3H0IA

Human fyn sh3 domain r96i mutant, crystal form ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
VTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
total genus 11
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0iA00
1QLYA 1WFWA 4RTTA 2JS0A 4LN2A 4ESRA 1CKAA 2YDLA 3NMZC 2BZYA 2DL8A 2DMOA 1WX6A 3PVLA 1K1ZA 2BTTA 2CUBA 2EGEA 2GTOA 2VKNA 2KBTA 2KXDA 4RTVA 3UA7A 4JZ3A 2AZVA 3M0UA 2B86A 2L3QA 2LP5A 1K9AA 1PRMC 1AD5A 2DILA 4M4ZA 4F16A 2KXCA 5IXBA 4AG1C 1H8KA 1QWEA 2EYZA 1WXUA 1WI7A 4F14A 2X3XD 1JU5C 2L3SA 1X69A 1UHFA 1PKSA 3I5RA 2O88A 1J3TA 4OMLA 1YCSB 2MOXA 2EGCA 2GQIA 2DL5A 4AG2C 3M0RA 4ZNXA 2O9VA 1M3CA 2KGTA 1GCQC 3VS1A 1QKWA 4IIMA 5IHNA 1I0CA 1K4US 2YSQA 1X6BA 2BZ8A 1ARKA 4HVWA 1CSKA 1Y57A 1MV0B 1K0SA 4OMNA 3UF4A 3EG1A 2DM1A 3RNJA 2C0TA 2YUPA 1GCPA 3REAB 1OV3A 3R6NA 1U3OA 4RTXA 1WDXA 1W70A 3EHRA 3QWYA 4CC4B 2DL4A 1SHFA 2FO0A 4Z88A 2CH4A 2O31A 3UATA 2M0YA 2ROLA 3EGUA 3VS0A 2A28A 1UJ0A 4Z8AA 4RTWA 1I07A 1KSWA 1AWOA 1E6HA 1JO8A 5EC7A 2LMJA 2EQIA 1M27C 2D1XA 1FYNA 4OMPA 4LUEA 1PNJA 2YUOA 1QKXA 5L23A 3VS5A 2HSPA 1NLOC 1PKTA 1M8MA 1PWTA 2CREA 1RUWA 1M3BA 2EYYA 4HCKA 1V1CA 2FPDA 4D8DA 1JXOA 2EVRA 2PNIA 4OMOA 4AFZC 4D8KA 2JMAA 2LQNA 3A98A 1OPKA 1ZBJA 2RQVA 1QCFA 4LE9A 1GFCA 4R0KA 1K76A 3RBBB 4HVUA 1H92A 2JW4A 3I9QA 3NHNA 2DE0X 2MIOA 1Y0MA 4J9HA 3VS4A 4F17A 1NEGA 2JT4A 1UGVA 3H41A 2FRYA 1ABQA 2DBKA 1UHCA 2GNCA 1HSQA 4J9IA 1BU1A 1TUDA 1T3LA 1KJWA 1T0JA 1NYGA 1ZLMA 5FWCA 2FPEA 1U5SA 4JPBW 1U06A 2HEQA 1NEBA 1T0HA 2PZ1A 2LNHB 1LCKA 1MV3A 1IO6A 2K3BA 2A37A 2KROA 2ECZA 2LQWA 2O2OA 4HXJA 1X2KA 1SEMA 2EKHA 3EHQA 1X27A 2KYBA 2V1QA 2YUNA 2JM9A 3M0PA 2EGAA 2DVJA 4DEYA 2ABLA 5HCKA 3TSZA 2RNAA 2JM8A 1M3AA 1YWOA 2FPFA 2LZ6B 2EYXA 1TUCA 4QT7A 4J9DA 1E7OA 1UDLA 1QWFA 2GGRA 4Y92A 3M0SA 1VA7A 1VYUA 2EBPA 5IHKA 1E6GA 1WIEA 1RLPC 2J06A 3M0QA 2DNUA 4CC7A 1PRLC 4RTYA 1YWPA 5I22A 1PHTA 4GLMA 1SSHA 3PE0A 2AK5A 2C0OA 2JS2A 2NUZA 2PTKA 2HBWA 2RQRA 2NWMA 2ENMA 2V1RA 1VYTA 2ED0A 1AWJA 5FW9A 1N5ZA 3UA6A 1AVZC 1UUEA 2LCSA 2FEIA 3REBB 3SEMA 1ZUUA 1KFZA 2L2PA 1ZUYA 1T3SA 1UG1A 3KFVA 2LJ0A 2CSIA 1GCQA 1AZEA 1OPLA 2W10A 2KRMA 2DA9A 1WXBA 1RLQC 4DEXA 2KT1A 4J9CA 1SRLA 1X2QA 3LH5A 3GBQA 3JV3A 4OMQA 1ZSGA 1H3HA 2LJ1A 4FSSA 2LX7A 1GBRA 2J6KA 1UFFA 5IHIA 1WA7A 2CDTA 4LNPA 1NYFA 5IXFA 1M30A 4AFQC 1BK2A 2I0NA 2G6FX 2KNBB 1YP5A 2KYMA 2RQTA 2SEMA 1Z9QA 4J9EA 1A0NB 4RTUA 4JJBA 1GFDA 1OOTA 2K7AA 4ORZA 1FMKA 3VS6A 2RQUA 2J6FA 4J9BA 5FWBA 1VYVA 5GJVB 2SRCA 5IH2A 1K0XA 3I35A 2DBMA 2OJ2A 2GTJA 1TG0A 2KRNA 2HCKA 3NPFA 1GBQA 2KEAA 1WLPB 1B3QA 2KT8A 1G83A 1XOVA 2F2XA 1W1FA 3VRYA 2QDLA 4CC2A 3QWXX 1I1JA 1NG2A 4J9GA 3CQTA 1SHGA 4JJDA 1NM7A 2AKLA 2VWFA 5GJWB 3M0TA 2ESWA 4Z89A 1GRIA 1SRMA 2DL3A 2DRKA 1YNZA 2EW3A 3ZL7C 1AEYA 2EPDA 1JXMA 1G2BA 2CH4W 4HVVA 4JZ4A 2DRMA 2F2VA 2VVKA 2FRWA 2H8HA 1ZX6A 3VRZA 1AWWA 4GBQA 2D8HA 1B07A 1MUZA 3ULRB 2L0AA 2JTEA 1ZUKA 2L3PA 3EG3A 4JJCA 4AFUC 2OI3A 2RPNA 2RF0A 2CSQA 3FJ5A 2C0IA 1Z9ZA 3O5ZA 2AKKA 4IIOA 2OAWA 2K6DA 2P4RA 4RTZA 1HD3A 1AZGB 1X6GA 1HJDA 3SHWA 3VS7A 1OEBA 2DYBA 2DLPA 2J05A 2XMFA 2JMCA 1BB9A 3C0CA 2AZSA 1UJYA 1JQQA 1JEGA 2GBQA 2D0NA 2M51A 2DL7A 2X3WD 3PVQA 3TSWA 2HDAA 1NLPC 2W0ZA 5ECAA 2KRSA 3H0IA 4OMMA 1EFNA 2K2MA 1RI9A 2K9GA 2CT3A 2LJ3A 2CUDA 2YUQA 4CC3A 1GL5A 2J7IA 2EYWA 4AFSC 1UTIA 2DJQA 1UECA 2DF6A 2E5KA 4A63B 2A08A 3THKA 3NGPA 2D8JA 3EG2A 3IQLA 2O9SA 2YT6A 3EG0A 2FG0A 2KE9A 3H0HA 1S1NA 2MCNA 2JXBA 1BBZA 1ABOA 4KRTA 3U23A 5I11A 2BZXA 4J9FA 1WXTA 2KR3A 4K11A 1X43A 2ED1A 4RUGA 2RN8A 2DX1A 4E6RA 1AWXA 3H0FA 1W6XA 2CT4A 2K79A 4X1VA 2IIMA 1UE9A 1SPKA 2J6OA 3VS2A 2ROTA 4LUDA 4EIKA 1AOJA 3VS3A 1KIKA 1CKBA 4WCIA 3I5SA 2F2WA 1WYXA 2A36A 3TVTA 2RMOA 2RQWA 1YN8A
chains in the Genus database with same CATH superfamily
5CR2A 1WFWA 1ZBXA 3TCJA 2JS0A 3MP6A 5FU6B 3CCMQ 2HSEB 2YDLA 1YI2A 2BZYA 4QKUA 1GXIE 1WX6A 2ATCB 1M9SA 5I21A 2EGEA 2QA4A 2KBTA 2MF2A 4J7FA 1NBEB 4HKEA 3HRUA 4M78A 2B86A 2L89A 2KXCA 2OTLA 2DXCA 3CMAT 2Z0WA 1WXUA 2RO0A 2X3XD 2L3SA 2DIQA 2E3HA 3A5ZB 3I5RA 2O88A 1J3TA 1Q86C 2MOXA 1YCYA 2YRVA 5CKEA 3OS0A 2DL5A 3CCSQ 4ZNXA 2O9VA 5GAMd 1M3CA 2KGTA 2RHIA 5D6WA 2K4YA 3VS1A 4RMOA 2ZPIB 4IIMA 1I0CA 1ARKA 4M7AC 1CSKA 1BIBA 1Y57A 4HCZA 3H9NA 3L2UA 2BE7D 2O4XB 2FHDA 3RNJA 2K5FA 3RUXA 1VQ5Q 3REAB 1OV3A 5LJ3h 1Q82C 1U3OA 1ZHIA 1WDXA 1XNIA 3S6WA 3BY7A 2CH4A 1D1BA 2O31A 5L8RE 2ROLA 3EGUA 4M7DA 2K3XA 4D6WA 2A28A 1M90R 1QVGA 3CBMA 1E6HA 4OB0B 4JLIA 3LGFA 4M75B 3JCMh 1M27C 1QVGP 3OS1A 4BI3A 4LUEA 2EQKA 2DD4A 4YTLA 3VS5A 1NLOC 4MDXA 4C92G 2OTJA 1M8MA 2CREA 2E12A 3HP9A 3OYJA 2RHYA 2EJ9A 1MNEA 3M4GA 3QHSA 4OMOA 4F7UE 4R56A 3QYGB 3NFCA 3A98A 1ZBJA 2KK4A 1VUBA 1D0YA 3QPHA 1FWZA 4EMKB 4IUVA 4E47A 3VKIA 3PFSA 3VS4A 1YJWQ 2Y90A 1MMNA 3X28B 1UGVA 3H8ZA 4C5GA 4PJLA 4XK8E 1IHWA 3QSUA 3BFMA 1RADB 5LJ5d 4J9IA 3WXMB 1BU1A 1KJWA 4BI4A 1M2OA 2RK2A 2X4XA 1VQKQ 3EGXB 5D6XA 1Y71A 3RIRA 5C6SA 4J5YA 3RKWA 2VB6A 4UC4A 2EWNA 2DEUA 1YJ9T 3JCMX 2C06A 1D0XA 2X35A 1WPYA 2QASA 3VU3C 1X2KA 2EKHA 3FLGA 3EHQA 1MGQA 4PJMA 2V1QA 4L6V5 3WVDB 1VQMT 2EQJA 4PLIA 1KQSS 2RNAA 2CYZB 1M3AA 4IURA 2NUTA 1QQJA 4J7IA 1I81A 2DFUA 2GGRA 1IHVA 3M0SA 1VYUA 1K73U 5FU7C 3KBGA 2VC8A 3M0QA 1RLPC 2DNUA 5CKBA 1PD1A 2XDPA 1PRLC 4RTYA 1YWPA 1YI2T 1PHTA 4GLMA 1YJ9Q 8ATCB 2XDDA 1QP3A 2MK5A 2JS2A 2NUZA 2RQRA 1JJ2P 4M7DD 2V1RA 1UEBA 1VYTA 1N8RU 2ED0A 1AWJA 2VV5A 1VQNT 1ZUUA 1W2BS 4FYXB 4A4GA 1ZUYA 3CCUA 2IG0A 1UG1A 2CSIA 4C0FA 1R0BG 5GAOp 2DA9A 2JTMA 3SWNA 1WJSA 3SD4A 1SRLA 1TS9A 1I4K1 2V26A 3GBQA 1PSEA 3GPLA 1VQ4A 1GBRA 2J6KA 1UFFA 5IHIA 1QCOA 2FL7A 3CMEQ 3L2RA 3UT1A 1BK2A 3H6ZA 4XTZA 1YP5A 1K73C 4BE0A 3RMQA 2F5KA 1NPRA 2RHZA 3QUIA 1Z9QA 4J9EA 1PG5B 3RERA 2XU8A 4ORZA 3PGGA 1VQ7A 1FMKA 2RQUA 5FWBA 2LVMA 3M9QA 2SRCA 2DBMA 4X9CA 4J6YA 1G83A 1XOVA 2E65A 5I2MA 1YJNA 3A8MB 2QDLA 1Q7YU 1EX4A 1NG2A 4J9GA 3CQTA 2PVDB 2X4YA 4FM4B 1SHGA 2X9HA 2AKLA 2XI9A 1BI0A 3JCMJ 3C94A 2RHUA 3M0TA 1S72Q 2JOYA 4NOYA 3GNGA 4IUTA 4EMHA 2DL3A 5KYWB 4XQ3A 1JXMA 2JUFA 2F2VA 2FRWA 1F1BB 4F7UG 4GBQA 2CP0A 2MMPA 1B7TA 1MUZA 2QEXA 1LPLA 5KYUA 3GOXA 1BI2A 3QDRB 2FZKB 3EFOA 1I8FA 1Z9ZA 3R6OA 3CMEA 3O5ZA 1KQSP 3G71A 2OAWA 2QA4T 3OYIA 3SHWA 1BI1A 3V8KA 2E64A 1OEBA 2DYBA 4HA8A 3X26B 2DLPA 4PK4A 2JMCA 3C0CA 3OMCA 1V29B 4PJNA 1JQQA 2GBQA 2FZGB 4M75D 1NLPC 3QBYA 4KBMB 2HNIA 3PTAA 3HL8A 2RJCA 4LD9K 1S72A 1QVFP 1VOMA 2EJGA 2P0PA 2CT3A 1K9MU 2QYZA 2NLUA 4KGZB 2J7IA 1JB0E 1X75C 1ZSZC 1VQ6Q 1PD0A 4E7JA 1VQKT 1M2VA 5GAOq 5FU6C 1WGSA 1UECA 1VIFA 3CD6T 4A4KA 3THKA 3L2WA 5KCOA 3NGPA 3V7SA 5GAMh 3CCVA 3OSSC 4XTVA 3EG0A 1KC8U 4M7DG 5KYYA 3OY9A 4ZGEB 2PQWA 1DJ7B 3M57A 1BBZA 3OYAA 1YHQQ 2JNGA 4KRTA 4J83A 2YHTA 4C8QC 4L59A 1X01A 3VJPA 3OYDA 3G71Q 4K11A 2JVVA 3A8OB 2QXFA 3CC4Q 2HQXA 2RD1A 4E6RA 1AWXA 3H0FA 4C5IA 2CT4A 4JJNK 1KQ2A 2A0FB 3VS2A 2ROTA 3CCLA 1AHJB 4B9XA 3FB9A 4HCCA 1K73R 1K9MC 9ATCB 3V7RA 2OX7A 4IUQA 3I5SA 1LJOA 4HT8A 2A36A 2RMOA 5LJ5h 2RQWA 4MZMA 2X4JA 3VUZA 1QLYA 1MMAA 4OGCA 1QVPA 2GFUA 3NMZC 4M75E 5CO7A 1NE8A 3OYKA 4DOWA 2KXDA 4RTVA 1I5OB 2L3QA 2LP5A 3JB9H 1PRMC 3SWNC 4M4ZA 4E2FB 3L42A 3OYCA 4AG1C 5IAYA 1VQNA 4WF2A 2QQ9A 5CAIA 1WHLA 1X69A 3I55T 1NJIU 2GQIA 3T9NA 4AG2C 3CCRT 2OTJQ 1N8RC 1GCQC 3CCSA 1K4US 2DAQA 3M54A 1D1CA 1WHJA 4EMKC 3JAME 3G4ST 2NUTB 3JB9J 1VQOT 4F7UF 4QVDA 2KQWA 5M9OA 3CCQA 4C92A 2C0TA 2QQRA 1GCPA 3FIFA 1VQ9Q 1V76A 3UWNA 1QMCA 3R6NA 1D1AA 3EHRA 4DBHA 3QWYA 1Q81C 5KYNA 1SHFA 4QVZA 1UGPB 2FO0A 1OZ3A 3UATA 1MMDA 3CCQT 4FT4A 4PFZA 1WHMA 3CCRQ 1UJ0A 4Z8AA 1ACMB 3CCUQ 1S72T 1YIJT 1Q82R 3JB9D 4ZTJA 2LMJA 1C0MA 3CC4T 3META 2D1XA 4M75C 1WHGA 2A3LA 2JTFA 1KD1C 5CQYA 1M8VA 2YUOA 2RB6A 1KD1U 4M7DC 2RA2A 5L23A 1VQLT 3CCJT 1RUWA 2VYTA 1M3BA 2XK0A 3OYYA 1V1CA 4M78D 4KULA 4D8DA 4RCBA 1JXOA 5HK3A 1Q86R 1FXXA 4EMKA 3DB3A 3Q1JA 5GANh 3JRZA 1K76A 2E4HA 3I9QA 2V8JA 2DE0X 4QQDA 4QW2A 1Y0MA 2KSSA 1NEGA 4LDUA 1XTDA 2LDMA 1LVKA 3JCMQ 4EDUA 2DBKA 5CK9A 1UHCA 1HSQA 5I2SA 5FWCA 2FPEA 1U5SA 3E9FA 1U06A 2QTVA 2HEQA 5KYXB 4M75F 1M90U 4M75A 2DXTA 2GF7A 2PZ1A 1LCKA 1OX8A 5FRNA 2KROA 2ECZA 4PLLA 3QDFA 2CZ1B 4ZGJB 5HY6A 3URGA 2D0QB 3JCMg 2JN0A 1Y07A 4DEYA 1M5Q1 4ZN1A 2M02A 1Q81R 2FPFA 4KUIA 1TUCA 2LCCA 2DIGA 1OX9A 3M55A 3JCMW 4C8QA 1E7OA 1UDLA 2ZPEB 1LNXA 3HKSA 3SB2A 5LJ5j 1QP2A 2LQKA 3MJXA 1KHCA 1VQ4T 5IHKA 1WIEA 2MPXC 1YITQ 4PFPA 1UGQB 5I22A 1Q86U 1YJWA 3PE0A 1VQKA 2QAZA 1VQ7Q 3JCMV 2F1LA 3CC2A 2LQ8A 5LJ3e 1N5ZA 4BACA 1AVZC 2RHXA 5DY9A 2LCSA 5CKFA 5D7UA 4KH0B 4L5GA 1TWBA 1KC8C 3HHTB 1VQPT 2L2PA 4M78B 1T3SA 1RACB 2LX9A 5LJ5e 3KFVA 2LJ0A 2B8AA 3MHXA 1Y96B 2VGNA 1W2BP 1RLQC 2XKOC 3AHUA 4OMQA 2WSCE 2BE9B 3GIBA 4LXCA 1ZSGA 3GLXA 1H3HA 1G3TA 1WA7A 4RCCA 3OYGA 5LJ3g 1M30A 5J26A 4AFQC 1G3WA 3O8VA 2G6FX 2KNBB 4FCYA 2KYMA 2RQTA 1QCNA 1A0NB 3ZBDA 4RTUA 4JJBA 1VQPQ 2MAMA 4IUPA 3EH2A 2K3YA 3VS6A 4ME7A 2J6FA 3I35A 1IGQA 2OJ2A 5J39A 2QGGA 2KRNA 5CVIA 3E9GA 1YJ9A 2HQHA 4ZGDB 3QZ5B 2KT8A 2ZCFB 2WACA 3C95A 4N4GA 1W2BA 5CCAA 2CZ0B 2Y4YA 3QWXX 4DBFA 7AT1B 1K8AU 1BKBA 4ANJA 1VQOQ 2VWFA 2CZ7B 6AT1B 2ESWA 1U1TA 1YJNT 4FYYB 1G2BA 2CH4W 4JZ4A 4DBRA 4PJJA 1ZX6A 1MMGA 2DKGA 1EIFA 1M1KR 2D8HA 3VUBA 5GAMj 3FC3A 3EG3A 5C0MA 3A8LB 5GANj 2DXUA 4J8OA 3FJ5A 3ZFJA 2C0IA 3VV0A 5KYUB 5GMKj 4FW2A 3CC2T 1VQ5T 4IKFA 5A2QE 2P4RA 4RTZA 1HD3A 3CPWP 2QEXT 1BI3A 3RDVA 2LRQA 3OYBA 1HJDA 1R8OB 3VS7A 5CKDA 3QO3A 4V2SA 4XU3A 2DEQA 3OSVA 2DTIA 4O5VA 1BB9A 1RI0A 1YITA 2LT1A 5GANg 1ZQ1A 3DKMA 5IT9E 2X3WD 3TSWA 3HFOA 2DETA 2QGFB 3DLMA 2W0ZA 5ECAA 1RL2A 3H0IA 3HRSA 1RAIB 3EG9A 3HPWA 1TXQA 2HAXA 1BCMA 2CUDA 2DJZA 4OGEA 4CC3A 1TTHB 1VQ9A 1GL5A 4MDWA 3C12A 2ZZDA 2LC4A 2XIDA 3EH1A 4AFSC 4B9WA 4M7AF 2RI2A 3CCMA 2DJQA 2K57A 2K5LA 1D09B 4C8QD 5KYXA 4A63B 2A08A 2HKNA 4M77E 2LT4A 2D8JA 2E1HA 3EG2A 3G7ZA 3ASKA 4PKCC 4P5NA 1M4ZA 3H0HA 4JLGA 2FYKA 3ZEHA 2QQBA 1S1NA 2BKDN 2DZCA 5LL6S 3CPWA 1RAEB 2GQVA 1IZ6A 4J9FA 3G6ET 3CCVT 2VXFA 3GF5A 1YIJA 1G5VA 2M16A 3D7SB 2DX1A 1Q95G 2K79A 1B34B 5HKCA 4M75G 2OTLT 2VUBA 2IIMA 3MCAB 1SPKA 2J6OA 5FLXE 1M1KU 2KAFA 3VS3A 5IN1A 4DOVA 4WCIA 4JUVA 1WYXA 2DK3A 2Y4XA 5GMKi 1UGSB 4RTTA 3CCLT 4LN2A 4M7AG 1CKAA 3CPWS 2AT1B 4LDYA 2CS7A 2FB7A 2DL8A 4A4EA 3PVLA 2RM4A 2GTOA 1R77A 3M58A 2L8DA 2COWA 3CCJA 4CRIA 4BY6C 4ZN3A 2I2LA 4NS5A 2QEXQ 1H3ZA 1K9AA 4A4FA 2R58A 3OW2S 1AD5A 1N27A 2M0OA 2COZA 1H8KA 2HL5C 4XTXA 1OU8A 5LJ5g 4XU2A 2O4XA 1UHFA 1YJWT 1QVFS 3CMAQ 4OMLA 1YCSB 3MPUB 1FMVA 3RMSA 4JRPA 4PJOG 1WQ7A 2HD0A 1VQ8T 2CP7A 2YRCA 2YSQA 4HVWA 5AYFA 5LJ3d 2DZ9A 4FIBA 3LX7A 3LH0A 2YUPA 2FZCB 1KHIA 3X20B 1OU9A 5FRMA 4OB1B 4VUBA 1W70A 2YXYA 1O9SA 2L3RA 2E5QA 2DL4A 2IPOB 3MP1A 4M77A 4BI8B 5KE2A 3CXCA 2QTXA 3PMTA 4OVAA 1IXDA 1SF9A 4RTWA 1BCOA 1ZA1B 1KQ1A 1JO8A 2L5QA 2EQIA 3HTRA 1RAGB 4OMPA 1QKXA 4MMKA 4JS5A 4M77D 3VYGA 4C92E 3OYMA 2DD5A 3M56A 2EQMA 1NJIR 2E6ZA 1RAHB 4AFZC 4D8KA 5GAOn 4E7ZA 2XHCA 2JMAA 2LQNA 1OPKA 3CD6Q 2RQVA 3CCLQ 3AT1B 4LE9A 3EGDA 3CXCS 4R0KA 2VXEA 3RBBB 4HVUA 2MIOA 4J9HA 3GNFB 1AT1B 3E19A 3H41A 2FRYA 3JSCA 1JRIA 3PMIA 2GNCA 2MWPA 1TUGB 1T3LA 1T0JA 1NYGA 2EQUA 4HT9A 4JPBW 4FT2A 1TOVA 2VASA 1JJ2A 1NZ9A 2KMTA 3KXTA 1MV3A 1IO6A 2K3BA 2A37A 2LQWA 3V7CA 3ER0A 1QVFA 3S3MA 3FEOA 4CI0C 3SFMA 3X25B 5GMKe 2KYBA 3CCEQ 4M7DF 4X9DA 2JM9A 2EGAA 4C0DC 4M7AD 1XQHA 5CKHA 3TEEA 4M78G 3INZA 2ABLA 2G3RA 3EAEA 3BW1A 3TSZA 1PM3A 1YWOA 3OBYA 2LZ6B 3FRNA 1QW1A 4A54A 3FJPA 2ZPBB 3EGDB 1XJWB 1Y96A 4Y92A 2IVWA 4GY5A 1VQ6T 2EBPA 2PVGB 2J06A 3OMGA 4ELYC 1VQLA 2QK0A 2DVEA 4BE1A 3HFNA 1EZZB 1M1FA 2PTKA 2NWMA 2ENMA 5GAN2 5FW9A 3UA6A 2FEIA 4Y91A 3REBB 3NTHA 1ZSZB 1M1GA 1KD1R 3HSBA 4NL2A 3G71T 3ME9A 3P8BB 3CCEA 1GCQA 1OPLA 2YWWA 2W10A 2PUKB 3CBOA 2KI7A 3QKJA 2E6NA 4FU6A 5KYWA 4LDWA 2KRMA 2OAUA 2NYSA 2KT1A 4J9CA 4DEXA 3G4SQ 2R5MA 3LH5A 1X2QA 3MKDA 5AT1B 5A0LA 4FSSA 3G4SA 1M1KC 2CDTA 1D3BA 5IXFA 1MNDA 1G3SA 1M90C 3MEUA 3FDRA 2SEMA 2XDBA 1GFDA 1OOTA 4RG2A 3OW2A 4PNOA 2K7AA 3CCUT 1U1SA 4M7AB 2ZGWA 3QIIA 4J9BA 5GJVB 4M7DB 1HXDA 2GTJA 4NL3A 1TG0A 4PL6A 2HCKA 3NPFA 2O01E 1WLPB 1B3QA 3OYFA 2HZYA 1VQLQ 1K8AC 4BDZA 3LGLA 2BUDA 4CC2A 3VYHB 4C0DB 4JJDA 4C92B 3SWNB 1Y7XA 1YI2Q 1SRMA 2EW3A 3ZL7C 1YNZA 3MEWA 3JCMc 2VVKA 4E7LA 2H8HA 5LJ3j 1WJRA 1AWWA 4C8QE 1Q7YR 1VQ8A 1UGRB 2L0AA 5GAN6 2JTEA 2KY9A 3OB9A 2QQAA 4AFUC 2OI3A 2RPNA 2CSQA 5GAN8 4RKUE 4N0AC 4PJOA 5GMKh 2AKKA 4IIOA 2K6DA 1AZGB 1SG5A 2V8IA 5FROA 1QVGS 3L2QA 1YFNA 3J81E 2J05A 1B34A 3OQ5A 2P0QA 4ZTFA 2XMFA 2AZSA 5A0GA 4LDVA 1BYMA 1JEGA 2D0NA 1BIAA 1IREB 2M51A 1G8XA 3PVQA 2EIFA 4QQ6A 3DB4A 5GANd 3QJYA 2KRSA 1EFNA 2K2VA 1RI9A 3BDUA 2ZPGB 2F5TX 2K9GA 2DXBA 3M4YA 3A8GB 3V8JA 1TH7A 1O75A 3CXCP 1N9RA 1IRXA 2RI5A 2X4WA 4M7AA 2HMAA 4BUGA 2M1HA 3QYHB 3EFSA 4C0GA 4E7SA 4FYVB 2OTJT 5GMKm 1K9MR 2YT6A 2P4TA 4XU1A 2MYSA 4M77F 2MCNA 3EG9B 2JXBA 2FVUA 4BD3A 4JRQA 3F70A 3LLRA 5I11A 3U23A 5GAN5 3OA6A 3KUFA 1WXTA 2KR3A 1YHQA 2ED1A 4RUGA 3RR6A 3OYLA 1OULA 4JS4A 4X1VA 1RAFB 3OYHA 2PUOB 5GAMf 3CBPA 3JCMP 4LUDA 3V8LA 4EIKA 1AOJA 4M7AE 1KIKA 3CMET 2PVOB 1CKBA 3PIPA 3P8HA 2F2WA 3OS2A 2MWOA 3TVTA 1YN8A 2YRDA 4LDXA 4JDSA 4E7KA 5GAN7 4ESRA 4F7UB 1I5LA 5GAN4 2EAYA 2DMOA 1JJ2S 1K1ZA 3CC7T 4C8QG 2CKKA 3CCJQ 2BTTA 2CUBA 2VKNA 5CQXA 4QVCA 3UA7A 4JZ3A 4M78F 2AZVA 3M0UA 4KGXB 5LJ5f 2DILA 4F16A 3I55Q 1LOJA 4B6MA 4F7UA 5IXBA 2HBPA 1QWEA 2KVQG 2EYZA 1WI7A 4F14A 4ELZC 5KYYB 1JU5C 4OF1A 1PKSA 4BB7A 2RK1A 1VQNQ 2EGCA 3M0RA 2RJFA 1N9SA 2P0KA 2CP6A 1OZ2A 2QG9B 1IGUA 1NJIC 1M2VB 2QQSA 1QKWA 5IHNA 1X6BA 2BZ8A 1YHQT 2WSFE 5DLQE 1MV0B 1OYXA 1K0SA 1TSFA 4OMNA 2X51A 3UF4A 4C8QB 3EG1A 4MZTA 2DM1A 1RABB 2CZ6B 1KK7A 4RTXA 3CCQQ 4CC4B 1RAAB 4Z88A 2RJDA 5KH6A 2M0YA 3PT9A 3VS0A 3A1PA 3OBWA 3N5BB 1I07A 1KSWA 3TREA 1OI1A 1R0CB 1N6AA 1AWOA 4BDYA 1G3YA 5EC7A 4KUDK 1FYNA 3M59A 3NTKA 3JCMb 3JB9I 1PNJA 1MHNA 3GP8A 2RJEA 4C0ZA 4XTWA 2HSPA 1PKTA 2ZPFB 4A53A 3WVEB 4DQ2A 1PWTA 3QZ9B 4N0AA 4PJOC 3CC4A 2EYYA 1WNLA 3EFRA 4HCKA 2EKOA 2GFAA 2FPDA 3E1SA 2EVRA 1VQ7T 2PNIA 1U8RA 2P84A 5GAOl 3PNWC 5HK0A 1QCFA 2GCXA 5KCHA 4RG8A 1GFCA 5FU7B 1VIEA 1H92A 2JW4A 2COYA 4C5EA 3NHNA 5GAMg 5GAOm 4PJOD 2DYIA 2DTOA 3JCMd 4AT1B 4F17A 2QI2A 2R57A 4XAXB 2JT4A 3JB9F 3JB9G 3L1AA 3CEYA 2LTOA 1ABQA 5GAOr 1C6VX 2DTHA 1IB8A 8AT1B 4E7HA 1TUDA 4GLKA 4N4IA 1WZOA 2MI6A 1ZLMA 3TQ7P 2F69A 5GANf 3CC2Q 1ZA2B 1NEBA 1T0HA 2LNHB 3CCRA 4DA4A 2AIRB 2O2OA 4M77G 4HXJA 3I55A 1SEMA 3QG1A 4BY6B 4M77B 3UPUA 1X27A 2YUNA 3M0PA 1Q82U 3HRTA 2DVJA 3I56T 1H641 3BDLA 2NUPA 5HCKA 3DLLA 2JM8A 2EYXA 1P92A 4PFOA 5GAMe 4QT7A 3NTIA 1SKUB 1VQ4Q 4J9DA 1PC0A 3OYNA 1QWFA 4C92F 4JRIA 3UDCA 4X34A 3X24B 1VA7A 2KDSA 4FSXA 1E6GA 4CC7A 3LW5E 2E70A 1JBMA 2V8KA 1SSHA 3M53A 5J3BA 5GAN3 2ZAEA 4JRKA 2E41A 3EGXA 2LNVA 1YITT 1PSFA 1VQMA 2AK5A 4PJOB 2CP5A 2LCLA 2C0OA 1WHHA 2HBWA 5GMKl 2E3IA 3MO8A 2D9TA 1VQMQ 1W4SA 1UUEA 5CIUA 1KQSA 3SEMA 2DERA 3S3OA 1KFZA 2XG8D 4KT0E 3A8HB 1AZEA 4HCBA 4M78C 4OMFB 3L2ZA 3L2VA 2R5AA 1WXBA 4TVRA 3C4SA 3JCMe 1YBYA 3I56A 2BIVA 3JV3A 4BE2A 2LJ1A 4R55A 2LX7A 2D6FA 2AHJB 4LNPA 1NYFA 2I0NA 2WSEE 1K8AR 2M9UA 4N4HA 4MZPA 1PCXA 3P8DA 4XTYA 2EJFA 2EFIA 1VYVA 3OW2P 5IH2A 5D6YA 1K0XA 1KG1A 5GANe 3BE3A 1GBQA 2KEAA 4DBQA 2H3JA 4J6WA 2F2XA 1W1FA 4ATOA 3VRYA 4C8QF 4C5HA 1I1JA 2NUPB 3LWHA 5A0DA 1YJNQ 1NM7A 5GJWB 4Z89A 1GRIA 4FW1A 1WQWA 4IUUA 3MP8A 1VQOA 1HK9A 2DRKA 1AEYA 5DLOA 2EPDA 3I56Q 4HVVA 2DRMA 2YLCA 3VRZA 1VQ6A 4O6JA 3CCMT 2K5IA 1B07A 3ULRB 3M5AA 4Z02A 3PIOA 4QQGA 1ZUKA 2L3PA 3G1JA 4JJCA 3CPFA 4OB3B 2RF0A 2E10A 1VQ9T 1VQPA 4Q5WA 1HYOA 1X6GA 4WTOB 2XD0A 4Y28E 2CGHA 2DO3A 3MEAA 5LJ3f 4E7IA 4KH1B 1UJYA 2A7YA 3LYIA 1WHKA 2ZPHB 2DL7A 1YIJQ 1Q7YC 5DM7R 2EYQA 1ZSZA 2HDAA 3CCET 3G6EA 4OMMA 4OP0A 1C1AA 2YLBA 2K2MA 3CCST 4LD6A 2LJ3A 2YUQA 3EFOB 3MEVA 3JCMf 1FX7A 1D0ZA 3RKXA 4C92D 2EYWA 3E2UA 1UTIA 4MMLA 2VGMA 4II1A 2QA4Q 5EG2A 2CP2A 1SSFA 3LWIA 2DF6A 2E5KA 3RESA 3S3NA 2HL3A 3TU4K 4FL6A 2H3EB 3IQLA 2O9SA 2RI3A 3SDZA 4C92C 4XTUA 1VQ8Q 4J6XA 4M7DE 2FG0A 2KE9A 3QXEB 4AMCA 2QDYB 1D3BB 3J80E 3CCVQ 3RKYA 4FYWB 1OQKA 1UB4A 4EPCA 2JJ9A 1ABOA 1X6OA 4PJOE 2BZXA 2DPPB 3CC7Q 1KC8R 4XU0A 2XICA 2HKQB 3OS5A 1NPPA 2OTLQ 4KGVB 1X43A 2RN8A 4EMGA 3CC7A 1Q81U 4A4HA 4M78E 4OB2B 1W6XA 3G6EQ 5KE3A 2CP3A 3OYEA 1TU0B 1UE9A 3CD6A 3CMAA 3QJ6A 1WJQA 3J7AF 2JZ2A 2HQEA 2RH2A 4PJOF 4M77C 2PU9B 1FMWA 1N8RR 1VQ5A 4F04B
chains in the Genus database with same CATH topology
1QLYA 1WFWA 4RTTA 2JS0A 4LN2A 4ESRA 1CKAA 2YDLA 3NMZC 2BZYA 2DL8A 2DMOA 1WX6A 3PVLA 1K1ZA 2BTTA 2CUBA 2EGEA 2GTOA 2VKNA 2KBTA 2KXDA 4RTVA 3UA7A 4JZ3A 2AZVA 3M0UA 2B86A 2L3QA 2LP5A 1K9AA 1PRMC 1AD5A 2DILA 4M4ZA 4F16A 2KXCA 5IXBA 4AG1C 1H8KA 1QWEA 2EYZA 1WXUA 1WI7A 4F14A 2X3XD 1JU5C 2L3SA 1X69A 1UHFA 1PKSA 3I5RA 2O88A 1J3TA 4OMLA 1YCSB 2MOXA 2EGCA 2GQIA 2DL5A 4AG2C 3M0RA 4ZNXA 2O9VA 1M3CA 2KGTA 1GCQC 3VS1A 1QKWA 4IIMA 5IHNA 1I0CA 1K4US 2YSQA 1X6BA 2BZ8A 1ARKA 4HVWA 1CSKA 1Y57A 1MV0B 1K0SA 4OMNA 3UF4A 3EG1A 2DM1A 3RNJA 2C0TA 2YUPA 1GCPA 3REAB 1OV3A 3R6NA 1U3OA 4RTXA 1WDXA 1W70A 3EHRA 3QWYA 4CC4B 2DL4A 1SHFA 2FO0A 4Z88A 2CH4A 2O31A 3UATA 2M0YA 2ROLA 3EGUA 3VS0A 2A28A 1UJ0A 4Z8AA 4RTWA 1I07A 1KSWA 1AWOA 1E6HA 1JO8A 5EC7A 2LMJA 2EQIA 1M27C 2D1XA 1FYNA 4OMPA 4LUEA 1PNJA 2YUOA 1QKXA 5L23A 3VS5A 2HSPA 1NLOC 1PKTA 1M8MA 1PWTA 2CREA 1RUWA 1M3BA 2EYYA 4HCKA 1V1CA 2FPDA 4D8DA 1JXOA 2EVRA 2PNIA 4OMOA 4AFZC 4D8KA 2JMAA 2LQNA 3A98A 1OPKA 1ZBJA 2RQVA 1QCFA 4LE9A 1GFCA 4R0KA 1K76A 3RBBB 4HVUA 1H92A 2JW4A 3I9QA 3NHNA 2DE0X 2MIOA 1Y0MA 4J9HA 3VS4A 4F17A 1NEGA 2JT4A 1UGVA 3H41A 2FRYA 1ABQA 2DBKA 1UHCA 2GNCA 1HSQA 4J9IA 1BU1A 1TUDA 1T3LA 1KJWA 1T0JA 1NYGA 1ZLMA 5FWCA 2FPEA 1U5SA 4JPBW 1U06A 2HEQA 1NEBA 1T0HA 2PZ1A 2LNHB 1LCKA 1MV3A 1IO6A 2K3BA 2A37A 2KROA 2ECZA 2LQWA 2O2OA 4HXJA 1X2KA 1SEMA 2EKHA 3EHQA 1X27A 2KYBA 2V1QA 2YUNA 2JM9A 3M0PA 2EGAA 2DVJA 4DEYA 2ABLA 5HCKA 3TSZA 2RNAA 2JM8A 1M3AA 1YWOA 2FPFA 2LZ6B 2EYXA 1TUCA 4QT7A 4J9DA 1E7OA 1UDLA 1QWFA 2GGRA 4Y92A 3M0SA 1VA7A 1VYUA 2EBPA 5IHKA 1E6GA 1WIEA 1RLPC 2J06A 3M0QA 2DNUA 4CC7A 1PRLC 4RTYA 1YWPA 5I22A 1PHTA 4GLMA 1SSHA 3PE0A 2AK5A 2C0OA 2JS2A 2NUZA 2PTKA 2HBWA 2RQRA 2NWMA 2ENMA 2V1RA 1VYTA 2ED0A 1AWJA 5FW9A 1N5ZA 3UA6A 1AVZC 1UUEA 2LCSA 2FEIA 3REBB 3SEMA 1ZUUA 1KFZA 2L2PA 1ZUYA 1T3SA 1UG1A 3KFVA 2LJ0A 2CSIA 1GCQA 1AZEA 1OPLA 2W10A 2KRMA 2DA9A 1WXBA 1RLQC 4DEXA 2KT1A 4J9CA 1SRLA 1X2QA 3LH5A 3GBQA 3JV3A 4OMQA 1ZSGA 1H3HA 2LJ1A 4FSSA 2LX7A 1GBRA 2J6KA 1UFFA 5IHIA 1WA7A 2CDTA 4LNPA 1NYFA 5IXFA 1M30A 4AFQC 1BK2A 2I0NA 2G6FX 2KNBB 1YP5A 2KYMA 2RQTA 2SEMA 1Z9QA 4J9EA 1A0NB 4RTUA 4JJBA 1GFDA 1OOTA 2K7AA 4ORZA 1FMKA 3VS6A 2RQUA 2J6FA 4J9BA 5FWBA 1VYVA 5GJVB 2SRCA 5IH2A 1K0XA 3I35A 2DBMA 2OJ2A 2GTJA 1TG0A 2KRNA 2HCKA 3NPFA 1GBQA 2KEAA 1WLPB 1B3QA 2KT8A 1G83A 1XOVA 2F2XA 1W1FA 3VRYA 2QDLA 4CC2A 3QWXX 1I1JA 1NG2A 4J9GA 3CQTA 1SHGA 4JJDA 1NM7A 2AKLA 2VWFA 5GJWB 3M0TA 2ESWA 4Z89A 1GRIA 1SRMA 2DL3A 2DRKA 1YNZA 2EW3A 3ZL7C 1AEYA 2EPDA 1JXMA 1G2BA 2CH4W 4HVVA 4JZ4A 2DRMA 2F2VA 2VVKA 2FRWA 2H8HA 1ZX6A 3VRZA 1AWWA 4GBQA 2D8HA 1B07A 1MUZA 3ULRB 2L0AA 2JTEA 1ZUKA 2L3PA 3EG3A 4JJCA 4AFUC 2OI3A 2RPNA 2RF0A 2CSQA 3FJ5A 2C0IA 1Z9ZA 3O5ZA 2AKKA 4IIOA 2OAWA 2K6DA 2P4RA 4RTZA 1HD3A 1AZGB 1X6GA 1HJDA 3SHWA 3VS7A 1OEBA 2DYBA 2DLPA 2J05A 2XMFA 2JMCA 1BB9A 3C0CA 2AZSA 1UJYA 1JQQA 1JEGA 2GBQA 2D0NA 2M51A 2DL7A 2X3WD 3PVQA 3TSWA 2HDAA 1NLPC 2W0ZA 5ECAA 2KRSA 3H0IA 4OMMA 1EFNA 2K2MA 1RI9A 2K9GA 2CT3A 2LJ3A 2CUDA 2YUQA 4CC3A 1GL5A 2J7IA 2EYWA 4AFSC 1UTIA 2DJQA 1UECA 2DF6A 2E5KA 4A63B 2A08A 3THKA 3NGPA 2D8JA 3EG2A 3IQLA 2O9SA 2YT6A 3EG0A 2FG0A 2KE9A 3H0HA 1S1NA 2MCNA 2JXBA 1BBZA 1ABOA 4KRTA 3U23A 5I11A 2BZXA 4J9FA 1WXTA 2KR3A 4K11A 1X43A 2ED1A 4RUGA 2RN8A 2DX1A 4E6RA 1AWXA 3H0FA 1W6XA 2CT4A 2K79A 4X1VA 2IIMA 1UE9A 1SPKA 2J6OA 3VS2A 2ROTA 4LUDA 4EIKA 1AOJA 3VS3A 1KIKA 1CKBA 4WCIA 3I5SA 2F2WA 1WYXA 2A36A 3TVTA 2RMOA 2RQWA 1YN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLY A;  1WFW A;  4RTT A;  2JS0 A;  4LN2 A;  4ESR A;  1CKA A;  2YDL A;  3NMZ C;  2BZY A;  2DL8 A;  2DMO A;  1WX6 A;  3PVL A;  1K1Z A;  2BTT A;  2CUB A;  2EGE A;  2GTO A;  2VKN A;  2KBT A;  2KXD A;  4RTV A;  3UA7 A;  4JZ3 A;  2AZV A;  3M0U A;  2B86 A;  2L3Q A;  2LP5 A;  1K9A A;  1PRM C;  1AD5 A;  2DIL A;  4M4Z A;  4F16 A;  2KXC A;  5IXB A;  4AG1 C;  1H8K A;  1QWE A;  2EYZ A;  1WXU A;  1WI7 A;  4F14 A;  2X3X D;  1JU5 C;  2L3S A;  1X69 A;  1UHF A;  1PKS A;  3I5R A;  2O88 A;  1J3T A;  4OML A;  1YCS B;  2MOX A;  2EGC A;  2GQI A;  2DL5 A;  4AG2 C;  3M0R A;  4ZNX A;  2O9V A;  1M3C A;  2KGT A;  1GCQ C;  3VS1 A;  1QKW A;  4IIM A;  5IHN A;  1I0C A;  1K4U S;  2YSQ A;  1X6B A;  2BZ8 A;  1ARK A;  4HVW A;  1CSK A;  1Y57 A;  1MV0 B;  1K0S A;  4OMN A;  3UF4 A;  3EG1 A;  2DM1 A;  3RNJ A;  2C0T A;  2YUP A;  1GCP A;  3REA B;  1OV3 A;  3R6N A;  1U3O A;  4RTX A;  1WDX A;  1W70 A;  3EHR A;  3QWY A;  4CC4 B;  2DL4 A;  1SHF A;  2FO0 A;  4Z88 A;  2CH4 A;  2O31 A;  3UAT A;  2M0Y A;  2ROL A;  3EGU A;  3VS0 A;  2A28 A;  1UJ0 A;  4Z8A A;  4RTW A;  1I07 A;  1KSW A;  1AWO A;  1E6H A;  1JO8 A;  5EC7 A;  2LMJ A;  2EQI A;  1M27 C;  2D1X A;  1FYN A;  4OMP A;  4LUE A;  1PNJ A;  2YUO A;  1QKX A;  5L23 A;  3VS5 A;  2HSP A;  1NLO C;  1PKT A;  1M8M A;  1PWT A;  2CRE A;  1RUW A;  1M3B A;  2EYY A;  4HCK A;  1V1C A;  2FPD A;  4D8D A;  1JXO A;  2EVR A;  2PNI A;  4OMO A;  4AFZ C;  4D8K A;  2JMA A;  2LQN A;  3A98 A;  1OPK A;  1ZBJ A;  2RQV A;  1QCF A;  4LE9 A;  1GFC A;  4R0K A;  1K76 A;  3RBB B;  4HVU A;  1H92 A;  2JW4 A;  3I9Q A;  3NHN A;  2DE0 X;  2MIO A;  1Y0M A;  4J9H A;  3VS4 A;  4F17 A;  1NEG A;  2JT4 A;  1UGV A;  3H41 A;  2FRY A;  1ABQ A;  2DBK A;  1UHC A;  2GNC A;  1HSQ A;  4J9I A;  1BU1 A;  1TUD A;  1T3L A;  1KJW A;  1T0J A;  1NYG A;  1ZLM A;  5FWC A;  2FPE A;  1U5S A;  4JPB W;  1U06 A;  2HEQ A;  1NEB A;  1T0H A;  2PZ1 A;  2LNH B;  1LCK A;  1MV3 A;  1IO6 A;  2K3B A;  2A37 A;  2KRO A;  2ECZ A;  2LQW A;  2O2O A;  4HXJ A;  1X2K A;  1SEM A;  2EKH A;  3EHQ A;  1X27 A;  2KYB A;  2V1Q A;  2YUN A;  2JM9 A;  3M0P A;  2EGA A;  2DVJ A;  4DEY A;  2ABL A;  5HCK A;  3TSZ A;  2RNA A;  2JM8 A;  1M3A A;  1YWO A;  2FPF A;  2LZ6 B;  2EYX A;  1TUC A;  4QT7 A;  4J9D A;  1E7O A;  1UDL A;  1QWF A;  2GGR A;  4Y92 A;  3M0S A;  1VA7 A;  1VYU A;  2EBP A;  5IHK A;  1E6G A;  1WIE A;  1RLP C;  2J06 A;  3M0Q A;  2DNU A;  4CC7 A;  1PRL C;  4RTY A;  1YWP A;  5I22 A;  1PHT A;  4GLM A;  1SSH A;  3PE0 A;  2AK5 A;  2C0O A;  2JS2 A;  2NUZ A;  2PTK A;  2HBW A;  2RQR A;  2NWM A;  2ENM A;  2V1R A;  1VYT A;  2ED0 A;  1AWJ A;  5FW9 A;  1N5Z A;  3UA6 A;  1AVZ C;  1UUE A;  2LCS A;  2FEI A;  3REB B;  3SEM A;  1ZUU A;  1KFZ A;  2L2P A;  1ZUY A;  1T3S A;  1UG1 A;  3KFV A;  2LJ0 A;  2CSI A;  1GCQ A;  1AZE A;  1OPL A;  2W10 A;  2KRM A;  2DA9 A;  1WXB A;  1RLQ C;  4DEX A;  2KT1 A;  4J9C A;  1SRL A;  1X2Q A;  3LH5 A;  3GBQ A;  3JV3 A;  4OMQ A;  1ZSG A;  1H3H A;  2LJ1 A;  4FSS A;  2LX7 A;  1GBR A;  2J6K A;  1UFF A;  5IHI A;  1WA7 A;  2CDT A;  4LNP A;  1NYF A;  5IXF A;  1M30 A;  4AFQ C;  1BK2 A;  2I0N A;  2G6F X;  2KNB B;  1YP5 A;  2KYM A;  2RQT A;  2SEM A;  1Z9Q A;  4J9E A;  1A0N B;  4RTU A;  4JJB A;  1GFD A;  1OOT A;  2K7A A;  4ORZ A;  1FMK A;  3VS6 A;  2RQU A;  2J6F A;  4J9B A;  5FWB A;  1VYV A;  5GJV B;  2SRC A;  5IH2 A;  1K0X A;  3I35 A;  2DBM A;  2OJ2 A;  2GTJ A;  1TG0 A;  2KRN A;  2HCK A;  3NPF A;  1GBQ A;  2KEA A;  1WLP B;  1B3Q A;  2KT8 A;  1G83 A;  1XOV A;  2F2X A;  1W1F A;  3VRY A;  2QDL A;  4CC2 A;  3QWX X;  1I1J A;  1NG2 A;  4J9G A;  3CQT A;  1SHG A;  4JJD A;  1NM7 A;  2AKL A;  2VWF A;  5GJW B;  3M0T A;  2ESW A;  4Z89 A;  1GRI A;  1SRM A;  2DL3 A;  2DRK A;  1YNZ A;  2EW3 A;  3ZL7 C;  1AEY A;  2EPD A;  1JXM A;  1G2B A;  2CH4 W;  4HVV A;  4JZ4 A;  2DRM A;  2F2V A;  2VVK A;  2FRW A;  2H8H A;  1ZX6 A;  3VRZ A;  1AWW A;  4GBQ A;  2D8H A;  1B07 A;  1MUZ A;  3ULR B;  2L0A A;  2JTE A;  1ZUK A;  2L3P A;  3EG3 A;  4JJC A;  4AFU C;  2OI3 A;  2RPN A;  2RF0 A;  2CSQ A;  3FJ5 A;  2C0I A;  1Z9Z A;  3O5Z A;  2AKK A;  4IIO A;  2OAW A;  2K6D A;  2P4R A;  4RTZ A;  1HD3 A;  1AZG B;  1X6G A;  1HJD A;  3SHW A;  3VS7 A;  1OEB A;  2DYB A;  2DLP A;  2J05 A;  2XMF A;  2JMC A;  1BB9 A;  3C0C A;  2AZS A;  1UJY A;  1JQQ A;  1JEG A;  2GBQ A;  2D0N A;  2M51 A;  2DL7 A;  2X3W D;  3PVQ A;  3TSW A;  2HDA A;  1NLP C;  2W0Z A;  5ECA A;  2KRS A;  3H0I A;  4OMM A;  1EFN A;  2K2M A;  1RI9 A;  2K9G A;  2CT3 A;  2LJ3 A;  2CUD A;  2YUQ A;  4CC3 A;  1GL5 A;  2J7I A;  2EYW A;  4AFS C;  1UTI A;  2DJQ A;  1UEC A;  2DF6 A;  2E5K A;  4A63 B;  2A08 A;  3THK A;  3NGP A;  2D8J A;  3EG2 A;  3IQL A;  2O9S A;  2YT6 A;  3EG0 A;  2FG0 A;  2KE9 A;  3H0H A;  1S1N A;  2MCN A;  2JXB A;  1BBZ A;  1ABO A;  4KRT A;  3U23 A;  5I11 A;  2BZX A;  4J9F A;  1WXT A;  2KR3 A;  4K11 A;  1X43 A;  2ED1 A;  4RUG A;  2RN8 A;  2DX1 A;  4E6R A;  1AWX A;  3H0F A;  1W6X A;  2CT4 A;  2K79 A;  4X1V A;  2IIM A;  1UE9 A;  1SPK A;  2J6O A;  3VS2 A;  2ROT A;  4LUD A;  4EIK A;  1AOJ A;  3VS3 A;  1KIK A;  1CKB A;  4WCI A;  3I5S A;  2F2W A;  1WYX A;  2A36 A;  3TVT A;  2RMO A;  2RQW A;  1YN8 A; 
#chains in the Genus database with same CATH topology
 5CR2 A;  1WFW A;  1ZBX A;  3TCJ A;  2JS0 A;  3MP6 A;  5FU6 B;  3CCM Q;  2HSE B;  2YDL A;  1YI2 A;  2BZY A;  4QKU A;  1GXI E;  1WX6 A;  2ATC B;  1M9S A;  5I21 A;  2EGE A;  2QA4 A;  2KBT A;  2MF2 A;  4J7F A;  1NBE B;  4HKE A;  3HRU A;  4M78 A;  2B86 A;  2L89 A;  2KXC A;  2OTL A;  2DXC A;  3CMA T;  2Z0W A;  1WXU A;  2RO0 A;  2X3X D;  2L3S A;  2DIQ A;  2E3H A;  3A5Z B;  3I5R A;  2O88 A;  1J3T A;  1Q86 C;  2MOX A;  1YCY A;  2YRV A;  5CKE A;  3OS0 A;  2DL5 A;  3CCS Q;  4ZNX A;  2O9V A;  5GAM d;  1M3C A;  2KGT A;  2RHI A;  5D6W A;  2K4Y A;  3VS1 A;  4RMO A;  2ZPI B;  4IIM A;  1I0C A;  1ARK A;  4M7A C;  1CSK A;  1BIB A;  1Y57 A;  4HCZ A;  3H9N A;  3L2U A;  2BE7 D;  2O4X B;  2FHD A;  3RNJ A;  2K5F A;  3RUX A;  1VQ5 Q;  3REA B;  1OV3 A;  5LJ3 h;  1Q82 C;  1U3O A;  1ZHI A;  1WDX A;  1XNI A;  3S6W A;  3BY7 A;  2CH4 A;  1D1B A;  2O31 A;  5L8R E;  2ROL A;  3EGU A;  4M7D A;  2K3X A;  4D6W A;  2A28 A;  1M90 R;  1QVG A;  3CBM A;  1E6H A;  4OB0 B;  4JLI A;  3LGF A;  4M75 B;  3JCM h;  1M27 C;  1QVG P;  3OS1 A;  4BI3 A;  4LUE A;  2EQK A;  2DD4 A;  4YTL A;  3VS5 A;  1NLO C;  4MDX A;  4C92 G;  2OTJ A;  1M8M A;  2CRE A;  2E12 A;  3HP9 A;  3OYJ A;  2RHY A;  2EJ9 A;  1MNE A;  3M4G A;  3QHS A;  4OMO A;  4F7U E;  4R56 A;  3QYG B;  3NFC A;  3A98 A;  1ZBJ A;  2KK4 A;  1VUB A;  1D0Y A;  3QPH A;  1FWZ A;  4EMK B;  4IUV A;  4E47 A;  3VKI A;  3PFS A;  3VS4 A;  1YJW Q;  2Y90 A;  1MMN A;  3X28 B;  1UGV A;  3H8Z A;  4C5G A;  4PJL A;  4XK8 E;  1IHW A;  3QSU A;  3BFM A;  1RAD B;  5LJ5 d;  4J9I A;  3WXM B;  1BU1 A;  1KJW A;  4BI4 A;  1M2O A;  2RK2 A;  2X4X A;  1VQK Q;  3EGX B;  5D6X A;  1Y71 A;  3RIR A;  5C6S A;  4J5Y A;  3RKW A;  2VB6 A;  4UC4 A;  2EWN A;  2DEU A;  1YJ9 T;  3JCM X;  2C06 A;  1D0X A;  2X35 A;  1WPY A;  2QAS A;  3VU3 C;  1X2K A;  2EKH A;  3FLG A;  3EHQ A;  1MGQ A;  4PJM A;  2V1Q A;  4L6V 5;  3WVD B;  1VQM T;  2EQJ A;  4PLI A;  1KQS S;  2RNA A;  2CYZ B;  1M3A A;  4IUR A;  2NUT A;  1QQJ A;  4J7I A;  1I81 A;  2DFU A;  2GGR A;  1IHV A;  3M0S A;  1VYU A;  1K73 U;  5FU7 C;  3KBG A;  2VC8 A;  3M0Q A;  1RLP C;  2DNU A;  5CKB A;  1PD1 A;  2XDP A;  1PRL C;  4RTY A;  1YWP A;  1YI2 T;  1PHT A;  4GLM A;  1YJ9 Q;  8ATC B;  2XDD A;  1QP3 A;  2MK5 A;  2JS2 A;  2NUZ A;  2RQR A;  1JJ2 P;  4M7D D;  2V1R A;  1UEB A;  1VYT A;  1N8R U;  2ED0 A;  1AWJ A;  2VV5 A;  1VQN T;  1ZUU A;  1W2B S;  4FYX B;  4A4G A;  1ZUY A;  3CCU A;  2IG0 A;  1UG1 A;  2CSI A;  4C0F A;  1R0B G;  5GAO p;  2DA9 A;  2JTM A;  3SWN A;  1WJS A;  3SD4 A;  1SRL A;  1TS9 A;  1I4K 1;  2V26 A;  3GBQ A;  1PSE A;  3GPL A;  1VQ4 A;  1GBR A;  2J6K A;  1UFF A;  5IHI A;  1QCO A;  2FL7 A;  3CME Q;  3L2R A;  3UT1 A;  1BK2 A;  3H6Z A;  4XTZ A;  1YP5 A;  1K73 C;  4BE0 A;  3RMQ A;  2F5K A;  1NPR A;  2RHZ A;  3QUI A;  1Z9Q A;  4J9E A;  1PG5 B;  3RER A;  2XU8 A;  4ORZ A;  3PGG A;  1VQ7 A;  1FMK A;  2RQU A;  5FWB A;  2LVM A;  3M9Q A;  2SRC A;  2DBM A;  4X9C A;  4J6Y A;  1G83 A;  1XOV A;  2E65 A;  5I2M A;  1YJN A;  3A8M B;  2QDL A;  1Q7Y U;  1EX4 A;  1NG2 A;  4J9G A;  3CQT A;  2PVD B;  2X4Y A;  4FM4 B;  1SHG A;  2X9H A;  2AKL A;  2XI9 A;  1BI0 A;  3JCM J;  3C94 A;  2RHU A;  3M0T A;  1S72 Q;  2JOY A;  4NOY A;  3GNG A;  4IUT A;  4EMH A;  2DL3 A;  5KYW B;  4XQ3 A;  1JXM A;  2JUF A;  2F2V A;  2FRW A;  1F1B B;  4F7U G;  4GBQ A;  2CP0 A;  2MMP A;  1B7T A;  1MUZ A;  2QEX A;  1LPL A;  5KYU A;  3GOX A;  1BI2 A;  3QDR B;  2FZK B;  3EFO A;  1I8F A;  1Z9Z A;  3R6O A;  3CME A;  3O5Z A;  1KQS P;  3G71 A;  2OAW A;  2QA4 T;  3OYI A;  3SHW A;  1BI1 A;  3V8K A;  2E64 A;  1OEB A;  2DYB A;  4HA8 A;  3X26 B;  2DLP A;  4PK4 A;  2JMC A;  3C0C A;  3OMC A;  1V29 B;  4PJN A;  1JQQ A;  2GBQ A;  2FZG B;  4M75 D;  1NLP C;  3QBY A;  4KBM B;  2HNI A;  3PTA A;  3HL8 A;  2RJC A;  4LD9 K;  1S72 A;  1QVF P;  1VOM A;  2EJG A;  2P0P A;  2CT3 A;  1K9M U;  2QYZ A;  2NLU A;  4KGZ B;  2J7I A;  1JB0 E;  1X75 C;  1ZSZ C;  1VQ6 Q;  1PD0 A;  4E7J A;  1VQK T;  1M2V A;  5GAO q;  5FU6 C;  1WGS A;  1UEC A;  1VIF A;  3CD6 T;  4A4K A;  3THK A;  3L2W A;  5KCO A;  3NGP A;  3V7S A;  5GAM h;  3CCV A;  3OSS C;  4XTV A;  3EG0 A;  1KC8 U;  4M7D G;  5KYY A;  3OY9 A;  4ZGE B;  2PQW A;  1DJ7 B;  3M57 A;  1BBZ A;  3OYA A;  1YHQ Q;  2JNG A;  4KRT A;  4J83 A;  2YHT A;  4C8Q C;  4L59 A;  1X01 A;  3VJP A;  3OYD A;  3G71 Q;  4K11 A;  2JVV A;  3A8O B;  2QXF A;  3CC4 Q;  2HQX A;  2RD1 A;  4E6R A;  1AWX A;  3H0F A;  4C5I A;  2CT4 A;  4JJN K;  1KQ2 A;  2A0F B;  3VS2 A;  2ROT A;  3CCL A;  1AHJ B;  4B9X A;  3FB9 A;  4HCC A;  1K73 R;  1K9M C;  9ATC B;  3V7R A;  2OX7 A;  4IUQ A;  3I5S A;  1LJO A;  4HT8 A;  2A36 A;  2RMO A;  5LJ5 h;  2RQW A;  4MZM A;  2X4J A;  3VUZ A;  1QLY A;  1MMA A;  4OGC A;  1QVP A;  2GFU A;  3NMZ C;  4M75 E;  5CO7 A;  1NE8 A;  3OYK A;  4DOW A;  2KXD A;  4RTV A;  1I5O B;  2L3Q A;  2LP5 A;  3JB9 H;  1PRM C;  3SWN C;  4M4Z A;  4E2F B;  3L42 A;  3OYC A;  4AG1 C;  5IAY A;  1VQN A;  4WF2 A;  2QQ9 A;  5CAI A;  1WHL A;  1X69 A;  3I55 T;  1NJI U;  2GQI A;  3T9N A;  4AG2 C;  3CCR T;  2OTJ Q;  1N8R C;  1GCQ C;  3CCS A;  1K4U S;  2DAQ A;  3M54 A;  1D1C A;  1WHJ A;  4EMK C;  3JAM E;  3G4S T;  2NUT B;  3JB9 J;  1VQO T;  4F7U F;  4QVD A;  2KQW A;  5M9O A;  3CCQ A;  4C92 A;  2C0T A;  2QQR A;  1GCP A;  3FIF A;  1VQ9 Q;  1V76 A;  3UWN A;  1QMC A;  3R6N A;  1D1A A;  3EHR A;  4DBH A;  3QWY A;  1Q81 C;  5KYN A;  1SHF A;  4QVZ A;  1UGP B;  2FO0 A;  1OZ3 A;  3UAT A;  1MMD A;  3CCQ T;  4FT4 A;  4PFZ A;  1WHM A;  3CCR Q;  1UJ0 A;  4Z8A A;  1ACM B;  3CCU Q;  1S72 T;  1YIJ T;  1Q82 R;  3JB9 D;  4ZTJ A;  2LMJ A;  1C0M A;  3CC4 T;  3MET A;  2D1X A;  4M75 C;  1WHG A;  2A3L A;  2JTF A;  1KD1 C;  5CQY A;  1M8V A;  2YUO A;  2RB6 A;  1KD1 U;  4M7D C;  2RA2 A;  5L23 A;  1VQL T;  3CCJ T;  1RUW A;  2VYT A;  1M3B A;  2XK0 A;  3OYY A;  1V1C A;  4M78 D;  4KUL A;  4D8D A;  4RCB A;  1JXO A;  5HK3 A;  1Q86 R;  1FXX A;  4EMK A;  3DB3 A;  3Q1J A;  5GAN h;  3JRZ A;  1K76 A;  2E4H A;  3I9Q A;  2V8J A;  2DE0 X;  4QQD A;  4QW2 A;  1Y0M A;  2KSS A;  1NEG A;  4LDU A;  1XTD A;  2LDM A;  1LVK A;  3JCM Q;  4EDU A;  2DBK A;  5CK9 A;  1UHC A;  1HSQ A;  5I2S A;  5FWC A;  2FPE A;  1U5S A;  3E9F A;  1U06 A;  2QTV A;  2HEQ A;  5KYX B;  4M75 F;  1M90 U;  4M75 A;  2DXT A;  2GF7 A;  2PZ1 A;  1LCK A;  1OX8 A;  5FRN A;  2KRO A;  2ECZ A;  4PLL A;  3QDF A;  2CZ1 B;  4ZGJ B;  5HY6 A;  3URG A;  2D0Q B;  3JCM g;  2JN0 A;  1Y07 A;  4DEY A;  1M5Q 1;  4ZN1 A;  2M02 A;  1Q81 R;  2FPF A;  4KUI A;  1TUC A;  2LCC A;  2DIG A;  1OX9 A;  3M55 A;  3JCM W;  4C8Q A;  1E7O A;  1UDL A;  2ZPE B;  1LNX A;  3HKS A;  3SB2 A;  5LJ5 j;  1QP2 A;  2LQK A;  3MJX A;  1KHC A;  1VQ4 T;  5IHK A;  1WIE A;  2MPX C;  1YIT Q;  4PFP A;  1UGQ B;  5I22 A;  1Q86 U;  1YJW A;  3PE0 A;  1VQK A;  2QAZ A;  1VQ7 Q;  3JCM V;  2F1L A;  3CC2 A;  2LQ8 A;  5LJ3 e;  1N5Z A;  4BAC A;  1AVZ C;  2RHX A;  5DY9 A;  2LCS A;  5CKF A;  5D7U A;  4KH0 B;  4L5G A;  1TWB A;  1KC8 C;  3HHT B;  1VQP T;  2L2P A;  4M78 B;  1T3S A;  1RAC B;  2LX9 A;  5LJ5 e;  3KFV A;  2LJ0 A;  2B8A A;  3MHX A;  1Y96 B;  2VGN A;  1W2B P;  1RLQ C;  2XKO C;  3AHU A;  4OMQ A;  2WSC E;  2BE9 B;  3GIB A;  4LXC A;  1ZSG A;  3GLX A;  1H3H A;  1G3T A;  1WA7 A;  4RCC A;  3OYG A;  5LJ3 g;  1M30 A;  5J26 A;  4AFQ C;  1G3W A;  3O8V A;  2G6F X;  2KNB B;  4FCY A;  2KYM A;  2RQT A;  1QCN A;  1A0N B;  3ZBD A;  4RTU A;  4JJB A;  1VQP Q;  2MAM A;  4IUP A;  3EH2 A;  2K3Y A;  3VS6 A;  4ME7 A;  2J6F A;  3I35 A;  1IGQ A;  2OJ2 A;  5J39 A;  2QGG A;  2KRN A;  5CVI A;  3E9G A;  1YJ9 A;  2HQH A;  4ZGD B;  3QZ5 B;  2KT8 A;  2ZCF B;  2WAC A;  3C95 A;  4N4G A;  1W2B A;  5CCA A;  2CZ0 B;  2Y4Y A;  3QWX X;  4DBF A;  7AT1 B;  1K8A U;  1BKB A;  4ANJ A;  1VQO Q;  2VWF A;  2CZ7 B;  6AT1 B;  2ESW A;  1U1T A;  1YJN T;  4FYY B;  1G2B A;  2CH4 W;  4JZ4 A;  4DBR A;  4PJJ A;  1ZX6 A;  1MMG A;  2DKG A;  1EIF A;  1M1K R;  2D8H A;  3VUB A;  5GAM j;  3FC3 A;  3EG3 A;  5C0M A;  3A8L B;  5GAN j;  2DXU A;  4J8O A;  3FJ5 A;  3ZFJ A;  2C0I A;  3VV0 A;  5KYU B;  5GMK j;  4FW2 A;  3CC2 T;  1VQ5 T;  4IKF A;  5A2Q E;  2P4R A;  4RTZ A;  1HD3 A;  3CPW P;  2QEX T;  1BI3 A;  3RDV A;  2LRQ A;  3OYB A;  1HJD A;  1R8O B;  3VS7 A;  5CKD A;  3QO3 A;  4V2S A;  4XU3 A;  2DEQ A;  3OSV A;  2DTI A;  4O5V A;  1BB9 A;  1RI0 A;  1YIT A;  2LT1 A;  5GAN g;  1ZQ1 A;  3DKM A;  5IT9 E;  2X3W D;  3TSW A;  3HFO A;  2DET A;  2QGF B;  3DLM A;  2W0Z A;  5ECA A;  1RL2 A;  3H0I A;  3HRS A;  1RAI B;  3EG9 A;  3HPW A;  1TXQ A;  2HAX A;  1BCM A;  2CUD A;  2DJZ A;  4OGE A;  4CC3 A;  1TTH B;  1VQ9 A;  1GL5 A;  4MDW A;  3C12 A;  2ZZD A;  2LC4 A;  2XID A;  3EH1 A;  4AFS C;  4B9W A;  4M7A F;  2RI2 A;  3CCM A;  2DJQ A;  2K57 A;  2K5L A;  1D09 B;  4C8Q D;  5KYX A;  4A63 B;  2A08 A;  2HKN A;  4M77 E;  2LT4 A;  2D8J A;  2E1H A;  3EG2 A;  3G7Z A;  3ASK A;  4PKC C;  4P5N A;  1M4Z A;  3H0H A;  4JLG A;  2FYK A;  3ZEH A;  2QQB A;  1S1N A;  2BKD N;  2DZC A;  5LL6 S;  3CPW A;  1RAE B;  2GQV A;  1IZ6 A;  4J9F A;  3G6E T;  3CCV T;  2VXF A;  3GF5 A;  1YIJ A;  1G5V A;  2M16 A;  3D7S B;  2DX1 A;  1Q95 G;  2K79 A;  1B34 B;  5HKC A;  4M75 G;  2OTL T;  2VUB A;  2IIM A;  3MCA B;  1SPK A;  2J6O A;  5FLX E;  1M1K U;  2KAF A;  3VS3 A;  5IN1 A;  4DOV A;  4WCI A;  4JUV A;  1WYX A;  2DK3 A;  2Y4X A;  5GMK i;  1UGS B;  4RTT A;  3CCL T;  4LN2 A;  4M7A G;  1CKA A;  3CPW S;  2AT1 B;  4LDY A;  2CS7 A;  2FB7 A;  2DL8 A;  4A4E A;  3PVL A;  2RM4 A;  2GTO A;  1R77 A;  3M58 A;  2L8D A;  2COW A;  3CCJ A;  4CRI A;  4BY6 C;  4ZN3 A;  2I2L A;  4NS5 A;  2QEX Q;  1H3Z A;  1K9A A;  4A4F A;  2R58 A;  3OW2 S;  1AD5 A;  1N27 A;  2M0O A;  2COZ A;  1H8K A;  2HL5 C;  4XTX A;  1OU8 A;  5LJ5 g;  4XU2 A;  2O4X A;  1UHF A;  1YJW T;  1QVF S;  3CMA Q;  4OML A;  1YCS B;  3MPU B;  1FMV A;  3RMS A;  4JRP A;  4PJO G;  1WQ7 A;  2HD0 A;  1VQ8 T;  2CP7 A;  2YRC A;  2YSQ A;  4HVW A;  5AYF A;  5LJ3 d;  2DZ9 A;  4FIB A;  3LX7 A;  3LH0 A;  2YUP A;  2FZC B;  1KHI A;  3X20 B;  1OU9 A;  5FRM A;  4OB1 B;  4VUB A;  1W70 A;  2YXY A;  1O9S A;  2L3R A;  2E5Q A;  2DL4 A;  2IPO B;  3MP1 A;  4M77 A;  4BI8 B;  5KE2 A;  3CXC A;  2QTX A;  3PMT A;  4OVA A;  1IXD A;  1SF9 A;  4RTW A;  1BCO A;  1ZA1 B;  1KQ1 A;  1JO8 A;  2L5Q A;  2EQI A;  3HTR A;  1RAG B;  4OMP A;  1QKX A;  4MMK A;  4JS5 A;  4M77 D;  3VYG A;  4C92 E;  3OYM A;  2DD5 A;  3M56 A;  2EQM A;  1NJI R;  2E6Z A;  1RAH B;  4AFZ C;  4D8K A;  5GAO n;  4E7Z A;  2XHC A;  2JMA A;  2LQN A;  1OPK A;  3CD6 Q;  2RQV A;  3CCL Q;  3AT1 B;  4LE9 A;  3EGD A;  3CXC S;  4R0K A;  2VXE A;  3RBB B;  4HVU A;  2MIO A;  4J9H A;  3GNF B;  1AT1 B;  3E19 A;  3H41 A;  2FRY A;  3JSC A;  1JRI A;  3PMI A;  2GNC A;  2MWP A;  1TUG B;  1T3L A;  1T0J A;  1NYG A;  2EQU A;  4HT9 A;  4JPB W;  4FT2 A;  1TOV A;  2VAS A;  1JJ2 A;  1NZ9 A;  2KMT A;  3KXT A;  1MV3 A;  1IO6 A;  2K3B A;  2A37 A;  2LQW A;  3V7C A;  3ER0 A;  1QVF A;  3S3M A;  3FEO A;  4CI0 C;  3SFM A;  3X25 B;  5GMK e;  2KYB A;  3CCE Q;  4M7D F;  4X9D A;  2JM9 A;  2EGA A;  4C0D C;  4M7A D;  1XQH A;  5CKH A;  3TEE A;  4M78 G;  3INZ A;  2ABL A;  2G3R A;  3EAE A;  3BW1 A;  3TSZ A;  1PM3 A;  1YWO A;  3OBY A;  2LZ6 B;  3FRN A;  1QW1 A;  4A54 A;  3FJP A;  2ZPB B;  3EGD B;  1XJW B;  1Y96 A;  4Y92 A;  2IVW A;  4GY5 A;  1VQ6 T;  2EBP A;  2PVG B;  2J06 A;  3OMG A;  4ELY C;  1VQL A;  2QK0 A;  2DVE A;  4BE1 A;  3HFN A;  1EZZ B;  1M1F A;  2PTK A;  2NWM A;  2ENM A;  5GAN 2;  5FW9 A;  3UA6 A;  2FEI A;  4Y91 A;  3REB B;  3NTH A;  1ZSZ B;  1M1G A;  1KD1 R;  3HSB A;  4NL2 A;  3G71 T;  3ME9 A;  3P8B B;  3CCE A;  1GCQ A;  1OPL A;  2YWW A;  2W10 A;  2PUK B;  3CBO A;  2KI7 A;  3QKJ A;  2E6N A;  4FU6 A;  5KYW A;  4LDW A;  2KRM A;  2OAU A;  2NYS A;  2KT1 A;  4J9C A;  4DEX A;  3G4S Q;  2R5M A;  3LH5 A;  1X2Q A;  3MKD A;  5AT1 B;  5A0L A;  4FSS A;  3G4S A;  1M1K C;  2CDT A;  1D3B A;  5IXF A;  1MND A;  1G3S A;  1M90 C;  3MEU A;  3FDR A;  2SEM A;  2XDB A;  1GFD A;  1OOT A;  4RG2 A;  3OW2 A;  4PNO A;  2K7A A;  3CCU T;  1U1S A;  4M7A B;  2ZGW A;  3QII A;  4J9B A;  5GJV B;  4M7D B;  1HXD A;  2GTJ A;  4NL3 A;  1TG0 A;  4PL6 A;  2HCK A;  3NPF A;  2O01 E;  1WLP B;  1B3Q A;  3OYF A;  2HZY A;  1VQL Q;  1K8A C;  4BDZ A;  3LGL A;  2BUD A;  4CC2 A;  3VYH B;  4C0D B;  4JJD A;  4C92 B;  3SWN B;  1Y7X A;  1YI2 Q;  1SRM A;  2EW3 A;  3ZL7 C;  1YNZ A;  3MEW A;  3JCM c;  2VVK A;  4E7L A;  2H8H A;  5LJ3 j;  1WJR A;  1AWW A;  4C8Q E;  1Q7Y R;  1VQ8 A;  1UGR B;  2L0A A;  5GAN 6;  2JTE A;  2KY9 A;  3OB9 A;  2QQA A;  4AFU C;  2OI3 A;  2RPN A;  2CSQ A;  5GAN 8;  4RKU E;  4N0A C;  4PJO A;  5GMK h;  2AKK A;  4IIO A;  2K6D A;  1AZG B;  1SG5 A;  2V8I A;  5FRO A;  1QVG S;  3L2Q A;  1YFN A;  3J81 E;  2J05 A;  1B34 A;  3OQ5 A;  2P0Q A;  4ZTF A;  2XMF A;  2AZS A;  5A0G A;  4LDV A;  1BYM A;  1JEG A;  2D0N A;  1BIA A;  1IRE B;  2M51 A;  1G8X A;  3PVQ A;  2EIF A;  4QQ6 A;  3DB4 A;  5GAN d;  3QJY A;  2KRS A;  1EFN A;  2K2V A;  1RI9 A;  3BDU A;  2ZPG B;  2F5T X;  2K9G A;  2DXB A;  3M4Y A;  3A8G B;  3V8J A;  1TH7 A;  1O75 A;  3CXC P;  1N9R A;  1IRX A;  2RI5 A;  2X4W A;  4M7A A;  2HMA A;  4BUG A;  2M1H A;  3QYH B;  3EFS A;  4C0G A;  4E7S A;  4FYV B;  2OTJ T;  5GMK m;  1K9M R;  2YT6 A;  2P4T A;  4XU1 A;  2MYS A;  4M77 F;  2MCN A;  3EG9 B;  2JXB A;  2FVU A;  4BD3 A;  4JRQ A;  3F70 A;  3LLR A;  5I11 A;  3U23 A;  5GAN 5;  3OA6 A;  3KUF A;  1WXT A;  2KR3 A;  1YHQ A;  2ED1 A;  4RUG A;  3RR6 A;  3OYL A;  1OUL A;  4JS4 A;  4X1V A;  1RAF B;  3OYH A;  2PUO B;  5GAM f;  3CBP A;  3JCM P;  4LUD A;  3V8L A;  4EIK A;  1AOJ A;  4M7A E;  1KIK A;  3CME T;  2PVO B;  1CKB A;  3PIP A;  3P8H A;  2F2W A;  3OS2 A;  2MWO A;  3TVT A;  1YN8 A;  2YRD A;  4LDX A;  4JDS A;  4E7K A;  5GAN 7;  4ESR A;  4F7U B;  1I5L A;  5GAN 4;  2EAY A;  2DMO A;  1JJ2 S;  1K1Z A;  3CC7 T;  4C8Q G;  2CKK A;  3CCJ Q;  2BTT A;  2CUB A;  2VKN A;  5CQX A;  4QVC A;  3UA7 A;  4JZ3 A;  4M78 F;  2AZV A;  3M0U A;  4KGX B;  5LJ5 f;  2DIL A;  4F16 A;  3I55 Q;  1LOJ A;  4B6M A;  4F7U A;  5IXB A;  2HBP A;  1QWE A;  2KVQ G;  2EYZ A;  1WI7 A;  4F14 A;  4ELZ C;  5KYY B;  1JU5 C;  4OF1 A;  1PKS A;  4BB7 A;  2RK1 A;  1VQN Q;  2EGC A;  3M0R A;  2RJF A;  1N9S A;  2P0K A;  2CP6 A;  1OZ2 A;  2QG9 B;  1IGU A;  1NJI C;  1M2V B;  2QQS A;  1QKW A;  5IHN A;  1X6B A;  2BZ8 A;  1YHQ T;  2WSF E;  5DLQ E;  1MV0 B;  1OYX A;  1K0S A;  1TSF A;  4OMN A;  2X51 A;  3UF4 A;  4C8Q B;  3EG1 A;  4MZT A;  2DM1 A;  1RAB B;  2CZ6 B;  1KK7 A;  4RTX A;  3CCQ Q;  4CC4 B;  1RAA B;  4Z88 A;  2RJD A;  5KH6 A;  2M0Y A;  3PT9 A;  3VS0 A;  3A1P A;  3OBW A;  3N5B B;  1I07 A;  1KSW A;  3TRE A;  1OI1 A;  1R0C B;  1N6A A;  1AWO A;  4BDY A;  1G3Y A;  5EC7 A;  4KUD K;  1FYN A;  3M59 A;  3NTK A;  3JCM b;  3JB9 I;  1PNJ A;  1MHN A;  3GP8 A;  2RJE A;  4C0Z A;  4XTW A;  2HSP A;  1PKT A;  2ZPF B;  4A53 A;  3WVE B;  4DQ2 A;  1PWT A;  3QZ9 B;  4N0A A;  4PJO C;  3CC4 A;  2EYY A;  1WNL A;  3EFR A;  4HCK A;  2EKO A;  2GFA A;  2FPD A;  3E1S A;  2EVR A;  1VQ7 T;  2PNI A;  1U8R A;  2P84 A;  5GAO l;  3PNW C;  5HK0 A;  1QCF A;  2GCX A;  5KCH A;  4RG8 A;  1GFC A;  5FU7 B;  1VIE A;  1H92 A;  2JW4 A;  2COY A;  4C5E A;  3NHN A;  5GAM g;  5GAO m;  4PJO D;  2DYI A;  2DTO A;  3JCM d;  4AT1 B;  4F17 A;  2QI2 A;  2R57 A;  4XAX B;  2JT4 A;  3JB9 F;  3JB9 G;  3L1A A;  3CEY A;  2LTO A;  1ABQ A;  5GAO r;  1C6V X;  2DTH A;  1IB8 A;  8AT1 B;  4E7H A;  1TUD A;  4GLK A;  4N4I A;  1WZO A;  2MI6 A;  1ZLM A;  3TQ7 P;  2F69 A;  5GAN f;  3CC2 Q;  1ZA2 B;  1NEB A;  1T0H A;  2LNH B;  3CCR A;  4DA4 A;  2AIR B;  2O2O A;  4M77 G;  4HXJ A;  3I55 A;  1SEM A;  3QG1 A;  4BY6 B;  4M77 B;  3UPU A;  1X27 A;  2YUN A;  3M0P A;  1Q82 U;  3HRT A;  2DVJ A;  3I56 T;  1H64 1;  3BDL A;  2NUP A;  5HCK A;  3DLL A;  2JM8 A;  2EYX A;  1P92 A;  4PFO A;  5GAM e;  4QT7 A;  3NTI A;  1SKU B;  1VQ4 Q;  4J9D A;  1PC0 A;  3OYN A;  1QWF A;  4C92 F;  4JRI A;  3UDC A;  4X34 A;  3X24 B;  1VA7 A;  2KDS A;  4FSX A;  1E6G A;  4CC7 A;  3LW5 E;  2E70 A;  1JBM A;  2V8K A;  1SSH A;  3M53 A;  5J3B A;  5GAN 3;  2ZAE A;  4JRK A;  2E41 A;  3EGX A;  2LNV A;  1YIT T;  1PSF A;  1VQM A;  2AK5 A;  4PJO B;  2CP5 A;  2LCL A;  2C0O A;  1WHH A;  2HBW A;  5GMK l;  2E3I A;  3MO8 A;  2D9T A;  1VQM Q;  1W4S A;  1UUE A;  5CIU A;  1KQS A;  3SEM A;  2DER A;  3S3O A;  1KFZ A;  2XG8 D;  4KT0 E;  3A8H B;  1AZE A;  4HCB A;  4M78 C;  4OMF B;  3L2Z A;  3L2V A;  2R5A A;  1WXB A;  4TVR A;  3C4S A;  3JCM e;  1YBY A;  3I56 A;  2BIV A;  3JV3 A;  4BE2 A;  2LJ1 A;  4R55 A;  2LX7 A;  2D6F A;  2AHJ B;  4LNP A;  1NYF A;  2I0N A;  2WSE E;  1K8A R;  2M9U A;  4N4H A;  4MZP A;  1PCX A;  3P8D A;  4XTY A;  2EJF A;  2EFI A;  1VYV A;  3OW2 P;  5IH2 A;  5D6Y A;  1K0X A;  1KG1 A;  5GAN e;  3BE3 A;  1GBQ A;  2KEA A;  4DBQ A;  2H3J A;  4J6W A;  2F2X A;  1W1F A;  4ATO A;  3VRY A;  4C8Q F;  4C5H A;  1I1J A;  2NUP B;  3LWH A;  5A0D A;  1YJN Q;  1NM7 A;  5GJW B;  4Z89 A;  1GRI A;  4FW1 A;  1WQW A;  4IUU A;  3MP8 A;  1VQO A;  1HK9 A;  2DRK A;  1AEY A;  5DLO A;  2EPD A;  3I56 Q;  4HVV A;  2DRM A;  2YLC A;  3VRZ A;  1VQ6 A;  4O6J A;  3CCM T;  2K5I A;  1B07 A;  3ULR B;  3M5A A;  4Z02 A;  3PIO A;  4QQG A;  1ZUK A;  2L3P A;  3G1J A;  4JJC A;  3CPF A;  4OB3 B;  2RF0 A;  2E10 A;  1VQ9 T;  1VQP A;  4Q5W A;  1HYO A;  1X6G A;  4WTO B;  2XD0 A;  4Y28 E;  2CGH A;  2DO3 A;  3MEA A;  5LJ3 f;  4E7I A;  4KH1 B;  1UJY A;  2A7Y A;  3LYI A;  1WHK A;  2ZPH B;  2DL7 A;  1YIJ Q;  1Q7Y C;  5DM7 R;  2EYQ A;  1ZSZ A;  2HDA A;  3CCE T;  3G6E A;  4OMM A;  4OP0 A;  1C1A A;  2YLB A;  2K2M A;  3CCS T;  4LD6 A;  2LJ3 A;  2YUQ A;  3EFO B;  3MEV A;  3JCM f;  1FX7 A;  1D0Z A;  3RKX A;  4C92 D;  2EYW A;  3E2U A;  1UTI A;  4MML A;  2VGM A;  4II1 A;  2QA4 Q;  5EG2 A;  2CP2 A;  1SSF A;  3LWI A;  2DF6 A;  2E5K A;  3RES A;  3S3N A;  2HL3 A;  3TU4 K;  4FL6 A;  2H3E B;  3IQL A;  2O9S A;  2RI3 A;  3SDZ A;  4C92 C;  4XTU A;  1VQ8 Q;  4J6X A;  4M7D E;  2FG0 A;  2KE9 A;  3QXE B;  4AMC A;  2QDY B;  1D3B B;  3J80 E;  3CCV Q;  3RKY A;  4FYW B;  1OQK A;  1UB4 A;  4EPC A;  2JJ9 A;  1ABO A;  1X6O A;  4PJO E;  2BZX A;  2DPP B;  3CC7 Q;  1KC8 R;  4XU0 A;  2XIC A;  2HKQ B;  3OS5 A;  1NPP A;  2OTL Q;  4KGV B;  1X43 A;  2RN8 A;  4EMG A;  3CC7 A;  1Q81 U;  4A4H A;  4M78 E;  4OB2 B;  1W6X A;  3G6E Q;  5KE3 A;  2CP3 A;  3OYE A;  1TU0 B;  1UE9 A;  3CD6 A;  3CMA A;  3QJ6 A;  1WJQ A;  3J7A F;  2JZ2 A;  2HQE A;  2RH2 A;  4PJO F;  4M77 C;  2PU9 B;  1FMW A;  1N8R R;  1VQ5 A;  4F04 B; 
#chains in the Genus database with same CATH homology
 1QLY A;  1WFW A;  4RTT A;  2JS0 A;  4LN2 A;  4ESR A;  1CKA A;  2YDL A;  3NMZ C;  2BZY A;  2DL8 A;  2DMO A;  1WX6 A;  3PVL A;  1K1Z A;  2BTT A;  2CUB A;  2EGE A;  2GTO A;  2VKN A;  2KBT A;  2KXD A;  4RTV A;  3UA7 A;  4JZ3 A;  2AZV A;  3M0U A;  2B86 A;  2L3Q A;  2LP5 A;  1K9A A;  1PRM C;  1AD5 A;  2DIL A;  4M4Z A;  4F16 A;  2KXC A;  5IXB A;  4AG1 C;  1H8K A;  1QWE A;  2EYZ A;  1WXU A;  1WI7 A;  4F14 A;  2X3X D;  1JU5 C;  2L3S A;  1X69 A;  1UHF A;  1PKS A;  3I5R A;  2O88 A;  1J3T A;  4OML A;  1YCS B;  2MOX A;  2EGC A;  2GQI A;  2DL5 A;  4AG2 C;  3M0R A;  4ZNX A;  2O9V A;  1M3C A;  2KGT A;  1GCQ C;  3VS1 A;  1QKW A;  4IIM A;  5IHN A;  1I0C A;  1K4U S;  2YSQ A;  1X6B A;  2BZ8 A;  1ARK A;  4HVW A;  1CSK A;  1Y57 A;  1MV0 B;  1K0S A;  4OMN A;  3UF4 A;  3EG1 A;  2DM1 A;  3RNJ A;  2C0T A;  2YUP A;  1GCP A;  3REA B;  1OV3 A;  3R6N A;  1U3O A;  4RTX A;  1WDX A;  1W70 A;  3EHR A;  3QWY A;  4CC4 B;  2DL4 A;  1SHF A;  2FO0 A;  4Z88 A;  2CH4 A;  2O31 A;  3UAT A;  2M0Y A;  2ROL A;  3EGU A;  3VS0 A;  2A28 A;  1UJ0 A;  4Z8A A;  4RTW A;  1I07 A;  1KSW A;  1AWO A;  1E6H A;  1JO8 A;  5EC7 A;  2LMJ A;  2EQI A;  1M27 C;  2D1X A;  1FYN A;  4OMP A;  4LUE A;  1PNJ A;  2YUO A;  1QKX A;  5L23 A;  3VS5 A;  2HSP A;  1NLO C;  1PKT A;  1M8M A;  1PWT A;  2CRE A;  1RUW A;  1M3B A;  2EYY A;  4HCK A;  1V1C A;  2FPD A;  4D8D A;  1JXO A;  2EVR A;  2PNI A;  4OMO A;  4AFZ C;  4D8K A;  2JMA A;  2LQN A;  3A98 A;  1OPK A;  1ZBJ A;  2RQV A;  1QCF A;  4LE9 A;  1GFC A;  4R0K A;  1K76 A;  3RBB B;  4HVU A;  1H92 A;  2JW4 A;  3I9Q A;  3NHN A;  2DE0 X;  2MIO A;  1Y0M A;  4J9H A;  3VS4 A;  4F17 A;  1NEG A;  2JT4 A;  1UGV A;  3H41 A;  2FRY A;  1ABQ A;  2DBK A;  1UHC A;  2GNC A;  1HSQ A;  4J9I A;  1BU1 A;  1TUD A;  1T3L A;  1KJW A;  1T0J A;  1NYG A;  1ZLM A;  5FWC A;  2FPE A;  1U5S A;  4JPB W;  1U06 A;  2HEQ A;  1NEB A;  1T0H A;  2PZ1 A;  2LNH B;  1LCK A;  1MV3 A;  1IO6 A;  2K3B A;  2A37 A;  2KRO A;  2ECZ A;  2LQW A;  2O2O A;  4HXJ A;  1X2K A;  1SEM A;  2EKH A;  3EHQ A;  1X27 A;  2KYB A;  2V1Q A;  2YUN A;  2JM9 A;  3M0P A;  2EGA A;  2DVJ A;  4DEY A;  2ABL A;  5HCK A;  3TSZ A;  2RNA A;  2JM8 A;  1M3A A;  1YWO A;  2FPF A;  2LZ6 B;  2EYX A;  1TUC A;  4QT7 A;  4J9D A;  1E7O A;  1UDL A;  1QWF A;  2GGR A;  4Y92 A;  3M0S A;  1VA7 A;  1VYU A;  2EBP A;  5IHK A;  1E6G A;  1WIE A;  1RLP C;  2J06 A;  3M0Q A;  2DNU A;  4CC7 A;  1PRL C;  4RTY A;  1YWP A;  5I22 A;  1PHT A;  4GLM A;  1SSH A;  3PE0 A;  2AK5 A;  2C0O A;  2JS2 A;  2NUZ A;  2PTK A;  2HBW A;  2RQR A;  2NWM A;  2ENM A;  2V1R A;  1VYT A;  2ED0 A;  1AWJ A;  5FW9 A;  1N5Z A;  3UA6 A;  1AVZ C;  1UUE A;  2LCS A;  2FEI A;  3REB B;  3SEM A;  1ZUU A;  1KFZ A;  2L2P A;  1ZUY A;  1T3S A;  1UG1 A;  3KFV A;  2LJ0 A;  2CSI A;  1GCQ A;  1AZE A;  1OPL A;  2W10 A;  2KRM A;  2DA9 A;  1WXB A;  1RLQ C;  4DEX A;  2KT1 A;  4J9C A;  1SRL A;  1X2Q A;  3LH5 A;  3GBQ A;  3JV3 A;  4OMQ A;  1ZSG A;  1H3H A;  2LJ1 A;  4FSS A;  2LX7 A;  1GBR A;  2J6K A;  1UFF A;  5IHI A;  1WA7 A;  2CDT A;  4LNP A;  1NYF A;  5IXF A;  1M30 A;  4AFQ C;  1BK2 A;  2I0N A;  2G6F X;  2KNB B;  1YP5 A;  2KYM A;  2RQT A;  2SEM A;  1Z9Q A;  4J9E A;  1A0N B;  4RTU A;  4JJB A;  1GFD A;  1OOT A;  2K7A A;  4ORZ A;  1FMK A;  3VS6 A;  2RQU A;  2J6F A;  4J9B A;  5FWB A;  1VYV A;  5GJV B;  2SRC A;  5IH2 A;  1K0X A;  3I35 A;  2DBM A;  2OJ2 A;  2GTJ A;  1TG0 A;  2KRN A;  2HCK A;  3NPF A;  1GBQ A;  2KEA A;  1WLP B;  1B3Q A;  2KT8 A;  1G83 A;  1XOV A;  2F2X A;  1W1F A;  3VRY A;  2QDL A;  4CC2 A;  3QWX X;  1I1J A;  1NG2 A;  4J9G A;  3CQT A;  1SHG A;  4JJD A;  1NM7 A;  2AKL A;  2VWF A;  5GJW B;  3M0T A;  2ESW A;  4Z89 A;  1GRI A;  1SRM A;  2DL3 A;  2DRK A;  1YNZ A;  2EW3 A;  3ZL7 C;  1AEY A;  2EPD A;  1JXM A;  1G2B A;  2CH4 W;  4HVV A;  4JZ4 A;  2DRM A;  2F2V A;  2VVK A;  2FRW A;  2H8H A;  1ZX6 A;  3VRZ A;  1AWW A;  4GBQ A;  2D8H A;  1B07 A;  1MUZ A;  3ULR B;  2L0A A;  2JTE A;  1ZUK A;  2L3P A;  3EG3 A;  4JJC A;  4AFU C;  2OI3 A;  2RPN A;  2RF0 A;  2CSQ A;  3FJ5 A;  2C0I A;  1Z9Z A;  3O5Z A;  2AKK A;  4IIO A;  2OAW A;  2K6D A;  2P4R A;  4RTZ A;  1HD3 A;  1AZG B;  1X6G A;  1HJD A;  3SHW A;  3VS7 A;  1OEB A;  2DYB A;  2DLP A;  2J05 A;  2XMF A;  2JMC A;  1BB9 A;  3C0C A;  2AZS A;  1UJY A;  1JQQ A;  1JEG A;  2GBQ A;  2D0N A;  2M51 A;  2DL7 A;  2X3W D;  3PVQ A;  3TSW A;  2HDA A;  1NLP C;  2W0Z A;  5ECA A;  2KRS A;  3H0I A;  4OMM A;  1EFN A;  2K2M A;  1RI9 A;  2K9G A;  2CT3 A;  2LJ3 A;  2CUD A;  2YUQ A;  4CC3 A;  1GL5 A;  2J7I A;  2EYW A;  4AFS C;  1UTI A;  2DJQ A;  1UEC A;  2DF6 A;  2E5K A;  4A63 B;  2A08 A;  3THK A;  3NGP A;  2D8J A;  3EG2 A;  3IQL A;  2O9S A;  2YT6 A;  3EG0 A;  2FG0 A;  2KE9 A;  3H0H A;  1S1N A;  2MCN A;  2JXB A;  1BBZ A;  1ABO A;  4KRT A;  3U23 A;  5I11 A;  2BZX A;  4J9F A;  1WXT A;  2KR3 A;  4K11 A;  1X43 A;  2ED1 A;  4RUG A;  2RN8 A;  2DX1 A;  4E6R A;  1AWX A;  3H0F A;  1W6X A;  2CT4 A;  2K79 A;  4X1V A;  2IIM A;  1UE9 A;  1SPK A;  2J6O A;  3VS2 A;  2ROT A;  4LUD A;  4EIK A;  1AOJ A;  3VS3 A;  1KIK A;  1CKB A;  4WCI A;  3I5S A;  2F2W A;  1WYX A;  2A36 A;  3TVT A;  2RMO A;  2RQW A;  1YN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...