3H0GL

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
45
structure length
45
Chain Sequence
b'TMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 1
structure length 45
sequence length 45
chains with identical sequence X
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03604 DNA_RNApol_7kD DNA directed RNA polymerase, 7 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.30 Mainly Beta Single Sheet Rubrerythrin, domain 2 RNA polymerase ii, chain L 3h0gL00
4C3IL 2NVYL 3PO2L 3RZOL 5IYCL 5IP9L 4A3GL 3I4ML 3S1QL 1TWAL 4QIWP 3GTGL 2B63L 4C3JL 5FLML 3GTJL 3GTQL 5M5WL 1TWFL 1K83L 5C4XL 5IP7L 3PO3L 3S1RL 1Y1VL 2WB1P 2E2IL 4BBRL 2JA6L 4X6AL 3S2HL 5IYBL 4BBSL 1I50L 2JA7L 2JA8L 3HOZL 2R93L 1Y1WL 1WCML 2E2HL 5M3ML 2WAQP 3GTML 4A3BL 2R7ZL 4A3FL 4A3IL 4C3HL 3GTOL 3S1NL 2NVXL 3H0GL 3S2DL 3S14L 2E2JL 4A3KL 1R9TL 2R92L 5C4JL 3S15L 2NVTL 2VUML 4A3ML 3HOXL 4A3EL 4A93L 1TWHL 3FKIL 3RZDL 4BXXL 4A3LL 5IYDL 2JA5L 5M3FL 3HOVL 4BY1L 4A3JL 3H3VM 1TWGL 3CQZL 3GTLL 4Y7NL 3S17L 3S16L 3GTPL 3HKZP 3GTKL 2PMZP 3M4OL 1SFOL 4C2M1 3HOYL 3I4NL 5C44L 5M5XL 4BY7L 4A3DL 5C3EL 4AYBP 2YU9L 3HOWL 1I3QL 3M3YL 4A3CL 1I6HL 2NVQL 5FJ8L 3S1ML 2Y0SP 4Y52L 3HOUL 1TWCL 5M5YL 3K7AL
chains in the Genus database with same CATH superfamily
3MQKB 3J7Z1 3MSUA 5MFZA 5IYCL 1YV1A 4A3GL 1R0HA 3A44A 3I4ML 1S2ZA 2V0FA 3LWPB 2L0ZA 4QIWP 1F4LA 3QVDA 5FLML 3RZ6A 2RDVA 2B5ID 3PO3L 2JI2A 1IU5A 1YK4A 2JA6L 4X6AL 1RWDA 1I50L 1B2JA 1WCML 4JAFA 5GADc 2XJUA 3H99A 5GAHc 4A3BL 4TVMA 1YK5A 1FHHA 2PSMC 3S2DL 3S14L 4A3KL 2A69D 5MF6A 4UY81 3KYYA 3S15L 1CAAA 2NVTL 1IRNA 2EY4E 3LWRB 2HR5A 3WWNB 4A93L 2RFKB 1TWHL 3FKIL 3RZDL 4A3LL 3LWOB 4JAGA 5MGNA 3HOVL 1DX8A 3PIO1 5DM61 3K35A 3GTPL 4AHXA 5JVG1 1BRFA 3HKZP 3GTKL 3PKIA 1SFOL 3HOYL 4GS7D 3I4NL 5MFPA 3H97A 5M5XL 5EIOC 1NXEA 1OWCA 2KN9A 3M3YL 3RZTA 1PFVA 3P8BA 5FJ8L 5GAEc 2MS3A 1SMMA 4POFA 2ERJA 1TWCL 3K7AL 5JVH1 2CKCA 3B08B 2NVYL 3PO2L 1IU6A 1BQ9A 1T9PA 5RXNA 1TWAL 2O5JD 1S24A 5AN9H 2M4YA 2NYDA 2XJRA 2ZIXA 5C4XL 3HAXC 3PKJA 4AI2A 3KYVA 2XJSA 1BQ8A 3HOZL 4AHWA 2E2HL 1T9QA 3GTML 5AI2A 4A3FL 4TPUA 4C3HL 4WFN1 3RYGA 1LKMA 3PZAA 2R92L 2ERSA 1LTLA 4LHLA 1B71A 3HOXL 2PVXA 4A3EL 3KYXA 4BXXL 2V3BB 4BY1L 2PVEA 4YWLA 1SMUA 3H3VM 3GTLL 3S17L 1B13A 7RXNA 1S30A 2VL6A 1OWBA 3IU3I 1R0GA 4C2M1 2M6OA 2A6HD 2PPTA 4AI0A 2QL0A 4G6BA 3PWFA 1IROA 1FHMA 4XXBB 2XJQA 1R0IA 4A3CL 1I6HL 4JAEA 2KKDA 3S1ML 3PL5A 1RYTA 3JR7A 4V196 3MPSA 1RYQA 3RZOL 5GAGc 4AHZA 4K9FA 1E8JA 1LKOA 5AI3A 1LKPA 1BFYA 3KYUA 2M4VA 1SMWA 5IY0A 1ZRPA 4C3JL 3GTQL 2Z3QB 2XJVA 3P2AA 2A6ED 1R0FA 1TWFL 5H1Sc 2LCQA 1QYBA 3WWLA 3H9CA 2WB1P 2DSXA 1ODHA 3S2HL 5IYBL 1B2OA 3FDJA 2R93L 1Y1WL 2PYAA 5M3ML 1VZGA 1QQTA 3S1NL 1R0JA 1VCXA 3H0GL 2JI1A 2E2JL 4AR5A 1PFWA 5EINC 2VUML 3HJWB 5MLC3 4AR4A 1PFYA 2CKAA 5IYDL 4XGHA 4B8CD 2AYJA 5M3FL 3SS2A 3LNLA 1DVBA 1NNQA 1VZIA 2M6PA 2PMZP 1C09A 2GMGA 1T9OA 2XJTA 3PIP1 2BE5D 4AI1A 5DM71 3J7Y1 3HOWL 2AUSB 1IW7D 3NFPI 3LWVB 2C6AA 2Y0SP 4Y52L 2Z3RB 2A68D 4ME3A 2AQCA 1Y1VL 5M5YL 1PZXA 4LHNA 4C3IL 1H7VA 2XJPA 1QCVA 3LWQB 5IP9L 3B0AB 4JADA 3S1QL 1YUXA 4ZN3B 3GTGL 4U671 2B63L 3GTJL 5M5WL 4RXNA 4AR6A 1K83L 5IP7L 4AI3A 3S1RL 5K2ME 2HVYC 2E2IL 4BBRL 4BBSL 1Z92B 3QQCE 2JA8L 2JA7L 4AR3A 2J9UB 1RDVA 3H9BA 2WAQP 1VZHA 2R7ZL 4A3IL 3GTOL 2NVXL 1RDGA 2K2DA 1R9TL 5C4JL 4A3ML 2C6BA 4E6YA 4YWMA 6RXNA 1P7PA 2JA5L 2JI3A 1CADA 1RB9A 3KYWA 2CR8A 3LPEB 4POGA 1NXGA 1WJVA 4A3JL 2V0EA 1TWGL 3CQZL 4Y7NL 3S16L 8RXNA 1JYBA 2APOB 3HJYB 3M4OL 3ZG6A 1PFUA 5C44L 4ZN1B 1BE7A 4BY7L 4A3DL 1YUZA 5C3EL 4AYBP 2YU9L 1I3QL 2H12A 3VPBE 2NVQL 4AHYA 3HOUL
chains in the Genus database with same CATH topology
4C3IL 2NVYL 3PO2L 3RZOL 5IYCL 5IP9L 4A3GL 3I4ML 3S1QL 1TWAL 4QIWP 3GTGL 2B63L 4C3JL 5FLML 3GTJL 3GTQL 5M5WL 1TWFL 1K83L 5C4XL 5IP7L 3PO3L 3S1RL 1Y1VL 2WB1P 2E2IL 4BBRL 2JA6L 4X6AL 3S2HL 5IYBL 4BBSL 1I50L 2JA7L 2JA8L 3HOZL 2R93L 1Y1WL 1WCML 2E2HL 5M3ML 2WAQP 3GTML 4A3BL 2R7ZL 4A3FL 4A3IL 4C3HL 3GTOL 3S1NL 2NVXL 3H0GL 3S2DL 3S14L 2E2JL 4A3KL 1R9TL 2R92L 5C4JL 3S15L 2NVTL 2VUML 4A3ML 3HOXL 4A3EL 4A93L 1TWHL 3FKIL 3RZDL 4BXXL 4A3LL 5IYDL 2JA5L 5M3FL 3HOVL 4BY1L 4A3JL 3H3VM 1TWGL 3CQZL 3GTLL 4Y7NL 3S17L 3S16L 3GTPL 3HKZP 3GTKL 2PMZP 3M4OL 1SFOL 4C2M1 3HOYL 3I4NL 5C44L 5M5XL 4BY7L 4A3DL 5C3EL 4AYBP 2YU9L 3HOWL 1I3QL 3M3YL 4A3CL 1I6HL 2NVQL 5FJ8L 3S1ML 2Y0SP 4Y52L 3HOUL 1TWCL 5M5YL 3K7AL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I L;  2NVY L;  3PO2 L;  3RZO L;  5IYC L;  5IP9 L;  4A3G L;  3I4M L;  3S1Q L;  1TWA L;  4QIW P;  3GTG L;  2B63 L;  4C3J L;  5FLM L;  3GTJ L;  3GTQ L;  5M5W L;  1TWF L;  1K83 L;  5C4X L;  5IP7 L;  3PO3 L;  3S1R L;  1Y1V L;  2WB1 P;  2E2I L;  4BBR L;  2JA6 L;  4X6A L;  3S2H L;  5IYB L;  4BBS L;  1I50 L;  2JA7 L;  2JA8 L;  3HOZ L;  2R93 L;  1Y1W L;  1WCM L;  2E2H L;  5M3M L;  2WAQ P;  3GTM L;  4A3B L;  2R7Z L;  4A3F L;  4A3I L;  4C3H L;  3GTO L;  3S1N L;  2NVX L;  3H0G L;  3S2D L;  3S14 L;  2E2J L;  4A3K L;  1R9T L;  2R92 L;  5C4J L;  3S15 L;  2NVT L;  2VUM L;  4A3M L;  3HOX L;  4A3E L;  4A93 L;  1TWH L;  3FKI L;  3RZD L;  4BXX L;  4A3L L;  5IYD L;  2JA5 L;  5M3F L;  3HOV L;  4BY1 L;  4A3J L;  3H3V M;  1TWG L;  3CQZ L;  3GTL L;  4Y7N L;  3S17 L;  3S16 L;  3GTP L;  3HKZ P;  3GTK L;  2PMZ P;  3M4O L;  1SFO L;  4C2M 1;  3HOY L;  3I4N L;  5C44 L;  5M5X L;  4BY7 L;  4A3D L;  5C3E L;  4AYB P;  2YU9 L;  3HOW L;  1I3Q L;  3M3Y L;  4A3C L;  1I6H L;  2NVQ L;  5FJ8 L;  3S1M L;  2Y0S P;  4Y52 L;  3HOU L;  1TWC L;  5M5Y L;  3K7A L; 
#chains in the Genus database with same CATH topology
 3MQK B;  3J7Z 1;  3MSU A;  5MFZ A;  5IYC L;  1YV1 A;  4A3G L;  1R0H A;  3A44 A;  3I4M L;  1S2Z A;  2V0F A;  3LWP B;  2L0Z A;  4QIW P;  1F4L A;  3QVD A;  5FLM L;  3RZ6 A;  2RDV A;  2B5I D;  3PO3 L;  2JI2 A;  1IU5 A;  1YK4 A;  2JA6 L;  4X6A L;  1RWD A;  1I50 L;  1B2J A;  1WCM L;  4JAF A;  5GAD c;  2XJU A;  3H99 A;  5GAH c;  4A3B L;  4TVM A;  1YK5 A;  1FHH A;  2PSM C;  3S2D L;  3S14 L;  4A3K L;  2A69 D;  5MF6 A;  4UY8 1;  3KYY A;  3S15 L;  1CAA A;  2NVT L;  1IRN A;  2EY4 E;  3LWR B;  2HR5 A;  3WWN B;  4A93 L;  2RFK B;  1TWH L;  3FKI L;  3RZD L;  4A3L L;  3LWO B;  4JAG A;  5MGN A;  3HOV L;  1DX8 A;  3PIO 1;  5DM6 1;  3K35 A;  3GTP L;  4AHX A;  5JVG 1;  1BRF A;  3HKZ P;  3GTK L;  3PKI A;  1SFO L;  3HOY L;  4GS7 D;  3I4N L;  5MFP A;  3H97 A;  5M5X L;  5EIO C;  1NXE A;  1OWC A;  2KN9 A;  3M3Y L;  3RZT A;  1PFV A;  3P8B A;  5FJ8 L;  5GAE c;  2MS3 A;  1SMM A;  4POF A;  2ERJ A;  1TWC L;  3K7A L;  5JVH 1;  2CKC A;  3B08 B;  2NVY L;  3PO2 L;  1IU6 A;  1BQ9 A;  1T9P A;  5RXN A;  1TWA L;  2O5J D;  1S24 A;  5AN9 H;  2M4Y A;  2NYD A;  2XJR A;  2ZIX A;  5C4X L;  3HAX C;  3PKJ A;  4AI2 A;  3KYV A;  2XJS A;  1BQ8 A;  3HOZ L;  4AHW A;  2E2H L;  1T9Q A;  3GTM L;  5AI2 A;  4A3F L;  4TPU A;  4C3H L;  4WFN 1;  3RYG A;  1LKM A;  3PZA A;  2R92 L;  2ERS A;  1LTL A;  4LHL A;  1B71 A;  3HOX L;  2PVX A;  4A3E L;  3KYX A;  4BXX L;  2V3B B;  4BY1 L;  2PVE A;  4YWL A;  1SMU A;  3H3V M;  3GTL L;  3S17 L;  1B13 A;  7RXN A;  1S30 A;  2VL6 A;  1OWB A;  3IU3 I;  1R0G A;  4C2M 1;  2M6O A;  2A6H D;  2PPT A;  4AI0 A;  2QL0 A;  4G6B A;  3PWF A;  1IRO A;  1FHM A;  4XXB B;  2XJQ A;  1R0I A;  4A3C L;  1I6H L;  4JAE A;  2KKD A;  3S1M L;  3PL5 A;  1RYT A;  3JR7 A;  4V19 6;  3MPS A;  1RYQ A;  3RZO L;  5GAG c;  4AHZ A;  4K9F A;  1E8J A;  1LKO A;  5AI3 A;  1LKP A;  1BFY A;  3KYU A;  2M4V A;  1SMW A;  5IY0 A;  1ZRP A;  4C3J L;  3GTQ L;  2Z3Q B;  2XJV A;  3P2A A;  2A6E D;  1R0F A;  1TWF L;  5H1S c;  2LCQ A;  1QYB A;  3WWL A;  3H9C A;  2WB1 P;  2DSX A;  1ODH A;  3S2H L;  5IYB L;  1B2O A;  3FDJ A;  2R93 L;  1Y1W L;  2PYA A;  5M3M L;  1VZG A;  1QQT A;  3S1N L;  1R0J A;  1VCX A;  3H0G L;  2JI1 A;  2E2J L;  4AR5 A;  1PFW A;  5EIN C;  2VUM L;  3HJW B;  5MLC 3;  4AR4 A;  1PFY A;  2CKA A;  5IYD L;  4XGH A;  4B8C D;  2AYJ A;  5M3F L;  3SS2 A;  3LNL A;  1DVB A;  1NNQ A;  1VZI A;  2M6P A;  2PMZ P;  1C09 A;  2GMG A;  1T9O A;  2XJT A;  3PIP 1;  2BE5 D;  4AI1 A;  5DM7 1;  3J7Y 1;  3HOW L;  2AUS B;  1IW7 D;  3NFP I;  3LWV B;  2C6A A;  2Y0S P;  4Y52 L;  2Z3R B;  2A68 D;  4ME3 A;  2AQC A;  1Y1V L;  5M5Y L;  1PZX A;  4LHN A;  4C3I L;  1H7V A;  2XJP A;  1QCV A;  3LWQ B;  5IP9 L;  3B0A B;  4JAD A;  3S1Q L;  1YUX A;  4ZN3 B;  3GTG L;  4U67 1;  2B63 L;  3GTJ L;  5M5W L;  4RXN A;  4AR6 A;  1K83 L;  5IP7 L;  4AI3 A;  3S1R L;  5K2M E;  2HVY C;  2E2I L;  4BBR L;  4BBS L;  1Z92 B;  3QQC E;  2JA8 L;  2JA7 L;  4AR3 A;  2J9U B;  1RDV A;  3H9B A;  2WAQ P;  1VZH A;  2R7Z L;  4A3I L;  3GTO L;  2NVX L;  1RDG A;  2K2D A;  1R9T L;  5C4J L;  4A3M L;  2C6B A;  4E6Y A;  4YWM A;  6RXN A;  1P7P A;  2JA5 L;  2JI3 A;  1CAD A;  1RB9 A;  3KYW A;  2CR8 A;  3LPE B;  4POG A;  1NXG A;  1WJV A;  4A3J L;  2V0E A;  1TWG L;  3CQZ L;  4Y7N L;  3S16 L;  8RXN A;  1JYB A;  2APO B;  3HJY B;  3M4O L;  3ZG6 A;  1PFU A;  5C44 L;  4ZN1 B;  1BE7 A;  4BY7 L;  4A3D L;  1YUZ A;  5C3E L;  4AYB P;  2YU9 L;  1I3Q L;  2H12 A;  3VPB E;  2NVQ L;  4AHY A;  3HOU L; 
#chains in the Genus database with same CATH homology
 4C3I L;  2NVY L;  3PO2 L;  3RZO L;  5IYC L;  5IP9 L;  4A3G L;  3I4M L;  3S1Q L;  1TWA L;  4QIW P;  3GTG L;  2B63 L;  4C3J L;  5FLM L;  3GTJ L;  3GTQ L;  5M5W L;  1TWF L;  1K83 L;  5C4X L;  5IP7 L;  3PO3 L;  3S1R L;  1Y1V L;  2WB1 P;  2E2I L;  4BBR L;  2JA6 L;  4X6A L;  3S2H L;  5IYB L;  4BBS L;  1I50 L;  2JA7 L;  2JA8 L;  3HOZ L;  2R93 L;  1Y1W L;  1WCM L;  2E2H L;  5M3M L;  2WAQ P;  3GTM L;  4A3B L;  2R7Z L;  4A3F L;  4A3I L;  4C3H L;  3GTO L;  3S1N L;  2NVX L;  3H0G L;  3S2D L;  3S14 L;  2E2J L;  4A3K L;  1R9T L;  2R92 L;  5C4J L;  3S15 L;  2NVT L;  2VUM L;  4A3M L;  3HOX L;  4A3E L;  4A93 L;  1TWH L;  3FKI L;  3RZD L;  4BXX L;  4A3L L;  5IYD L;  2JA5 L;  5M3F L;  3HOV L;  4BY1 L;  4A3J L;  3H3V M;  1TWG L;  3CQZ L;  3GTL L;  4Y7N L;  3S17 L;  3S16 L;  3GTP L;  3HKZ P;  3GTK L;  2PMZ P;  3M4O L;  1SFO L;  4C2M 1;  3HOY L;  3I4N L;  5C44 L;  5M5X L;  4BY7 L;  4A3D L;  5C3E L;  4AYB P;  2YU9 L;  3HOW L;  1I3Q L;  3M3Y L;  4A3C L;  1I6H L;  2NVQ L;  5FJ8 L;  3S1M L;  2Y0S P;  4Y52 L;  3HOU L;  1TWC L;  5M5Y L;  3K7A L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...