  5IOT A;  4Y7N C;  5C4J K;  4BY7 C;  2R93 A;  4A3D C;  2ZUE A;  1J98 A;  1TWH C;  1TWF C;  3GTJ K;  1I50 C;  5M3F K;  3ERE D;  4BKW A;  3GTG K;  2E2I C;  4KC6 A;  4KAW X;  4GZY A;  2JA7 K;  3OEP A;  2GAH C;  2NVT K;  2GSN A;  4KN4 A;  4GFQ A;  5C3E C;  3HOZ C;  1WQG A;  1XZP A;  3I4N K;  4A3L K;  5JFE A;  2JA7 C;  2E2H A;  3EQL A;  4XCH A;  2JA5 K;  3LAP A;  3HOY C;  5C44 K;  4P5B A;  3GTK C;  5IYC K;  2E2H C;  4BBR C;  3S2H K;  3HOW K;  3AQP A;  4MEY A;  1G51 A;  5M5W K;  4X6A K;  4A3F K;  3A8K A;  3A8I A;  3HKZ L;  1KQ4 A;  3GTJ A;  1O26 A;  4JK1 A;  4BBS K;  3S14 K;  4XLP A;  2XCR B;  3OPF A;  4P9S A;  4BY1 K;  2JA7 A;  2NVQ K;  2VUM K;  3S14 C;  3I4N C;  4A3L C;  5C3E K;  4GT9 A;  1HI9 A;  3GTL C;  1X31 C;  4ILD A;  2B63 K;  3PO2 C;  1WQF A;  3SZZ A;  1IQ0 A;  4BLB A;  4A3I C;  1TWA K;  2PPB A;  4BBR K;  2CFA B;  4A3D K;  3L4K A;  3Q3Q A;  3S1M K;  1EFW A;  5HL8 A;  3FKI K;  2GSU A;  1I3Q C;  1USM A;  1R9T C;  4BXX K;  4BBS C;  1TWA C;  1AB4 A;  3HOU K;  3BP8 C;  1SFO A;  4C45 A;  1DCP A;  3T02 A;  1ZBS A;  4KAS A;  3LAJ A;  5C4X C;  1ZXO A;  2EBB A;  1K83 K;  1BDF A;  1WSR A;  1EQR A;  4MQ9 A;  5TMF A;  3T01 A;  2RGR A;  2KWA A;  3K7A C;  4FZB A;  2PMZ D;  3CQZ A;  1IL2 A;  3HOV K;  1Y1W A;  2D6F C;  4PAB A;  3CAG A;  1TWA A;  3N3Y A;  3AH5 A;  1O2B A;  4YG2 A;  1PJ7 A;  5M5Y K;  1R9T K;  3CQZ C;  4WJ3 M;  1VLO A;  5IOQ A;  5CJ9 A;  4LR2 A;  4Q5S A;  1V5V A;  3GDZ A;  1EH1 A;  1ZVU A;  2JA6 A;  3N0B A;  4XSX A;  3HOY K;  5C4X K;  3HKZ D;  2WB1 L;  3GIR A;  4KAR A;  4A93 C;  1TWG A;  2NVX C;  3PO2 K;  3L4J A;  1O25 A;  3RZO C;  4PAA A;  1TWG K;  1TWH A;  4A3K K;  3TTG A;  1JOE A;  1WOP A;  3AD7 C;  4OIN A;  1I3Q K;  2Y3P A;  1TWH K;  4BXX C;  2E2J C;  2R92 K;  4QJV A;  3S2D C;  3VA7 A;  1XZQ B;  4P5A A;  3TFJ A;  5M5X K;  5IYB K;  3S1Q C;  2R93 K;  1SMY A;  1XZP B;  1L0W A;  4QIW L;  1XXA A;  4C3H K;  5E68 A;  2JA6 C;  4C3J K;  3RZD K;  1INN A;  1Y1V A;  3HOZ K;  2RH6 A;  4ZH4 A;  2YU9 K;  1I6H C;  3FKI C;  1VH2 A;  2JA5 A;  3S1N K;  3H3V L;  1XPP A;  1I50 K;  4G7H A;  2R7Z A;  5TJ3 A;  4NOI A;  3M3Y C;  3FOF A;  4LOW A;  2A69 A;  3IPJ A;  1WCM A;  3NUH A;  4GTC A;  1F7V A;  4MEX A;  3RZD C;  2R7Z K;  1IBA A;  1GE9 A;  2R92 A;  4GTB A;  1XZQ A;  4KMA A;  4GTE A;  4G0V A;  4A3B C;  1WOO A;  4A3M C;  3GTQ A;  3GEH A;  3A8J A;  4A3J K;  4A3E K;  4KDD A;  2JA5 C;  4C2M C;  4GTA A;  3M4O K;  3S15 K;  5IP9 K;  1IS1 A;  3H3V D;  2VUM A;  4Y52 C;  3I4M K;  3HOX C;  4AH6 A;  1C0A A;  2B63 A;  5IP9 C;  3GTG C;  4KMH A;  2E2I K;  4YFN A;  1I50 A;  1WSV A;  2GAG C;  5D4D A;  1ZQ1 C;  2NVY C;  3WOD A;  2B63 C;  2R93 C;  5IYB C;  4G7Z A;  4BY1 C;  1IW7 A;  3T00 A;  1JQW A;  4Q4Z A;  2NVQ C;  2VUM C;  4A3K C;  1TWC A;  3S0X A;  5M3M K;  4OIP A;  2ZUF A;  1Y1V K;  2V6T A;  4A3G K;  3H0G A;  2BE5 A;  3GTG A;  3BUE A;  4WJ4 A;  3GTK A;  1VRQ C;  3JST A;  2YU9 C;  2JA6 K;  4G0W A;  3TFI A;  2PA8 L;  3GTQ C;  2A6E A;  1IE0 A;  2FQO A;  5FLM C;  3G4C A;  3GTK K;  3S1M C;  3S1Q K;  2E2H K;  3GEI A;  4A3C C;  3GTL A;  3GTP C;  4KMD A;  2XCO A;  3FKI A;  1DD5 A;  4DDQ A;  4M1X A;  5EGE A;  2W7V A;  3GTO K;  4AYB L;  1XXC A;  2Y0S L;  3G4A A;  4A3E C;  4GTF A;  4G7O A;  2GSO A;  1K83 C;  4A3F C;  1WOS A;  1TWF A;  2P8T A;  1K83 A;  1B4B A;  1O2A A;  1WOR A;  2YU9 A;  3MML B;  3CQZ K;  3HOU C;  1BGW A;  4KN7 A;  3FHZ A;  2E2J K;  4A3J C;  3GSI A;  1ISE A;  3N0C A;  1I3Q A;  3S17 C;  3GTP A;  1WCM K;  2V6U A;  5L46 A;  4X6A C;  3GTM C;  4G0U A;  5CHP A;  4XLN A;  4YFX A;  3AD9 C;  1TWC C;  2NVY K;  1SFO C;  3S16 K;  4FM9 A;  5IOR A;  3S2D K;  3V4G A;  1B4A A;  4OIQ A;  1HQM A;  2WAQ L;  1F7U A;  3DXJ A;  5TMC A;  1Y1W K;  3GTM A;  1YNJ A;  2NVX K;  3GTP K;  2WB1 D;  3GTQ K;  1R9T A;  3AQO A;  4RMF A;  4BY7 K;  1YX2 A;  4LQY A;  2V6S A; 
#chains in the Genus database with same CATH homology
 5M3M K;  4OIP A;  3I4M C;  4Y52 K;  3M3Y K;  1Y1V K;  4YG2 A;  4KMU A;  4C2M K;  5M5Y K;  5IYD C;  2BE5 A;  3GTO C;  4A3G K;  3RZO K;  1R9T K;  3CQZ C;  3S16 C;  4LJZ A;  4LK0 A;  4Y7N C;  2YU9 C;  2JA6 K;  3S2H C;  4Q5S A;  2PA8 L;  5C4J K;  4BY7 C;  3GTQ C;  2A6E A;  4A3D C;  3PO3 C;  3GTK K;  5FLM C;  3S1M C;  2PA8 D;  4XSX A;  1TWH C;  1TWF C;  3GTJ K;  1I50 C;  3HOY K;  3S17 K;  5C44 C;  3S1Q K;  2E2H K;  5C4X K;  3HKZ D;  5M3F K;  2WB1 L;  3GTG K;  4A3C C;  4QJV B;  2E2I C;  3GTP C;  2WAQ D;  4A93 C;  2NVX C;  3HOW C;  2JA7 K;  3PO2 K;  4GZY A;  2NVT K;  2A68 A;  3HOX K;  5IP7 K;  4KN4 A;  3S1R C;  3HOV K;  5IYD K;  3RZO C;  5C3E C;  1TWG K;  3GTO K;  3HOZ C;  3K7A K;  4AYB L;  4LLG A;  3I4N K;  4A3L K;  2O5J A;  4A3K K;  2JA7 C;  2Y0S L;  4OIR A;  4A3E C;  3HOV C;  4G7O A;  3EQL A;  4LK1 A;  1SFO K;  4OIN A;  1I6H K;  1I3Q K;  2JA5 K;  1TWH K;  3HOY C;  2E2J C;  2R92 K;  4QJV A;  3S2D C;  5C44 K;  4BXX C;  3GTK C;  1K83 C;  2R93 K;  1TWF K;  5M5X K;  5IYB K;  3GTJ C;  4AYB D;  4A3F C;  5IYC K;  3S1Q C;  1SMY A;  2E2H C;  1I6V A;  4A3L C;  4BBR C;  4QIW L;  4A3I K;  4C3H K;  4A3B K;  2JA6 C;  3HOW K;  3S2H K;  4MEY A;  3GTL K;  4C3J K;  5C4J C;  5M5W K;  3RZD K;  4X6A K;  4A3F K;  3HKZ L;  3HOZ K;  1TWG C;  2PMZ L;  4JK1 A;  3CQZ K;  3HOU C;  3S14 K;  4BBS K;  4XLP A;  4ZH4 A;  2YU9 K;  1I6H C;  4KN7 A;  4A93 K;  2E2J K;  4BY1 K;  4A3J C;  3FKI C;  3S1N K;  3S15 C;  3H3V L;  5IP7 C;  2NVQ K;  2VUM K;  3S14 C;  3I4N C;  1XPP A;  1I50 K;  2CW0 A;  4OIO A;  4G7H A;  5C3E K;  3S17 C;  1WCM K;  4NOI A;  3M3Y C;  2O5I A;  2A6H A;  2JA8 K;  3GTL C;  2A69 A;  2B63 K;  3H0G C;  4XSZ A;  4MEX A;  3PO2 C;  2R7Z K;  3RZD C;  2NVT C;  3GTM C;  4X6A C;  4XLN A;  5IYC C;  4YFX A;  1TWC C;  1Y1W C;  4A3B C;  4A3I C;  1TWA K;  4A3M C;  2PPB A;  1Y1V C;  4BBR K;  2NVY K;  2Y0S D;  4A3D K;  4A3J K;  4A3E K;  3S1M K;  1YNN A;  1SFO C;  3FKI K;  1R9T C;  1I3Q C;  2JA5 C;  3S16 K;  4BXX K;  3S2D K;  4A3G C;  3M4O K;  3S15 K;  5IP9 K;  3S1N C;  4Y7N K;  4BBS C;  3H3V D;  1TWA C;  5FJ8 K;  4C3I K;  4A3M K;  4Y52 C;  3I4M K;  3HOU K;  4OIQ A;  1HQM A;  2WAQ L;  4YFK A;  3HOX C;  3DXJ A;  3S1R K;  3GTM K;  2R7Z C;  5IP9 C;  5TMC A;  1TWC K;  1Y1W K;  4QIW D;  3GTG C;  4A3C K;  2E2I K;  4YFN A;  1YNJ A;  5C4X C;  2NVX K;  1ZYR A;  1WCM C;  3GTP K;  2JA8 C;  2WB1 D;  5D4D A;  2NVY C;  3WOD A;  3H0G K;  2R92 C;  2B63 C;  3GTQ K;  5FLM K;  1K83 K;  2R93 C;  1BDF A;  3PO3 K;  5IYB C;  4G7Z A;  4BY7 K;  4BY1 C;  1IW7 A;  4MQ9 A;  5TMF A;  4Q4Z A;  3M4O C;  2NVQ C;  3K7A C;  2VUM C;  2PMZ D;  4A3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...