3H0IA

Human fyn sh3 domain r96i mutant, crystal form ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
VTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0iA00
2CH4A 1G83A 2JM9A 3VS3A 1FYNA 1JXOA 2JMCA 2KT1A 3EG2A 2L3QA 5I22A 5L23A 1N5ZA 3VS1A 4LN2A 2YUPA 2HBWA 1SEMA 4IIOA 2DYBA 2RQWA 3H41A 3REAB 3H0FA 5GJWB 2FPEA 3PVQA 3M0PA 3I5RA 3NHNA 4RTZA 1AOJA 1UGVA 2RQRA 4ESRA 1B3QA 2DL8A 2PTKA 1UHFA 2C0IA 2A28A 2KXCA 1TG0A 4LE9A 2GTOA 1W70A 2LCSA 2FG0A 3VS0A 2KGTA 2VVKA 2X3XD 2KYBA 5EC7A 1JQQA 1NEGA 1ABOA 2J6FA 2LNHB 1AWXA 3H0HA 2IIMA 2CT4A 5HCKA 4GLMA 1K76A 1UDLA 1NLPC 2EGEA 1WI7A 2KEAA 3EGUA 1NEBA 1M30A 2DMOA 1M3AA 1JU5C 1KIKA 2F2VA 3UA6A 1RLQC 4LUEA 2EPDA 2VWFA 1EFNA 2GNCA 2NWMA 2KRSA 1XOVA 1ZBJA 4CC7A 1G2BA 1WX6A 1GRIA 2CSIA 2DILA 4J9HA 3VS7A 4JPBW 2V1RA 3UA7A 1KSWA 1QKWA 2A37A 1WIEA 1CSKA 2A08A 2D0NA 2PNIA 1MV3A 1NM7A 1QKXA 1VYVA 1ZLMA 2YUNA 2KRMA 4RTWA 3C0CA 3VRZA 4CC2A 2LMJA 4D8KA 1X2QA 2OAWA 1UTIA 2M0YA 1OPKA 2ED0A 4F14A 2D1XA 3UF4A 1AWJA 2ED1A 1YWPA 1WYXA 1QWEA 1M27C 2VKNA 1JXMA 3TSWA 4OMLA 2BZYA 2OI3A 1AVZC 4LUDA 3RNJA 2FRYA 4CC3A 2K7AA 4K11A 4HVVA 3EG3A 4D8DA 2DA9A 2LJ0A 1PKSA 1YCSB 1K0XA 3TVTA 2FRWA 5IXBA 2J6OA 1BB9A 1SRLA 3VS5A 1UE9A 4QT7A 2DVJA 3LH5A 1B07A 1U5SA 1HD3A 1RUWA 2MCNA 2KNBB 3FJ5A 1BK2A 1JO8A 2JMAA 3SHWA 2RNAA 1V1CA 2L2PA 2BZXA 5IHIA 2YSQA 2A36A 3M0SA 4OMPA 3PVLA 1PRLC 4AFZC 3ULRB 2GTJA 1H8KA 1RLPC 2O9VA 1GFCA 2HDAA 2DL4A 2RF0A 2JS2A 1Y57A 3M0RA 1WXTA 1HJDA 3H0IA 4HXJA 1VYUA 3VS6A 1SSHA 1MV0B 1X69A 1QWFA 2LP5A 3EHQA 1CKBA 2FPDA 1AWOA 2GBQA 3I35A 2SEMA 2AKKA 1GCPA 1NYGA 2L3PA 4J9DA 2E5KA 5IHKA 3NGPA 4RUGA 1NYFA 2RQTA 4F16A 2C0TA 1T0JA 5IH2A 3REBB 1UG1A 3UATA 3VRYA 3NPFA 2EGCA 1YN8A 3THKA 2RN8A 1WFWA 5IHNA 1GL5A 2DM1A 2ROLA 1WLPB 2DBKA 1BBZA 4ORZA 3TSZA 3QWYA 2F2WA 2DRKA 1AD5A 1E6HA 4FSSA 2D8JA 5IXFA 1PNJA 1UUEA 2W0ZA 1X6BA 4J9BA 1TUDA 1ZSGA 2EYXA 2NUZA 3R6NA 2XMFA 2G6FX 4RTTA 4Y92A 1WXUA 3EHRA 2KRNA 2PZ1A 1I07A 3GBQA 4LNPA 2JXBA 5GJVB 1T3LA 2DJQA 1OOTA 4E6RA 4J9GA 2LQNA 1MUZA 1BU1A 4JZ4A 2AZVA 1LCKA 2K6DA 2DE0X 2CUBA 2LQWA 1UJ0A 2KT8A 1FMKA 2CDTA 1AEYA 1NLOC 2EYZA 1ZUKA 2OJ2A 4JJBA 4A63B 2CUDA 4M4ZA 2KBTA 2EYYA 3U23A 3VS2A 2GQIA 2J06A 4IIMA 4HCKA 1Z9QA 4KRTA 5ECAA 4J9EA 4JJCA 1K9AA 2K9GA 1JEGA 2LJ3A 4ZNXA 1J3TA 2J7IA 1X2KA 2BTTA 2KE9A 1H3HA 1TUCA 2LX7A 4WCIA 2JS0A 3I9QA 1S1NA 2EBPA 2YDLA 1H92A 1WA7A 4J9CA 1PRMC 4DEXA 2M51A 2RQVA 1UECA 1ZX6A 2FEIA 2I0NA 1ZUUA 1M3CA 4JZ3A 4OMOA 3QWXX 1UHCA 2HCKA 3M0TA 1ABQA 1X27A 2ABLA 2P4RA 1SRMA 1UFFA 4AG1C 2ECZA 5I11A 2F2XA 2ESWA 1T0HA 2RMOA 2KROA 1W6XA 1GBRA 2ROTA 2AZSA 1AWWA 2FPFA 1RI9A 3NMZC 4JJDA 2JTEA 1X43A 2YT6A 2JT4A 3IQLA 4HVUA 1SHGA 3O5ZA 2JW4A 2DL7A 2DL5A 4R0KA 4F17A 2O2OA 2BZ8A 2DL3A 3I5SA 1GCQA 2CREA 2K79A 2DLPA 2K2MA 3SEMA 3RBBB 3CQTA 2CH4W 4X1VA 4AFQC 2LJ1A 1UJYA 2EGAA 1T3SA 2FO0A 5FWBA 2L0AA 1QLYA 2DF6A 1Z9ZA 2H8HA 2HEQA 2LZ6B 4DEYA 2JM8A 2B86A 5FWCA 2W10A 2AKLA 1YP5A 2HSPA 2CT3A 3ZL7C 1ZUYA 3M0QA 2L3SA 1AZEA 4OMNA 2KYMA 1AZGB 2ENMA 1M3BA 1E7OA 1QCFA 2MOXA 1WXBA 1K0SA 1SHFA 2J6KA 1VYTA 4J9IA 1SPKA 2QDLA 4Z88A 4CC4B 3PE0A 1PWTA 2DX1A 1IO6A 1K4US 2DRMA 2EYWA 3EG1A 1VA7A 5FW9A 1U3OA 4Z8AA 1I1JA 1WDXA 2O31A 2K3BA 4AFSC 1X6GA 4GBQA 1U06A 4OMMA 1KFZA 1GFDA 1Y0MA 4RTUA 1E6GA 1OEBA 1W1FA 4RTYA 1ARKA 1KJWA 2YUOA 2RQUA 2DNUA 2DBMA 2EKHA 2EVRA 4HVWA 2SRCA 2KXDA 1PHTA 4J9FA 3EG0A 2EQIA 1M8MA 1GBQA 1YNZA 1GCQC 2V1QA 3A98A 2O9SA 2X3WD 2EW3A 4EIKA 4RTXA 3KFVA 4AFUC 2CSQA 1NG2A 1YWOA 2KR3A 2GGRA 3VS4A 1K1ZA 2MIOA 2C0OA 1HSQA 4AG2C 1OV3A 1OPLA 2YUQA 1A0NB 4OMQA 2O88A 1PKTA 2AK5A 2RPNA 4RTVA 2D8HA 3M0UA 4Z89A 2J05A 3JV3A 1I0CA 1CKAA
chains in the Genus database with same CATH superfamily
2JM9A 2QGFB 2EAYA 1AT1B 3M54A 3BFMA 1FYNA 5D6XA 3PIPA 3JB9G 4DBQA 5I22A 1YHQA 1N8RU 5KYWA 1M1KU 2YUPA 1I5LA 1SEMA 3H41A 1D1BA 2P0PA 2MYSA 3M0PA 1AOJA 2RQRA 4ESRA 3HFOA 1UHFA 2CYZB 2JNGA 1YHQT 2A28A 2KXCA 2QQBA 2OTLA 3RKXA 1W70A 4EMHA 3QDFA 2FG0A 4A4FA 2X3XD 2RHZA 1RAFB 1YJNQ 3M5AA 2P84A 5FU6B 1QCOA 3MP8A 1AWXA 4JS4A 5LJ3h 4A54A 2IIMA 2CT4A 2BE9B 4BUGA 5GAOl 1B7TA 2QG9B 2EGEA 3EGUA 4NOYA 5GMKh 2HNIA 3TCJA 1M30A 4KH0B 4DA4A 1QVGP 1M3AA 1JU5C 3CPWP 3GP8A 3UA6A 4LUEA 2K2VA 4M7AG 1QMCA 4PJLA 3CCMA 4PK4A 3D7SB 1G2BA 3PFSA 2YLBA 2DILA 1C6VX 3CMAA 3LX7A 3CCSQ 4M7DD 1ZA2B 3BY7A 2KVQG 5A0DA 2WSCE 1JRIA 2D6FA 4QQDA 2PNIA 3NTIA 1MV3A 1Q86U 4E7HA 2YUNA 4J6WA 5CKBA 3C94A 2RH2A 1M90R 3DKMA 1X2QA 1UTIA 4C0GA 3ZBDA 3WVDB 4XAXB 5KYNA 2D1XA 3E9FA 3UF4A 1AWJA 2DD5A 3L2WA 5C0MA 4M7DF 1YWPA 4IUUA 2HL3A 1VQKA 3TSWA 1JJ2A 2OI3A 3QKJA 4XTUA 4HVVA 2DTHA 5GANf 2P0QA 4D8DA 2YWWA 3CXCS 2LJ0A 3CPWA 3UWNA 4ELYC 1OULA 3GF5A 2CZ0B 3TVTA 1IGUA 2WACA 4PJNA 1SSFA 1BIBA 2RJEA 1B07A 4JDSA 1K9MC 1HD3A 3MP6A 4ATOA 3OS2A 4B9WA 1JO8A 4MDWA 1KQ1A 2RNAA 1QVFA 2YSQA 3ZEHA 2DYIA 1W4SA 4AFZC 2QI2A 2CGHA 4HCBA 1MMAA 4EMKB 5I2SA 3H0IA 3Q1JA 3CCLA 1MV0B 2X4XA 1KG1A 4OB1B 3PTAA 3KBGA 3RKYA 2FPDA 3PIOA 3MCAB 2DVEA 2SEMA 4M7AB 1U1SA 2E5KA 5CKEA 4RUGA 1NYFA 4NL3A 2PVOB 2D0QB 4NL2A 1T0JA 1UG1A 1XTDA 1RAAB 3UATA 1KD1C 3NPFA 3S3MA 4PJOD 3FIFA 1WFWA 1GL5A 2DM1A 2F5TX 2K4YA 3QWYA 2CZ6B 1FMWA 1Y7XA 1PNJA 2W0ZA 3MJXA 3CCRA 3LYIA 4J9BA 4IUPA 4WF2A 1QP2A 2EYXA 2XMFA 3QZ9B 2FHDA 4PJOF 4FCYA 1KQSS 5GANe 4JLIA 4M7DG 4BY6C 2AT1B 2KRNA 2HKNA 3JCMJ 3CEYA 2EQKA 4LNPA 3CCRT 2QASA 4E6RA 2LCCA 3TEEA 5D6YA 2QQRA 3TQ7P 1UJ0A 4M77E 2KT8A 1AEYA 1NLOC 2E6NA 1YCYA 4EMKA 1ZSZC 4X9CA 4BE0A 2HL5C 4ZN1A 2QQSA 4IIMA 2ZPGB 5DLQE 2LJ3A 4ZNXA 5AYFA 1X2KA 1TUCA 3ASKA 2LX7A 2JS0A 3E19A 1VIFA 4M7AA 3CXCP 2MWPA 2GQVA 3QJ6A 2IG0A 2RA2A 3JCMQ 3MEUA 4J9CA 2LT4A 2PUOB 2M51A 2RQVA 7AT1B 3LGLA 2FZCB 5GAMh 3PMTA 4OMOA 4KGXB 1TSFA 4KH1B 1MMDA 2E70A 1YJ9Q 5I11A 3KUFA 2F2XA 1RAIB 1T0HA 2RMOA 3L2ZA 2R5AA 1VIEA 2ROTA 1K73U 5CR2A 1N8RR 1BI1A 1M1KR 1BCOA 3QO3A 5GAN7 4R0KA 1TU0B 2WSFE 3I5SA 3OBYA 4C8QC 2C06A 2K79A 3OSSC 5CQXA 4B6MA 3SEMA 2L3RA 2LJ1A 5HY6A 2H3JA 5LJ5h 4PJOC 5FWBA 2HEQA 3G6EQ 4DEYA 3DLLA 2JM8A 4KUIA 4M7DB 3CXCA 4M78G 2QAZA 1ZUYA 2L3SA 1AZEA 2ZGWA 1RI0A 4OMNA 2KYMA 4XTXA 2ENMA 4J7FA 1WHLA 4YTLA 2VGNA 1E7OA 3SWNC 1YITA 1VQMA 1QCNA 3V8LA 3JCMW 1KQSP 4M75G 5LJ3f 1K8AU 1BKBA 1YITT 1ZSZB 3CC7Q 1VA7A 2FVUA 1VQMT 2LQ8A 2K3BA 3PGGA 3UPUA 5GAN2 1X6GA 2LTOA 2EJGA 4DQ2A 3HRTA 1KFZA 5KYUB 4MMLA 2GFUA 2HZYA 2ZAEA 2R58A 3AT1B 1E6GA 2JOYA 2YUOA 2RQUA 1RL2A 3VV0A 2DBMA 3G4SA 5GANh 3MP1A 3EG0A 1PM3A 1GBQA 1KC8C 4O6JA 4PKCC 4P5NA 1GCQC 4JUVA 3FRNA 3I56A 3HHTB 3JCMX 1D0YA 2VUBA 2RHXA 3FLGA 3G4ST 2X3WD 3VU3C 1VQ4Q 4M7DA 2CSQA 1B34B 1K1ZA 2DETA 1OU8A 1OV3A 4QKUA 3I56T 3VJPA 4JRIA 4L59A 4N0AA 5GAOm 3JV3A 1VQMQ 3SFMA 2CH4A 1M5Q1 3VS3A 4LXCA 4M77D 5IT9E 4KT0E 1Q86C 1ZSZA 5C6SA 2VXFA 3H8ZA 5GAOp 4GY5A 2A3LA 5LJ3e 4LN2A 5GAN5 1LNXA 2COYA 3SWNB 2HD0A 3JCMg 5GMKe 2DYBA 4FT2A 2RQWA 4PL6A 3REAB 3H0FA 3CC4Q 5KYUA 3PVQA 2HAXA 2DTIA 2VV5A 1YFNA 2LQKA 3NHNA 4RTZA 2EKOA 2YRCA 4X34A 2PTKA 4M77F 2CKKA 1RAHB 2C0IA 4B9XA 3X24B 1ZHIA 2G3RA 4LE9A 3VS0A 1OYXA 2KGTA 2KYBA 2M1HA 2J6FA 3MHXA 4JLGA 5FU7B 1JJ2S 1DJ7B 2Z0WA 4GLMA 2HMAA 5DM7R 9ATCB 2DZ9A 4OB3B 1C0MA 5KH6A 3O8VA 4FW1A 1X6OA 1B34A 1FX7A 4XU1A 2VWFA 1KHCA 1N6AA 1M4ZA 2KRSA 1ZBJA 4CC7A 1GRIA 1NBEB 2CSIA 4J9HA 3VS7A 1BIAA 1VQ5A 4JPBW 1KSWA 3CMEA 1QVFS 4PJOA 1WIEA 3JCMd 2FYKA 4QW2A 2JJ9A 3EFRA 1NM7A 1ZLMA 2CP7A 3C4SA 4RTWA 3I55Q 3CCQA 1VQ5T 3VRZA 3RESA 2JTMA 2LMJA 4D8KA 3L2QA 3CC2A 2M9UA 3HFNA 2EQMA 3CMET 2M0YA 3SWNA 2E41A 2ED1A 4C8QE 4XU3A 1G3YA 2KI7A 3CCQT 2BZYA 1P92A 4Q5WA 4LUDA 2QQ9A 2F69A 2K7AA 4K11A 4C5IA 1VQ6A 2DA9A 4PJOE 5GAN4 1BCMA 2RHYA 4X9DA 3CD6A 3MPUB 1VQOT 1K73R 4AMCA 1PG5B 4ME7A 1VQPT 5CAIA 4D6WA 3VS5A 1UE9A 2KQWA 3OSVA 2QA4A 2ATCB 1D1AA 3OQ5A 1VQ6T 5AT1B 5GAMf 3T9NA 1Q82C 4M77G 2MCNA 2V8KA 1BK2A 3SHWA 2JMAA 3HRUA 1ZBXA 5J3BA 5IHIA 3CD6T 2MMPA 1SKUB 2YLCA 2A36A 2XHCA 1TTHB 1H8KA 1RLPC 4C5EA 3OYBA 2DEQA 2QA4T 3NTKA 4EMGA 2RF0A 2JS2A 3F70A 2I2LA 4KBMB 4XQ3A 3OYJA 4RG2A 3E1SA 1NJIC 1G3SA 2LP5A 1CKBA 4LDXA 1Q81U 3CCJA 2L3PA 2JTFA 3P8BB 2QK0A 3V7RA 5A0LA 4F16A 3CCQQ 3M4YA 4J5YA 2VYTA 2IVWA 5LJ5f 1JJ2P 1RADB 3VRYA 4RCCA 4IUTA 2F5KA 1YN8A 2RN8A 4A4EA 3CCJT 2OTLT 1VQNA 1WNLA 1K8AR 1BBZA 1VQOQ 3OYIA 3R6OA 1AD5A 1VQPQ 2D8JA 5IXFA 3OB9A 1UUEA 2QGGA 1OZ2A 4BI3A 1TUDA 3G7ZA 2DTOA 1LJOA 1Q7YU 4KGZB 4E2FB 2DXUA 1RAEB 1VQNT 2G6FX 3L2RA 4RTTA 4WTOB 4V2SA 3EGDB 3M58A 4ZGDB 2LNVA 1QVFP 2P4TA 2V8JA 1QW1A 5GJVB 3C12A 3CCMT 2D9TA 2DK3A 1BU1A 3DLMA 4TVRA 3CMAT 2CUBA 3M57A 3LWIA 4CI0C 5GAMe 1LOJA 1QP3A 2RJCA 1YHQQ 1NZ9A 3GLXA 2EYZA 3OW2A 4JJBA 5LJ3j 4A63B 4M4ZA 4CRIA 3V8KA 2K3XA 4M77B 2FZKB 2GQIA 2J06A 4J9EA 5GMKj 3S3OA 1JEGA 2YXYA 4E7IA 2EIFA 1H3HA 2JN0A 2FL7A 3I9QA 1S1NA 2EBPA 1VQ8A 3CCJQ 2OTLQ 2XD0A 1H92A 1WA7A 3EFOB 3URGA 1VQKT 5IAYA 1UECA 2FEIA 2I0NA 1ZUUA 3EH2A 4PJJA 4JZ3A 4C92D 3JCMb 1X27A 2ABLA 2P4RA 2RM4A 2X9HA 1UFFA 4AG1C 5LJ5e 3GPLA 1VQ8T 1TXQA 2A0FB 5CK9A 1RI9A 2JTEA 3OYDA 2OX7A 4XTVA 2YT6A 5GAOn 3CCMQ 2DL7A 4F17A 2O4XB 1WJRA 4C92F 2O2OA 2BZ8A 3CMAQ 3EGDA 3A5ZB 4MZMA 5HK3A 3GIBA 1M90C 3CCVA 4C8QD 2FO0A 3V7SA 2L0AA 1QLYA 3CCLT 3M4GA 3DB3A 2MAMA 1IREB 5HK0A 2BKDN 2QYZA 2CP5A 4E7JA 2P0KA 2OAUA 4M77A 2BUDA 1VQKQ 1NPRA 3OS0A 4C8QF 2DZCA 3M55A 1R77A 1KK7A 1WXBA 1K0SA 1SHFA 1PC0A 1D0XA 2Y90A 4PFPA 1HXDA 3EFOA 2DX1A 5M9OA 2RK2A 1YI2A 1HK9A 1PSEA 1IHWA 3M56A 1IRXA 5CKFA 1WDXA 2O31A 3L2UA 2XI9A 4BI8B 1ZQ1A 2QEXA 3CCEA 4DBRA 2DD4A 4F7UE 3WXMB 1YI2T 3G71A 1Y0MA 1ZA1B 4RTUA 4KULA 3GNGA 3JB9J 2O4XA 4RTYA 1HYOA 1WPYA 2PUKB 1ARKA 4LD6A 2DNUA 1Y07A 2EKHA 2EVRA 4HVWA 3CCLQ 3EAEA 4JRQA 2QEXT 4RG8A 3CCET 2KXDA 2RO0A 4J9FA 2NLUA 1Y71A 3G71T 2XDDA 1VQ9A 2HQHA 4C92C 2ZCFB 2F1LA 2COZA 4JRPA 1D09B 4DOVA 3KFVA 4AFUC 1S72A 3S6WA 1YWOA 2OTJA 2KR3A 2YRVA 4FYWB 5CKHA 4ANJA 3VS4A 1VQ9T 1HSQA 1TUGB 1UGQB 2YUQA 3LH0A 3OBWA 3QBYA 2JZ2A 4OMQA 1M8VA 2EQUA 2O88A 2AK5A 2GFAA 1S72T 3CCRQ 3M0UA 3FC3A 2OTJT 1I0CA 2HBPA 3J7AF 1NPPA 5A2QE 2DEUA 1G83A 3FB9A 1TS9A 1JXOA 2JMCA 2KT1A 5GAOr 3OA6A 2L3QA 5FRMA 1YI2Q 1BI2A 2H3EB 1Q81R 4C8QG 5L23A 2LDMA 3VS1A 4BDYA 2DKGA 3RIRA 3MEWA 4N4IA 4EPCA 3JCMh 3CCEQ 2FPEA 4A53A 3I5RA 4PJOG 5CO7A 2KDSA 1UGVA 4XU0A 1B3QA 3QSUA 3PMIA 3H6ZA 1G5VA 4BB7A 3WVEB 1TG0A 4BY6B 2ZZDA 1W2BA 2E64A 5J26A 2CZ7B 1MNDA 1NEGA 4OMFB 1ABOA 1VOMA 2LNHB 5EG2A 1Q7YR 2DERA 5HCKA 1K76A 3LWHA 1NLPC 3OYKA 1WI7A 2KEAA 1MMNA 1NEBA 3FEOA 2DMOA 3QG1A 4J6YA 1KIKA 3EGXB 1RLQC 2CP0A 1S72Q 4C5GA 4OGCA 2GNCA 3OYFA 4M75C 1N8RC 1M1KC 4FM4B 3X25B 4XTZA 4C0DC 1WX6A 2V1RA 3OYNA 1TOVA 2KK4A 1QKWA 4C92B 3EFSA 1K9MU 1CSKA 2DXTA 4HA8A 1UGPB 2D0NA 1EZZB 1QKXA 1VYVA 4L5GA 5KCOA 2E6ZA 3CCUA 2E1HA 3C0CA 4CC2A 3EH1A 3CBMA 4QVDA 4XK8E 3QZ5B 1OPKA 2JVVA 2CZ1B 3M9QA 1QWEA 2E10A 3S3NA 5IN1A 4LD9K 2M02A 3CCUT 4CC3A 2FRYA 3EG3A 4C8QB 2E4HA 2CP6A 3OYMA 2PVDB 3HRSA 1YCSB 1IHVA 1YITQ 1WHKA 1KD1U 5KE3A 2LVMA 2J6OA 4PJOB 1BB9A 3PT9A 4QT7A 4QVZA 3JSCA 4J8OA 1U5SA 2K5IA 1RUWA 3FJ5A 1UEBA 1V1CA 2L2PA 2BZXA 5GANj 2BE7D 3EGXA 3M0SA 1NE8A 4OMPA 3PVLA 4E7ZA 3ULRB 2GTJA 3BE3A 3VYGA 1G3TA 1GFCA 2HDAA 1BI3A 1RAGB 3M0RA 1WXTA 5GMKm 4HXJA 1VYUA 4MMKA 1QQJA 4C92A 3EHQA 2M16A 2GBQA 4F7UF 3I35A 1NYGA 1I4K1 4A4GA 2R57A 2RQTA 3G4SQ 3OW2S 1MNEA 2VXEA 2C0TA 2XDPA 3TREA 5IH2A 1XNIA 1I8FA 3H9NA 2L8DA 3LLRA 3I56Q 2QTVA 3MO8A 2ROLA 2DBKA 1M1GA 4ORZA 3TSZA 2DRKA 3PNWC 1X6BA 4FYXB 4C92E 4C8QA 5CVIA 4PJMA 1H3ZA 3P8DA 5LL6S 1FXXA 1Y96B 2WSEE 4Y92A 4F04B 2PZ1A 4R55A 3GBQA 3FDRA 1T3LA 2DJQA 3JRZA 2EJFA 3QYHB 4J9GA 1Q82R 4FW2A 1MUZA 1KHIA 2RJFA 3QUIA 5FU6C 5KYXB 4JZ4A 2AZVA 1LCKA 1XQHA 2E5QA 2DE0X 3GOXA 2LX9A 1X75C 8AT1B 2X4YA 1RACB 3HTRA 2VB6A 3ZFJA 1SG5A 1IB8A 1ZUKA 2OJ2A 2CUDA 1GXIE 2EYYA 2MWOA 5GANg 1YBYA 5GAOq 1Z9QA 5ECAA 1K9AA 2J7IA 2BTTA 1YJNA 3CC2T 3X20B 4WCIA 4PFOA 5CKDA 1G3WA 2YDLA 1UGSB 1LPLA 2YHTA 1PRMC 4DEXA 4OF1A 1ZX6A 1M3CA 3A1PA 4C0FA 4R56A 1UHCA 1ABQA 2HQXA 1YJWA 2CP3A 1M2OA 2MI6A 1SRMA 4F7UG 2ESWA 5KCHA 2Y4YA 3A8LB 2DXCA 3UDCA 2FPFA 3NMZC 3VKIA 4FYVB 3CCSA 1X43A 2JT4A 1YJWT 1N27A 1WHGA 4QQ6A 2K57A 1Y96A 1FMVA 2DL3A 1VQ5Q 1GCQA 2DLPA 2K5FA 3CMEQ 2X4WA 3CCST 4M75E 3CQTA 4A4HA 2CH4W 4X1VA 4AFQC 5GANd 3OW2P 1UGRB 2EGAA 1T3SA 4JJNK 3INZA 5KYXA 5HKCA 2H8HA 3SDZA 4E7KA 3CC2Q 1U1TA 1O9SA 3TU4K 3JCMf 3OMGA 2PU9B 2HSPA 4IKFA 3ZL7C 3E9GA 1AZGB 1M3BA 3QIIA 1QCFA 4EMKC 1KC8U 1C1AA 1K73C 2ZPBB 2M0OA 2J6KA 1VYTA 2QDLA 1VQ6Q 2MPXC 2K5LA 3CD6Q 1VQ7A 5GMKl 1IO6A 3HPWA 4M7AC 4HCCA 2EYWA 3EG1A 2QTXA 4QVCA 3HL8A 4Y91A 3RMSA 2LCLA 2XIDA 1K9MR 2PVGB 5I2MA 1U3OA 2QA4Q 1I1JA 3BDLA 1YJWQ 2XDBA 4AFSC 3OYCA 1EX4A 3RDVA 4GBQA 4RKUE 2KMTA 1PD0A 3M53A 1U06A 3N5BB 4OMMA 1VQ7T 1JB0E 1BYMA 1D1CA 4FSXA 2V8IA 3RR6A 3OYLA 1G8XA 1W1FA 5D6WA 1O75A 1KJWA 2E12A 4F7UB 2XG8D 2SRCA 2MK5A 1PHTA 3A8GB 1N9SA 1M8MA 2EQIA 2AHJB 1YNZA 4HKEA 3LGFA 3RKWA 1AHJB 3LW5E 3A98A 2XU8A 3JCMP 4LDUA 2EW3A 4EIKA 1R8OB 4RCBA 1PSFA 3OS1A 1KD1R 1K8AC 4ZTFA 2ZPIB 1W2BS 5DY9A 5KE2A 2EJ9A 4HT9A 4BACA 2MIOA 4LDVA 2RI3A 5A0GA 4HT8A 1VQNQ 1QVGA 3JCMe 1WJQA 1OX8A 1PKTA 5D7UA 2Y4XA 2RPNA 3JCMc 4E7SA 4Z89A 4IUQA 2IPOB 2X4JA 2HKQB 3OYYA 4FIBA 3BW1A 4MDXA 5FRNA 1VQ7Q 1BI0A 1M2VB 3OS5A 3EG2A 4AT1B 1U8RA 1N5ZA 4ZGJB 2HBWA 2MF2A 4IIOA 3MEVA 1TH7A 5GJWB 2GCXA 5GAN8 2YRDA 2PQWA 5KYYB 2HQEA 4KUDK 2E3HA 2DL8A 3A8OB 2DO3A 4ZN3A 1D0ZA 3CCVT 2RHIA 2GTOA 2LCSA 4F7UA 1R0CB 2VVKA 3NTHA 1XJWB 5EC7A 1JQQA 3A8MB 5LJ3g 4GLKA 3H0HA 1WJSA 4FYYB 3SD4A 4E7LA 2X35A 1LVKA 1UDLA 6AT1B 3L2VA 1VQ8Q 1YJ9A 4M78D 1WHMA 4BI4A 3RUXA 3JAME 3HP9A 2F2VA 2COWA 3CBOA 8ATCB 2EPDA 1EFNA 2NWMA 5CCAA 1WZOA 4OB2B 4M7DC 1XOVA 1YJ9T 2L5QA 2B8AA 2XK0A 4XTWA 3MKDA 1WHHA 3UA7A 3EG9B 5CIUA 4M78F 2A37A 4M75D 2RD1A 3OYAA 1MHNA 1Q82U 1V76A 4OGEA 2A08A 4FL6A 4PLIA 1H641 4N0AC 1OI1A 2KRMA 3G6EA 1M2VA 2KSSA 2OAWA 1I5OB 2ED0A 4F14A 3CCVQ 5J39A 4M75F 1D3BB 3AHUA 1WYXA 1M27C 2VKNA 5LJ3d 1NJIU 1JXMA 4C92G 1W2BP 4OMLA 1R0BG 3G6ET 5KYYA 1AVZC 3RNJA 4C0ZA 3OYHA 1KQ2A 2DAQA 1PKSA 1K0XA 2K3YA 2RI5A 2FRWA 3P8HA 5IXBA 1WGSA 4LDYA 3CC7A 1SRLA 1PCXA 2EQJA 2DVJA 3LH5A 1YIJA 3KXTA 3A8HB 2KNBB 4LDWA 4II1A 2EYQA 2LT1A 3E2UA 2FB7A 3L1AA 3VUBA 1PRLC 3CC7T 2VGMA 2O9VA 2NYSA 5GAN3 2DL4A 3G1JA 1YIJT 1Y57A 3ER0A 1HJDA 3VS6A 4M7AE 2QEXQ 1SSHA 3QDRB 1OU9A 1M9SA 1X69A 3EG9A 1QWFA 5GAMj 1VQLA 4UC4A 5GMKi 3G71Q 1AWOA 4BD3A 2NUPB 2AKKA 4OB0B 1GCPA 1ACMB 4QQGA 4J9DA 5IHKA 3NGPA 1OQKA 4M78C 1VQ4A 1KC8R 4FT4A 3REBB 1VQLT 2JUFA 2EGCA 3THKA 2EWNA 1VQ9Q 3J80E 5IHNA 1D3BA 1MMGA 4NS5A 1WLPB 4XTYA 2F2WA 4N4GA 1E6HA 4FSSA 1VQ4T 2XKOC 2OTJQ 4J83A 3OYEA 1ZSGA 2NUZA 3QPHA 4O5VA 3J81E 1PD1A 4C5HA 2RI2A 4BE2A 1IXDA 3ME9A 3R6NA 5LJ5j 2ZPHB 3FJPA 3JB9I 4DBHA 4PLLA 3META 1WXUA 2R5MA 3EHRA 2RJDA 1I07A 1FWZA 2JXBA 4Z02A 1OOTA 2LQNA 1WQ7A 1YIJQ 1Q81C 3HSBA 5FU7C 2EFIA 4E47A 1Q86R 3SB2A 2K6DA 4XU2A 3CC4A 2DFUA 2LQWA 2HSEB 3RMQA 4DBFA 3CBPA 3MEAA 1FMKA 2CDTA 2LC4A 1VUBA 4JS5A 2KBTA 3U23A 3VS2A 2X51A 2NUTB 1JBMA 4HCKA 4EDUA 4KRTA 2ZPEB 4JJCA 2K9GA 4ELZC 4MZTA 3CC4T 1J3TA 4BE1A 2KE9A 1VQLQ 1M90U 3GNFB 2NUPA 2VASA 3JCMV 4MZPA 1Q7YC 2CP2A 1Q95G 5GAMg 2DIGA 3DB4A 2KAFA 2RHUA 2KY9A 1X01A 2FZGB 3QWXX 2HCKA 3M0TA 1KQSA 1EIFA 3QHSA 2ECZA 3V7CA 5GAN6 2KROA 3X26B 1W6XA 1F1BB 1GBRA 2AZSA 3CPFA 1AWWA 4JJDA 2DJZA 4A4KA 1M1FA 3IQLA 4HVUA 4PFZA 1SHGA 3O5ZA 2JW4A 1RABB 4M78B 2RK1A 3OYGA 4J6XA 2DL5A 3I55A 2E3IA 2CREA 2K2MA 3RBBB 1IGQA 4VUBA 3JB9D 5LJ5g 4M7DE 1UJYA 1N9RA 4RMOA 2DIQA 3NFCA 2DF6A 1Z9ZA 4KGVB 2LZ6B 4DOWA 4M75B 3I55T 3CCUQ 2B86A 5FWCA 4ZTJA 2W10A 4C0DB 2AKLA 1YP5A 1WQWA 3M59A 2CT3A 2DXBA 2QDYB 3M0QA 5GAMd 1V29B 3JB9F 2NUTA 1OZ3A 3C95A 5FROA 2XICA 2MOXA 3JB9H 5L8RE 4N4HA 2A7YA 4J9IA 5DLOA 1SPKA 4Z88A 4CC4B 1OX9A 3PE0A 1PWTA 3QYGB 1TWBA 5FLXE 1K4US 3BDUA 2DRMA 4BDZA 1QVGS 4Y28E 5FW9A 3V8JA 4PNOA 3CPWS 5KYWB 4Z8AA 4OP0A 1MGQA 4M7AD 2CS7A 4FU6A 2E65A 1GFDA 5LJ5d 4JRKA 3RERA 3QJYA 2DPPB 4M78A 3L42A 1OEBA 3QXEB 4HCZA 2ZPFB 1NJIR 1IZ6A 5CQYA 5I21A 2L89A 4M7AF 3HKSA 2V1QA 1SF9A 1I81A 3VYHB 2O9SA 2O01E 2RB6A 4L6V5 1VQOA 4M75A 4RTXA 2V26A 4IURA 1VQPA 1YJNT 1NG2A 2GGRA 4IUVA 2GF7A 3UT1A 3X28B 3OMCA 4OVAA 2AIRB 2C0OA 3OY9A 4AG2C 1OPLA 2BIVA 2LRQA 1WHJA 4J7IA 1UB4A 4M78E 2QXFA 1A0NB 2VC8A 1QVPA 4RTVA 2D8HA 4M77C 3VUZA 2J05A 4ZGEB 1CKAA 2QQAA
chains in the Genus database with same CATH topology
2CH4A 1G83A 2JM9A 3VS3A 1FYNA 1JXOA 2JMCA 2KT1A 3EG2A 2L3QA 5I22A 5L23A 1N5ZA 3VS1A 4LN2A 2YUPA 2HBWA 1SEMA 4IIOA 2DYBA 2RQWA 3H41A 3REAB 3H0FA 5GJWB 2FPEA 3PVQA 3M0PA 3I5RA 3NHNA 4RTZA 1AOJA 1UGVA 2RQRA 4ESRA 1B3QA 2DL8A 2PTKA 1UHFA 2C0IA 2A28A 2KXCA 1TG0A 4LE9A 2GTOA 1W70A 2LCSA 2FG0A 3VS0A 2KGTA 2VVKA 2X3XD 2KYBA 5EC7A 1JQQA 1NEGA 1ABOA 2J6FA 2LNHB 1AWXA 3H0HA 2IIMA 2CT4A 5HCKA 4GLMA 1K76A 1UDLA 1NLPC 2EGEA 1WI7A 2KEAA 3EGUA 1NEBA 1M30A 2DMOA 1M3AA 1JU5C 1KIKA 2F2VA 3UA6A 1RLQC 4LUEA 2EPDA 2VWFA 1EFNA 2GNCA 2NWMA 2KRSA 1XOVA 1ZBJA 4CC7A 1G2BA 1WX6A 1GRIA 2CSIA 2DILA 4J9HA 3VS7A 4JPBW 2V1RA 3UA7A 1KSWA 1QKWA 2A37A 1WIEA 1CSKA 2A08A 2D0NA 2PNIA 1MV3A 1NM7A 1QKXA 1VYVA 1ZLMA 2YUNA 2KRMA 4RTWA 3C0CA 3VRZA 4CC2A 2LMJA 4D8KA 1X2QA 2OAWA 1UTIA 2M0YA 1OPKA 2ED0A 4F14A 2D1XA 3UF4A 1AWJA 2ED1A 1YWPA 1WYXA 1QWEA 1M27C 2VKNA 1JXMA 3TSWA 4OMLA 2BZYA 2OI3A 1AVZC 4LUDA 3RNJA 2FRYA 4CC3A 2K7AA 4K11A 4HVVA 3EG3A 4D8DA 2DA9A 2LJ0A 1PKSA 1YCSB 1K0XA 3TVTA 2FRWA 5IXBA 2J6OA 1BB9A 1SRLA 3VS5A 1UE9A 4QT7A 2DVJA 3LH5A 1B07A 1U5SA 1HD3A 1RUWA 2MCNA 2KNBB 3FJ5A 1BK2A 1JO8A 2JMAA 3SHWA 2RNAA 1V1CA 2L2PA 2BZXA 5IHIA 2YSQA 2A36A 3M0SA 4OMPA 3PVLA 1PRLC 4AFZC 3ULRB 2GTJA 1H8KA 1RLPC 2O9VA 1GFCA 2HDAA 2DL4A 2RF0A 2JS2A 1Y57A 3M0RA 1WXTA 1HJDA 3H0IA 4HXJA 1VYUA 3VS6A 1SSHA 1MV0B 1X69A 1QWFA 2LP5A 3EHQA 1CKBA 2FPDA 1AWOA 2GBQA 3I35A 2SEMA 2AKKA 1GCPA 1NYGA 2L3PA 4J9DA 2E5KA 5IHKA 3NGPA 4RUGA 1NYFA 2RQTA 4F16A 2C0TA 1T0JA 5IH2A 3REBB 1UG1A 3UATA 3VRYA 3NPFA 2EGCA 1YN8A 3THKA 2RN8A 1WFWA 5IHNA 1GL5A 2DM1A 2ROLA 1WLPB 2DBKA 1BBZA 4ORZA 3TSZA 3QWYA 2F2WA 2DRKA 1AD5A 1E6HA 4FSSA 2D8JA 5IXFA 1PNJA 1UUEA 2W0ZA 1X6BA 4J9BA 1TUDA 1ZSGA 2EYXA 2NUZA 3R6NA 2XMFA 2G6FX 4RTTA 4Y92A 1WXUA 3EHRA 2KRNA 2PZ1A 1I07A 3GBQA 4LNPA 2JXBA 5GJVB 1T3LA 2DJQA 1OOTA 4E6RA 4J9GA 2LQNA 1MUZA 1BU1A 4JZ4A 2AZVA 1LCKA 2K6DA 2DE0X 2CUBA 2LQWA 1UJ0A 2KT8A 1FMKA 2CDTA 1AEYA 1NLOC 2EYZA 1ZUKA 2OJ2A 4JJBA 4A63B 2CUDA 4M4ZA 2KBTA 2EYYA 3U23A 3VS2A 2GQIA 2J06A 4IIMA 4HCKA 1Z9QA 4KRTA 5ECAA 4J9EA 4JJCA 1K9AA 2K9GA 1JEGA 2LJ3A 4ZNXA 1J3TA 2J7IA 1X2KA 2BTTA 2KE9A 1H3HA 1TUCA 2LX7A 4WCIA 2JS0A 3I9QA 1S1NA 2EBPA 2YDLA 1H92A 1WA7A 4J9CA 1PRMC 4DEXA 2M51A 2RQVA 1UECA 1ZX6A 2FEIA 2I0NA 1ZUUA 1M3CA 4JZ3A 4OMOA 3QWXX 1UHCA 2HCKA 3M0TA 1ABQA 1X27A 2ABLA 2P4RA 1SRMA 1UFFA 4AG1C 2ECZA 5I11A 2F2XA 2ESWA 1T0HA 2RMOA 2KROA 1W6XA 1GBRA 2ROTA 2AZSA 1AWWA 2FPFA 1RI9A 3NMZC 4JJDA 2JTEA 1X43A 2YT6A 2JT4A 3IQLA 4HVUA 1SHGA 3O5ZA 2JW4A 2DL7A 2DL5A 4R0KA 4F17A 2O2OA 2BZ8A 2DL3A 3I5SA 1GCQA 2CREA 2K79A 2DLPA 2K2MA 3SEMA 3RBBB 3CQTA 2CH4W 4X1VA 4AFQC 2LJ1A 1UJYA 2EGAA 1T3SA 2FO0A 5FWBA 2L0AA 1QLYA 2DF6A 1Z9ZA 2H8HA 2HEQA 2LZ6B 4DEYA 2JM8A 2B86A 5FWCA 2W10A 2AKLA 1YP5A 2HSPA 2CT3A 3ZL7C 1ZUYA 3M0QA 2L3SA 1AZEA 4OMNA 2KYMA 1AZGB 2ENMA 1M3BA 1E7OA 1QCFA 2MOXA 1WXBA 1K0SA 1SHFA 2J6KA 1VYTA 4J9IA 1SPKA 2QDLA 4Z88A 4CC4B 3PE0A 1PWTA 2DX1A 1IO6A 1K4US 2DRMA 2EYWA 3EG1A 1VA7A 5FW9A 1U3OA 4Z8AA 1I1JA 1WDXA 2O31A 2K3BA 4AFSC 1X6GA 4GBQA 1U06A 4OMMA 1KFZA 1GFDA 1Y0MA 4RTUA 1E6GA 1OEBA 1W1FA 4RTYA 1ARKA 1KJWA 2YUOA 2RQUA 2DNUA 2DBMA 2EKHA 2EVRA 4HVWA 2SRCA 2KXDA 1PHTA 4J9FA 3EG0A 2EQIA 1M8MA 1GBQA 1YNZA 1GCQC 2V1QA 3A98A 2O9SA 2X3WD 2EW3A 4EIKA 4RTXA 3KFVA 4AFUC 2CSQA 1NG2A 1YWOA 2KR3A 2GGRA 3VS4A 1K1ZA 2MIOA 2C0OA 1HSQA 4AG2C 1OV3A 1OPLA 2YUQA 1A0NB 4OMQA 2O88A 1PKTA 2AK5A 2RPNA 4RTVA 2D8HA 3M0UA 4Z89A 2J05A 3JV3A 1I0CA 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH4 A;  1G83 A;  2JM9 A;  3VS3 A;  1FYN A;  1JXO A;  2JMC A;  2KT1 A;  3EG2 A;  2L3Q A;  5I22 A;  5L23 A;  1N5Z A;  3VS1 A;  4LN2 A;  2YUP A;  2HBW A;  1SEM A;  4IIO A;  2DYB A;  2RQW A;  3H41 A;  3REA B;  3H0F A;  5GJW B;  2FPE A;  3PVQ A;  3M0P A;  3I5R A;  3NHN A;  4RTZ A;  1AOJ A;  1UGV A;  2RQR A;  4ESR A;  1B3Q A;  2DL8 A;  2PTK A;  1UHF A;  2C0I A;  2A28 A;  2KXC A;  1TG0 A;  4LE9 A;  2GTO A;  1W70 A;  2LCS A;  2FG0 A;  3VS0 A;  2KGT A;  2VVK A;  2X3X D;  2KYB A;  5EC7 A;  1JQQ A;  1NEG A;  1ABO A;  2J6F A;  2LNH B;  1AWX A;  3H0H A;  2IIM A;  2CT4 A;  5HCK A;  4GLM A;  1K76 A;  1UDL A;  1NLP C;  2EGE A;  1WI7 A;  2KEA A;  3EGU A;  1NEB A;  1M30 A;  2DMO A;  1M3A A;  1JU5 C;  1KIK A;  2F2V A;  3UA6 A;  1RLQ C;  4LUE A;  2EPD A;  2VWF A;  1EFN A;  2GNC A;  2NWM A;  2KRS A;  1XOV A;  1ZBJ A;  4CC7 A;  1G2B A;  1WX6 A;  1GRI A;  2CSI A;  2DIL A;  4J9H A;  3VS7 A;  4JPB W;  2V1R A;  3UA7 A;  1KSW A;  1QKW A;  2A37 A;  1WIE A;  1CSK A;  2A08 A;  2D0N A;  2PNI A;  1MV3 A;  1NM7 A;  1QKX A;  1VYV A;  1ZLM A;  2YUN A;  2KRM A;  4RTW A;  3C0C A;  3VRZ A;  4CC2 A;  2LMJ A;  4D8K A;  1X2Q A;  2OAW A;  1UTI A;  2M0Y A;  1OPK A;  2ED0 A;  4F14 A;  2D1X A;  3UF4 A;  1AWJ A;  2ED1 A;  1YWP A;  1WYX A;  1QWE A;  1M27 C;  2VKN A;  1JXM A;  3TSW A;  4OML A;  2BZY A;  2OI3 A;  1AVZ C;  4LUD A;  3RNJ A;  2FRY A;  4CC3 A;  2K7A A;  4K11 A;  4HVV A;  3EG3 A;  4D8D A;  2DA9 A;  2LJ0 A;  1PKS A;  1YCS B;  1K0X A;  3TVT A;  2FRW A;  5IXB A;  2J6O A;  1BB9 A;  1SRL A;  3VS5 A;  1UE9 A;  4QT7 A;  2DVJ A;  3LH5 A;  1B07 A;  1U5S A;  1HD3 A;  1RUW A;  2MCN A;  2KNB B;  3FJ5 A;  1BK2 A;  1JO8 A;  2JMA A;  3SHW A;  2RNA A;  1V1C A;  2L2P A;  2BZX A;  5IHI A;  2YSQ A;  2A36 A;  3M0S A;  4OMP A;  3PVL A;  1PRL C;  4AFZ C;  3ULR B;  2GTJ A;  1H8K A;  1RLP C;  2O9V A;  1GFC A;  2HDA A;  2DL4 A;  2RF0 A;  2JS2 A;  1Y57 A;  3M0R A;  1WXT A;  1HJD A;  3H0I A;  4HXJ A;  1VYU A;  3VS6 A;  1SSH A;  1MV0 B;  1X69 A;  1QWF A;  2LP5 A;  3EHQ A;  1CKB A;  2FPD A;  1AWO A;  2GBQ A;  3I35 A;  2SEM A;  2AKK A;  1GCP A;  1NYG A;  2L3P A;  4J9D A;  2E5K A;  5IHK A;  3NGP A;  4RUG A;  1NYF A;  2RQT A;  4F16 A;  2C0T A;  1T0J A;  5IH2 A;  3REB B;  1UG1 A;  3UAT A;  3VRY A;  3NPF A;  2EGC A;  1YN8 A;  3THK A;  2RN8 A;  1WFW A;  5IHN A;  1GL5 A;  2DM1 A;  2ROL A;  1WLP B;  2DBK A;  1BBZ A;  4ORZ A;  3TSZ A;  3QWY A;  2F2W A;  2DRK A;  1AD5 A;  1E6H A;  4FSS A;  2D8J A;  5IXF A;  1PNJ A;  1UUE A;  2W0Z A;  1X6B A;  4J9B A;  1TUD A;  1ZSG A;  2EYX A;  2NUZ A;  3R6N A;  2XMF A;  2G6F X;  4RTT A;  4Y92 A;  1WXU A;  3EHR A;  2KRN A;  2PZ1 A;  1I07 A;  3GBQ A;  4LNP A;  2JXB A;  5GJV B;  1T3L A;  2DJQ A;  1OOT A;  4E6R A;  4J9G A;  2LQN A;  1MUZ A;  1BU1 A;  4JZ4 A;  2AZV A;  1LCK A;  2K6D A;  2DE0 X;  2CUB A;  2LQW A;  1UJ0 A;  2KT8 A;  1FMK A;  2CDT A;  1AEY A;  1NLO C;  2EYZ A;  1ZUK A;  2OJ2 A;  4JJB A;  4A63 B;  2CUD A;  4M4Z A;  2KBT A;  2EYY A;  3U23 A;  3VS2 A;  2GQI A;  2J06 A;  4IIM A;  4HCK A;  1Z9Q A;  4KRT A;  5ECA A;  4J9E A;  4JJC A;  1K9A A;  2K9G A;  1JEG A;  2LJ3 A;  4ZNX A;  1J3T A;  2J7I A;  1X2K A;  2BTT A;  2KE9 A;  1H3H A;  1TUC A;  2LX7 A;  4WCI A;  2JS0 A;  3I9Q A;  1S1N A;  2EBP A;  2YDL A;  1H92 A;  1WA7 A;  4J9C A;  1PRM C;  4DEX A;  2M51 A;  2RQV A;  1UEC A;  1ZX6 A;  2FEI A;  2I0N A;  1ZUU A;  1M3C A;  4JZ3 A;  4OMO A;  3QWX X;  1UHC A;  2HCK A;  3M0T A;  1ABQ A;  1X27 A;  2ABL A;  2P4R A;  1SRM A;  1UFF A;  4AG1 C;  2ECZ A;  5I11 A;  2F2X A;  2ESW A;  1T0H A;  2RMO A;  2KRO A;  1W6X A;  1GBR A;  2ROT A;  2AZS A;  1AWW A;  2FPF A;  1RI9 A;  3NMZ C;  4JJD A;  2JTE A;  1X43 A;  2YT6 A;  2JT4 A;  3IQL A;  4HVU A;  1SHG A;  3O5Z A;  2JW4 A;  2DL7 A;  2DL5 A;  4R0K A;  4F17 A;  2O2O A;  2BZ8 A;  2DL3 A;  3I5S A;  1GCQ A;  2CRE A;  2K79 A;  2DLP A;  2K2M A;  3SEM A;  3RBB B;  3CQT A;  2CH4 W;  4X1V A;  4AFQ C;  2LJ1 A;  1UJY A;  2EGA A;  1T3S A;  2FO0 A;  5FWB A;  2L0A A;  1QLY A;  2DF6 A;  1Z9Z A;  2H8H A;  2HEQ A;  2LZ6 B;  4DEY A;  2JM8 A;  2B86 A;  5FWC A;  2W10 A;  2AKL A;  1YP5 A;  2HSP A;  2CT3 A;  3ZL7 C;  1ZUY A;  3M0Q A;  2L3S A;  1AZE A;  4OMN A;  2KYM A;  1AZG B;  2ENM A;  1M3B A;  1E7O A;  1QCF A;  2MOX A;  1WXB A;  1K0S A;  1SHF A;  2J6K A;  1VYT A;  4J9I A;  1SPK A;  2QDL A;  4Z88 A;  4CC4 B;  3PE0 A;  1PWT A;  2DX1 A;  1IO6 A;  1K4U S;  2DRM A;  2EYW A;  3EG1 A;  1VA7 A;  5FW9 A;  1U3O A;  4Z8A A;  1I1J A;  1WDX A;  2O31 A;  2K3B A;  4AFS C;  1X6G A;  4GBQ A;  1U06 A;  4OMM A;  1KFZ A;  1GFD A;  1Y0M A;  4RTU A;  1E6G A;  1OEB A;  1W1F A;  4RTY A;  1ARK A;  1KJW A;  2YUO A;  2RQU A;  2DNU A;  2DBM A;  2EKH A;  2EVR A;  4HVW A;  2SRC A;  2KXD A;  1PHT A;  4J9F A;  3EG0 A;  2EQI A;  1M8M A;  1GBQ A;  1YNZ A;  1GCQ C;  2V1Q A;  3A98 A;  2O9S A;  2X3W D;  2EW3 A;  4EIK A;  4RTX A;  3KFV A;  4AFU C;  2CSQ A;  1NG2 A;  1YWO A;  2KR3 A;  2GGR A;  3VS4 A;  1K1Z A;  2MIO A;  2C0O A;  1HSQ A;  4AG2 C;  1OV3 A;  1OPL A;  2YUQ A;  1A0N B;  4OMQ A;  2O88 A;  1PKT A;  2AK5 A;  2RPN A;  4RTV A;  2D8H A;  3M0U A;  4Z89 A;  2J05 A;  3JV3 A;  1I0C A;  1CKA A; 
#chains in the Genus database with same CATH topology
 2JM9 A;  2QGF B;  2EAY A;  1AT1 B;  3M54 A;  3BFM A;  1FYN A;  5D6X A;  3PIP A;  3JB9 G;  4DBQ A;  5I22 A;  1YHQ A;  1N8R U;  5KYW A;  1M1K U;  2YUP A;  1I5L A;  1SEM A;  3H41 A;  1D1B A;  2P0P A;  2MYS A;  3M0P A;  1AOJ A;  2RQR A;  4ESR A;  3HFO A;  1UHF A;  2CYZ B;  2JNG A;  1YHQ T;  2A28 A;  2KXC A;  2QQB A;  2OTL A;  3RKX A;  1W70 A;  4EMH A;  3QDF A;  2FG0 A;  4A4F A;  2X3X D;  2RHZ A;  1RAF B;  1YJN Q;  3M5A A;  2P84 A;  5FU6 B;  1QCO A;  3MP8 A;  1AWX A;  4JS4 A;  5LJ3 h;  4A54 A;  2IIM A;  2CT4 A;  2BE9 B;  4BUG A;  5GAO l;  1B7T A;  2QG9 B;  2EGE A;  3EGU A;  4NOY A;  5GMK h;  2HNI A;  3TCJ A;  1M30 A;  4KH0 B;  4DA4 A;  1QVG P;  1M3A A;  1JU5 C;  3CPW P;  3GP8 A;  3UA6 A;  4LUE A;  2K2V A;  4M7A G;  1QMC A;  4PJL A;  3CCM A;  4PK4 A;  3D7S B;  1G2B A;  3PFS A;  2YLB A;  2DIL A;  1C6V X;  3CMA A;  3LX7 A;  3CCS Q;  4M7D D;  1ZA2 B;  3BY7 A;  2KVQ G;  5A0D A;  2WSC E;  1JRI A;  2D6F A;  4QQD A;  2PNI A;  3NTI A;  1MV3 A;  1Q86 U;  4E7H A;  2YUN A;  4J6W A;  5CKB A;  3C94 A;  2RH2 A;  1M90 R;  3DKM A;  1X2Q A;  1UTI A;  4C0G A;  3ZBD A;  3WVD B;  4XAX B;  5KYN A;  2D1X A;  3E9F A;  3UF4 A;  1AWJ A;  2DD5 A;  3L2W A;  5C0M A;  4M7D F;  1YWP A;  4IUU A;  2HL3 A;  1VQK A;  3TSW A;  1JJ2 A;  2OI3 A;  3QKJ A;  4XTU A;  4HVV A;  2DTH A;  5GAN f;  2P0Q A;  4D8D A;  2YWW A;  3CXC S;  2LJ0 A;  3CPW A;  3UWN A;  4ELY C;  1OUL A;  3GF5 A;  2CZ0 B;  3TVT A;  1IGU A;  2WAC A;  4PJN A;  1SSF A;  1BIB A;  2RJE A;  1B07 A;  4JDS A;  1K9M C;  1HD3 A;  3MP6 A;  4ATO A;  3OS2 A;  4B9W A;  1JO8 A;  4MDW A;  1KQ1 A;  2RNA A;  1QVF A;  2YSQ A;  3ZEH A;  2DYI A;  1W4S A;  4AFZ C;  2QI2 A;  2CGH A;  4HCB A;  1MMA A;  4EMK B;  5I2S A;  3H0I A;  3Q1J A;  3CCL A;  1MV0 B;  2X4X A;  1KG1 A;  4OB1 B;  3PTA A;  3KBG A;  3RKY A;  2FPD A;  3PIO A;  3MCA B;  2DVE A;  2SEM A;  4M7A B;  1U1S A;  2E5K A;  5CKE A;  4RUG A;  1NYF A;  4NL3 A;  2PVO B;  2D0Q B;  4NL2 A;  1T0J A;  1UG1 A;  1XTD A;  1RAA B;  3UAT A;  1KD1 C;  3NPF A;  3S3M A;  4PJO D;  3FIF A;  1WFW A;  1GL5 A;  2DM1 A;  2F5T X;  2K4Y A;  3QWY A;  2CZ6 B;  1FMW A;  1Y7X A;  1PNJ A;  2W0Z A;  3MJX A;  3CCR A;  3LYI A;  4J9B A;  4IUP A;  4WF2 A;  1QP2 A;  2EYX A;  2XMF A;  3QZ9 B;  2FHD A;  4PJO F;  4FCY A;  1KQS S;  5GAN e;  4JLI A;  4M7D G;  4BY6 C;  2AT1 B;  2KRN A;  2HKN A;  3JCM J;  3CEY A;  2EQK A;  4LNP A;  3CCR T;  2QAS A;  4E6R A;  2LCC A;  3TEE A;  5D6Y A;  2QQR A;  3TQ7 P;  1UJ0 A;  4M77 E;  2KT8 A;  1AEY A;  1NLO C;  2E6N A;  1YCY A;  4EMK A;  1ZSZ C;  4X9C A;  4BE0 A;  2HL5 C;  4ZN1 A;  2QQS A;  4IIM A;  2ZPG B;  5DLQ E;  2LJ3 A;  4ZNX A;  5AYF A;  1X2K A;  1TUC A;  3ASK A;  2LX7 A;  2JS0 A;  3E19 A;  1VIF A;  4M7A A;  3CXC P;  2MWP A;  2GQV A;  3QJ6 A;  2IG0 A;  2RA2 A;  3JCM Q;  3MEU A;  4J9C A;  2LT4 A;  2PUO B;  2M51 A;  2RQV A;  7AT1 B;  3LGL A;  2FZC B;  5GAM h;  3PMT A;  4OMO A;  4KGX B;  1TSF A;  4KH1 B;  1MMD A;  2E70 A;  1YJ9 Q;  5I11 A;  3KUF A;  2F2X A;  1RAI B;  1T0H A;  2RMO A;  3L2Z A;  2R5A A;  1VIE A;  2ROT A;  1K73 U;  5CR2 A;  1N8R R;  1BI1 A;  1M1K R;  1BCO A;  3QO3 A;  5GAN 7;  4R0K A;  1TU0 B;  2WSF E;  3I5S A;  3OBY A;  4C8Q C;  2C06 A;  2K79 A;  3OSS C;  5CQX A;  4B6M A;  3SEM A;  2L3R A;  2LJ1 A;  5HY6 A;  2H3J A;  5LJ5 h;  4PJO C;  5FWB A;  2HEQ A;  3G6E Q;  4DEY A;  3DLL A;  2JM8 A;  4KUI A;  4M7D B;  3CXC A;  4M78 G;  2QAZ A;  1ZUY A;  2L3S A;  1AZE A;  2ZGW A;  1RI0 A;  4OMN A;  2KYM A;  4XTX A;  2ENM A;  4J7F A;  1WHL A;  4YTL A;  2VGN A;  1E7O A;  3SWN C;  1YIT A;  1VQM A;  1QCN A;  3V8L A;  3JCM W;  1KQS P;  4M75 G;  5LJ3 f;  1K8A U;  1BKB A;  1YIT T;  1ZSZ B;  3CC7 Q;  1VA7 A;  2FVU A;  1VQM T;  2LQ8 A;  2K3B A;  3PGG A;  3UPU A;  5GAN 2;  1X6G A;  2LTO A;  2EJG A;  4DQ2 A;  3HRT A;  1KFZ A;  5KYU B;  4MML A;  2GFU A;  2HZY A;  2ZAE A;  2R58 A;  3AT1 B;  1E6G A;  2JOY A;  2YUO A;  2RQU A;  1RL2 A;  3VV0 A;  2DBM A;  3G4S A;  5GAN h;  3MP1 A;  3EG0 A;  1PM3 A;  1GBQ A;  1KC8 C;  4O6J A;  4PKC C;  4P5N A;  1GCQ C;  4JUV A;  3FRN A;  3I56 A;  3HHT B;  3JCM X;  1D0Y A;  2VUB A;  2RHX A;  3FLG A;  3G4S T;  2X3W D;  3VU3 C;  1VQ4 Q;  4M7D A;  2CSQ A;  1B34 B;  1K1Z A;  2DET A;  1OU8 A;  1OV3 A;  4QKU A;  3I56 T;  3VJP A;  4JRI A;  4L59 A;  4N0A A;  5GAO m;  3JV3 A;  1VQM Q;  3SFM A;  2CH4 A;  1M5Q 1;  3VS3 A;  4LXC A;  4M77 D;  5IT9 E;  4KT0 E;  1Q86 C;  1ZSZ A;  5C6S A;  2VXF A;  3H8Z A;  5GAO p;  4GY5 A;  2A3L A;  5LJ3 e;  4LN2 A;  5GAN 5;  1LNX A;  2COY A;  3SWN B;  2HD0 A;  3JCM g;  5GMK e;  2DYB A;  4FT2 A;  2RQW A;  4PL6 A;  3REA B;  3H0F A;  3CC4 Q;  5KYU A;  3PVQ A;  2HAX A;  2DTI A;  2VV5 A;  1YFN A;  2LQK A;  3NHN A;  4RTZ A;  2EKO A;  2YRC A;  4X34 A;  2PTK A;  4M77 F;  2CKK A;  1RAH B;  2C0I A;  4B9X A;  3X24 B;  1ZHI A;  2G3R A;  4LE9 A;  3VS0 A;  1OYX A;  2KGT A;  2KYB A;  2M1H A;  2J6F A;  3MHX A;  4JLG A;  5FU7 B;  1JJ2 S;  1DJ7 B;  2Z0W A;  4GLM A;  2HMA A;  5DM7 R;  9ATC B;  2DZ9 A;  4OB3 B;  1C0M A;  5KH6 A;  3O8V A;  4FW1 A;  1X6O A;  1B34 A;  1FX7 A;  4XU1 A;  2VWF A;  1KHC A;  1N6A A;  1M4Z A;  2KRS A;  1ZBJ A;  4CC7 A;  1GRI A;  1NBE B;  2CSI A;  4J9H A;  3VS7 A;  1BIA A;  1VQ5 A;  4JPB W;  1KSW A;  3CME A;  1QVF S;  4PJO A;  1WIE A;  3JCM d;  2FYK A;  4QW2 A;  2JJ9 A;  3EFR A;  1NM7 A;  1ZLM A;  2CP7 A;  3C4S A;  4RTW A;  3I55 Q;  3CCQ A;  1VQ5 T;  3VRZ A;  3RES A;  2JTM A;  2LMJ A;  4D8K A;  3L2Q A;  3CC2 A;  2M9U A;  3HFN A;  2EQM A;  3CME T;  2M0Y A;  3SWN A;  2E41 A;  2ED1 A;  4C8Q E;  4XU3 A;  1G3Y A;  2KI7 A;  3CCQ T;  2BZY A;  1P92 A;  4Q5W A;  4LUD A;  2QQ9 A;  2F69 A;  2K7A A;  4K11 A;  4C5I A;  1VQ6 A;  2DA9 A;  4PJO E;  5GAN 4;  1BCM A;  2RHY A;  4X9D A;  3CD6 A;  3MPU B;  1VQO T;  1K73 R;  4AMC A;  1PG5 B;  4ME7 A;  1VQP T;  5CAI A;  4D6W A;  3VS5 A;  1UE9 A;  2KQW A;  3OSV A;  2QA4 A;  2ATC B;  1D1A A;  3OQ5 A;  1VQ6 T;  5AT1 B;  5GAM f;  3T9N A;  1Q82 C;  4M77 G;  2MCN A;  2V8K A;  1BK2 A;  3SHW A;  2JMA A;  3HRU A;  1ZBX A;  5J3B A;  5IHI A;  3CD6 T;  2MMP A;  1SKU B;  2YLC A;  2A36 A;  2XHC A;  1TTH B;  1H8K A;  1RLP C;  4C5E A;  3OYB A;  2DEQ A;  2QA4 T;  3NTK A;  4EMG A;  2RF0 A;  2JS2 A;  3F70 A;  2I2L A;  4KBM B;  4XQ3 A;  3OYJ A;  4RG2 A;  3E1S A;  1NJI C;  1G3S A;  2LP5 A;  1CKB A;  4LDX A;  1Q81 U;  3CCJ A;  2L3P A;  2JTF A;  3P8B B;  2QK0 A;  3V7R A;  5A0L A;  4F16 A;  3CCQ Q;  3M4Y A;  4J5Y A;  2VYT A;  2IVW A;  5LJ5 f;  1JJ2 P;  1RAD B;  3VRY A;  4RCC A;  4IUT A;  2F5K A;  1YN8 A;  2RN8 A;  4A4E A;  3CCJ T;  2OTL T;  1VQN A;  1WNL A;  1K8A R;  1BBZ A;  1VQO Q;  3OYI A;  3R6O A;  1AD5 A;  1VQP Q;  2D8J A;  5IXF A;  3OB9 A;  1UUE A;  2QGG A;  1OZ2 A;  4BI3 A;  1TUD A;  3G7Z A;  2DTO A;  1LJO A;  1Q7Y U;  4KGZ B;  4E2F B;  2DXU A;  1RAE B;  1VQN T;  2G6F X;  3L2R A;  4RTT A;  4WTO B;  4V2S A;  3EGD B;  3M58 A;  4ZGD B;  2LNV A;  1QVF P;  2P4T A;  2V8J A;  1QW1 A;  5GJV B;  3C12 A;  3CCM T;  2D9T A;  2DK3 A;  1BU1 A;  3DLM A;  4TVR A;  3CMA T;  2CUB A;  3M57 A;  3LWI A;  4CI0 C;  5GAM e;  1LOJ A;  1QP3 A;  2RJC A;  1YHQ Q;  1NZ9 A;  3GLX A;  2EYZ A;  3OW2 A;  4JJB A;  5LJ3 j;  4A63 B;  4M4Z A;  4CRI A;  3V8K A;  2K3X A;  4M77 B;  2FZK B;  2GQI A;  2J06 A;  4J9E A;  5GMK j;  3S3O A;  1JEG A;  2YXY A;  4E7I A;  2EIF A;  1H3H A;  2JN0 A;  2FL7 A;  3I9Q A;  1S1N A;  2EBP A;  1VQ8 A;  3CCJ Q;  2OTL Q;  2XD0 A;  1H92 A;  1WA7 A;  3EFO B;  3URG A;  1VQK T;  5IAY A;  1UEC A;  2FEI A;  2I0N A;  1ZUU A;  3EH2 A;  4PJJ A;  4JZ3 A;  4C92 D;  3JCM b;  1X27 A;  2ABL A;  2P4R A;  2RM4 A;  2X9H A;  1UFF A;  4AG1 C;  5LJ5 e;  3GPL A;  1VQ8 T;  1TXQ A;  2A0F B;  5CK9 A;  1RI9 A;  2JTE A;  3OYD A;  2OX7 A;  4XTV A;  2YT6 A;  5GAO n;  3CCM Q;  2DL7 A;  4F17 A;  2O4X B;  1WJR A;  4C92 F;  2O2O A;  2BZ8 A;  3CMA Q;  3EGD A;  3A5Z B;  4MZM A;  5HK3 A;  3GIB A;  1M90 C;  3CCV A;  4C8Q D;  2FO0 A;  3V7S A;  2L0A A;  1QLY A;  3CCL T;  3M4G A;  3DB3 A;  2MAM A;  1IRE B;  5HK0 A;  2BKD N;  2QYZ A;  2CP5 A;  4E7J A;  2P0K A;  2OAU A;  4M77 A;  2BUD A;  1VQK Q;  1NPR A;  3OS0 A;  4C8Q F;  2DZC A;  3M55 A;  1R77 A;  1KK7 A;  1WXB A;  1K0S A;  1SHF A;  1PC0 A;  1D0X A;  2Y90 A;  4PFP A;  1HXD A;  3EFO A;  2DX1 A;  5M9O A;  2RK2 A;  1YI2 A;  1HK9 A;  1PSE A;  1IHW A;  3M56 A;  1IRX A;  5CKF A;  1WDX A;  2O31 A;  3L2U A;  2XI9 A;  4BI8 B;  1ZQ1 A;  2QEX A;  3CCE A;  4DBR A;  2DD4 A;  4F7U E;  3WXM B;  1YI2 T;  3G71 A;  1Y0M A;  1ZA1 B;  4RTU A;  4KUL A;  3GNG A;  3JB9 J;  2O4X A;  4RTY A;  1HYO A;  1WPY A;  2PUK B;  1ARK A;  4LD6 A;  2DNU A;  1Y07 A;  2EKH A;  2EVR A;  4HVW A;  3CCL Q;  3EAE A;  4JRQ A;  2QEX T;  4RG8 A;  3CCE T;  2KXD A;  2RO0 A;  4J9F A;  2NLU A;  1Y71 A;  3G71 T;  2XDD A;  1VQ9 A;  2HQH A;  4C92 C;  2ZCF B;  2F1L A;  2COZ A;  4JRP A;  1D09 B;  4DOV A;  3KFV A;  4AFU C;  1S72 A;  3S6W A;  1YWO A;  2OTJ A;  2KR3 A;  2YRV A;  4FYW B;  5CKH A;  4ANJ A;  3VS4 A;  1VQ9 T;  1HSQ A;  1TUG B;  1UGQ B;  2YUQ A;  3LH0 A;  3OBW A;  3QBY A;  2JZ2 A;  4OMQ A;  1M8V A;  2EQU A;  2O88 A;  2AK5 A;  2GFA A;  1S72 T;  3CCR Q;  3M0U A;  3FC3 A;  2OTJ T;  1I0C A;  2HBP A;  3J7A F;  1NPP A;  5A2Q E;  2DEU A;  1G83 A;  3FB9 A;  1TS9 A;  1JXO A;  2JMC A;  2KT1 A;  5GAO r;  3OA6 A;  2L3Q A;  5FRM A;  1YI2 Q;  1BI2 A;  2H3E B;  1Q81 R;  4C8Q G;  5L23 A;  2LDM A;  3VS1 A;  4BDY A;  2DKG A;  3RIR A;  3MEW A;  4N4I A;  4EPC A;  3JCM h;  3CCE Q;  2FPE A;  4A53 A;  3I5R A;  4PJO G;  5CO7 A;  2KDS A;  1UGV A;  4XU0 A;  1B3Q A;  3QSU A;  3PMI A;  3H6Z A;  1G5V A;  4BB7 A;  3WVE B;  1TG0 A;  4BY6 B;  2ZZD A;  1W2B A;  2E64 A;  5J26 A;  2CZ7 B;  1MND A;  1NEG A;  4OMF B;  1ABO A;  1VOM A;  2LNH B;  5EG2 A;  1Q7Y R;  2DER A;  5HCK A;  1K76 A;  3LWH A;  1NLP C;  3OYK A;  1WI7 A;  2KEA A;  1MMN A;  1NEB A;  3FEO A;  2DMO A;  3QG1 A;  4J6Y A;  1KIK A;  3EGX B;  1RLQ C;  2CP0 A;  1S72 Q;  4C5G A;  4OGC A;  2GNC A;  3OYF A;  4M75 C;  1N8R C;  1M1K C;  4FM4 B;  3X25 B;  4XTZ A;  4C0D C;  1WX6 A;  2V1R A;  3OYN A;  1TOV A;  2KK4 A;  1QKW A;  4C92 B;  3EFS A;  1K9M U;  1CSK A;  2DXT A;  4HA8 A;  1UGP B;  2D0N A;  1EZZ B;  1QKX A;  1VYV A;  4L5G A;  5KCO A;  2E6Z A;  3CCU A;  2E1H A;  3C0C A;  4CC2 A;  3EH1 A;  3CBM A;  4QVD A;  4XK8 E;  3QZ5 B;  1OPK A;  2JVV A;  2CZ1 B;  3M9Q A;  1QWE A;  2E10 A;  3S3N A;  5IN1 A;  4LD9 K;  2M02 A;  3CCU T;  4CC3 A;  2FRY A;  3EG3 A;  4C8Q B;  2E4H A;  2CP6 A;  3OYM A;  2PVD B;  3HRS A;  1YCS B;  1IHV A;  1YIT Q;  1WHK A;  1KD1 U;  5KE3 A;  2LVM A;  2J6O A;  4PJO B;  1BB9 A;  3PT9 A;  4QT7 A;  4QVZ A;  3JSC A;  4J8O A;  1U5S A;  2K5I A;  1RUW A;  3FJ5 A;  1UEB A;  1V1C A;  2L2P A;  2BZX A;  5GAN j;  2BE7 D;  3EGX A;  3M0S A;  1NE8 A;  4OMP A;  3PVL A;  4E7Z A;  3ULR B;  2GTJ A;  3BE3 A;  3VYG A;  1G3T A;  1GFC A;  2HDA A;  1BI3 A;  1RAG B;  3M0R A;  1WXT A;  5GMK m;  4HXJ A;  1VYU A;  4MMK A;  1QQJ A;  4C92 A;  3EHQ A;  2M16 A;  2GBQ A;  4F7U F;  3I35 A;  1NYG A;  1I4K 1;  4A4G A;  2R57 A;  2RQT A;  3G4S Q;  3OW2 S;  1MNE A;  2VXE A;  2C0T A;  2XDP A;  3TRE A;  5IH2 A;  1XNI A;  1I8F A;  3H9N A;  2L8D A;  3LLR A;  3I56 Q;  2QTV A;  3MO8 A;  2ROL A;  2DBK A;  1M1G A;  4ORZ A;  3TSZ A;  2DRK A;  3PNW C;  1X6B A;  4FYX B;  4C92 E;  4C8Q A;  5CVI A;  4PJM A;  1H3Z A;  3P8D A;  5LL6 S;  1FXX A;  1Y96 B;  2WSE E;  4Y92 A;  4F04 B;  2PZ1 A;  4R55 A;  3GBQ A;  3FDR A;  1T3L A;  2DJQ A;  3JRZ A;  2EJF A;  3QYH B;  4J9G A;  1Q82 R;  4FW2 A;  1MUZ A;  1KHI A;  2RJF A;  3QUI A;  5FU6 C;  5KYX B;  4JZ4 A;  2AZV A;  1LCK A;  1XQH A;  2E5Q A;  2DE0 X;  3GOX A;  2LX9 A;  1X75 C;  8AT1 B;  2X4Y A;  1RAC B;  3HTR A;  2VB6 A;  3ZFJ A;  1SG5 A;  1IB8 A;  1ZUK A;  2OJ2 A;  2CUD A;  1GXI E;  2EYY A;  2MWO A;  5GAN g;  1YBY A;  5GAO q;  1Z9Q A;  5ECA A;  1K9A A;  2J7I A;  2BTT A;  1YJN A;  3CC2 T;  3X20 B;  4WCI A;  4PFO A;  5CKD A;  1G3W A;  2YDL A;  1UGS B;  1LPL A;  2YHT A;  1PRM C;  4DEX A;  4OF1 A;  1ZX6 A;  1M3C A;  3A1P A;  4C0F A;  4R56 A;  1UHC A;  1ABQ A;  2HQX A;  1YJW A;  2CP3 A;  1M2O A;  2MI6 A;  1SRM A;  4F7U G;  2ESW A;  5KCH A;  2Y4Y A;  3A8L B;  2DXC A;  3UDC A;  2FPF A;  3NMZ C;  3VKI A;  4FYV B;  3CCS A;  1X43 A;  2JT4 A;  1YJW T;  1N27 A;  1WHG A;  4QQ6 A;  2K57 A;  1Y96 A;  1FMV A;  2DL3 A;  1VQ5 Q;  1GCQ A;  2DLP A;  2K5F A;  3CME Q;  2X4W A;  3CCS T;  4M75 E;  3CQT A;  4A4H A;  2CH4 W;  4X1V A;  4AFQ C;  5GAN d;  3OW2 P;  1UGR B;  2EGA A;  1T3S A;  4JJN K;  3INZ A;  5KYX A;  5HKC A;  2H8H A;  3SDZ A;  4E7K A;  3CC2 Q;  1U1T A;  1O9S A;  3TU4 K;  3JCM f;  3OMG A;  2PU9 B;  2HSP A;  4IKF A;  3ZL7 C;  3E9G A;  1AZG B;  1M3B A;  3QII A;  1QCF A;  4EMK C;  1KC8 U;  1C1A A;  1K73 C;  2ZPB B;  2M0O A;  2J6K A;  1VYT A;  2QDL A;  1VQ6 Q;  2MPX C;  2K5L A;  3CD6 Q;  1VQ7 A;  5GMK l;  1IO6 A;  3HPW A;  4M7A C;  4HCC A;  2EYW A;  3EG1 A;  2QTX A;  4QVC A;  3HL8 A;  4Y91 A;  3RMS A;  2LCL A;  2XID A;  1K9M R;  2PVG B;  5I2M A;  1U3O A;  2QA4 Q;  1I1J A;  3BDL A;  1YJW Q;  2XDB A;  4AFS C;  3OYC A;  1EX4 A;  3RDV A;  4GBQ A;  4RKU E;  2KMT A;  1PD0 A;  3M53 A;  1U06 A;  3N5B B;  4OMM A;  1VQ7 T;  1JB0 E;  1BYM A;  1D1C A;  4FSX A;  2V8I A;  3RR6 A;  3OYL A;  1G8X A;  1W1F A;  5D6W A;  1O75 A;  1KJW A;  2E12 A;  4F7U B;  2XG8 D;  2SRC A;  2MK5 A;  1PHT A;  3A8G B;  1N9S A;  1M8M A;  2EQI A;  2AHJ B;  1YNZ A;  4HKE A;  3LGF A;  3RKW A;  1AHJ B;  3LW5 E;  3A98 A;  2XU8 A;  3JCM P;  4LDU A;  2EW3 A;  4EIK A;  1R8O B;  4RCB A;  1PSF A;  3OS1 A;  1KD1 R;  1K8A C;  4ZTF A;  2ZPI B;  1W2B S;  5DY9 A;  5KE2 A;  2EJ9 A;  4HT9 A;  4BAC A;  2MIO A;  4LDV A;  2RI3 A;  5A0G A;  4HT8 A;  1VQN Q;  1QVG A;  3JCM e;  1WJQ A;  1OX8 A;  1PKT A;  5D7U A;  2Y4X A;  2RPN A;  3JCM c;  4E7S A;  4Z89 A;  4IUQ A;  2IPO B;  2X4J A;  2HKQ B;  3OYY A;  4FIB A;  3BW1 A;  4MDX A;  5FRN A;  1VQ7 Q;  1BI0 A;  1M2V B;  3OS5 A;  3EG2 A;  4AT1 B;  1U8R A;  1N5Z A;  4ZGJ B;  2HBW A;  2MF2 A;  4IIO A;  3MEV A;  1TH7 A;  5GJW B;  2GCX A;  5GAN 8;  2YRD A;  2PQW A;  5KYY B;  2HQE A;  4KUD K;  2E3H A;  2DL8 A;  3A8O B;  2DO3 A;  4ZN3 A;  1D0Z A;  3CCV T;  2RHI A;  2GTO A;  2LCS A;  4F7U A;  1R0C B;  2VVK A;  3NTH A;  1XJW B;  5EC7 A;  1JQQ A;  3A8M B;  5LJ3 g;  4GLK A;  3H0H A;  1WJS A;  4FYY B;  3SD4 A;  4E7L A;  2X35 A;  1LVK A;  1UDL A;  6AT1 B;  3L2V A;  1VQ8 Q;  1YJ9 A;  4M78 D;  1WHM A;  4BI4 A;  3RUX A;  3JAM E;  3HP9 A;  2F2V A;  2COW A;  3CBO A;  8ATC B;  2EPD A;  1EFN A;  2NWM A;  5CCA A;  1WZO A;  4OB2 B;  4M7D C;  1XOV A;  1YJ9 T;  2L5Q A;  2B8A A;  2XK0 A;  4XTW A;  3MKD A;  1WHH A;  3UA7 A;  3EG9 B;  5CIU A;  4M78 F;  2A37 A;  4M75 D;  2RD1 A;  3OYA A;  1MHN A;  1Q82 U;  1V76 A;  4OGE A;  2A08 A;  4FL6 A;  4PLI A;  1H64 1;  4N0A C;  1OI1 A;  2KRM A;  3G6E A;  1M2V A;  2KSS A;  2OAW A;  1I5O B;  2ED0 A;  4F14 A;  3CCV Q;  5J39 A;  4M75 F;  1D3B B;  3AHU A;  1WYX A;  1M27 C;  2VKN A;  5LJ3 d;  1NJI U;  1JXM A;  4C92 G;  1W2B P;  4OML A;  1R0B G;  3G6E T;  5KYY A;  1AVZ C;  3RNJ A;  4C0Z A;  3OYH A;  1KQ2 A;  2DAQ A;  1PKS A;  1K0X A;  2K3Y A;  2RI5 A;  2FRW A;  3P8H A;  5IXB A;  1WGS A;  4LDY A;  3CC7 A;  1SRL A;  1PCX A;  2EQJ A;  2DVJ A;  3LH5 A;  1YIJ A;  3KXT A;  3A8H B;  2KNB B;  4LDW A;  4II1 A;  2EYQ A;  2LT1 A;  3E2U A;  2FB7 A;  3L1A A;  3VUB A;  1PRL C;  3CC7 T;  2VGM A;  2O9V A;  2NYS A;  5GAN 3;  2DL4 A;  3G1J A;  1YIJ T;  1Y57 A;  3ER0 A;  1HJD A;  3VS6 A;  4M7A E;  2QEX Q;  1SSH A;  3QDR B;  1OU9 A;  1M9S A;  1X69 A;  3EG9 A;  1QWF A;  5GAM j;  1VQL A;  4UC4 A;  5GMK i;  3G71 Q;  1AWO A;  4BD3 A;  2NUP B;  2AKK A;  4OB0 B;  1GCP A;  1ACM B;  4QQG A;  4J9D A;  5IHK A;  3NGP A;  1OQK A;  4M78 C;  1VQ4 A;  1KC8 R;  4FT4 A;  3REB B;  1VQL T;  2JUF A;  2EGC A;  3THK A;  2EWN A;  1VQ9 Q;  3J80 E;  5IHN A;  1D3B A;  1MMG A;  4NS5 A;  1WLP B;  4XTY A;  2F2W A;  4N4G A;  1E6H A;  4FSS A;  1VQ4 T;  2XKO C;  2OTJ Q;  4J83 A;  3OYE A;  1ZSG A;  2NUZ A;  3QPH A;  4O5V A;  3J81 E;  1PD1 A;  4C5H A;  2RI2 A;  4BE2 A;  1IXD A;  3ME9 A;  3R6N A;  5LJ5 j;  2ZPH B;  3FJP A;  3JB9 I;  4DBH A;  4PLL A;  3MET A;  1WXU A;  2R5M A;  3EHR A;  2RJD A;  1I07 A;  1FWZ A;  2JXB A;  4Z02 A;  1OOT A;  2LQN A;  1WQ7 A;  1YIJ Q;  1Q81 C;  3HSB A;  5FU7 C;  2EFI A;  4E47 A;  1Q86 R;  3SB2 A;  2K6D A;  4XU2 A;  3CC4 A;  2DFU A;  2LQW A;  2HSE B;  3RMQ A;  4DBF A;  3CBP A;  3MEA A;  1FMK A;  2CDT A;  2LC4 A;  1VUB A;  4JS5 A;  2KBT A;  3U23 A;  3VS2 A;  2X51 A;  2NUT B;  1JBM A;  4HCK A;  4EDU A;  4KRT A;  2ZPE B;  4JJC A;  2K9G A;  4ELZ C;  4MZT A;  3CC4 T;  1J3T A;  4BE1 A;  2KE9 A;  1VQL Q;  1M90 U;  3GNF B;  2NUP A;  2VAS A;  3JCM V;  4MZP A;  1Q7Y C;  2CP2 A;  1Q95 G;  5GAM g;  2DIG A;  3DB4 A;  2KAF A;  2RHU A;  2KY9 A;  1X01 A;  2FZG B;  3QWX X;  2HCK A;  3M0T A;  1KQS A;  1EIF A;  3QHS A;  2ECZ A;  3V7C A;  5GAN 6;  2KRO A;  3X26 B;  1W6X A;  1F1B B;  1GBR A;  2AZS A;  3CPF A;  1AWW A;  4JJD A;  2DJZ A;  4A4K A;  1M1F A;  3IQL A;  4HVU A;  4PFZ A;  1SHG A;  3O5Z A;  2JW4 A;  1RAB B;  4M78 B;  2RK1 A;  3OYG A;  4J6X A;  2DL5 A;  3I55 A;  2E3I A;  2CRE A;  2K2M A;  3RBB B;  1IGQ A;  4VUB A;  3JB9 D;  5LJ5 g;  4M7D E;  1UJY A;  1N9R A;  4RMO A;  2DIQ A;  3NFC A;  2DF6 A;  1Z9Z A;  4KGV B;  2LZ6 B;  4DOW A;  4M75 B;  3I55 T;  3CCU Q;  2B86 A;  5FWC A;  4ZTJ A;  2W10 A;  4C0D B;  2AKL A;  1YP5 A;  1WQW A;  3M59 A;  2CT3 A;  2DXB A;  2QDY B;  3M0Q A;  5GAM d;  1V29 B;  3JB9 F;  2NUT A;  1OZ3 A;  3C95 A;  5FRO A;  2XIC A;  2MOX A;  3JB9 H;  5L8R E;  4N4H A;  2A7Y A;  4J9I A;  5DLO A;  1SPK A;  4Z88 A;  4CC4 B;  1OX9 A;  3PE0 A;  1PWT A;  3QYG B;  1TWB A;  5FLX E;  1K4U S;  3BDU A;  2DRM A;  4BDZ A;  1QVG S;  4Y28 E;  5FW9 A;  3V8J A;  4PNO A;  3CPW S;  5KYW B;  4Z8A A;  4OP0 A;  1MGQ A;  4M7A D;  2CS7 A;  4FU6 A;  2E65 A;  1GFD A;  5LJ5 d;  4JRK A;  3RER A;  3QJY A;  2DPP B;  4M78 A;  3L42 A;  1OEB A;  3QXE B;  4HCZ A;  2ZPF B;  1NJI R;  1IZ6 A;  5CQY A;  5I21 A;  2L89 A;  4M7A F;  3HKS A;  2V1Q A;  1SF9 A;  1I81 A;  3VYH B;  2O9S A;  2O01 E;  2RB6 A;  4L6V 5;  1VQO A;  4M75 A;  4RTX A;  2V26 A;  4IUR A;  1VQP A;  1YJN T;  1NG2 A;  2GGR A;  4IUV A;  2GF7 A;  3UT1 A;  3X28 B;  3OMC A;  4OVA A;  2AIR B;  2C0O A;  3OY9 A;  4AG2 C;  1OPL A;  2BIV A;  2LRQ A;  1WHJ A;  4J7I A;  1UB4 A;  4M78 E;  2QXF A;  1A0N B;  2VC8 A;  1QVP A;  4RTV A;  2D8H A;  4M77 C;  3VUZ A;  2J05 A;  4ZGE B;  1CKA A;  2QQA A; 
#chains in the Genus database with same CATH homology
 2CH4 A;  1G83 A;  2JM9 A;  3VS3 A;  1FYN A;  1JXO A;  2JMC A;  2KT1 A;  3EG2 A;  2L3Q A;  5I22 A;  5L23 A;  1N5Z A;  3VS1 A;  4LN2 A;  2YUP A;  2HBW A;  1SEM A;  4IIO A;  2DYB A;  2RQW A;  3H41 A;  3REA B;  3H0F A;  5GJW B;  2FPE A;  3PVQ A;  3M0P A;  3I5R A;  3NHN A;  4RTZ A;  1AOJ A;  1UGV A;  2RQR A;  4ESR A;  1B3Q A;  2DL8 A;  2PTK A;  1UHF A;  2C0I A;  2A28 A;  2KXC A;  1TG0 A;  4LE9 A;  2GTO A;  1W70 A;  2LCS A;  2FG0 A;  3VS0 A;  2KGT A;  2VVK A;  2X3X D;  2KYB A;  5EC7 A;  1JQQ A;  1NEG A;  1ABO A;  2J6F A;  2LNH B;  1AWX A;  3H0H A;  2IIM A;  2CT4 A;  5HCK A;  4GLM A;  1K76 A;  1UDL A;  1NLP C;  2EGE A;  1WI7 A;  2KEA A;  3EGU A;  1NEB A;  1M30 A;  2DMO A;  1M3A A;  1JU5 C;  1KIK A;  2F2V A;  3UA6 A;  1RLQ C;  4LUE A;  2EPD A;  2VWF A;  1EFN A;  2GNC A;  2NWM A;  2KRS A;  1XOV A;  1ZBJ A;  4CC7 A;  1G2B A;  1WX6 A;  1GRI A;  2CSI A;  2DIL A;  4J9H A;  3VS7 A;  4JPB W;  2V1R A;  3UA7 A;  1KSW A;  1QKW A;  2A37 A;  1WIE A;  1CSK A;  2A08 A;  2D0N A;  2PNI A;  1MV3 A;  1NM7 A;  1QKX A;  1VYV A;  1ZLM A;  2YUN A;  2KRM A;  4RTW A;  3C0C A;  3VRZ A;  4CC2 A;  2LMJ A;  4D8K A;  1X2Q A;  2OAW A;  1UTI A;  2M0Y A;  1OPK A;  2ED0 A;  4F14 A;  2D1X A;  3UF4 A;  1AWJ A;  2ED1 A;  1YWP A;  1WYX A;  1QWE A;  1M27 C;  2VKN A;  1JXM A;  3TSW A;  4OML A;  2BZY A;  2OI3 A;  1AVZ C;  4LUD A;  3RNJ A;  2FRY A;  4CC3 A;  2K7A A;  4K11 A;  4HVV A;  3EG3 A;  4D8D A;  2DA9 A;  2LJ0 A;  1PKS A;  1YCS B;  1K0X A;  3TVT A;  2FRW A;  5IXB A;  2J6O A;  1BB9 A;  1SRL A;  3VS5 A;  1UE9 A;  4QT7 A;  2DVJ A;  3LH5 A;  1B07 A;  1U5S A;  1HD3 A;  1RUW A;  2MCN A;  2KNB B;  3FJ5 A;  1BK2 A;  1JO8 A;  2JMA A;  3SHW A;  2RNA A;  1V1C A;  2L2P A;  2BZX A;  5IHI A;  2YSQ A;  2A36 A;  3M0S A;  4OMP A;  3PVL A;  1PRL C;  4AFZ C;  3ULR B;  2GTJ A;  1H8K A;  1RLP C;  2O9V A;  1GFC A;  2HDA A;  2DL4 A;  2RF0 A;  2JS2 A;  1Y57 A;  3M0R A;  1WXT A;  1HJD A;  3H0I A;  4HXJ A;  1VYU A;  3VS6 A;  1SSH A;  1MV0 B;  1X69 A;  1QWF A;  2LP5 A;  3EHQ A;  1CKB A;  2FPD A;  1AWO A;  2GBQ A;  3I35 A;  2SEM A;  2AKK A;  1GCP A;  1NYG A;  2L3P A;  4J9D A;  2E5K A;  5IHK A;  3NGP A;  4RUG A;  1NYF A;  2RQT A;  4F16 A;  2C0T A;  1T0J A;  5IH2 A;  3REB B;  1UG1 A;  3UAT A;  3VRY A;  3NPF A;  2EGC A;  1YN8 A;  3THK A;  2RN8 A;  1WFW A;  5IHN A;  1GL5 A;  2DM1 A;  2ROL A;  1WLP B;  2DBK A;  1BBZ A;  4ORZ A;  3TSZ A;  3QWY A;  2F2W A;  2DRK A;  1AD5 A;  1E6H A;  4FSS A;  2D8J A;  5IXF A;  1PNJ A;  1UUE A;  2W0Z A;  1X6B A;  4J9B A;  1TUD A;  1ZSG A;  2EYX A;  2NUZ A;  3R6N A;  2XMF A;  2G6F X;  4RTT A;  4Y92 A;  1WXU A;  3EHR A;  2KRN A;  2PZ1 A;  1I07 A;  3GBQ A;  4LNP A;  2JXB A;  5GJV B;  1T3L A;  2DJQ A;  1OOT A;  4E6R A;  4J9G A;  2LQN A;  1MUZ A;  1BU1 A;  4JZ4 A;  2AZV A;  1LCK A;  2K6D A;  2DE0 X;  2CUB A;  2LQW A;  1UJ0 A;  2KT8 A;  1FMK A;  2CDT A;  1AEY A;  1NLO C;  2EYZ A;  1ZUK A;  2OJ2 A;  4JJB A;  4A63 B;  2CUD A;  4M4Z A;  2KBT A;  2EYY A;  3U23 A;  3VS2 A;  2GQI A;  2J06 A;  4IIM A;  4HCK A;  1Z9Q A;  4KRT A;  5ECA A;  4J9E A;  4JJC A;  1K9A A;  2K9G A;  1JEG A;  2LJ3 A;  4ZNX A;  1J3T A;  2J7I A;  1X2K A;  2BTT A;  2KE9 A;  1H3H A;  1TUC A;  2LX7 A;  4WCI A;  2JS0 A;  3I9Q A;  1S1N A;  2EBP A;  2YDL A;  1H92 A;  1WA7 A;  4J9C A;  1PRM C;  4DEX A;  2M51 A;  2RQV A;  1UEC A;  1ZX6 A;  2FEI A;  2I0N A;  1ZUU A;  1M3C A;  4JZ3 A;  4OMO A;  3QWX X;  1UHC A;  2HCK A;  3M0T A;  1ABQ A;  1X27 A;  2ABL A;  2P4R A;  1SRM A;  1UFF A;  4AG1 C;  2ECZ A;  5I11 A;  2F2X A;  2ESW A;  1T0H A;  2RMO A;  2KRO A;  1W6X A;  1GBR A;  2ROT A;  2AZS A;  1AWW A;  2FPF A;  1RI9 A;  3NMZ C;  4JJD A;  2JTE A;  1X43 A;  2YT6 A;  2JT4 A;  3IQL A;  4HVU A;  1SHG A;  3O5Z A;  2JW4 A;  2DL7 A;  2DL5 A;  4R0K A;  4F17 A;  2O2O A;  2BZ8 A;  2DL3 A;  3I5S A;  1GCQ A;  2CRE A;  2K79 A;  2DLP A;  2K2M A;  3SEM A;  3RBB B;  3CQT A;  2CH4 W;  4X1V A;  4AFQ C;  2LJ1 A;  1UJY A;  2EGA A;  1T3S A;  2FO0 A;  5FWB A;  2L0A A;  1QLY A;  2DF6 A;  1Z9Z A;  2H8H A;  2HEQ A;  2LZ6 B;  4DEY A;  2JM8 A;  2B86 A;  5FWC A;  2W10 A;  2AKL A;  1YP5 A;  2HSP A;  2CT3 A;  3ZL7 C;  1ZUY A;  3M0Q A;  2L3S A;  1AZE A;  4OMN A;  2KYM A;  1AZG B;  2ENM A;  1M3B A;  1E7O A;  1QCF A;  2MOX A;  1WXB A;  1K0S A;  1SHF A;  2J6K A;  1VYT A;  4J9I A;  1SPK A;  2QDL A;  4Z88 A;  4CC4 B;  3PE0 A;  1PWT A;  2DX1 A;  1IO6 A;  1K4U S;  2DRM A;  2EYW A;  3EG1 A;  1VA7 A;  5FW9 A;  1U3O A;  4Z8A A;  1I1J A;  1WDX A;  2O31 A;  2K3B A;  4AFS C;  1X6G A;  4GBQ A;  1U06 A;  4OMM A;  1KFZ A;  1GFD A;  1Y0M A;  4RTU A;  1E6G A;  1OEB A;  1W1F A;  4RTY A;  1ARK A;  1KJW A;  2YUO A;  2RQU A;  2DNU A;  2DBM A;  2EKH A;  2EVR A;  4HVW A;  2SRC A;  2KXD A;  1PHT A;  4J9F A;  3EG0 A;  2EQI A;  1M8M A;  1GBQ A;  1YNZ A;  1GCQ C;  2V1Q A;  3A98 A;  2O9S A;  2X3W D;  2EW3 A;  4EIK A;  4RTX A;  3KFV A;  4AFU C;  2CSQ A;  1NG2 A;  1YWO A;  2KR3 A;  2GGR A;  3VS4 A;  1K1Z A;  2MIO A;  2C0O A;  1HSQ A;  4AG2 C;  1OV3 A;  1OPL A;  2YUQ A;  1A0N B;  4OMQ A;  2O88 A;  1PKT A;  2AK5 A;  2RPN A;  4RTV A;  2D8H A;  3M0U A;  4Z89 A;  2J05 A;  3JV3 A;  1I0C A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...