3H0IA

Human fyn sh3 domain r96i mutant, crystal form ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'VTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
molecule tags Transferase
source organism Homo sapiens
publication title SH3 domain specificity
rcsb
total genus 11
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0iA00
2RPNA 1HJDA 2LZ6B 2K2MA 1ZUUA 2K3BA 2CDTA 2EGAA 1M3AA 1YNZA 1ZUKA 5FWBA 1K1ZA 1BU1A 5IH2A 2BZYA 2FPDA 3M0TA 4AG2C 5ECAA 1NEGA 1X27A 1X69A 3O5ZA 2ROTA 2CREA 4J9DA 2EYXA 2DRKA 1CSKA 4F17A 2LCSA 1M3CA 2V1RA 1U06A 1AD5A 2DVJA 1H8KA 1WX6A 2O9VA 2YUQA 1K76A 2RF0A 2A36A 1BB9A 1UUEA 3VRZA 1PKSA 1M27C 5HCKA 1GBRA 2CT4A 2EYYA 1BK2A 1X2QA 2KEAA 2YT6A 1QWFA 3VS5A 4RTZA 1VYTA 4HVWA 1NLOC 3M0QA 2PNIA 3VS1A 1XOVA 4QT7A 2YUNA 1K9AA 1JXOA 1X6GA 2L2PA 1B07A 1GBQA 2EPDA 3KFVA 1TUCA 1UTIA 4WCIA 4LUDA 2EYWA 2LQNA 2JT4A 3RBBB 3ZL7C 4D8DA 2H8HA 1UG1A 1PNJA 1AWWA 4F16A 1B3QA 2ED1A 1NLPC 2L3QA 1WA7A 1UHCA 2JTEA 2XMFA 3M0SA 1QLYA 2I0NA 2FPFA 2DL5A 1K0SA 2LJ0A 1KFZA 1NEBA 2KGTA 2YUOA 2KYMA 2YSQA 2DM1A 1JU5C 3VRYA 2AKKA 2KXDA 2LP5A 2E5KA 2RQVA 4Z8AA 1KJWA 2VWFA 2AZSA 5I11A 1ZLMA 3NHNA 2CH4W 2JMAA 1I07A 4AG1C 2LJ3A 4LUEA 2JS0A 3REAB 2GGRA 1OPLA 1A0NB 2FPEA 2DL3A 1PWTA 1UE9A 2X3WD 4OMQA 1SSHA 4LE9A 2O88A 1GFDA 2VVKA 2J05A 3QWXX 2D1XA 1GCPA 3A98A 4ZNXA 1JXMA 2NWMA 4D8KA 1T3SA 2L3SA 2HSPA 4J9CA 3VS2A 3H41A 2C0IA 4OMMA 3VS4A 2HDAA 3PE0A 4LN2A 1YWOA 1WYXA 1Z9ZA 1ZX6A 1TUDA 3I5RA 4ESRA 2F2WA 2EYZA 4RTUA 2CH4A 2JW4A 4R0KA 1RLQC 3TSZA 3M0PA 4Z89A 1G2BA 5FWCA 2JS2A 4KRTA 2AKLA 2EGCA 4JZ3A 1AWXA 2KNBB 2C0TA 3H0HA 2KBTA 2M51A 3I35A 4J9IA 4RTWA 4ORZA 2DMOA 2DE0X 4CC4B 4CC2A 2FRYA 1CKBA 1NG2A 1X43A 4OMPA 4J9EA 1AVZC 2F2XA 1GL5A 1YWPA 2HEQA 2O31A 3M0UA 2CSIA 3UA7A 3H0FA 2FG0A 3REBB 1FYNA 3LH5A 1E7OA 1WLPB 1QWEA 3NPFA 2DL4A 1S1NA 1SHFA 5IHIA 3EG3A 1V1CA 4DEXA 1N5ZA 4AFQC 4FSSA 2BTTA 1WI7A 3TVTA 4RTVA 2X3XD 5IXFA 4F14A 1IO6A 5L23A 2JXBA 3PVQA 1QKXA 2PZ1A 1RI9A 2EVRA 1WXBA 3UATA 2D0NA 4Z88A 2J6FA 1M8MA 2BZ8A 1GCQC 2ROLA 2W0ZA 2JM8A 1AWJA 1W1FA 4X1VA 1ABOA 1AWOA 5GJWB 1RLPC 1MV0B 3C0CA 5EC7A 1GFCA 2KE9A 4OMNA 1YN8A 4JJBA 2CSQA 1QKWA 4LNPA 2DX1A 2FO0A 3EGUA 2D8JA 3EHQA 4AFUC 3M0RA 2YDLA 5IXBA 1VYVA 4JPBW 4M4ZA 1T0JA 3VS6A 2EW3A 3I9QA 2ESWA 2KRMA 3FJ5A 2KT8A 2ABLA 1PRMC 3NGPA 2A37A 2J06A 2RN8A 3VS7A 2ED0A 1T0HA 1ABQA 1Z9QA 3GBQA 2GQIA 2L0AA 3R6NA 2RQUA 2MCNA 2KRSA 4GBQA 4RTYA 2GTJA 3UA6A 1G83A 2J7IA 2A28A 2DF6A 1E6HA 2PTKA 3VS0A 1GCQA 2B86A 4OMLA 2NUZA 1PRLC 3SHWA 1LCKA 2QDLA 2SEMA 2OI3A 1ZUYA 2DNUA 2SRCA 2KROA 5IHNA 1QCFA 2DILA 1AZEA 2KYBA 2MOXA 2P4RA 4J9GA 1WXUA 1SRLA 1RUWA 4J9HA 1W70A 2CUBA 3PVLA 1NM7A 2GNCA 1WFWA 1WXTA 2RNAA 4IIOA 1SHGA 1ARKA 2FRWA 2O9SA 1I0CA 2DL8A 2KR3A 2K7AA 2F2VA 1AZGB 1SEMA 2A08A 4JZ4A 1YCSB 3SEMA 4CC7A 1YP5A 2J6KA 1KIKA 3H0IA 2AZVA 2RQTA 2RQWA 2EGEA 2JM9A 5FW9A 4Y92A 3IQLA 5IHKA 2DYBA 1MV3A 5I22A 1OPKA 2KRNA 1MUZA 2V1QA 2IIMA 1EFNA 1AEYA 1UHFA 4RUGA 2ENMA 4J9FA 4OMOA 2AK5A 4HCKA 2DBKA 4DEYA 2DL7A 3EHRA 2FEIA 3EG0A 1UJ0A 3CQTA 3QWYA 2OJ2A 4HVUA 1PHTA 1H92A 2DLPA 1HD3A 2RMOA 1T3LA 1E6GA 2LNHB 3UF4A 1K0XA 2LX7A 1K4US 1X2KA 1OV3A 3TSWA 2OAWA 3RNJA 2D8HA 4HXJA 4K11A 1NYGA 4EIKA 4JJCA 1WIEA 3JV3A 1UDLA 3THKA 2C0OA 1FMKA 1CKAA 1X6BA 1JQQA 2LMJA 4A63B 2DA9A 3ULRB 2YUPA 2DJQA 1UJYA 2W10A 1KSWA 4GLMA 1M3BA 2KT1A 4AFZC 1U3OA 1WDXA 4HVVA 2VKNA 2GTOA 2JMCA 1GRIA 1OEBA 1NYFA 2BZXA 2ECZA 2DRMA 2J6OA 1M30A 1Y0MA 5GJVB 1OOTA 1ZSGA 1JEGA 1BBZA 2K9GA 2CT3A 1SPKA 2HBWA 1UGVA 1ZBJA 2EKHA 2EQIA 1Y57A 3EG2A 1H3HA 1HSQA 4E6RA 2O2OA 4RTXA 4CC3A 1VA7A 1PKTA 2CUDA 1UFFA 4AFSC 1AOJA 2K6DA 2MIOA 2LQWA 2EBPA 2GBQA 1JO8A 1J3TA 1SRMA 4RTTA 3NMZC 4J9BA 2RQRA 1W6XA 3U23A 2LJ1A 1VYUA 2K79A 2HCKA 2G6FX 2M0YA 3I5SA 2L3PA 2DBMA 4IIMA 3EG1A 1TG0A 4JJDA 3VS3A 2KXCA 1U5SA 1I1JA 1UECA
chains in the Genus database with same CATH superfamily
4LDUA 1UB4A 3EH1A 4DQ2A 4ZGEB 3OYKA 2K3BA 4OB3B 2HBPA 4A53A 1XTDA 5FWBA 3JAME 3V7RA 1BU1A 5IH2A 3E1SA 3F70A 2FPDA 3E2UA 1WZOA 2E65A 1NEGA 3E19A 1X27A 3CC2A 2PUOB 3VJPA 3OYLA 1YJ9A 3CCUQ 4J9DA 4O5VA 2OX7A 2DRKA 4F17A 2LCSA 2QQAA 2YRDA 1XJWB 3OS2A 1K76A 1BB9A 1UUEA 3OYHA 3SB2A 5HCKA 1W2BA 5GAMg 1X2QA 2COWA 2KEAA 1QWFA 2HSEB 4RTZA 1BCMA 3CCUT 1MMGA 1NLOC 3PT9A 2PNIA 1M90C 1XOVA 1H3ZA 4M77E 3G4SA 1K9AA 2YWWA 1JXOA 1B07A 1NJIC 2QAZA 1V76A 1NE8A 4WCIA 3OYMA 4FYYB 5IN1A 1R77A 2NUPB 3RBBB 4ZN3A 5LJ3d 1XNIA 5AT1B 4OMFB 4F16A 1OI1A 2EKOA 1K9MR 3CMAT 1VQ7A 2YRVA 1ACMB 3M0SA 2P0PA 1I8FA 4MZPA 2I0NA 2FPFA 2F69A 1JBMA 2KGTA 3GLXA 1WJRA 2YUOA 3GIBA 4RG2A 2LCLA 3JCMW 1QMCA 1KD1U 5GMKm 2AKKA 2KXDA 2LP5A 1EIFA 2E5KA 2RQVA 5KH6A 2CH4W 4FT2A 4QVZA 1Y96B 4LUEA 4GLKA 1XQHA 2JS0A 2L3RA 2R5AA 4OMQA 5KYWA 1SSHA 5FLXE 2VVKA 4QVCA 2J05A 3A98A 4C5EA 2HSPA 1Q82C 3H41A 4OMMA 3VS4A 3KUFA 2XHCA 3S3MA 1YHQA 1VQ9T 1ZX6A 4ESRA 1YITT 4IUUA 2F2WA 2EYZA 4RTUA 2LQKA 3D7SB 4C8QC 3I55A 1RLQC 1LNXA 3M0PA 1OYXA 4C5IA 5FWCA 3JB9G 2AKLA 4UC4A 4PLIA 3G71A 2KNBB 1YJNT 2C0TA 3H0HA 3CCLA 2CZ1B 5GAMe 2M51A 3OS5A 4J7FA 3EGDB 1BKBA 4RTWA 2DMOA 3MEVA 1CKBA 2E3HA 4XU0A 2CZ6B 2YRCA 4IUTA 2XICA 5LJ5d 2F2XA 3RKYA 3JCMJ 1D3BA 1NPRA 4KGXB 4FYXB 1FYNA 3LH5A 1E7OA 3NPFA 3QJ6A 4B6MA 1SHFA 4QKUA 3EG3A 1VQOQ 1N5ZA 2HQHA 2KY9A 5GANd 3CC4Q 1OQKA 3CPFA 4RTVA 5IXFA 4F14A 5L23A 2JXBA 4KULA 3UPUA 1Q7YC 1QKXA 2EVRA 1WXBA 3UATA 3R6OA 3OYCA 3CCVT 1M1GA 2J6FA 5GANe 2NLUA 2QGGA 1ABOA 3I55T 1UGPB 4E7IA 5KYWB 3H6ZA 4N4IA 4JJBA 3CMEA 1NPPA 2KAFA 2RHXA 2FO0A 3EGUA 1OX8A 3EHQA 1UGSB 3M0RA 2XDDA 2YDLA 1H641 4JPBW 3JCMX 1K73R 1QP2A 3G71Q 1C1AA 4PJLA 3FIFA 1TWBA 3DKMA 3I9QA 3JCMQ 2KRMA 2KT8A 2HKNA 3OYDA 2V8IA 1PRMC 3M53A 2EQUA 3NGPA 1Q86U 4EDUA 1M90R 4J6YA 1QCNA 1ABQA 1RAHB 1NJIR 4BDYA 4RCBA 4RTYA 1YI2Q 1R8OB 2EJGA 2QYZA 4M7AC 3LLRA 3VS0A 5GMKj 3ER0A 2DNUA 3CC2Q 3M4YA 4L5GA 1GXIE 3CXCP 2M16A 4J9GA 5GAN8 4M7AG 2Z0WA 4JLGA 1YFNA 4J8OA 2FZGB 5KYUB 3PVLA 3C94A 1Q7YU 1OZ3A 1WFWA 1WXTA 5GMKl 4JRKA 1ZSZC 2FRWA 4M75D 2O9SA 1I0CA 2OTJT 1AZGB 3CC4T 3SEMA 2DPPB 4XU3A 2O4XB 3HL8A 4J5YA 2CS7A 5A2QE 3A8GB 1QVGS 2G3RA 1EFNA 1UGQB 1AEYA 4LDVA 4RUGA 2A3LA 5GANh 4OMOA 2R5MA 1VQ5T 4HCKA 3VUZA 4E7JA 2DBKA 3JCMh 2NYSA 1VQLQ 4C5HA 1BYMA 2FZKB 3OB9A 4ZTFA 2KK4A 4HVUA 4XU2A 5D7UA 4PFZA 4PJOE 1FMVA 2LX7A 2HZYA 3TSWA 3G6EA 4F04B 5CKDA 3M56A 4N4GA 3PTAA 2M1HA 3M58A 4XU1A 1PCXA 1UDLA 4M7AB 3THKA 3OW2S 4M77A 4A63B 2A0FB 1JJ2A 3CXCS 2DJQA 2QA4Q 1PD1A 4ZTJA 4GLMA 1BIAA 3J80E 3LH0A 1WDXA 3QKJA 4JS4A 2VKNA 2GTOA 2EFIA 3J7AF 1EZZB 2ECZA 1RL2A 5A0LA 1OOTA 1ZSGA 2K9GA 2CT3A 4PJOF 2HBWA 1Q7YR 2EQIA 2P84A 3CPWS 4C8QG 4RTXA 4CC3A 2HQXA 1UFFA 4AFSC 5GAMf 3NTKA 1PSEA 4DA4A 2LRQA 3HP9A 1JO8A 5IT9E 2ZPFB 3L2UA 3MKDA 4J9BA 3OYBA 2XI9A 2LJ1A 4M7AA 4VUBA 3GF5A 2G6FX 1ZBXA 2L3PA 2DBMA 1K73C 5J26A 3HRTA 5LL6S 5D6YA 2KXCA 3WVDB 5GAN4 2QA4A 4HCZA 1I1JA 2CDTA 1VQOA 2EGAA 4BACA 3VU3C 1ZUKA 5LJ3f 1HYOA 2HD0A 3OYJA 5CKEA 2BZYA 3FB9A 4AG2C 5ECAA 5CAIA 1IGUA 3O5ZA 5LJ5e 4JS5A 4BE1A 2CREA 2XKOC 4ANJA 1CSKA 4J6XA 2GFAA 3MP8A 5KE3A 2RF0A 1SKUB 4TVRA 4PJNA 4C5GA 3SFMA 1PKSA 1I81A 1KD1R 2CT4A 2PUKB 1BK2A 2LCCA 5FU6B 2YT6A 5GANg 4B9WA 5HK0A 3JCMg 2COZA 3DLMA 3P8HA 3QBYA 1K8AC 3ZEHA 4QQ6A 1TUCA 4CRIA 4QQDA 1UTIA 5DM7R 2QQSA 2EQMA 2LQNA 5KYYB 2DD5A 2ZCFB 4M7DD 4FYWB 4D8DA 3OYAA 3SWNA 4C0FA 1SSFA 3NFCA 3NTIA 3O8VA 2ED1A 3CCST 1YIJA 3AHUA 1NLPC 1IHVA 1KHIA 3X28B 1WA7A 3CCRT 4X9CA 1ZSZB 2K5FA 4IUVA 2DL5A 1YJ9T 4XTZA 1KFZA 1NEBA 4A54A 2JN0A 1S72Q 3SD4A 3JCMc 1RAEB 3CCLT 1G5VA 2DM1A 4DOWA 2MWOA 4FCYA 3VRYA 4QQGA 1VQ5Q 3HTRA 1KJWA 3VV0A 5I11A 3NHNA 2K5IA 4OF1A 2QXFA 1N9SA 4AG1C 3MO8A 4JRPA 2EQJA 3L2WA 3CBOA 1W2BP 3M4GA 2JUFA 1G3SA 3X25B 1PWTA 2QQRA 1M1KR 1UE9A 3MP1A 4RKUE 1D1BA 1GFDA 2CP5A 4M7DG 1JXMA 4HCCA 3VS2A 2ZPEB 1MGQA 2C0IA 1MMNA 3OBWA 2HDAA 4LN2A 1AT1B 1YWOA 2Y4XA 3I5RA 1YJWT 2E6ZA 3DB4A 4Y91A 4M77D 2CH4A 1X6OA 3TSZA 2DZCA 1G2BA 2JS2A 2QEXQ 2EJ9A 1WPYA 2AHJB 2EGCA 4M75F 1FMWA 4JZ3A 1AWXA 1YBYA 1SG5A 4DBQA 2JOYA 1YITQ 2QTVA 1C0MA 2KBTA 4F7UB 1TUGB 2OTJA 3I35A 4J9IA 1WJQA 4ORZA 2DE0X 1K9MU 2FRYA 3LGLA 3MJXA 4M77C 4FT4A 4J9EA 5GAOq 1W2BS 2DEUA 2XDPA 3VYGA 2CSIA 3VYHB 3CBPA 5FRMA 1WLPB 2DL4A 1QQJA 5IHIA 1S1NA 3CMAQ 1V1CA 3L1AA 4AFQC 4FSSA 3EG9B 1M2VA 2YLBA 3CBMA 2RJEA 4BDZA 3CD6A 3V7SA 2KI7A 4M78E 1QCOA 1YJWA 1M8MA 1GCQC 1Y96A 4MMLA 3DLLA 2JM8A 2DFUA 1W1FA 1AWOA 5GJWB 1RLPC 4PNOA 3T9NA 2QEXT 1PSFA 3C0CA 1MNEA 2VGNA 2P4TA 2CSQA 1QKWA 3CC7A 4LNPA 5CK9A 3LW5E 1M2VB 5KCHA 4PJOA 5IXBA 1VYVA 2E64A 2OAUA 4M4ZA 2NUTA 3V7CA 3A8HB 2YHTA 1QVPA 4F7UG 5LJ5f 4C8QD 2OTJQ 5FU7B 4ME7A 1KD1C 3CCMA 3BDUA 2A37A 2OTLQ 1P92A 3P8DA 3VS7A 2VUBA 3M5AA 1AHJB 4P5NA 3RUXA 2P0QA 1T0HA 3OW2P 1N8RU 2L0AA 1B7TA 2RQUA 1D09B 2DIQA 5GAN2 2KRSA 3EGXA 4GBQA 2CP3A 2GTJA 4IURA 3X24B 2GCXA 2DF6A 3PGGA 4KT0E 4DBHA 2PTKA 4OMLA 1UEBA 3CD6Q 4EMHA 5GAN7 3SHWA 2QDLA 1WQ7A 3BFMA 3CCRQ 4XAXB 5IHNA 2WSEE 5D6WA 1S72T 4HCBA 2MOXA 5KYXA 1DJ7B 2KQWA 2PVGB 1Q82R 2CUBA 1JJ2P 1D1CA 3FJPA 1TOVA 1SHGA 3FDRA 1B34B 3A5ZB 2LT1A 1KQ2A 4BY6C 1VQ6A 4M78B 3A1PA 1SEMA 2F2VA 2R57A 4LDYA 4E7HA 1KIKA 2QA4T 4JRIA 4LDXA 3L2QA 2EGEA 3S3NA 4BI3A 4IKFA 4M78D 4M75G 1KC8R 2KRNA 1PM3A 2DTOA 2V1QA 4ELYC 1UHFA 4M7AE 4PFOA 4J9FA 4E7LA 2E70A 4DEYA 2CP0A 2DL7A 3EHRA 8AT1B 1N27A 1W4SA 3GP8A 3EG0A 2LVMA 2XIDA 2F5KA 3QWYA 2OJ2A 3RIRA 4NS5A 1WGSA 2XG8D 1H92A 2DLPA 1HD3A 4AT1B 3PNWC 1E6GA 4NOYA 2D8HA 3OSVA 4HXJA 2Y4YA 1VQ8Q 1KHCA 1K73U 3VKIA 1TSFA 3H9NA 2RO0A 1FMKA 5CKBA 1JQQA 2LMJA 2DA9A 1QVGA 1UJYA 1KSWA 2H3EB 3RMQA 3KXTA 2DKGA 4XK8E 4PJMA 4M7DF 2E3IA 2ZZDA 4HVVA 3L42A 3OYNA 4PK4A 4PJJA 4ZGJB 4PJOC 2J6OA 3E9FA 4YTLA 4BI8B 2L5QA 2RH2A 4RMOA 5GJVB 1O9SA 1TH7A 2QQ9A 1BBZA 2RHIA 2DIGA 2RK2A 4R56A 5GAMd 3ASKA 3OYYA 4E6RA 2O2OA 3FLGA 5CIUA 3CCJT 1VA7A 1PKTA 2DYIA 2EIFA 2BE7D 4BUGA 4V2SA 1VQLA 3OYIA 2EBPA 2GBQA 1TU0B 2BIVA 1SRMA 4E2FB 1QVFA 4M7AF 2RQRA 2O01E 2MWPA 3TU4K 3U23A 1IRXA 2K79A 1M2OA 4OB1B 3JCMP 4X9DA 3EGXB 3CCLQ 2YXYA 2PU9B 4IIMA 3EG1A 1KQSS 3I55Q 2CP7A 4BI4A 4XTVA 4C8QE 3URGA 3CCMQ 3A8LB 2JZ2A 1HJDA 2K2MA 3L2RA 3OSSC 1YNZA 4BD3A 1ZSZA 3LWHA 9ATCB 1IXDA 4PJOB 4NL2A 5M9OA 2X4YA 1WQWA 1BIBA 2ROTA 5J39A 2EYXA 2OTLT 3PMIA 3QXEB 1U06A 1AD5A 5KYUA 2DXUA 3QDRB 1VQ4A 1R0CB 1WX6A 2O9VA 2RM4A 2YUQA 3LYIA 3QO3A 2QI2A 3VRZA 4C92C 1D0YA 3RR6A 1M27C 5CCAA 1GBRA 3EFOA 1M4ZA 3OYFA 2V8JA 1MMDA 4HVWA 1Y71A 3VS1A 4O6JA 2D0QB 1FWZA 1X6GA 2L2PA 1GBQA 3I56A 5C6SA 2EPDA 3KFVA 5HY6A 3NTHA 2DZ9A 2PVOB 3S6WA 3CMEQ 4LUDA 5CR2A 1WHLA 2JT4A 4RCCA 1HXDA 4MZMA 4R55A 2K5LA 2EYQA 2LQ8A 3CCJQ 2RJDA 1AWWA 5DY9A 1N8RR 5A0DA 1UHCA 2XMFA 3CPWA 4F7UA 3QYHB 1QLYA 4EMKA 3LGFA 1K0SA 3CCQQ 2LJ0A 3HPWA 2K2VA 4PJOG 4M78A 4XTUA 3RKXA 2KYMA 2VV5A 5GAOp 1D0ZA 2RK1A 4C8QF 8ATCB 1O75A 2NUPA 1JU5C 4OB0B 2FB7A 4C8QB 1BCOA 4Z8AA 2VWFA 2AZSA 2DERA 1PD0A 2JMAA 1I07A 2LJ3A 4J7IA 2CYZB 1OPLA 1A0NB 2PQWA 1EX4A 4JJNK 3JCMf 1NZ9A 2E1HA 1VQNA 2O88A 5GAOl 3QWXX 3UT1A 2AIRB 2BKDN 3M9QA 3CCEQ 3A8MB 1GCPA 4ZNXA 5J3BA 2MYSA 4J9CA 2L3SA 4LD6A 2HL5C 2KMTA 4QW2A 2HQEA 3TREA 2M0OA 1Z9ZA 3CCVA 2RHYA 4EPCA 2JW4A 3CCSA 4LDWA 4OB2B 2QEXA 4KUIA 4Z89A 4E7SA 4XTYA 4FW1A 5GAOn 4KRTA 2DTIA 1Q95G 2D9TA 2GFUA 5CVIA 1Q82U 4M7DE 3CCQA 2DAQA 2P0KA 3ZFJA 5CQXA 3M55A 3G4SQ 2KSSA 3RESA 1M5Q1 1X43A 4OMPA 4BE2A 1AVZC 5KYNA 2RI3A 3OYEA 4M78G 3EFOB 2PVDB 4C0DB 5KYYA 1YWPA 2HEQA 3CCUA 3M0UA 4OGEA 3OYGA 4J83A 3MHXA 2FG0A 5L8RE 1QWEA 2X4XA 4C92E 1Q81U 3C95A 3QZ9B 3KBGA 1WI7A 1RAIB 3META 2FHDA 4N0AC 2JNGA 2VXFA 1YJ9Q 1IO6A 3PVQA 1M90U 3QG1A 2PZ1A 5LJ5h 1Q86R 1D0XA 4QVDA 1LOJA 2D0NA 1MHNA 4Z88A 2QK0A 1FX7A 2RHZA 2ROLA 2W0ZA 1AWJA 1NBEB 1K8AR 1MV0B 2RD1A 1GFCA 3CCSQ 1M1KU 3QJYA 4A4EA 2DK3A 4C92G 2K57A 2XDBA 3FEOA 3OMCA 5I2MA 3VS6A 1Q81C 2WACA 2DTHA 2EW3A 2ESWA 4WTOB 3FJ5A 5C0MA 1VQ7Q 2ABLA 2DVEA 2XU8A 2J06A 4XTXA 2MMPA 3WVEB 1IHWA 2RN8A 1JB0E 1I5OB 2ED0A 3JCMV 3TCJA 4BB7A 2DXCA 3BY7A 1OU8A 3ZBDA 2GQIA 3QZ5B 3R6NA 3CCET 2MCNA 3BE3A 1MNDA 1QW1A 2RJCA 1WHKA 3UA6A 2I2LA 1G83A 2J7IA 3C12A 2A28A 1VQMA 4M7DB 2NUZA 1M9SA 1G3TA 3CCJA 1LCKA 2SEMA 2OI3A 1ZUYA 2CZ7B 2KROA 3HSBA 2FVUA 1QCFA 2DILA 3M54A 5LJ3g 1N8RC 4GY5A 5GMKi 2P4RA 1WXUA 1SRLA 3OQ5A 1W70A 2QDYB 3JB9J 1NM7A 2GNCA 3C4SA 3G71T 2RNAA 4IIOA 1ARKA 4KGVB 3JB9I 2YLCA 4JZ4A 1QP3A 2A08A 2KR3A 1YCSB 5HK3A 4C92B 2AZVA 2RQTA 2WSFE 2RQWA 3PIPA 2JM9A 5CKFA 3IQLA 1YHQQ 5I22A 4XQ3A 4A4GA 2ZPIB 3UWNA 5KE2A 1KQSP 2ZPHB 4EMKC 1U1TA 4A4FA 2EWNA 3CC2T 4C0ZA 5GAN5 2HMAA 3CQTA 4M77F 3JB9H 1TXQA 3RERA 1PHTA 4RG8A 1RAGB 2LNVA 3V8JA 1VQ4T 2RMOA 3OS1A 5FU6C 3RKWA 1IREB 1F1BB 4HA8A 3UF4A 3CEYA 4FU6A 1X2KA 2OAWA 3EG9A 2VB6A 3ME9A 2F5TX 2E10A 3G1JA 3PMTA 4EIKA 2EJFA 3JV3A 1KQ1A 2MAMA 5KYXB 2A7YA 5GMKh 4FW2A 1CKAA 1VQPT 1G3YA 1K9MC 2JTMA 3ULRB 2YUPA 1RAAB 5LJ5g 3CC4A 3V8KA 2DD4A 2KT1A 2IPOB 4L6V5 4ZN1A 1KC8U 1X75C 2E12A 3EAEA 2F1LA 1GRIA 2DXTA 1VQOT 1OEBA 1NYFA 2BZXA 2RA2A 2DRMA 2DJZA 1M30A 1VQ5A 3OBYA 3SDZA 2XD0A 1OX9A 3INZA 3MCAB 1B34A 1Y7XA 1VOMA 4FYVB 4M77G 1ZBJA 2EKHA 3H8ZA 3HKSA 3OA6A 3EG2A 1I4K1 1OZ2A 1HSQA 4A4HA 1YIJQ 1PG5B 4E47A 2DEQA 3TQ7P 4BE0A 1YJNQ 1AOJA 2K6DA 2MIOA 1S72A 2WSCE 2XK0A 3V8LA 1J3TA 4DOVA 3NMZC 1W6XA 4KBMB 4M7AD 2LT4A 2LDMA 4CI0C 4KH0B 3I5SA 4JJDA 4EMGA 3VS3A 4ZGDB 3MPUB 5LJ3j 2FL7A 5DLQE 4F7UE 1U5SA 1YI2A 1VQ9Q 1UECA 1TTHB 3JB9F 1YHQT 2ZAEA 2MPXC 2RPNA 2LZ6B 5LJ3h 1ZUUA 3JCMb 1YITA 1JJ2S 4WF2A 1M3AA 1K1ZA 5GAN3 2L89A 5A0GA 3M0TA 3CMAA 4PL6A 3HFNA 2QTXA 3QIIA 1X69A 2EQKA 2GQVA 1BI3A 3QDFA 4OP0A 4A4KA 2LC4A 1M3CA 1SF9A 2V1RA 1KC8C 2DVJA 1H8KA 2Y90A 3HRSA 2A36A 2VGMA 2JTFA 2JJ9A 2EYYA 4M75B 4KH1B 3VS5A 3PIOA 1WNLA 4M75E 1BI2A 1VYTA 4NL3A 5EG2A 3M0QA 1MMAA 4ATOA 1VQPA 4QT7A 1QVFS 2YUNA 4N0AA 2X4JA 3M59A 5KCOA 1VQNT 2DXBA 2K4YA 1U1SA 2L8DA 2RI2A 3BDLA 4MDWA 1RACB 5FRNA 2E41A 2EYWA 1QVGP 1VQ9A 3ZL7C 4M7DA 2COYA 5CQYA 2B8AA 2H8HA 1UG1A 1PNJA 1B3QA 3G6EQ 5GAOr 2L3QA 1NJIU 3LWIA 3EGDA 1WHHA 2JTEA 2M02A 1VQMQ 2CKKA 1VQKT 1WJSA 3CMET 4M78F 1YJWQ 2MF2A 2OTLA 4XTWA 3GNFB 1VIEA 2YSQA 4M75C 1M1FA 1ZLMA 3CC7Q 2RHUA 3FRNA 3CCMT 2HNIA 2H3JA 1N6AA 4D6WA 3REAB 1I5LA 2GGRA 2FPEA 4IUQA 4AMCA 1VQNQ 2DL3A 1VQ4Q 1IZ6A 2X3WD 3G4ST 3X26B 4LE9A 1N9RA 2D1XA 1KG1A 1G8XA 4D8KA 2NWMA 1T3SA 1YI2T 1VQKQ 2HKQB 3PE0A 5DLOA 1IGQA 3GNGA 5GMKe 1WYXA 1TUDA 4JDSA 3Q1JA 5IAYA 3BW1A 3EFRA 3J81E 4R0KA 3JCMe 1BI0A 5D6XA 2E5QA 3M57A 2DETA 1OULA 4IUPA 3MP6A 3GPLA 2X9HA 3SWNC 3OS0A 3CC7T 2KDSA 2QGFB 1VQ6T 1LVKA 4C92A 2D6FA 4CC4B 4CC2A 2VXEA 1NG2A 1BI1A 1VQ8A 3EH2A 3MEWA 2DO3A 3QUIA 1GL5A 4DBRA 2O31A 1VIFA 3UA7A 3H0FA 3DB3A 3S3OA 3REBB 1C6VX 1D1AA 4Y28E 5HKCA 2FYKA 4DEXA 3AT1B 4HT9A 2BTTA 3LX7A 3TVTA 4N4HA 2X3XD 3MEAA 4E7ZA 1RI9A 1X01A 1RABB 2BZ8A 2QG9B 5GAOm 4OVAA 5FROA 4PLLA 2CP2A 4X1VA 1YIJT 3P8BB 1VQ7T 3EFSA 5EC7A 4OMNA 2IG0A 2KE9A 1YN8A 2KVQG 1M8VA 4FIBA 2DX1A 2RJFA 2MI6A 2D8JA 2IVWA 5LJ3e 4AFUC 3CCQT 2ZPGB 1YJNA 3HRUA 2BE9B 4PJOD 1T0JA 4DBFA 1Y07A 1D3BB 3JSCA 4C8QA 4B9XA 2VASA 1VQ8T 1PC0A 1UGRB 3JRZA 2RB6A 2ZGWA 2O4XA 4EMKB 1Z9QA 3GBQA 5AYFA 4KGZB 2BUDA 1RADB 2VC8A 3E9GA 1LPLA 4KUDK 1E6HA 1GCQA 2B86A 3RDVA 1PRLC 4HT8A 2SRCA 2K3YA 4M77B 2QASA 1YCYA 1AZEA 4E7KA 3GOXA 4LD9K 3MEUA 3N5BB 2KYBA 1WHMA 5GAMj 3OW2A 1RUWA 4J9HA 1RI0A 2HAXA 3CXCA 4HKEA 4JRQA 4JUVA 4PFPA 3JCMd 3SWNB 1IB8A 1OU9A 2DL8A 2E4HA 2K7AA 3HFOA 5I21A 3WXMB 4C0GA 1ZQ1A 1YP5A 4CC7A 2J6KA 3RMSA 3H0IA 4C92F 5FW9A 1VQPQ 4II1A 4Y92A 5IHKA 2DYBA 1MV3A 2K3XA 1OPKA 4L59A 1MUZA 2IIMA 1R0BG 7AT1B 1KQSA 5GAMh 2ENMA 1WHGA 2X35A 4J6WA 2FZCB 2AK5A 4M78C 3I56Q 3HHTB 2FEIA 1UJ0A 3VUBA 1VQMT 3CD6T 4X34A 4MDXA 4FSXA 2AT1B 3TEEA 4ELZC 4Z02A 1T3LA 4FM4B 2LNHB 1K0XA 1K4US 1OV3A 2E6NA 2EAYA 2LX9A 1VQLT 3RNJA 1KK7A 5CO7A 1FXXA 2LTOA 2QQBA 3PFSA 4K11A 1NYGA 2C06A 4JJCA 4BY6B 5CKHA 3OMGA 3OY9A 1WIEA 4FL6A 5GANf 3X20B 3QPHA 1VUBA 1WHJA 2C0OA 1Q86C 1X6BA 1V29B 1HK9A 3QSUA 4LXCA 1ZA2B 2W10A 3L2VA 1K8AU 1M3BA 5GANj 4AFZC 5GAN6 2R58A 1U3OA 1U8RA 3A8OB 2CGHA 2HL3A 1JRIA 2JMCA 5FU7C 2ZPBB 1TS9A 4MMKA 3UDCA 5LJ5j 3JB9D 1QVFP 4C92D 1Y0MA 2MK5A 4F7UF 3CCRA 1Q81R 1VQKA 3CCEA 1JEGA 3G7ZA 2RI5A 4Q5WA 1SPKA 4M75A 5I2SA 4PKCC 1UGVA 1Y57A 2M9UA 4C0DC 1M1KC 1LJOA 1H3HA 4MZTA 4OGCA 2GF7A 2NUTB 2CUDA 3G6ET 3QHSA 1VQ6Q 2LQWA 2VYTA 3L2ZA 4RTTA 1ZHIA 6AT1B 1ZA1B 3FC3A 2CZ0B 3CPWP 4M7DC 1VYUA 2ATCB 2V8KA 1RAFB 2JVVA 2HCKA 3CCVQ 2X4WA 2M0YA 1G3WA 2CP6A 1TG0A 4JLIA 3I56T 3QYGB 2V26A 2X51A
chains in the Genus database with same CATH topology
2RPNA 1HJDA 2LZ6B 2K2MA 1ZUUA 2K3BA 2CDTA 2EGAA 1M3AA 1YNZA 1ZUKA 5FWBA 1K1ZA 1BU1A 5IH2A 2BZYA 2FPDA 3M0TA 4AG2C 5ECAA 1NEGA 1X27A 1X69A 3O5ZA 2ROTA 2CREA 4J9DA 2EYXA 2DRKA 1CSKA 4F17A 2LCSA 1M3CA 2V1RA 1U06A 1AD5A 2DVJA 1H8KA 1WX6A 2O9VA 2YUQA 1K76A 2RF0A 2A36A 1BB9A 1UUEA 3VRZA 1PKSA 1M27C 5HCKA 1GBRA 2CT4A 2EYYA 1BK2A 1X2QA 2KEAA 2YT6A 1QWFA 3VS5A 4RTZA 1VYTA 4HVWA 1NLOC 3M0QA 2PNIA 3VS1A 1XOVA 4QT7A 2YUNA 1K9AA 1JXOA 1X6GA 2L2PA 1B07A 1GBQA 2EPDA 3KFVA 1TUCA 1UTIA 4WCIA 4LUDA 2EYWA 2LQNA 2JT4A 3RBBB 3ZL7C 4D8DA 2H8HA 1UG1A 1PNJA 1AWWA 4F16A 1B3QA 2ED1A 1NLPC 2L3QA 1WA7A 1UHCA 2JTEA 2XMFA 3M0SA 1QLYA 2I0NA 2FPFA 2DL5A 1K0SA 2LJ0A 1KFZA 1NEBA 2KGTA 2YUOA 2KYMA 2YSQA 2DM1A 1JU5C 3VRYA 2AKKA 2KXDA 2LP5A 2E5KA 2RQVA 4Z8AA 1KJWA 2VWFA 2AZSA 5I11A 1ZLMA 3NHNA 2CH4W 2JMAA 1I07A 4AG1C 2LJ3A 4LUEA 2JS0A 3REAB 2GGRA 1OPLA 1A0NB 2FPEA 2DL3A 1PWTA 1UE9A 2X3WD 4OMQA 1SSHA 4LE9A 2O88A 1GFDA 2VVKA 2J05A 3QWXX 2D1XA 1GCPA 3A98A 4ZNXA 1JXMA 2NWMA 4D8KA 1T3SA 2L3SA 2HSPA 4J9CA 3VS2A 3H41A 2C0IA 4OMMA 3VS4A 2HDAA 3PE0A 4LN2A 1YWOA 1WYXA 1Z9ZA 1ZX6A 1TUDA 3I5RA 4ESRA 2F2WA 2EYZA 4RTUA 2CH4A 2JW4A 4R0KA 1RLQC 3TSZA 3M0PA 4Z89A 1G2BA 5FWCA 2JS2A 4KRTA 2AKLA 2EGCA 4JZ3A 1AWXA 2KNBB 2C0TA 3H0HA 2KBTA 2M51A 3I35A 4J9IA 4RTWA 4ORZA 2DMOA 2DE0X 4CC4B 4CC2A 2FRYA 1CKBA 1NG2A 1X43A 4OMPA 4J9EA 1AVZC 2F2XA 1GL5A 1YWPA 2HEQA 2O31A 3M0UA 2CSIA 3UA7A 3H0FA 2FG0A 3REBB 1FYNA 3LH5A 1E7OA 1WLPB 1QWEA 3NPFA 2DL4A 1S1NA 1SHFA 5IHIA 3EG3A 1V1CA 4DEXA 1N5ZA 4AFQC 4FSSA 2BTTA 1WI7A 3TVTA 4RTVA 2X3XD 5IXFA 4F14A 1IO6A 5L23A 2JXBA 3PVQA 1QKXA 2PZ1A 1RI9A 2EVRA 1WXBA 3UATA 2D0NA 4Z88A 2J6FA 1M8MA 2BZ8A 1GCQC 2ROLA 2W0ZA 2JM8A 1AWJA 1W1FA 4X1VA 1ABOA 1AWOA 5GJWB 1RLPC 1MV0B 3C0CA 5EC7A 1GFCA 2KE9A 4OMNA 1YN8A 4JJBA 2CSQA 1QKWA 4LNPA 2DX1A 2FO0A 3EGUA 2D8JA 3EHQA 4AFUC 3M0RA 2YDLA 5IXBA 1VYVA 4JPBW 4M4ZA 1T0JA 3VS6A 2EW3A 3I9QA 2ESWA 2KRMA 3FJ5A 2KT8A 2ABLA 1PRMC 3NGPA 2A37A 2J06A 2RN8A 3VS7A 2ED0A 1T0HA 1ABQA 1Z9QA 3GBQA 2GQIA 2L0AA 3R6NA 2RQUA 2MCNA 2KRSA 4GBQA 4RTYA 2GTJA 3UA6A 1G83A 2J7IA 2A28A 2DF6A 1E6HA 2PTKA 3VS0A 1GCQA 2B86A 4OMLA 2NUZA 1PRLC 3SHWA 1LCKA 2QDLA 2SEMA 2OI3A 1ZUYA 2DNUA 2SRCA 2KROA 5IHNA 1QCFA 2DILA 1AZEA 2KYBA 2MOXA 2P4RA 4J9GA 1WXUA 1SRLA 1RUWA 4J9HA 1W70A 2CUBA 3PVLA 1NM7A 2GNCA 1WFWA 1WXTA 2RNAA 4IIOA 1SHGA 1ARKA 2FRWA 2O9SA 1I0CA 2DL8A 2KR3A 2K7AA 2F2VA 1AZGB 1SEMA 2A08A 4JZ4A 1YCSB 3SEMA 4CC7A 1YP5A 2J6KA 1KIKA 3H0IA 2AZVA 2RQTA 2RQWA 2EGEA 2JM9A 5FW9A 4Y92A 3IQLA 5IHKA 2DYBA 1MV3A 5I22A 1OPKA 2KRNA 1MUZA 2V1QA 2IIMA 1EFNA 1AEYA 1UHFA 4RUGA 2ENMA 4J9FA 4OMOA 2AK5A 4HCKA 2DBKA 4DEYA 2DL7A 3EHRA 2FEIA 3EG0A 1UJ0A 3CQTA 3QWYA 2OJ2A 4HVUA 1PHTA 1H92A 2DLPA 1HD3A 2RMOA 1T3LA 1E6GA 2LNHB 3UF4A 1K0XA 2LX7A 1K4US 1X2KA 1OV3A 3TSWA 2OAWA 3RNJA 2D8HA 4HXJA 4K11A 1NYGA 4EIKA 4JJCA 1WIEA 3JV3A 1UDLA 3THKA 2C0OA 1FMKA 1CKAA 1X6BA 1JQQA 2LMJA 4A63B 2DA9A 3ULRB 2YUPA 2DJQA 1UJYA 2W10A 1KSWA 4GLMA 1M3BA 2KT1A 4AFZC 1U3OA 1WDXA 4HVVA 2VKNA 2GTOA 2JMCA 1GRIA 1OEBA 1NYFA 2BZXA 2ECZA 2DRMA 2J6OA 1M30A 1Y0MA 5GJVB 1OOTA 1ZSGA 1JEGA 1BBZA 2K9GA 2CT3A 1SPKA 2HBWA 1UGVA 1ZBJA 2EKHA 2EQIA 1Y57A 3EG2A 1H3HA 1HSQA 4E6RA 2O2OA 4RTXA 4CC3A 1VA7A 1PKTA 2CUDA 1UFFA 4AFSC 1AOJA 2K6DA 2MIOA 2LQWA 2EBPA 2GBQA 1JO8A 1J3TA 1SRMA 4RTTA 3NMZC 4J9BA 2RQRA 1W6XA 3U23A 2LJ1A 1VYUA 2K79A 2HCKA 2G6FX 2M0YA 3I5SA 2L3PA 2DBMA 4IIMA 3EG1A 1TG0A 4JJDA 3VS3A 2KXCA 1U5SA 1I1JA 1UECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPN A;  1HJD A;  2LZ6 B;  2K2M A;  1ZUU A;  2K3B A;  2CDT A;  2EGA A;  1M3A A;  1YNZ A;  1ZUK A;  5FWB A;  1K1Z A;  1BU1 A;  5IH2 A;  2BZY A;  2FPD A;  3M0T A;  4AG2 C;  5ECA A;  1NEG A;  1X27 A;  1X69 A;  3O5Z A;  2ROT A;  2CRE A;  4J9D A;  2EYX A;  2DRK A;  1CSK A;  4F17 A;  2LCS A;  1M3C A;  2V1R A;  1U06 A;  1AD5 A;  2DVJ A;  1H8K A;  1WX6 A;  2O9V A;  2YUQ A;  1K76 A;  2RF0 A;  2A36 A;  1BB9 A;  1UUE A;  3VRZ A;  1PKS A;  1M27 C;  5HCK A;  1GBR A;  2CT4 A;  2EYY A;  1BK2 A;  1X2Q A;  2KEA A;  2YT6 A;  1QWF A;  3VS5 A;  4RTZ A;  1VYT A;  4HVW A;  1NLO C;  3M0Q A;  2PNI A;  3VS1 A;  1XOV A;  4QT7 A;  2YUN A;  1K9A A;  1JXO A;  1X6G A;  2L2P A;  1B07 A;  1GBQ A;  2EPD A;  3KFV A;  1TUC A;  1UTI A;  4WCI A;  4LUD A;  2EYW A;  2LQN A;  2JT4 A;  3RBB B;  3ZL7 C;  4D8D A;  2H8H A;  1UG1 A;  1PNJ A;  1AWW A;  4F16 A;  1B3Q A;  2ED1 A;  1NLP C;  2L3Q A;  1WA7 A;  1UHC A;  2JTE A;  2XMF A;  3M0S A;  1QLY A;  2I0N A;  2FPF A;  2DL5 A;  1K0S A;  2LJ0 A;  1KFZ A;  1NEB A;  2KGT A;  2YUO A;  2KYM A;  2YSQ A;  2DM1 A;  1JU5 C;  3VRY A;  2AKK A;  2KXD A;  2LP5 A;  2E5K A;  2RQV A;  4Z8A A;  1KJW A;  2VWF A;  2AZS A;  5I11 A;  1ZLM A;  3NHN A;  2CH4 W;  2JMA A;  1I07 A;  4AG1 C;  2LJ3 A;  4LUE A;  2JS0 A;  3REA B;  2GGR A;  1OPL A;  1A0N B;  2FPE A;  2DL3 A;  1PWT A;  1UE9 A;  2X3W D;  4OMQ A;  1SSH A;  4LE9 A;  2O88 A;  1GFD A;  2VVK A;  2J05 A;  3QWX X;  2D1X A;  1GCP A;  3A98 A;  4ZNX A;  1JXM A;  2NWM A;  4D8K A;  1T3S A;  2L3S A;  2HSP A;  4J9C A;  3VS2 A;  3H41 A;  2C0I A;  4OMM A;  3VS4 A;  2HDA A;  3PE0 A;  4LN2 A;  1YWO A;  1WYX A;  1Z9Z A;  1ZX6 A;  1TUD A;  3I5R A;  4ESR A;  2F2W A;  2EYZ A;  4RTU A;  2CH4 A;  2JW4 A;  4R0K A;  1RLQ C;  3TSZ A;  3M0P A;  4Z89 A;  1G2B A;  5FWC A;  2JS2 A;  4KRT A;  2AKL A;  2EGC A;  4JZ3 A;  1AWX A;  2KNB B;  2C0T A;  3H0H A;  2KBT A;  2M51 A;  3I35 A;  4J9I A;  4RTW A;  4ORZ A;  2DMO A;  2DE0 X;  4CC4 B;  4CC2 A;  2FRY A;  1CKB A;  1NG2 A;  1X43 A;  4OMP A;  4J9E A;  1AVZ C;  2F2X A;  1GL5 A;  1YWP A;  2HEQ A;  2O31 A;  3M0U A;  2CSI A;  3UA7 A;  3H0F A;  2FG0 A;  3REB B;  1FYN A;  3LH5 A;  1E7O A;  1WLP B;  1QWE A;  3NPF A;  2DL4 A;  1S1N A;  1SHF A;  5IHI A;  3EG3 A;  1V1C A;  4DEX A;  1N5Z A;  4AFQ C;  4FSS A;  2BTT A;  1WI7 A;  3TVT A;  4RTV A;  2X3X D;  5IXF A;  4F14 A;  1IO6 A;  5L23 A;  2JXB A;  3PVQ A;  1QKX A;  2PZ1 A;  1RI9 A;  2EVR A;  1WXB A;  3UAT A;  2D0N A;  4Z88 A;  2J6F A;  1M8M A;  2BZ8 A;  1GCQ C;  2ROL A;  2W0Z A;  2JM8 A;  1AWJ A;  1W1F A;  4X1V A;  1ABO A;  1AWO A;  5GJW B;  1RLP C;  1MV0 B;  3C0C A;  5EC7 A;  1GFC A;  2KE9 A;  4OMN A;  1YN8 A;  4JJB A;  2CSQ A;  1QKW A;  4LNP A;  2DX1 A;  2FO0 A;  3EGU A;  2D8J A;  3EHQ A;  4AFU C;  3M0R A;  2YDL A;  5IXB A;  1VYV A;  4JPB W;  4M4Z A;  1T0J A;  3VS6 A;  2EW3 A;  3I9Q A;  2ESW A;  2KRM A;  3FJ5 A;  2KT8 A;  2ABL A;  1PRM C;  3NGP A;  2A37 A;  2J06 A;  2RN8 A;  3VS7 A;  2ED0 A;  1T0H A;  1ABQ A;  1Z9Q A;  3GBQ A;  2GQI A;  2L0A A;  3R6N A;  2RQU A;  2MCN A;  2KRS A;  4GBQ A;  4RTY A;  2GTJ A;  3UA6 A;  1G83 A;  2J7I A;  2A28 A;  2DF6 A;  1E6H A;  2PTK A;  3VS0 A;  1GCQ A;  2B86 A;  4OML A;  2NUZ A;  1PRL C;  3SHW A;  1LCK A;  2QDL A;  2SEM A;  2OI3 A;  1ZUY A;  2DNU A;  2SRC A;  2KRO A;  5IHN A;  1QCF A;  2DIL A;  1AZE A;  2KYB A;  2MOX A;  2P4R A;  4J9G A;  1WXU A;  1SRL A;  1RUW A;  4J9H A;  1W70 A;  2CUB A;  3PVL A;  1NM7 A;  2GNC A;  1WFW A;  1WXT A;  2RNA A;  4IIO A;  1SHG A;  1ARK A;  2FRW A;  2O9S A;  1I0C A;  2DL8 A;  2KR3 A;  2K7A A;  2F2V A;  1AZG B;  1SEM A;  2A08 A;  4JZ4 A;  1YCS B;  3SEM A;  4CC7 A;  1YP5 A;  2J6K A;  1KIK A;  3H0I A;  2AZV A;  2RQT A;  2RQW A;  2EGE A;  2JM9 A;  5FW9 A;  4Y92 A;  3IQL A;  5IHK A;  2DYB A;  1MV3 A;  5I22 A;  1OPK A;  2KRN A;  1MUZ A;  2V1Q A;  2IIM A;  1EFN A;  1AEY A;  1UHF A;  4RUG A;  2ENM A;  4J9F A;  4OMO A;  2AK5 A;  4HCK A;  2DBK A;  4DEY A;  2DL7 A;  3EHR A;  2FEI A;  3EG0 A;  1UJ0 A;  3CQT A;  3QWY A;  2OJ2 A;  4HVU A;  1PHT A;  1H92 A;  2DLP A;  1HD3 A;  2RMO A;  1T3L A;  1E6G A;  2LNH B;  3UF4 A;  1K0X A;  2LX7 A;  1K4U S;  1X2K A;  1OV3 A;  3TSW A;  2OAW A;  3RNJ A;  2D8H A;  4HXJ A;  4K11 A;  1NYG A;  4EIK A;  4JJC A;  1WIE A;  3JV3 A;  1UDL A;  3THK A;  2C0O A;  1FMK A;  1CKA A;  1X6B A;  1JQQ A;  2LMJ A;  4A63 B;  2DA9 A;  3ULR B;  2YUP A;  2DJQ A;  1UJY A;  2W10 A;  1KSW A;  4GLM A;  1M3B A;  2KT1 A;  4AFZ C;  1U3O A;  1WDX A;  4HVV A;  2VKN A;  2GTO A;  2JMC A;  1GRI A;  1OEB A;  1NYF A;  2BZX A;  2ECZ A;  2DRM A;  2J6O A;  1M30 A;  1Y0M A;  5GJV B;  1OOT A;  1ZSG A;  1JEG A;  1BBZ A;  2K9G A;  2CT3 A;  1SPK A;  2HBW A;  1UGV A;  1ZBJ A;  2EKH A;  2EQI A;  1Y57 A;  3EG2 A;  1H3H A;  1HSQ A;  4E6R A;  2O2O A;  4RTX A;  4CC3 A;  1VA7 A;  1PKT A;  2CUD A;  1UFF A;  4AFS C;  1AOJ A;  2K6D A;  2MIO A;  2LQW A;  2EBP A;  2GBQ A;  1JO8 A;  1J3T A;  1SRM A;  4RTT A;  3NMZ C;  4J9B A;  2RQR A;  1W6X A;  3U23 A;  2LJ1 A;  1VYU A;  2K79 A;  2HCK A;  2G6F X;  2M0Y A;  3I5S A;  2L3P A;  2DBM A;  4IIM A;  3EG1 A;  1TG0 A;  4JJD A;  3VS3 A;  2KXC A;  1U5S A;  1I1J A;  1UEC A; 
#chains in the Genus database with same CATH topology
 4LDU A;  1UB4 A;  3EH1 A;  4DQ2 A;  4ZGE B;  3OYK A;  2K3B A;  4OB3 B;  2HBP A;  4A53 A;  1XTD A;  5FWB A;  3JAM E;  3V7R A;  1BU1 A;  5IH2 A;  3E1S A;  3F70 A;  2FPD A;  3E2U A;  1WZO A;  2E65 A;  1NEG A;  3E19 A;  1X27 A;  3CC2 A;  2PUO B;  3VJP A;  3OYL A;  1YJ9 A;  3CCU Q;  4J9D A;  4O5V A;  2OX7 A;  2DRK A;  4F17 A;  2LCS A;  2QQA A;  2YRD A;  1XJW B;  3OS2 A;  1K76 A;  1BB9 A;  1UUE A;  3OYH A;  3SB2 A;  5HCK A;  1W2B A;  5GAM g;  1X2Q A;  2COW A;  2KEA A;  1QWF A;  2HSE B;  4RTZ A;  1BCM A;  3CCU T;  1MMG A;  1NLO C;  3PT9 A;  2PNI A;  1M90 C;  1XOV A;  1H3Z A;  4M77 E;  3G4S A;  1K9A A;  2YWW A;  1JXO A;  1B07 A;  1NJI C;  2QAZ A;  1V76 A;  1NE8 A;  4WCI A;  3OYM A;  4FYY B;  5IN1 A;  1R77 A;  2NUP B;  3RBB B;  4ZN3 A;  5LJ3 d;  1XNI A;  5AT1 B;  4OMF B;  4F16 A;  1OI1 A;  2EKO A;  1K9M R;  3CMA T;  1VQ7 A;  2YRV A;  1ACM B;  3M0S A;  2P0P A;  1I8F A;  4MZP A;  2I0N A;  2FPF A;  2F69 A;  1JBM A;  2KGT A;  3GLX A;  1WJR A;  2YUO A;  3GIB A;  4RG2 A;  2LCL A;  3JCM W;  1QMC A;  1KD1 U;  5GMK m;  2AKK A;  2KXD A;  2LP5 A;  1EIF A;  2E5K A;  2RQV A;  5KH6 A;  2CH4 W;  4FT2 A;  4QVZ A;  1Y96 B;  4LUE A;  4GLK A;  1XQH A;  2JS0 A;  2L3R A;  2R5A A;  4OMQ A;  5KYW A;  1SSH A;  5FLX E;  2VVK A;  4QVC A;  2J05 A;  3A98 A;  4C5E A;  2HSP A;  1Q82 C;  3H41 A;  4OMM A;  3VS4 A;  3KUF A;  2XHC A;  3S3M A;  1YHQ A;  1VQ9 T;  1ZX6 A;  4ESR A;  1YIT T;  4IUU A;  2F2W A;  2EYZ A;  4RTU A;  2LQK A;  3D7S B;  4C8Q C;  3I55 A;  1RLQ C;  1LNX A;  3M0P A;  1OYX A;  4C5I A;  5FWC A;  3JB9 G;  2AKL A;  4UC4 A;  4PLI A;  3G71 A;  2KNB B;  1YJN T;  2C0T A;  3H0H A;  3CCL A;  2CZ1 B;  5GAM e;  2M51 A;  3OS5 A;  4J7F A;  3EGD B;  1BKB A;  4RTW A;  2DMO A;  3MEV A;  1CKB A;  2E3H A;  4XU0 A;  2CZ6 B;  2YRC A;  4IUT A;  2XIC A;  5LJ5 d;  2F2X A;  3RKY A;  3JCM J;  1D3B A;  1NPR A;  4KGX B;  4FYX B;  1FYN A;  3LH5 A;  1E7O A;  3NPF A;  3QJ6 A;  4B6M A;  1SHF A;  4QKU A;  3EG3 A;  1VQO Q;  1N5Z A;  2HQH A;  2KY9 A;  5GAN d;  3CC4 Q;  1OQK A;  3CPF A;  4RTV A;  5IXF A;  4F14 A;  5L23 A;  2JXB A;  4KUL A;  3UPU A;  1Q7Y C;  1QKX A;  2EVR A;  1WXB A;  3UAT A;  3R6O A;  3OYC A;  3CCV T;  1M1G A;  2J6F A;  5GAN e;  2NLU A;  2QGG A;  1ABO A;  3I55 T;  1UGP B;  4E7I A;  5KYW B;  3H6Z A;  4N4I A;  4JJB A;  3CME A;  1NPP A;  2KAF A;  2RHX A;  2FO0 A;  3EGU A;  1OX8 A;  3EHQ A;  1UGS B;  3M0R A;  2XDD A;  2YDL A;  1H64 1;  4JPB W;  3JCM X;  1K73 R;  1QP2 A;  3G71 Q;  1C1A A;  4PJL A;  3FIF A;  1TWB A;  3DKM A;  3I9Q A;  3JCM Q;  2KRM A;  2KT8 A;  2HKN A;  3OYD A;  2V8I A;  1PRM C;  3M53 A;  2EQU A;  3NGP A;  1Q86 U;  4EDU A;  1M90 R;  4J6Y A;  1QCN A;  1ABQ A;  1RAH B;  1NJI R;  4BDY A;  4RCB A;  4RTY A;  1YI2 Q;  1R8O B;  2EJG A;  2QYZ A;  4M7A C;  3LLR A;  3VS0 A;  5GMK j;  3ER0 A;  2DNU A;  3CC2 Q;  3M4Y A;  4L5G A;  1GXI E;  3CXC P;  2M16 A;  4J9G A;  5GAN 8;  4M7A G;  2Z0W A;  4JLG A;  1YFN A;  4J8O A;  2FZG B;  5KYU B;  3PVL A;  3C94 A;  1Q7Y U;  1OZ3 A;  1WFW A;  1WXT A;  5GMK l;  4JRK A;  1ZSZ C;  2FRW A;  4M75 D;  2O9S A;  1I0C A;  2OTJ T;  1AZG B;  3CC4 T;  3SEM A;  2DPP B;  4XU3 A;  2O4X B;  3HL8 A;  4J5Y A;  2CS7 A;  5A2Q E;  3A8G B;  1QVG S;  2G3R A;  1EFN A;  1UGQ B;  1AEY A;  4LDV A;  4RUG A;  2A3L A;  5GAN h;  4OMO A;  2R5M A;  1VQ5 T;  4HCK A;  3VUZ A;  4E7J A;  2DBK A;  3JCM h;  2NYS A;  1VQL Q;  4C5H A;  1BYM A;  2FZK B;  3OB9 A;  4ZTF A;  2KK4 A;  4HVU A;  4XU2 A;  5D7U A;  4PFZ A;  4PJO E;  1FMV A;  2LX7 A;  2HZY A;  3TSW A;  3G6E A;  4F04 B;  5CKD A;  3M56 A;  4N4G A;  3PTA A;  2M1H A;  3M58 A;  4XU1 A;  1PCX A;  1UDL A;  4M7A B;  3THK A;  3OW2 S;  4M77 A;  4A63 B;  2A0F B;  1JJ2 A;  3CXC S;  2DJQ A;  2QA4 Q;  1PD1 A;  4ZTJ A;  4GLM A;  1BIA A;  3J80 E;  3LH0 A;  1WDX A;  3QKJ A;  4JS4 A;  2VKN A;  2GTO A;  2EFI A;  3J7A F;  1EZZ B;  2ECZ A;  1RL2 A;  5A0L A;  1OOT A;  1ZSG A;  2K9G A;  2CT3 A;  4PJO F;  2HBW A;  1Q7Y R;  2EQI A;  2P84 A;  3CPW S;  4C8Q G;  4RTX A;  4CC3 A;  2HQX A;  1UFF A;  4AFS C;  5GAM f;  3NTK A;  1PSE A;  4DA4 A;  2LRQ A;  3HP9 A;  1JO8 A;  5IT9 E;  2ZPF B;  3L2U A;  3MKD A;  4J9B A;  3OYB A;  2XI9 A;  2LJ1 A;  4M7A A;  4VUB A;  3GF5 A;  2G6F X;  1ZBX A;  2L3P A;  2DBM A;  1K73 C;  5J26 A;  3HRT A;  5LL6 S;  5D6Y A;  2KXC A;  3WVD B;  5GAN 4;  2QA4 A;  4HCZ A;  1I1J A;  2CDT A;  1VQO A;  2EGA A;  4BAC A;  3VU3 C;  1ZUK A;  5LJ3 f;  1HYO A;  2HD0 A;  3OYJ A;  5CKE A;  2BZY A;  3FB9 A;  4AG2 C;  5ECA A;  5CAI A;  1IGU A;  3O5Z A;  5LJ5 e;  4JS5 A;  4BE1 A;  2CRE A;  2XKO C;  4ANJ A;  1CSK A;  4J6X A;  2GFA A;  3MP8 A;  5KE3 A;  2RF0 A;  1SKU B;  4TVR A;  4PJN A;  4C5G A;  3SFM A;  1PKS A;  1I81 A;  1KD1 R;  2CT4 A;  2PUK B;  1BK2 A;  2LCC A;  5FU6 B;  2YT6 A;  5GAN g;  4B9W A;  5HK0 A;  3JCM g;  2COZ A;  3DLM A;  3P8H A;  3QBY A;  1K8A C;  3ZEH A;  4QQ6 A;  1TUC A;  4CRI A;  4QQD A;  1UTI A;  5DM7 R;  2QQS A;  2EQM A;  2LQN A;  5KYY B;  2DD5 A;  2ZCF B;  4M7D D;  4FYW B;  4D8D A;  3OYA A;  3SWN A;  4C0F A;  1SSF A;  3NFC A;  3NTI A;  3O8V A;  2ED1 A;  3CCS T;  1YIJ A;  3AHU A;  1NLP C;  1IHV A;  1KHI A;  3X28 B;  1WA7 A;  3CCR T;  4X9C A;  1ZSZ B;  2K5F A;  4IUV A;  2DL5 A;  1YJ9 T;  4XTZ A;  1KFZ A;  1NEB A;  4A54 A;  2JN0 A;  1S72 Q;  3SD4 A;  3JCM c;  1RAE B;  3CCL T;  1G5V A;  2DM1 A;  4DOW A;  2MWO A;  4FCY A;  3VRY A;  4QQG A;  1VQ5 Q;  3HTR A;  1KJW A;  3VV0 A;  5I11 A;  3NHN A;  2K5I A;  4OF1 A;  2QXF A;  1N9S A;  4AG1 C;  3MO8 A;  4JRP A;  2EQJ A;  3L2W A;  3CBO A;  1W2B P;  3M4G A;  2JUF A;  1G3S A;  3X25 B;  1PWT A;  2QQR A;  1M1K R;  1UE9 A;  3MP1 A;  4RKU E;  1D1B A;  1GFD A;  2CP5 A;  4M7D G;  1JXM A;  4HCC A;  3VS2 A;  2ZPE B;  1MGQ A;  2C0I A;  1MMN A;  3OBW A;  2HDA A;  4LN2 A;  1AT1 B;  1YWO A;  2Y4X A;  3I5R A;  1YJW T;  2E6Z A;  3DB4 A;  4Y91 A;  4M77 D;  2CH4 A;  1X6O A;  3TSZ A;  2DZC A;  1G2B A;  2JS2 A;  2QEX Q;  2EJ9 A;  1WPY A;  2AHJ B;  2EGC A;  4M75 F;  1FMW A;  4JZ3 A;  1AWX A;  1YBY A;  1SG5 A;  4DBQ A;  2JOY A;  1YIT Q;  2QTV A;  1C0M A;  2KBT A;  4F7U B;  1TUG B;  2OTJ A;  3I35 A;  4J9I A;  1WJQ A;  4ORZ A;  2DE0 X;  1K9M U;  2FRY A;  3LGL A;  3MJX A;  4M77 C;  4FT4 A;  4J9E A;  5GAO q;  1W2B S;  2DEU A;  2XDP A;  3VYG A;  2CSI A;  3VYH B;  3CBP A;  5FRM A;  1WLP B;  2DL4 A;  1QQJ A;  5IHI A;  1S1N A;  3CMA Q;  1V1C A;  3L1A A;  4AFQ C;  4FSS A;  3EG9 B;  1M2V A;  2YLB A;  3CBM A;  2RJE A;  4BDZ A;  3CD6 A;  3V7S A;  2KI7 A;  4M78 E;  1QCO A;  1YJW A;  1M8M A;  1GCQ C;  1Y96 A;  4MML A;  3DLL A;  2JM8 A;  2DFU A;  1W1F A;  1AWO A;  5GJW B;  1RLP C;  4PNO A;  3T9N A;  2QEX T;  1PSF A;  3C0C A;  1MNE A;  2VGN A;  2P4T A;  2CSQ A;  1QKW A;  3CC7 A;  4LNP A;  5CK9 A;  3LW5 E;  1M2V B;  5KCH A;  4PJO A;  5IXB A;  1VYV A;  2E64 A;  2OAU A;  4M4Z A;  2NUT A;  3V7C A;  3A8H B;  2YHT A;  1QVP A;  4F7U G;  5LJ5 f;  4C8Q D;  2OTJ Q;  5FU7 B;  4ME7 A;  1KD1 C;  3CCM A;  3BDU A;  2A37 A;  2OTL Q;  1P92 A;  3P8D A;  3VS7 A;  2VUB A;  3M5A A;  1AHJ B;  4P5N A;  3RUX A;  2P0Q A;  1T0H A;  3OW2 P;  1N8R U;  2L0A A;  1B7T A;  2RQU A;  1D09 B;  2DIQ A;  5GAN 2;  2KRS A;  3EGX A;  4GBQ A;  2CP3 A;  2GTJ A;  4IUR A;  3X24 B;  2GCX A;  2DF6 A;  3PGG A;  4KT0 E;  4DBH A;  2PTK A;  4OML A;  1UEB A;  3CD6 Q;  4EMH A;  5GAN 7;  3SHW A;  2QDL A;  1WQ7 A;  3BFM A;  3CCR Q;  4XAX B;  5IHN A;  2WSE E;  5D6W A;  1S72 T;  4HCB A;  2MOX A;  5KYX A;  1DJ7 B;  2KQW A;  2PVG B;  1Q82 R;  2CUB A;  1JJ2 P;  1D1C A;  3FJP A;  1TOV A;  1SHG A;  3FDR A;  1B34 B;  3A5Z B;  2LT1 A;  1KQ2 A;  4BY6 C;  1VQ6 A;  4M78 B;  3A1P A;  1SEM A;  2F2V A;  2R57 A;  4LDY A;  4E7H A;  1KIK A;  2QA4 T;  4JRI A;  4LDX A;  3L2Q A;  2EGE A;  3S3N A;  4BI3 A;  4IKF A;  4M78 D;  4M75 G;  1KC8 R;  2KRN A;  1PM3 A;  2DTO A;  2V1Q A;  4ELY C;  1UHF A;  4M7A E;  4PFO A;  4J9F A;  4E7L A;  2E70 A;  4DEY A;  2CP0 A;  2DL7 A;  3EHR A;  8AT1 B;  1N27 A;  1W4S A;  3GP8 A;  3EG0 A;  2LVM A;  2XID A;  2F5K A;  3QWY A;  2OJ2 A;  3RIR A;  4NS5 A;  1WGS A;  2XG8 D;  1H92 A;  2DLP A;  1HD3 A;  4AT1 B;  3PNW C;  1E6G A;  4NOY A;  2D8H A;  3OSV A;  4HXJ A;  2Y4Y A;  1VQ8 Q;  1KHC A;  1K73 U;  3VKI A;  1TSF A;  3H9N A;  2RO0 A;  1FMK A;  5CKB A;  1JQQ A;  2LMJ A;  2DA9 A;  1QVG A;  1UJY A;  1KSW A;  2H3E B;  3RMQ A;  3KXT A;  2DKG A;  4XK8 E;  4PJM A;  4M7D F;  2E3I A;  2ZZD A;  4HVV A;  3L42 A;  3OYN A;  4PK4 A;  4PJJ A;  4ZGJ B;  4PJO C;  2J6O A;  3E9F A;  4YTL A;  4BI8 B;  2L5Q A;  2RH2 A;  4RMO A;  5GJV B;  1O9S A;  1TH7 A;  2QQ9 A;  1BBZ A;  2RHI A;  2DIG A;  2RK2 A;  4R56 A;  5GAM d;  3ASK A;  3OYY A;  4E6R A;  2O2O A;  3FLG A;  5CIU A;  3CCJ T;  1VA7 A;  1PKT A;  2DYI A;  2EIF A;  2BE7 D;  4BUG A;  4V2S A;  1VQL A;  3OYI A;  2EBP A;  2GBQ A;  1TU0 B;  2BIV A;  1SRM A;  4E2F B;  1QVF A;  4M7A F;  2RQR A;  2O01 E;  2MWP A;  3TU4 K;  3U23 A;  1IRX A;  2K79 A;  1M2O A;  4OB1 B;  3JCM P;  4X9D A;  3EGX B;  3CCL Q;  2YXY A;  2PU9 B;  4IIM A;  3EG1 A;  1KQS S;  3I55 Q;  2CP7 A;  4BI4 A;  4XTV A;  4C8Q E;  3URG A;  3CCM Q;  3A8L B;  2JZ2 A;  1HJD A;  2K2M A;  3L2R A;  3OSS C;  1YNZ A;  4BD3 A;  1ZSZ A;  3LWH A;  9ATC B;  1IXD A;  4PJO B;  4NL2 A;  5M9O A;  2X4Y A;  1WQW A;  1BIB A;  2ROT A;  5J39 A;  2EYX A;  2OTL T;  3PMI A;  3QXE B;  1U06 A;  1AD5 A;  5KYU A;  2DXU A;  3QDR B;  1VQ4 A;  1R0C B;  1WX6 A;  2O9V A;  2RM4 A;  2YUQ A;  3LYI A;  3QO3 A;  2QI2 A;  3VRZ A;  4C92 C;  1D0Y A;  3RR6 A;  1M27 C;  5CCA A;  1GBR A;  3EFO A;  1M4Z A;  3OYF A;  2V8J A;  1MMD A;  4HVW A;  1Y71 A;  3VS1 A;  4O6J A;  2D0Q B;  1FWZ A;  1X6G A;  2L2P A;  1GBQ A;  3I56 A;  5C6S A;  2EPD A;  3KFV A;  5HY6 A;  3NTH A;  2DZ9 A;  2PVO B;  3S6W A;  3CME Q;  4LUD A;  5CR2 A;  1WHL A;  2JT4 A;  4RCC A;  1HXD A;  4MZM A;  4R55 A;  2K5L A;  2EYQ A;  2LQ8 A;  3CCJ Q;  2RJD A;  1AWW A;  5DY9 A;  1N8R R;  5A0D A;  1UHC A;  2XMF A;  3CPW A;  4F7U A;  3QYH B;  1QLY A;  4EMK A;  3LGF A;  1K0S A;  3CCQ Q;  2LJ0 A;  3HPW A;  2K2V A;  4PJO G;  4M78 A;  4XTU A;  3RKX A;  2KYM A;  2VV5 A;  5GAO p;  1D0Z A;  2RK1 A;  4C8Q F;  8ATC B;  1O75 A;  2NUP A;  1JU5 C;  4OB0 B;  2FB7 A;  4C8Q B;  1BCO A;  4Z8A A;  2VWF A;  2AZS A;  2DER A;  1PD0 A;  2JMA A;  1I07 A;  2LJ3 A;  4J7I A;  2CYZ B;  1OPL A;  1A0N B;  2PQW A;  1EX4 A;  4JJN K;  3JCM f;  1NZ9 A;  2E1H A;  1VQN A;  2O88 A;  5GAO l;  3QWX X;  3UT1 A;  2AIR B;  2BKD N;  3M9Q A;  3CCE Q;  3A8M B;  1GCP A;  4ZNX A;  5J3B A;  2MYS A;  4J9C A;  2L3S A;  4LD6 A;  2HL5 C;  2KMT A;  4QW2 A;  2HQE A;  3TRE A;  2M0O A;  1Z9Z A;  3CCV A;  2RHY A;  4EPC A;  2JW4 A;  3CCS A;  4LDW A;  4OB2 B;  2QEX A;  4KUI A;  4Z89 A;  4E7S A;  4XTY A;  4FW1 A;  5GAO n;  4KRT A;  2DTI A;  1Q95 G;  2D9T A;  2GFU A;  5CVI A;  1Q82 U;  4M7D E;  3CCQ A;  2DAQ A;  2P0K A;  3ZFJ A;  5CQX A;  3M55 A;  3G4S Q;  2KSS A;  3RES A;  1M5Q 1;  1X43 A;  4OMP A;  4BE2 A;  1AVZ C;  5KYN A;  2RI3 A;  3OYE A;  4M78 G;  3EFO B;  2PVD B;  4C0D B;  5KYY A;  1YWP A;  2HEQ A;  3CCU A;  3M0U A;  4OGE A;  3OYG A;  4J83 A;  3MHX A;  2FG0 A;  5L8R E;  1QWE A;  2X4X A;  4C92 E;  1Q81 U;  3C95 A;  3QZ9 B;  3KBG A;  1WI7 A;  1RAI B;  3MET A;  2FHD A;  4N0A C;  2JNG A;  2VXF A;  1YJ9 Q;  1IO6 A;  3PVQ A;  1M90 U;  3QG1 A;  2PZ1 A;  5LJ5 h;  1Q86 R;  1D0X A;  4QVD A;  1LOJ A;  2D0N A;  1MHN A;  4Z88 A;  2QK0 A;  1FX7 A;  2RHZ A;  2ROL A;  2W0Z A;  1AWJ A;  1NBE B;  1K8A R;  1MV0 B;  2RD1 A;  1GFC A;  3CCS Q;  1M1K U;  3QJY A;  4A4E A;  2DK3 A;  4C92 G;  2K57 A;  2XDB A;  3FEO A;  3OMC A;  5I2M A;  3VS6 A;  1Q81 C;  2WAC A;  2DTH A;  2EW3 A;  2ESW A;  4WTO B;  3FJ5 A;  5C0M A;  1VQ7 Q;  2ABL A;  2DVE A;  2XU8 A;  2J06 A;  4XTX A;  2MMP A;  3WVE B;  1IHW A;  2RN8 A;  1JB0 E;  1I5O B;  2ED0 A;  3JCM V;  3TCJ A;  4BB7 A;  2DXC A;  3BY7 A;  1OU8 A;  3ZBD A;  2GQI A;  3QZ5 B;  3R6N A;  3CCE T;  2MCN A;  3BE3 A;  1MND A;  1QW1 A;  2RJC A;  1WHK A;  3UA6 A;  2I2L A;  1G83 A;  2J7I A;  3C12 A;  2A28 A;  1VQM A;  4M7D B;  2NUZ A;  1M9S A;  1G3T A;  3CCJ A;  1LCK A;  2SEM A;  2OI3 A;  1ZUY A;  2CZ7 B;  2KRO A;  3HSB A;  2FVU A;  1QCF A;  2DIL A;  3M54 A;  5LJ3 g;  1N8R C;  4GY5 A;  5GMK i;  2P4R A;  1WXU A;  1SRL A;  3OQ5 A;  1W70 A;  2QDY B;  3JB9 J;  1NM7 A;  2GNC A;  3C4S A;  3G71 T;  2RNA A;  4IIO A;  1ARK A;  4KGV B;  3JB9 I;  2YLC A;  4JZ4 A;  1QP3 A;  2A08 A;  2KR3 A;  1YCS B;  5HK3 A;  4C92 B;  2AZV A;  2RQT A;  2WSF E;  2RQW A;  3PIP A;  2JM9 A;  5CKF A;  3IQL A;  1YHQ Q;  5I22 A;  4XQ3 A;  4A4G A;  2ZPI B;  3UWN A;  5KE2 A;  1KQS P;  2ZPH B;  4EMK C;  1U1T A;  4A4F A;  2EWN A;  3CC2 T;  4C0Z A;  5GAN 5;  2HMA A;  3CQT A;  4M77 F;  3JB9 H;  1TXQ A;  3RER A;  1PHT A;  4RG8 A;  1RAG B;  2LNV A;  3V8J A;  1VQ4 T;  2RMO A;  3OS1 A;  5FU6 C;  3RKW A;  1IRE B;  1F1B B;  4HA8 A;  3UF4 A;  3CEY A;  4FU6 A;  1X2K A;  2OAW A;  3EG9 A;  2VB6 A;  3ME9 A;  2F5T X;  2E10 A;  3G1J A;  3PMT A;  4EIK A;  2EJF A;  3JV3 A;  1KQ1 A;  2MAM A;  5KYX B;  2A7Y A;  5GMK h;  4FW2 A;  1CKA A;  1VQP T;  1G3Y A;  1K9M C;  2JTM A;  3ULR B;  2YUP A;  1RAA B;  5LJ5 g;  3CC4 A;  3V8K A;  2DD4 A;  2KT1 A;  2IPO B;  4L6V 5;  4ZN1 A;  1KC8 U;  1X75 C;  2E12 A;  3EAE A;  2F1L A;  1GRI A;  2DXT A;  1VQO T;  1OEB A;  1NYF A;  2BZX A;  2RA2 A;  2DRM A;  2DJZ A;  1M30 A;  1VQ5 A;  3OBY A;  3SDZ A;  2XD0 A;  1OX9 A;  3INZ A;  3MCA B;  1B34 A;  1Y7X A;  1VOM A;  4FYV B;  4M77 G;  1ZBJ A;  2EKH A;  3H8Z A;  3HKS A;  3OA6 A;  3EG2 A;  1I4K 1;  1OZ2 A;  1HSQ A;  4A4H A;  1YIJ Q;  1PG5 B;  4E47 A;  2DEQ A;  3TQ7 P;  4BE0 A;  1YJN Q;  1AOJ A;  2K6D A;  2MIO A;  1S72 A;  2WSC E;  2XK0 A;  3V8L A;  1J3T A;  4DOV A;  3NMZ C;  1W6X A;  4KBM B;  4M7A D;  2LT4 A;  2LDM A;  4CI0 C;  4KH0 B;  3I5S A;  4JJD A;  4EMG A;  3VS3 A;  4ZGD B;  3MPU B;  5LJ3 j;  2FL7 A;  5DLQ E;  4F7U E;  1U5S A;  1YI2 A;  1VQ9 Q;  1UEC A;  1TTH B;  3JB9 F;  1YHQ T;  2ZAE A;  2MPX C;  2RPN A;  2LZ6 B;  5LJ3 h;  1ZUU A;  3JCM b;  1YIT A;  1JJ2 S;  4WF2 A;  1M3A A;  1K1Z A;  5GAN 3;  2L89 A;  5A0G A;  3M0T A;  3CMA A;  4PL6 A;  3HFN A;  2QTX A;  3QII A;  1X69 A;  2EQK A;  2GQV A;  1BI3 A;  3QDF A;  4OP0 A;  4A4K A;  2LC4 A;  1M3C A;  1SF9 A;  2V1R A;  1KC8 C;  2DVJ A;  1H8K A;  2Y90 A;  3HRS A;  2A36 A;  2VGM A;  2JTF A;  2JJ9 A;  2EYY A;  4M75 B;  4KH1 B;  3VS5 A;  3PIO A;  1WNL A;  4M75 E;  1BI2 A;  1VYT A;  4NL3 A;  5EG2 A;  3M0Q A;  1MMA A;  4ATO A;  1VQP A;  4QT7 A;  1QVF S;  2YUN A;  4N0A A;  2X4J A;  3M59 A;  5KCO A;  1VQN T;  2DXB A;  2K4Y A;  1U1S A;  2L8D A;  2RI2 A;  3BDL A;  4MDW A;  1RAC B;  5FRN A;  2E41 A;  2EYW A;  1QVG P;  1VQ9 A;  3ZL7 C;  4M7D A;  2COY A;  5CQY A;  2B8A A;  2H8H A;  1UG1 A;  1PNJ A;  1B3Q A;  3G6E Q;  5GAO r;  2L3Q A;  1NJI U;  3LWI A;  3EGD A;  1WHH A;  2JTE A;  2M02 A;  1VQM Q;  2CKK A;  1VQK T;  1WJS A;  3CME T;  4M78 F;  1YJW Q;  2MF2 A;  2OTL A;  4XTW A;  3GNF B;  1VIE A;  2YSQ A;  4M75 C;  1M1F A;  1ZLM A;  3CC7 Q;  2RHU A;  3FRN A;  3CCM T;  2HNI A;  2H3J A;  1N6A A;  4D6W A;  3REA B;  1I5L A;  2GGR A;  2FPE A;  4IUQ A;  4AMC A;  1VQN Q;  2DL3 A;  1VQ4 Q;  1IZ6 A;  2X3W D;  3G4S T;  3X26 B;  4LE9 A;  1N9R A;  2D1X A;  1KG1 A;  1G8X A;  4D8K A;  2NWM A;  1T3S A;  1YI2 T;  1VQK Q;  2HKQ B;  3PE0 A;  5DLO A;  1IGQ A;  3GNG A;  5GMK e;  1WYX A;  1TUD A;  4JDS A;  3Q1J A;  5IAY A;  3BW1 A;  3EFR A;  3J81 E;  4R0K A;  3JCM e;  1BI0 A;  5D6X A;  2E5Q A;  3M57 A;  2DET A;  1OUL A;  4IUP A;  3MP6 A;  3GPL A;  2X9H A;  3SWN C;  3OS0 A;  3CC7 T;  2KDS A;  2QGF B;  1VQ6 T;  1LVK A;  4C92 A;  2D6F A;  4CC4 B;  4CC2 A;  2VXE A;  1NG2 A;  1BI1 A;  1VQ8 A;  3EH2 A;  3MEW A;  2DO3 A;  3QUI A;  1GL5 A;  4DBR A;  2O31 A;  1VIF A;  3UA7 A;  3H0F A;  3DB3 A;  3S3O A;  3REB B;  1C6V X;  1D1A A;  4Y28 E;  5HKC A;  2FYK A;  4DEX A;  3AT1 B;  4HT9 A;  2BTT A;  3LX7 A;  3TVT A;  4N4H A;  2X3X D;  3MEA A;  4E7Z A;  1RI9 A;  1X01 A;  1RAB B;  2BZ8 A;  2QG9 B;  5GAO m;  4OVA A;  5FRO A;  4PLL A;  2CP2 A;  4X1V A;  1YIJ T;  3P8B B;  1VQ7 T;  3EFS A;  5EC7 A;  4OMN A;  2IG0 A;  2KE9 A;  1YN8 A;  2KVQ G;  1M8V A;  4FIB A;  2DX1 A;  2RJF A;  2MI6 A;  2D8J A;  2IVW A;  5LJ3 e;  4AFU C;  3CCQ T;  2ZPG B;  1YJN A;  3HRU A;  2BE9 B;  4PJO D;  1T0J A;  4DBF A;  1Y07 A;  1D3B B;  3JSC A;  4C8Q A;  4B9X A;  2VAS A;  1VQ8 T;  1PC0 A;  1UGR B;  3JRZ A;  2RB6 A;  2ZGW A;  2O4X A;  4EMK B;  1Z9Q A;  3GBQ A;  5AYF A;  4KGZ B;  2BUD A;  1RAD B;  2VC8 A;  3E9G A;  1LPL A;  4KUD K;  1E6H A;  1GCQ A;  2B86 A;  3RDV A;  1PRL C;  4HT8 A;  2SRC A;  2K3Y A;  4M77 B;  2QAS A;  1YCY A;  1AZE A;  4E7K A;  3GOX A;  4LD9 K;  3MEU A;  3N5B B;  2KYB A;  1WHM A;  5GAM j;  3OW2 A;  1RUW A;  4J9H A;  1RI0 A;  2HAX A;  3CXC A;  4HKE A;  4JRQ A;  4JUV A;  4PFP A;  3JCM d;  3SWN B;  1IB8 A;  1OU9 A;  2DL8 A;  2E4H A;  2K7A A;  3HFO A;  5I21 A;  3WXM B;  4C0G A;  1ZQ1 A;  1YP5 A;  4CC7 A;  2J6K A;  3RMS A;  3H0I A;  4C92 F;  5FW9 A;  1VQP Q;  4II1 A;  4Y92 A;  5IHK A;  2DYB A;  1MV3 A;  2K3X A;  1OPK A;  4L59 A;  1MUZ A;  2IIM A;  1R0B G;  7AT1 B;  1KQS A;  5GAM h;  2ENM A;  1WHG A;  2X35 A;  4J6W A;  2FZC B;  2AK5 A;  4M78 C;  3I56 Q;  3HHT B;  2FEI A;  1UJ0 A;  3VUB A;  1VQM T;  3CD6 T;  4X34 A;  4MDX A;  4FSX A;  2AT1 B;  3TEE A;  4ELZ C;  4Z02 A;  1T3L A;  4FM4 B;  2LNH B;  1K0X A;  1K4U S;  1OV3 A;  2E6N A;  2EAY A;  2LX9 A;  1VQL T;  3RNJ A;  1KK7 A;  5CO7 A;  1FXX A;  2LTO A;  2QQB A;  3PFS A;  4K11 A;  1NYG A;  2C06 A;  4JJC A;  4BY6 B;  5CKH A;  3OMG A;  3OY9 A;  1WIE A;  4FL6 A;  5GAN f;  3X20 B;  3QPH A;  1VUB A;  1WHJ A;  2C0O A;  1Q86 C;  1X6B A;  1V29 B;  1HK9 A;  3QSU A;  4LXC A;  1ZA2 B;  2W10 A;  3L2V A;  1K8A U;  1M3B A;  5GAN j;  4AFZ C;  5GAN 6;  2R58 A;  1U3O A;  1U8R A;  3A8O B;  2CGH A;  2HL3 A;  1JRI A;  2JMC A;  5FU7 C;  2ZPB B;  1TS9 A;  4MMK A;  3UDC A;  5LJ5 j;  3JB9 D;  1QVF P;  4C92 D;  1Y0M A;  2MK5 A;  4F7U F;  3CCR A;  1Q81 R;  1VQK A;  3CCE A;  1JEG A;  3G7Z A;  2RI5 A;  4Q5W A;  1SPK A;  4M75 A;  5I2S A;  4PKC C;  1UGV A;  1Y57 A;  2M9U A;  4C0D C;  1M1K C;  1LJO A;  1H3H A;  4MZT A;  4OGC A;  2GF7 A;  2NUT B;  2CUD A;  3G6E T;  3QHS A;  1VQ6 Q;  2LQW A;  2VYT A;  3L2Z A;  4RTT A;  1ZHI A;  6AT1 B;  1ZA1 B;  3FC3 A;  2CZ0 B;  3CPW P;  4M7D C;  1VYU A;  2ATC B;  2V8K A;  1RAF B;  2JVV A;  2HCK A;  3CCV Q;  2X4W A;  2M0Y A;  1G3W A;  2CP6 A;  1TG0 A;  4JLI A;  3I56 T;  3QYG B;  2V26 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 2RPN A;  1HJD A;  2LZ6 B;  2K2M A;  1ZUU A;  2K3B A;  2CDT A;  2EGA A;  1M3A A;  1YNZ A;  1ZUK A;  5FWB A;  1K1Z A;  1BU1 A;  5IH2 A;  2BZY A;  2FPD A;  3M0T A;  4AG2 C;  5ECA A;  1NEG A;  1X27 A;  1X69 A;  3O5Z A;  2ROT A;  2CRE A;  4J9D A;  2EYX A;  2DRK A;  1CSK A;  4F17 A;  2LCS A;  1M3C A;  2V1R A;  1U06 A;  1AD5 A;  2DVJ A;  1H8K A;  1WX6 A;  2O9V A;  2YUQ A;  1K76 A;  2RF0 A;  2A36 A;  1BB9 A;  1UUE A;  3VRZ A;  1PKS A;  1M27 C;  5HCK A;  1GBR A;  2CT4 A;  2EYY A;  1BK2 A;  1X2Q A;  2KEA A;  2YT6 A;  1QWF A;  3VS5 A;  4RTZ A;  1VYT A;  4HVW A;  1NLO C;  3M0Q A;  2PNI A;  3VS1 A;  1XOV A;  4QT7 A;  2YUN A;  1K9A A;  1JXO A;  1X6G A;  2L2P A;  1B07 A;  1GBQ A;  2EPD A;  3KFV A;  1TUC A;  1UTI A;  4WCI A;  4LUD A;  2EYW A;  2LQN A;  2JT4 A;  3RBB B;  3ZL7 C;  4D8D A;  2H8H A;  1UG1 A;  1PNJ A;  1AWW A;  4F16 A;  1B3Q A;  2ED1 A;  1NLP C;  2L3Q A;  1WA7 A;  1UHC A;  2JTE A;  2XMF A;  3M0S A;  1QLY A;  2I0N A;  2FPF A;  2DL5 A;  1K0S A;  2LJ0 A;  1KFZ A;  1NEB A;  2KGT A;  2YUO A;  2KYM A;  2YSQ A;  2DM1 A;  1JU5 C;  3VRY A;  2AKK A;  2KXD A;  2LP5 A;  2E5K A;  2RQV A;  4Z8A A;  1KJW A;  2VWF A;  2AZS A;  5I11 A;  1ZLM A;  3NHN A;  2CH4 W;  2JMA A;  1I07 A;  4AG1 C;  2LJ3 A;  4LUE A;  2JS0 A;  3REA B;  2GGR A;  1OPL A;  1A0N B;  2FPE A;  2DL3 A;  1PWT A;  1UE9 A;  2X3W D;  4OMQ A;  1SSH A;  4LE9 A;  2O88 A;  1GFD A;  2VVK A;  2J05 A;  3QWX X;  2D1X A;  1GCP A;  3A98 A;  4ZNX A;  1JXM A;  2NWM A;  4D8K A;  1T3S A;  2L3S A;  2HSP A;  4J9C A;  3VS2 A;  3H41 A;  2C0I A;  4OMM A;  3VS4 A;  2HDA A;  3PE0 A;  4LN2 A;  1YWO A;  1WYX A;  1Z9Z A;  1ZX6 A;  1TUD A;  3I5R A;  4ESR A;  2F2W A;  2EYZ A;  4RTU A;  2CH4 A;  2JW4 A;  4R0K A;  1RLQ C;  3TSZ A;  3M0P A;  4Z89 A;  1G2B A;  5FWC A;  2JS2 A;  4KRT A;  2AKL A;  2EGC A;  4JZ3 A;  1AWX A;  2KNB B;  2C0T A;  3H0H A;  2KBT A;  2M51 A;  3I35 A;  4J9I A;  4RTW A;  4ORZ A;  2DMO A;  2DE0 X;  4CC4 B;  4CC2 A;  2FRY A;  1CKB A;  1NG2 A;  1X43 A;  4OMP A;  4J9E A;  1AVZ C;  2F2X A;  1GL5 A;  1YWP A;  2HEQ A;  2O31 A;  3M0U A;  2CSI A;  3UA7 A;  3H0F A;  2FG0 A;  3REB B;  1FYN A;  3LH5 A;  1E7O A;  1WLP B;  1QWE A;  3NPF A;  2DL4 A;  1S1N A;  1SHF A;  5IHI A;  3EG3 A;  1V1C A;  4DEX A;  1N5Z A;  4AFQ C;  4FSS A;  2BTT A;  1WI7 A;  3TVT A;  4RTV A;  2X3X D;  5IXF A;  4F14 A;  1IO6 A;  5L23 A;  2JXB A;  3PVQ A;  1QKX A;  2PZ1 A;  1RI9 A;  2EVR A;  1WXB A;  3UAT A;  2D0N A;  4Z88 A;  2J6F A;  1M8M A;  2BZ8 A;  1GCQ C;  2ROL A;  2W0Z A;  2JM8 A;  1AWJ A;  1W1F A;  4X1V A;  1ABO A;  1AWO A;  5GJW B;  1RLP C;  1MV0 B;  3C0C A;  5EC7 A;  1GFC A;  2KE9 A;  4OMN A;  1YN8 A;  4JJB A;  2CSQ A;  1QKW A;  4LNP A;  2DX1 A;  2FO0 A;  3EGU A;  2D8J A;  3EHQ A;  4AFU C;  3M0R A;  2YDL A;  5IXB A;  1VYV A;  4JPB W;  4M4Z A;  1T0J A;  3VS6 A;  2EW3 A;  3I9Q A;  2ESW A;  2KRM A;  3FJ5 A;  2KT8 A;  2ABL A;  1PRM C;  3NGP A;  2A37 A;  2J06 A;  2RN8 A;  3VS7 A;  2ED0 A;  1T0H A;  1ABQ A;  1Z9Q A;  3GBQ A;  2GQI A;  2L0A A;  3R6N A;  2RQU A;  2MCN A;  2KRS A;  4GBQ A;  4RTY A;  2GTJ A;  3UA6 A;  1G83 A;  2J7I A;  2A28 A;  2DF6 A;  1E6H A;  2PTK A;  3VS0 A;  1GCQ A;  2B86 A;  4OML A;  2NUZ A;  1PRL C;  3SHW A;  1LCK A;  2QDL A;  2SEM A;  2OI3 A;  1ZUY A;  2DNU A;  2SRC A;  2KRO A;  5IHN A;  1QCF A;  2DIL A;  1AZE A;  2KYB A;  2MOX A;  2P4R A;  4J9G A;  1WXU A;  1SRL A;  1RUW A;  4J9H A;  1W70 A;  2CUB A;  3PVL A;  1NM7 A;  2GNC A;  1WFW A;  1WXT A;  2RNA A;  4IIO A;  1SHG A;  1ARK A;  2FRW A;  2O9S A;  1I0C A;  2DL8 A;  2KR3 A;  2K7A A;  2F2V A;  1AZG B;  1SEM A;  2A08 A;  4JZ4 A;  1YCS B;  3SEM A;  4CC7 A;  1YP5 A;  2J6K A;  1KIK A;  3H0I A;  2AZV A;  2RQT A;  2RQW A;  2EGE A;  2JM9 A;  5FW9 A;  4Y92 A;  3IQL A;  5IHK A;  2DYB A;  1MV3 A;  5I22 A;  1OPK A;  2KRN A;  1MUZ A;  2V1Q A;  2IIM A;  1EFN A;  1AEY A;  1UHF A;  4RUG A;  2ENM A;  4J9F A;  4OMO A;  2AK5 A;  4HCK A;  2DBK A;  4DEY A;  2DL7 A;  3EHR A;  2FEI A;  3EG0 A;  1UJ0 A;  3CQT A;  3QWY A;  2OJ2 A;  4HVU A;  1PHT A;  1H92 A;  2DLP A;  1HD3 A;  2RMO A;  1T3L A;  1E6G A;  2LNH B;  3UF4 A;  1K0X A;  2LX7 A;  1K4U S;  1X2K A;  1OV3 A;  3TSW A;  2OAW A;  3RNJ A;  2D8H A;  4HXJ A;  4K11 A;  1NYG A;  4EIK A;  4JJC A;  1WIE A;  3JV3 A;  1UDL A;  3THK A;  2C0O A;  1FMK A;  1CKA A;  1X6B A;  1JQQ A;  2LMJ A;  4A63 B;  2DA9 A;  3ULR B;  2YUP A;  2DJQ A;  1UJY A;  2W10 A;  1KSW A;  4GLM A;  1M3B A;  2KT1 A;  4AFZ C;  1U3O A;  1WDX A;  4HVV A;  2VKN A;  2GTO A;  2JMC A;  1GRI A;  1OEB A;  1NYF A;  2BZX A;  2ECZ A;  2DRM A;  2J6O A;  1M30 A;  1Y0M A;  5GJV B;  1OOT A;  1ZSG A;  1JEG A;  1BBZ A;  2K9G A;  2CT3 A;  1SPK A;  2HBW A;  1UGV A;  1ZBJ A;  2EKH A;  2EQI A;  1Y57 A;  3EG2 A;  1H3H A;  1HSQ A;  4E6R A;  2O2O A;  4RTX A;  4CC3 A;  1VA7 A;  1PKT A;  2CUD A;  1UFF A;  4AFS C;  1AOJ A;  2K6D A;  2MIO A;  2LQW A;  2EBP A;  2GBQ A;  1JO8 A;  1J3T A;  1SRM A;  4RTT A;  3NMZ C;  4J9B A;  2RQR A;  1W6X A;  3U23 A;  2LJ1 A;  1VYU A;  2K79 A;  2HCK A;  2G6F X;  2M0Y A;  3I5S A;  2L3P A;  2DBM A;  4IIM A;  3EG1 A;  1TG0 A;  4JJD A;  3VS3 A;  2KXC A;  1U5S A;  1I1J A;  1UEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...