3H0LC

Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPERKDGFFVVPRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Insights into tRNA-Dependent Amidotransferase Evolution and Catalysis from the Structure of the Aquifex aeolicus Enzyme
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 17
structure length 91
sequence length 91
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3h0lC01
3H0MC 2DQNC 3KFUG 2DF4C 3A1KA 2G5HC 2F2AC 3H0LC 3IP4C 3AL0C 2G5IC 4WJ3C 3A1IA 3H0RC
chains in the Genus database with same CATH superfamily
3LELA 4JJNA 3W97C 3REJC 3F6TA 5B0YB 1M19D 4CSRA 3FDDA 4J8WB 3TU4A 3VH6T 1P3PC 4YM6B 3WAAD 3X1VC 3C1CB 4WU9C 5AVCB 4UPKA 3VH6A 5DNNB 5JA4A 5GT0A 3LZ1C 1S32C 4E44A 4H9SC 3KUYB 3NQJA 1AOIC 4HGAC 3AZJC 1P3FC 5B2JD 1U35D 4XUJD 2F8NA 5B24A 1ZLAD 4H9QA 3X1TB 5AV5A 3AZKC 2FJ7D 5B31C 5CPJC 3UTBC 3WKJB 4Z66A 4H9OA 1P34A 3REJD 5JRGC 3AFAA 4G92C 3REHB 1Q9CA 2HIOC 5B1MB 2Y2HA 1P3PD 3WTPE 4Z2MG 3X1VD 1P3AA 4WU9D 1P3GB 3WA9B 2HUEC 3X1SC 3WTPA 1S32D 5B1LA 3MGSA 3LZ0B 2Y2OA 3KXBB 3MGPB 3KWQA 3AZHC 2AROB 4WJ3C 5GXQD 1F66C 5BS7A 4Z5TA 1H3OB 5CPJD 5CPKB 3UTBD 2BYMA 4Z2MH 5GT3D 5BNVB 5JRGD 5AV6A 1F1EA 2HIOD 2XD1A 5B33B 1EQZB 5CP6C 3LELD 1KX4B 4JJND 3VH5T 1P3MC 3WAAB 4R8PB 4KUDC 1M18B 1Z2CB 3VH5A 3B6GB 4LD9B 1JFIB 5CPIA 2ZM5A 5KDMA 1TZYC 1P3KB 3B0DC 3A6NA 3O62A 1P3OB 5AV8B 3REIC 1P3BC 1F66D 3AV2C 2Y2NA 3MNNA 5B24D 1M19A 5BT1C 5B0YC 1KX5A 2Y2QA 4J8WC 4QLCB 5AV5D 4KHAB 4ZBJC 4WU8A 5E5AA 3AZLA 5CP6D 5AV9B 3MGRB 4Z66D 3AZMB 3A1IA 1P3MD 2Y2PA 3W98A 4NE3A 2CV5C 5AY8C 2ZY3A 3NQUA 5B2JA 4AWLB 4XZQB 3KSYA 1TZYD 5AVBC 4CAYB 3RELB 1ZLAA 3REKC 4J8VC 2FJ7A 1KX3C 3AV1B 5GXQB 3B6FC 3W97A 5B32B 3KWQD 3REJA 5BT1D 3REHC 3EPHA 2DQNC 3W96C 2J8PA 3AZIC 3W99C 1P3PA 5GT3B 4ZUXC 3X1VA 2YFWB 4WU9A 4WV4B 3LZ1A 1S32A 4DQYB 4H9SA 4CSRB 3TU4B 5F99C 2CV5D 1AOIA 3AZJA 1P3FA 1B6WA 2RVQD 5AVBD 3AZKA 3REKD 5JA4B 1KX3D 5GT0B 5B31A 3C1BC 5CPJA 3UTBA 1BH8A 5CPKC 3B6FD 3KFUG 3NQJB 3O62D 3UT9C 1HQ3B 5JRGA 3B0BA 3MVDC 2F8NB 1WWSA 3H0RC 2HIOA 5B24B 4NFTA 3AZID 4H9QB 3W99D 3W96D 3LJAC 1M1AC 5AV5B 3MNND 2CWEA 3R45A 1KX5D 3X1SA 2LY8A 5FUGA 4J8UC 4H9OB 1M18C 1P34B 4WU8D 5E5AD 3AFAB 3AZLD 2Y2KA 3AN2C 5F99D 3AZHA 5BNXA 5B40C 2PYOC 3W98D 1P3AB 1F66A 5AV8C 4EO5B 3IP4C 3WTPB 3H0MC 3AZNB 5B1LB 3MGSB 4J8XC 1B67A 4YS3B 3UTAB 5CP6A 3LJAD 3MGRC 1P3IC 3AZMC 1M1AD 3W97D 4Z5TB 1P3MA 5DNMB 2NZDC 4KUDA 1P3LC 2NQBC 5AV6B 2YFVB 5GSUB 3AN2D 3X1UB 2W8SA 3V9RA 1TZYA 4XZQC 4KGCB 4X23B 5B40D 2PYOD 3LZ1D 3REIA 1BH9A 1P3BA 3AV2A 2F2AC 1AOID 3AZJD 1P3FD 4NE6A 4J8XD 1ID3C 5B0YA 5CPIB 3AZEC 4H9PA 4H9RA 4J8WA 5KDMB 2F8NK 3AZKD 3A6NB 2G5IC 5B31D 5B0ZC 3MGQC 2BYKB 2DF4C 2NZDD 3MNNB 4UUZA 1P3LD 1M19B 2NQBD 1KX5B 3KUYA 2CV5A 5AY8A 2JE5A 4WU8B 5E5AB 5AVBA 3AZLB 2Y2GA 3X1SD 3REKA 4J8VA 3AYWC 1KX3A 3AZGC 3B6FA 4G91B 3AZFC 1KU5A 5B2IC 3AZHD 1HQ3C 1ID3D 3NQUB 5B2JB 3REHA 4XUJB 3AZED 1U35B 3W96A 3AZIA 1ZLAB 3W99A 4ZUXA 5B0ZD 5C3IB 2FJ7B 3P5JB 3W97B 3REJB 5B32G 3EG5B 4YM6C 3C1CC 5F99A 2VQRA 5AVCC 5DNNC 1P3PB 1BFMA 4H9NA 3X1VB 4WU9B 4KUDD 4EO5C 3KUYC 3AYWD 1S32B 3LZ1B 3C1BA 5CPKA 3AZGD 3AZNC 3B0CW 5B2ID 3X1TC 3UT9A 4HGAB 3MVDA 3REID 1P3BD 1P3FB 3AV2D 4WNNA 4YS3C 1WWIA 3LJAA 3WKJC 1M1AA 1N1JA 3AZKB 5B31B 5DNMC 5B0YD 5CPJB 3UTBB 4J8WD 4J8UA 1M18A 5B1MC 5JRGB 4YM6D 4G92B 3AN2A 2HIOB 5AVCD 3X1UC 1P3GC 2F8NG 3WA9C 1P3KA 4KGCC 5B40A 4X23C 3LELB 2PYOA 4JJNB 5AV8A 3R45B 3KUYD 3LZ0C 2HUEB 5AY8D 3MGPC 3KXBC 4J8XA 2AROC 3X1TD 4J8VD 3AZHB 1F66B 3MGRA 1P3IA 1T3UA 3AZMA 3AL0C 2Y2IA 2NZDA 3REHD 2UWXA 2F8NH 1EQZC 5B1MD 5B33C 1P3LA 2NQBA 3H0LC 4ZUXD 1KX4C 1TAFA 2BG1A 3EPLA 1P3GD 3WAAC 4XZQA 3WA9D 5CP6B 4R8PC 4Z66B 3EPJA 4LD9C 3B6GC 3VH5W 1P3MB 3MGPD 3KXBD 1P3KC 2AROD 1P3OC 1ID3A 3AZEA 1U35C 4XUJC 3V9RB 1TZYB 3B0DB 3C1BD 5CPKD 5B0ZA 3REIB 1BH9B 3MGQA 3UT9D 4QLCC 3MVDD 3KWQB 4NE5A 1EQZD 5B33D 1HTAA 4H9PB 4H9RB 5BO0A 5AV9C 1ULYA 1KX4D 4ZBJB 4R8PD 2BYMB 4J8UD 1M18D 2G5HC 3AYWA 4LD9D 3B6GD 3AZGA 4AWLC 3B0CT 5G49A 4UUZB 3AZFA 1P3KD 5B2IA 3RELC 2CV5B 1P3OD 1HQ3A 5AY8B 5AV8D 3AV1C 5AVBB 5GXQC 3A1KA 5B32C 4J8VB 3REKB 1KX3B 3B6FB 4QLCD 3O62B 5GT3C 4YM6A 4M6BA 2Y2LA 5AV9D 3MGRD 3C1CA 3AZMD 5AVCA 1P3ID 3W96B 3AZIB 3W99B 5DNNA 4ZUXB 3LELC 2RIQA 4JJNC 3TU4C 1PZRA 3AZNA 4XZQD 3X1TA 3RELD 5F99B 2L5AA 2JSSA 4H9NB 3AV1D 5GT0C 3W98B 4YS3A 3UTAA 2IO5B 3WKJA 5B32D 5DNMA 3C1BB 5B24C 5B1MA 3UT9B 2YFVA 5GSUA 5AV5C 3MVDB 3MGQD 3X1UA 1P3GA 2Y2JA 4WNNB 3WA9A 3LJAB 4KGCA 4Z66C 4X23A 1M1AB 1N1JB 1P34C 2FFFB 3AFAC 3TU4D 5B31G 3LZ0A 4J8UB 3MGPA 3KXBA 1R4VA 3VH6W 2AROA 2ZY4A 3AN2B 1P3AC 1H3OA 2ZY2A 5B40B 2PYOB 3WTPC 5GT0D 2ZY5A 4E45A 5B1LC 3MGSC 2BYKA 3AZFD 5BNVA 1HQ3D 3AZJB 1AOIB 3KWQC 2F8ND 4J8XB 1EQZA 5B33A 3UTAC 5BS7C 1KX4A 4Z5TC 4DRBA 3WAAA 1BH8B 4R8PA 1P3IB 1P34D 4LD9A 3B6GA 5AV6C 1JFIA 5GSUC 3AFAD 2NZDB 3C1CD 1P3LB 5DNND 2NQBB 2JCHA 1A7WA 1P3OA 1TAFB 1P3AD 1U35A 4XUJA 2XD5A 2RVQC 3X1SB 5FUGB 3WTPD 3AZND 5B1LD 3MGSD 5CPIC 4QLCA 4KHAA 3A6NC 5BNXB 3O62C 1ID3B 4YS3D 3UTAD 5AV9A 3AZEB 3WKJD 4WZSB 4Z5TD 5DNMD 5B0ZB 3MNNC 3MGQB 1M19C 1KX5C 3EPKA 5AV6D 5GSUD 3X1UD 5E5AC 4WU8C 3AZLC 4CAYA 5BO0B 3RELA 4X23D 4KGCD 1W2EA 2Y2MA 3AV1A 3W98C 3LZ0D 5GXQA 4KUDB 2IO5C 4G91C 5B32A 3AYWB 5CPID 5B2JC 3AZGB 5G49B 3AZFB 1ZLAC 5B2IB 3A6ND 5GT3A 5CHLB 1P3BB 2YFWA 5C3IC 3AV2B 4DRAA 2FJ7C
chains in the Genus database with same CATH topology
3LELA 4JJNA 3W97C 3REJC 3F6TA 5B0YB 1M19D 4CSRA 3FDDA 4J8WB 3TU4A 3VH6T 1P3PC 4YM6B 3WAAD 3X1VC 3C1CB 4WU9C 5AVCB 4UPKA 3VH6A 5DNNB 5JA4A 5GT0A 3LZ1C 1S32C 4E44A 4H9SC 3KUYB 3NQJA 1AOIC 4HGAC 3AZJC 1P3FC 5B2JD 1U35D 4XUJD 2F8NA 5B24A 1ZLAD 4H9QA 3X1TB 5AV5A 3AZKC 2FJ7D 5B31C 5CPJC 3UTBC 3WKJB 4Z66A 4H9OA 1P34A 3REJD 5JRGC 3AFAA 4G92C 3REHB 1Q9CA 2HIOC 5B1MB 2Y2HA 1P3PD 3WTPE 4Z2MG 3X1VD 1P3AA 4WU9D 1P3GB 3WA9B 2HUEC 3X1SC 3WTPA 1S32D 5B1LA 3MGSA 3LZ0B 2Y2OA 3KXBB 3MGPB 3KWQA 3AZHC 2AROB 4WJ3C 5GXQD 1F66C 5BS7A 4Z5TA 1H3OB 5CPJD 5CPKB 3UTBD 2BYMA 4Z2MH 5GT3D 5BNVB 5JRGD 5AV6A 1F1EA 2HIOD 2XD1A 5B33B 1EQZB 5CP6C 3LELD 1KX4B 4JJND 3VH5T 1P3MC 3WAAB 4R8PB 4KUDC 1M18B 1Z2CB 3VH5A 3B6GB 4LD9B 1JFIB 5CPIA 2ZM5A 5KDMA 1TZYC 1P3KB 3B0DC 3A6NA 3O62A 1P3OB 5AV8B 3REIC 1P3BC 1F66D 3AV2C 2Y2NA 3MNNA 5B24D 1M19A 5BT1C 5B0YC 1KX5A 2Y2QA 4J8WC 4QLCB 5AV5D 4KHAB 4ZBJC 4WU8A 5E5AA 3AZLA 5CP6D 5AV9B 3MGRB 4Z66D 3AZMB 3A1IA 1P3MD 2Y2PA 3W98A 4NE3A 2CV5C 5AY8C 2ZY3A 3NQUA 5B2JA 4AWLB 4XZQB 3KSYA 1TZYD 5AVBC 4CAYB 3RELB 1ZLAA 3REKC 4J8VC 2FJ7A 1KX3C 3AV1B 5GXQB 3B6FC 3W97A 5B32B 3KWQD 3REJA 5BT1D 3REHC 3EPHA 2DQNC 3W96C 2J8PA 3AZIC 3W99C 1P3PA 5GT3B 4ZUXC 3X1VA 2YFWB 4WU9A 4WV4B 3LZ1A 1S32A 4DQYB 4H9SA 4CSRB 3TU4B 5F99C 2CV5D 1AOIA 3AZJA 1P3FA 1B6WA 2RVQD 5AVBD 3AZKA 3REKD 5JA4B 1KX3D 5GT0B 5B31A 3C1BC 5CPJA 3UTBA 1BH8A 5CPKC 3B6FD 3KFUG 3NQJB 3O62D 3UT9C 1HQ3B 5JRGA 3B0BA 3MVDC 2F8NB 1WWSA 3H0RC 2HIOA 5B24B 4NFTA 3AZID 4H9QB 3W99D 3W96D 3LJAC 1M1AC 5AV5B 3MNND 2CWEA 3R45A 1KX5D 3X1SA 2LY8A 5FUGA 4J8UC 4H9OB 1M18C 1P34B 4WU8D 5E5AD 3AFAB 3AZLD 2Y2KA 3AN2C 5F99D 3AZHA 5BNXA 5B40C 2PYOC 3W98D 1P3AB 1F66A 5AV8C 4EO5B 3IP4C 3WTPB 3H0MC 3AZNB 5B1LB 3MGSB 4J8XC 1B67A 4YS3B 3UTAB 5CP6A 3LJAD 3MGRC 1P3IC 3AZMC 1M1AD 3W97D 4Z5TB 1P3MA 5DNMB 2NZDC 4KUDA 1P3LC 2NQBC 5AV6B 2YFVB 5GSUB 3AN2D 3X1UB 2W8SA 3V9RA 1TZYA 4XZQC 4KGCB 4X23B 5B40D 2PYOD 3LZ1D 3REIA 1BH9A 1P3BA 3AV2A 2F2AC 1AOID 3AZJD 1P3FD 4NE6A 4J8XD 1ID3C 5B0YA 5CPIB 3AZEC 4H9PA 4H9RA 4J8WA 5KDMB 2F8NK 3AZKD 3A6NB 2G5IC 5B31D 5B0ZC 3MGQC 2BYKB 2DF4C 2NZDD 3MNNB 4UUZA 1P3LD 1M19B 2NQBD 1KX5B 3KUYA 2CV5A 5AY8A 2JE5A 4WU8B 5E5AB 5AVBA 3AZLB 2Y2GA 3X1SD 3REKA 4J8VA 3AYWC 1KX3A 3AZGC 3B6FA 4G91B 3AZFC 1KU5A 5B2IC 3AZHD 1HQ3C 1ID3D 3NQUB 5B2JB 3REHA 4XUJB 3AZED 1U35B 3W96A 3AZIA 1ZLAB 3W99A 4ZUXA 5B0ZD 5C3IB 2FJ7B 3P5JB 3W97B 3REJB 5B32G 3EG5B 4YM6C 3C1CC 5F99A 2VQRA 5AVCC 5DNNC 1P3PB 1BFMA 4H9NA 3X1VB 4WU9B 4KUDD 4EO5C 3KUYC 3AYWD 1S32B 3LZ1B 3C1BA 5CPKA 3AZGD 3AZNC 3B0CW 5B2ID 3X1TC 3UT9A 4HGAB 3MVDA 3REID 1P3BD 1P3FB 3AV2D 4WNNA 4YS3C 1WWIA 3LJAA 3WKJC 1M1AA 1N1JA 3AZKB 5B31B 5DNMC 5B0YD 5CPJB 3UTBB 4J8WD 4J8UA 1M18A 5B1MC 5JRGB 4YM6D 4G92B 3AN2A 2HIOB 5AVCD 3X1UC 1P3GC 2F8NG 3WA9C 1P3KA 4KGCC 5B40A 4X23C 3LELB 2PYOA 4JJNB 5AV8A 3R45B 3KUYD 3LZ0C 2HUEB 5AY8D 3MGPC 3KXBC 4J8XA 2AROC 3X1TD 4J8VD 3AZHB 1F66B 3MGRA 1P3IA 1T3UA 3AZMA 3AL0C 2Y2IA 2NZDA 3REHD 2UWXA 2F8NH 1EQZC 5B1MD 5B33C 1P3LA 2NQBA 3H0LC 4ZUXD 1KX4C 1TAFA 2BG1A 3EPLA 1P3GD 3WAAC 4XZQA 3WA9D 5CP6B 4R8PC 4Z66B 3EPJA 4LD9C 3B6GC 3VH5W 1P3MB 3MGPD 3KXBD 1P3KC 2AROD 1P3OC 1ID3A 3AZEA 1U35C 4XUJC 3V9RB 1TZYB 3B0DB 3C1BD 5CPKD 5B0ZA 3REIB 1BH9B 3MGQA 3UT9D 4QLCC 3MVDD 3KWQB 4NE5A 1EQZD 5B33D 1HTAA 4H9PB 4H9RB 5BO0A 5AV9C 1ULYA 1KX4D 4ZBJB 4R8PD 2BYMB 4J8UD 1M18D 2G5HC 3AYWA 4LD9D 3B6GD 3AZGA 4AWLC 3B0CT 5G49A 4UUZB 3AZFA 1P3KD 5B2IA 3RELC 2CV5B 1P3OD 1HQ3A 5AY8B 5AV8D 3AV1C 5AVBB 5GXQC 3A1KA 5B32C 4J8VB 3REKB 1KX3B 3B6FB 4QLCD 3O62B 5GT3C 4YM6A 4M6BA 2Y2LA 5AV9D 3MGRD 3C1CA 3AZMD 5AVCA 1P3ID 3W96B 3AZIB 3W99B 5DNNA 4ZUXB 3LELC 2RIQA 4JJNC 3TU4C 1PZRA 3AZNA 4XZQD 3X1TA 3RELD 5F99B 2L5AA 2JSSA 4H9NB 3AV1D 5GT0C 3W98B 4YS3A 3UTAA 2IO5B 3WKJA 5B32D 5DNMA 3C1BB 5B24C 5B1MA 3UT9B 2YFVA 5GSUA 5AV5C 3MVDB 3MGQD 3X1UA 1P3GA 2Y2JA 4WNNB 3WA9A 3LJAB 4KGCA 4Z66C 4X23A 1M1AB 1N1JB 1P34C 2FFFB 3AFAC 3TU4D 5B31G 3LZ0A 4J8UB 3MGPA 3KXBA 1R4VA 3VH6W 2AROA 2ZY4A 3AN2B 1P3AC 1H3OA 2ZY2A 5B40B 2PYOB 3WTPC 5GT0D 2ZY5A 4E45A 5B1LC 3MGSC 2BYKA 3AZFD 5BNVA 1HQ3D 3AZJB 1AOIB 3KWQC 2F8ND 4J8XB 1EQZA 5B33A 3UTAC 5BS7C 1KX4A 4Z5TC 4DRBA 3WAAA 1BH8B 4R8PA 1P3IB 1P34D 4LD9A 3B6GA 5AV6C 1JFIA 5GSUC 3AFAD 2NZDB 3C1CD 1P3LB 5DNND 2NQBB 2JCHA 1A7WA 1P3OA 1TAFB 1P3AD 1U35A 4XUJA 2XD5A 2RVQC 3X1SB 5FUGB 3WTPD 3AZND 5B1LD 3MGSD 5CPIC 4QLCA 4KHAA 3A6NC 5BNXB 3O62C 1ID3B 4YS3D 3UTAD 5AV9A 3AZEB 3WKJD 4WZSB 4Z5TD 5DNMD 5B0ZB 3MNNC 3MGQB 1M19C 1KX5C 3EPKA 5AV6D 5GSUD 3X1UD 5E5AC 4WU8C 3AZLC 4CAYA 5BO0B 3RELA 4X23D 4KGCD 1W2EA 2Y2MA 3AV1A 3W98C 3LZ0D 5GXQA 4KUDB 2IO5C 4G91C 5B32A 3AYWB 5CPID 5B2JC 3AZGB 5G49B 3AZFB 1ZLAC 5B2IB 3A6ND 5GT3A 5CHLB 1P3BB 2YFWA 5C3IC 3AV2B 4DRAA 2FJ7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0M C;  2DQN C;  3KFU G;  2DF4 C;  3A1K A;  2G5H C;  2F2A C;  3H0L C;  3IP4 C;  3AL0 C;  2G5I C;  4WJ3 C;  3A1I A;  3H0R C; 
#chains in the Genus database with same CATH topology
 3LEL A;  4JJN A;  3W97 C;  3REJ C;  3F6T A;  5B0Y B;  1M19 D;  4CSR A;  3FDD A;  4J8W B;  3TU4 A;  3VH6 T;  1P3P C;  4YM6 B;  3WAA D;  3X1V C;  3C1C B;  4WU9 C;  5AVC B;  4UPK A;  3VH6 A;  5DNN B;  5JA4 A;  5GT0 A;  3LZ1 C;  1S32 C;  4E44 A;  4H9S C;  3KUY B;  3NQJ A;  1AOI C;  4HGA C;  3AZJ C;  1P3F C;  5B2J D;  1U35 D;  4XUJ D;  2F8N A;  5B24 A;  1ZLA D;  4H9Q A;  3X1T B;  5AV5 A;  3AZK C;  2FJ7 D;  5B31 C;  5CPJ C;  3UTB C;  3WKJ B;  4Z66 A;  4H9O A;  1P34 A;  3REJ D;  5JRG C;  3AFA A;  4G92 C;  3REH B;  1Q9C A;  2HIO C;  5B1M B;  2Y2H A;  1P3P D;  3WTP E;  4Z2M G;  3X1V D;  1P3A A;  4WU9 D;  1P3G B;  3WA9 B;  2HUE C;  3X1S C;  3WTP A;  1S32 D;  5B1L A;  3MGS A;  3LZ0 B;  2Y2O A;  3KXB B;  3MGP B;  3KWQ A;  3AZH C;  2ARO B;  4WJ3 C;  5GXQ D;  1F66 C;  5BS7 A;  4Z5T A;  1H3O B;  5CPJ D;  5CPK B;  3UTB D;  2BYM A;  4Z2M H;  5GT3 D;  5BNV B;  5JRG D;  5AV6 A;  1F1E A;  2HIO D;  2XD1 A;  5B33 B;  1EQZ B;  5CP6 C;  3LEL D;  1KX4 B;  4JJN D;  3VH5 T;  1P3M C;  3WAA B;  4R8P B;  4KUD C;  1M18 B;  1Z2C B;  3VH5 A;  3B6G B;  4LD9 B;  1JFI B;  5CPI A;  2ZM5 A;  5KDM A;  1TZY C;  1P3K B;  3B0D C;  3A6N A;  3O62 A;  1P3O B;  5AV8 B;  3REI C;  1P3B C;  1F66 D;  3AV2 C;  2Y2N A;  3MNN A;  5B24 D;  1M19 A;  5BT1 C;  5B0Y C;  1KX5 A;  2Y2Q A;  4J8W C;  4QLC B;  5AV5 D;  4KHA B;  4ZBJ C;  4WU8 A;  5E5A A;  3AZL A;  5CP6 D;  5AV9 B;  3MGR B;  4Z66 D;  3AZM B;  3A1I A;  1P3M D;  2Y2P A;  3W98 A;  4NE3 A;  2CV5 C;  5AY8 C;  2ZY3 A;  3NQU A;  5B2J A;  4AWL B;  4XZQ B;  3KSY A;  1TZY D;  5AVB C;  4CAY B;  3REL B;  1ZLA A;  3REK C;  4J8V C;  2FJ7 A;  1KX3 C;  3AV1 B;  5GXQ B;  3B6F C;  3W97 A;  5B32 B;  3KWQ D;  3REJ A;  5BT1 D;  3REH C;  3EPH A;  2DQN C;  3W96 C;  2J8P A;  3AZI C;  3W99 C;  1P3P A;  5GT3 B;  4ZUX C;  3X1V A;  2YFW B;  4WU9 A;  4WV4 B;  3LZ1 A;  1S32 A;  4DQY B;  4H9S A;  4CSR B;  3TU4 B;  5F99 C;  2CV5 D;  1AOI A;  3AZJ A;  1P3F A;  1B6W A;  2RVQ D;  5AVB D;  3AZK A;  3REK D;  5JA4 B;  1KX3 D;  5GT0 B;  5B31 A;  3C1B C;  5CPJ A;  3UTB A;  1BH8 A;  5CPK C;  3B6F D;  3KFU G;  3NQJ B;  3O62 D;  3UT9 C;  1HQ3 B;  5JRG A;  3B0B A;  3MVD C;  2F8N B;  1WWS A;  3H0R C;  2HIO A;  5B24 B;  4NFT A;  3AZI D;  4H9Q B;  3W99 D;  3W96 D;  3LJA C;  1M1A C;  5AV5 B;  3MNN D;  2CWE A;  3R45 A;  1KX5 D;  3X1S A;  2LY8 A;  5FUG A;  4J8U C;  4H9O B;  1M18 C;  1P34 B;  4WU8 D;  5E5A D;  3AFA B;  3AZL D;  2Y2K A;  3AN2 C;  5F99 D;  3AZH A;  5BNX A;  5B40 C;  2PYO C;  3W98 D;  1P3A B;  1F66 A;  5AV8 C;  4EO5 B;  3IP4 C;  3WTP B;  3H0M C;  3AZN B;  5B1L B;  3MGS B;  4J8X C;  1B67 A;  4YS3 B;  3UTA B;  5CP6 A;  3LJA D;  3MGR C;  1P3I C;  3AZM C;  1M1A D;  3W97 D;  4Z5T B;  1P3M A;  5DNM B;  2NZD C;  4KUD A;  1P3L C;  2NQB C;  5AV6 B;  2YFV B;  5GSU B;  3AN2 D;  3X1U B;  2W8S A;  3V9R A;  1TZY A;  4XZQ C;  4KGC B;  4X23 B;  5B40 D;  2PYO D;  3LZ1 D;  3REI A;  1BH9 A;  1P3B A;  3AV2 A;  2F2A C;  1AOI D;  3AZJ D;  1P3F D;  4NE6 A;  4J8X D;  1ID3 C;  5B0Y A;  5CPI B;  3AZE C;  4H9P A;  4H9R A;  4J8W A;  5KDM B;  2F8N K;  3AZK D;  3A6N B;  2G5I C;  5B31 D;  5B0Z C;  3MGQ C;  2BYK B;  2DF4 C;  2NZD D;  3MNN B;  4UUZ A;  1P3L D;  1M19 B;  2NQB D;  1KX5 B;  3KUY A;  2CV5 A;  5AY8 A;  2JE5 A;  4WU8 B;  5E5A B;  5AVB A;  3AZL B;  2Y2G A;  3X1S D;  3REK A;  4J8V A;  3AYW C;  1KX3 A;  3AZG C;  3B6F A;  4G91 B;  3AZF C;  1KU5 A;  5B2I C;  3AZH D;  1HQ3 C;  1ID3 D;  3NQU B;  5B2J B;  3REH A;  4XUJ B;  3AZE D;  1U35 B;  3W96 A;  3AZI A;  1ZLA B;  3W99 A;  4ZUX A;  5B0Z D;  5C3I B;  2FJ7 B;  3P5J B;  3W97 B;  3REJ B;  5B32 G;  3EG5 B;  4YM6 C;  3C1C C;  5F99 A;  2VQR A;  5AVC C;  5DNN C;  1P3P B;  1BFM A;  4H9N A;  3X1V B;  4WU9 B;  4KUD D;  4EO5 C;  3KUY C;  3AYW D;  1S32 B;  3LZ1 B;  3C1B A;  5CPK A;  3AZG D;  3AZN C;  3B0C W;  5B2I D;  3X1T C;  3UT9 A;  4HGA B;  3MVD A;  3REI D;  1P3B D;  1P3F B;  3AV2 D;  4WNN A;  4YS3 C;  1WWI A;  3LJA A;  3WKJ C;  1M1A A;  1N1J A;  3AZK B;  5B31 B;  5DNM C;  5B0Y D;  5CPJ B;  3UTB B;  4J8W D;  4J8U A;  1M18 A;  5B1M C;  5JRG B;  4YM6 D;  4G92 B;  3AN2 A;  2HIO B;  5AVC D;  3X1U C;  1P3G C;  2F8N G;  3WA9 C;  1P3K A;  4KGC C;  5B40 A;  4X23 C;  3LEL B;  2PYO A;  4JJN B;  5AV8 A;  3R45 B;  3KUY D;  3LZ0 C;  2HUE B;  5AY8 D;  3MGP C;  3KXB C;  4J8X A;  2ARO C;  3X1T D;  4J8V D;  3AZH B;  1F66 B;  3MGR A;  1P3I A;  1T3U A;  3AZM A;  3AL0 C;  2Y2I A;  2NZD A;  3REH D;  2UWX A;  2F8N H;  1EQZ C;  5B1M D;  5B33 C;  1P3L A;  2NQB A;  3H0L C;  4ZUX D;  1KX4 C;  1TAF A;  2BG1 A;  3EPL A;  1P3G D;  3WAA C;  4XZQ A;  3WA9 D;  5CP6 B;  4R8P C;  4Z66 B;  3EPJ A;  4LD9 C;  3B6G C;  3VH5 W;  1P3M B;  3MGP D;  3KXB D;  1P3K C;  2ARO D;  1P3O C;  1ID3 A;  3AZE A;  1U35 C;  4XUJ C;  3V9R B;  1TZY B;  3B0D B;  3C1B D;  5CPK D;  5B0Z A;  3REI B;  1BH9 B;  3MGQ A;  3UT9 D;  4QLC C;  3MVD D;  3KWQ B;  4NE5 A;  1EQZ D;  5B33 D;  1HTA A;  4H9P B;  4H9R B;  5BO0 A;  5AV9 C;  1ULY A;  1KX4 D;  4ZBJ B;  4R8P D;  2BYM B;  4J8U D;  1M18 D;  2G5H C;  3AYW A;  4LD9 D;  3B6G D;  3AZG A;  4AWL C;  3B0C T;  5G49 A;  4UUZ B;  3AZF A;  1P3K D;  5B2I A;  3REL C;  2CV5 B;  1P3O D;  1HQ3 A;  5AY8 B;  5AV8 D;  3AV1 C;  5AVB B;  5GXQ C;  3A1K A;  5B32 C;  4J8V B;  3REK B;  1KX3 B;  3B6F B;  4QLC D;  3O62 B;  5GT3 C;  4YM6 A;  4M6B A;  2Y2L A;  5AV9 D;  3MGR D;  3C1C A;  3AZM D;  5AVC A;  1P3I D;  3W96 B;  3AZI B;  3W99 B;  5DNN A;  4ZUX B;  3LEL C;  2RIQ A;  4JJN C;  3TU4 C;  1PZR A;  3AZN A;  4XZQ D;  3X1T A;  3REL D;  5F99 B;  2L5A A;  2JSS A;  4H9N B;  3AV1 D;  5GT0 C;  3W98 B;  4YS3 A;  3UTA A;  2IO5 B;  3WKJ A;  5B32 D;  5DNM A;  3C1B B;  5B24 C;  5B1M A;  3UT9 B;  2YFV A;  5GSU A;  5AV5 C;  3MVD B;  3MGQ D;  3X1U A;  1P3G A;  2Y2J A;  4WNN B;  3WA9 A;  3LJA B;  4KGC A;  4Z66 C;  4X23 A;  1M1A B;  1N1J B;  1P34 C;  2FFF B;  3AFA C;  3TU4 D;  5B31 G;  3LZ0 A;  4J8U B;  3MGP A;  3KXB A;  1R4V A;  3VH6 W;  2ARO A;  2ZY4 A;  3AN2 B;  1P3A C;  1H3O A;  2ZY2 A;  5B40 B;  2PYO B;  3WTP C;  5GT0 D;  2ZY5 A;  4E45 A;  5B1L C;  3MGS C;  2BYK A;  3AZF D;  5BNV A;  1HQ3 D;  3AZJ B;  1AOI B;  3KWQ C;  2F8N D;  4J8X B;  1EQZ A;  5B33 A;  3UTA C;  5BS7 C;  1KX4 A;  4Z5T C;  4DRB A;  3WAA A;  1BH8 B;  4R8P A;  1P3I B;  1P34 D;  4LD9 A;  3B6G A;  5AV6 C;  1JFI A;  5GSU C;  3AFA D;  2NZD B;  3C1C D;  1P3L B;  5DNN D;  2NQB B;  2JCH A;  1A7W A;  1P3O A;  1TAF B;  1P3A D;  1U35 A;  4XUJ A;  2XD5 A;  2RVQ C;  3X1S B;  5FUG B;  3WTP D;  3AZN D;  5B1L D;  3MGS D;  5CPI C;  4QLC A;  4KHA A;  3A6N C;  5BNX B;  3O62 C;  1ID3 B;  4YS3 D;  3UTA D;  5AV9 A;  3AZE B;  3WKJ D;  4WZS B;  4Z5T D;  5DNM D;  5B0Z B;  3MNN C;  3MGQ B;  1M19 C;  1KX5 C;  3EPK A;  5AV6 D;  5GSU D;  3X1U D;  5E5A C;  4WU8 C;  3AZL C;  4CAY A;  5BO0 B;  3REL A;  4X23 D;  4KGC D;  1W2E A;  2Y2M A;  3AV1 A;  3W98 C;  3LZ0 D;  5GXQ A;  4KUD B;  2IO5 C;  4G91 C;  5B32 A;  3AYW B;  5CPI D;  5B2J C;  3AZG B;  5G49 B;  3AZF B;  1ZLA C;  5B2I B;  3A6N D;  5GT3 A;  5CHL B;  1P3B B;  2YFW A;  5C3I C;  3AV2 B;  4DRA A;  2FJ7 C; 
#chains in the Genus database with same CATH homology
 3LEL A;  4JJN A;  3W97 C;  3REJ C;  3F6T A;  5B0Y B;  1M19 D;  4CSR A;  3FDD A;  4J8W B;  3TU4 A;  3VH6 T;  1P3P C;  4YM6 B;  3WAA D;  3X1V C;  3C1C B;  4WU9 C;  5AVC B;  4UPK A;  3VH6 A;  5DNN B;  5JA4 A;  5GT0 A;  3LZ1 C;  1S32 C;  4E44 A;  4H9S C;  3KUY B;  3NQJ A;  1AOI C;  4HGA C;  3AZJ C;  1P3F C;  5B2J D;  1U35 D;  4XUJ D;  2F8N A;  5B24 A;  1ZLA D;  4H9Q A;  3X1T B;  5AV5 A;  3AZK C;  2FJ7 D;  5B31 C;  5CPJ C;  3UTB C;  3WKJ B;  4Z66 A;  4H9O A;  1P34 A;  3REJ D;  5JRG C;  3AFA A;  4G92 C;  3REH B;  1Q9C A;  2HIO C;  5B1M B;  2Y2H A;  1P3P D;  3WTP E;  4Z2M G;  3X1V D;  1P3A A;  4WU9 D;  1P3G B;  3WA9 B;  2HUE C;  3X1S C;  3WTP A;  1S32 D;  5B1L A;  3MGS A;  3LZ0 B;  2Y2O A;  3KXB B;  3MGP B;  3KWQ A;  3AZH C;  2ARO B;  4WJ3 C;  5GXQ D;  1F66 C;  5BS7 A;  4Z5T A;  1H3O B;  5CPJ D;  5CPK B;  3UTB D;  2BYM A;  4Z2M H;  5GT3 D;  5BNV B;  5JRG D;  5AV6 A;  1F1E A;  2HIO D;  2XD1 A;  5B33 B;  1EQZ B;  5CP6 C;  3LEL D;  1KX4 B;  4JJN D;  3VH5 T;  1P3M C;  3WAA B;  4R8P B;  4KUD C;  1M18 B;  1Z2C B;  3VH5 A;  3B6G B;  4LD9 B;  1JFI B;  5CPI A;  2ZM5 A;  5KDM A;  1TZY C;  1P3K B;  3B0D C;  3A6N A;  3O62 A;  1P3O B;  5AV8 B;  3REI C;  1P3B C;  1F66 D;  3AV2 C;  2Y2N A;  3MNN A;  5B24 D;  1M19 A;  5BT1 C;  5B0Y C;  1KX5 A;  2Y2Q A;  4J8W C;  4QLC B;  5AV5 D;  4KHA B;  4ZBJ C;  4WU8 A;  5E5A A;  3AZL A;  5CP6 D;  5AV9 B;  3MGR B;  4Z66 D;  3AZM B;  3A1I A;  1P3M D;  2Y2P A;  3W98 A;  4NE3 A;  2CV5 C;  5AY8 C;  2ZY3 A;  3NQU A;  5B2J A;  4AWL B;  4XZQ B;  3KSY A;  1TZY D;  5AVB C;  4CAY B;  3REL B;  1ZLA A;  3REK C;  4J8V C;  2FJ7 A;  1KX3 C;  3AV1 B;  5GXQ B;  3B6F C;  3W97 A;  5B32 B;  3KWQ D;  3REJ A;  5BT1 D;  3REH C;  3EPH A;  2DQN C;  3W96 C;  2J8P A;  3AZI C;  3W99 C;  1P3P A;  5GT3 B;  4ZUX C;  3X1V A;  2YFW B;  4WU9 A;  4WV4 B;  3LZ1 A;  1S32 A;  4DQY B;  4H9S A;  4CSR B;  3TU4 B;  5F99 C;  2CV5 D;  1AOI A;  3AZJ A;  1P3F A;  1B6W A;  2RVQ D;  5AVB D;  3AZK A;  3REK D;  5JA4 B;  1KX3 D;  5GT0 B;  5B31 A;  3C1B C;  5CPJ A;  3UTB A;  1BH8 A;  5CPK C;  3B6F D;  3KFU G;  3NQJ B;  3O62 D;  3UT9 C;  1HQ3 B;  5JRG A;  3B0B A;  3MVD C;  2F8N B;  1WWS A;  3H0R C;  2HIO A;  5B24 B;  4NFT A;  3AZI D;  4H9Q B;  3W99 D;  3W96 D;  3LJA C;  1M1A C;  5AV5 B;  3MNN D;  2CWE A;  3R45 A;  1KX5 D;  3X1S A;  2LY8 A;  5FUG A;  4J8U C;  4H9O B;  1M18 C;  1P34 B;  4WU8 D;  5E5A D;  3AFA B;  3AZL D;  2Y2K A;  3AN2 C;  5F99 D;  3AZH A;  5BNX A;  5B40 C;  2PYO C;  3W98 D;  1P3A B;  1F66 A;  5AV8 C;  4EO5 B;  3IP4 C;  3WTP B;  3H0M C;  3AZN B;  5B1L B;  3MGS B;  4J8X C;  1B67 A;  4YS3 B;  3UTA B;  5CP6 A;  3LJA D;  3MGR C;  1P3I C;  3AZM C;  1M1A D;  3W97 D;  4Z5T B;  1P3M A;  5DNM B;  2NZD C;  4KUD A;  1P3L C;  2NQB C;  5AV6 B;  2YFV B;  5GSU B;  3AN2 D;  3X1U B;  2W8S A;  3V9R A;  1TZY A;  4XZQ C;  4KGC B;  4X23 B;  5B40 D;  2PYO D;  3LZ1 D;  3REI A;  1BH9 A;  1P3B A;  3AV2 A;  2F2A C;  1AOI D;  3AZJ D;  1P3F D;  4NE6 A;  4J8X D;  1ID3 C;  5B0Y A;  5CPI B;  3AZE C;  4H9P A;  4H9R A;  4J8W A;  5KDM B;  2F8N K;  3AZK D;  3A6N B;  2G5I C;  5B31 D;  5B0Z C;  3MGQ C;  2BYK B;  2DF4 C;  2NZD D;  3MNN B;  4UUZ A;  1P3L D;  1M19 B;  2NQB D;  1KX5 B;  3KUY A;  2CV5 A;  5AY8 A;  2JE5 A;  4WU8 B;  5E5A B;  5AVB A;  3AZL B;  2Y2G A;  3X1S D;  3REK A;  4J8V A;  3AYW C;  1KX3 A;  3AZG C;  3B6F A;  4G91 B;  3AZF C;  1KU5 A;  5B2I C;  3AZH D;  1HQ3 C;  1ID3 D;  3NQU B;  5B2J B;  3REH A;  4XUJ B;  3AZE D;  1U35 B;  3W96 A;  3AZI A;  1ZLA B;  3W99 A;  4ZUX A;  5B0Z D;  5C3I B;  2FJ7 B;  3P5J B;  3W97 B;  3REJ B;  5B32 G;  3EG5 B;  4YM6 C;  3C1C C;  5F99 A;  2VQR A;  5AVC C;  5DNN C;  1P3P B;  1BFM A;  4H9N A;  3X1V B;  4WU9 B;  4KUD D;  4EO5 C;  3KUY C;  3AYW D;  1S32 B;  3LZ1 B;  3C1B A;  5CPK A;  3AZG D;  3AZN C;  3B0C W;  5B2I D;  3X1T C;  3UT9 A;  4HGA B;  3MVD A;  3REI D;  1P3B D;  1P3F B;  3AV2 D;  4WNN A;  4YS3 C;  1WWI A;  3LJA A;  3WKJ C;  1M1A A;  1N1J A;  3AZK B;  5B31 B;  5DNM C;  5B0Y D;  5CPJ B;  3UTB B;  4J8W D;  4J8U A;  1M18 A;  5B1M C;  5JRG B;  4YM6 D;  4G92 B;  3AN2 A;  2HIO B;  5AVC D;  3X1U C;  1P3G C;  2F8N G;  3WA9 C;  1P3K A;  4KGC C;  5B40 A;  4X23 C;  3LEL B;  2PYO A;  4JJN B;  5AV8 A;  3R45 B;  3KUY D;  3LZ0 C;  2HUE B;  5AY8 D;  3MGP C;  3KXB C;  4J8X A;  2ARO C;  3X1T D;  4J8V D;  3AZH B;  1F66 B;  3MGR A;  1P3I A;  1T3U A;  3AZM A;  3AL0 C;  2Y2I A;  2NZD A;  3REH D;  2UWX A;  2F8N H;  1EQZ C;  5B1M D;  5B33 C;  1P3L A;  2NQB A;  3H0L C;  4ZUX D;  1KX4 C;  1TAF A;  2BG1 A;  3EPL A;  1P3G D;  3WAA C;  4XZQ A;  3WA9 D;  5CP6 B;  4R8P C;  4Z66 B;  3EPJ A;  4LD9 C;  3B6G C;  3VH5 W;  1P3M B;  3MGP D;  3KXB D;  1P3K C;  2ARO D;  1P3O C;  1ID3 A;  3AZE A;  1U35 C;  4XUJ C;  3V9R B;  1TZY B;  3B0D B;  3C1B D;  5CPK D;  5B0Z A;  3REI B;  1BH9 B;  3MGQ A;  3UT9 D;  4QLC C;  3MVD D;  3KWQ B;  4NE5 A;  1EQZ D;  5B33 D;  1HTA A;  4H9P B;  4H9R B;  5BO0 A;  5AV9 C;  1ULY A;  1KX4 D;  4ZBJ B;  4R8P D;  2BYM B;  4J8U D;  1M18 D;  2G5H C;  3AYW A;  4LD9 D;  3B6G D;  3AZG A;  4AWL C;  3B0C T;  5G49 A;  4UUZ B;  3AZF A;  1P3K D;  5B2I A;  3REL C;  2CV5 B;  1P3O D;  1HQ3 A;  5AY8 B;  5AV8 D;  3AV1 C;  5AVB B;  5GXQ C;  3A1K A;  5B32 C;  4J8V B;  3REK B;  1KX3 B;  3B6F B;  4QLC D;  3O62 B;  5GT3 C;  4YM6 A;  4M6B A;  2Y2L A;  5AV9 D;  3MGR D;  3C1C A;  3AZM D;  5AVC A;  1P3I D;  3W96 B;  3AZI B;  3W99 B;  5DNN A;  4ZUX B;  3LEL C;  2RIQ A;  4JJN C;  3TU4 C;  1PZR A;  3AZN A;  4XZQ D;  3X1T A;  3REL D;  5F99 B;  2L5A A;  2JSS A;  4H9N B;  3AV1 D;  5GT0 C;  3W98 B;  4YS3 A;  3UTA A;  2IO5 B;  3WKJ A;  5B32 D;  5DNM A;  3C1B B;  5B24 C;  5B1M A;  3UT9 B;  2YFV A;  5GSU A;  5AV5 C;  3MVD B;  3MGQ D;  3X1U A;  1P3G A;  2Y2J A;  4WNN B;  3WA9 A;  3LJA B;  4KGC A;  4Z66 C;  4X23 A;  1M1A B;  1N1J B;  1P34 C;  2FFF B;  3AFA C;  3TU4 D;  5B31 G;  3LZ0 A;  4J8U B;  3MGP A;  3KXB A;  1R4V A;  3VH6 W;  2ARO A;  2ZY4 A;  3AN2 B;  1P3A C;  1H3O A;  2ZY2 A;  5B40 B;  2PYO B;  3WTP C;  5GT0 D;  2ZY5 A;  4E45 A;  5B1L C;  3MGS C;  2BYK A;  3AZF D;  5BNV A;  1HQ3 D;  3AZJ B;  1AOI B;  3KWQ C;  2F8N D;  4J8X B;  1EQZ A;  5B33 A;  3UTA C;  5BS7 C;  1KX4 A;  4Z5T C;  4DRB A;  3WAA A;  1BH8 B;  4R8P A;  1P3I B;  1P34 D;  4LD9 A;  3B6G A;  5AV6 C;  1JFI A;  5GSU C;  3AFA D;  2NZD B;  3C1C D;  1P3L B;  5DNN D;  2NQB B;  2JCH A;  1A7W A;  1P3O A;  1TAF B;  1P3A D;  1U35 A;  4XUJ A;  2XD5 A;  2RVQ C;  3X1S B;  5FUG B;  3WTP D;  3AZN D;  5B1L D;  3MGS D;  5CPI C;  4QLC A;  4KHA A;  3A6N C;  5BNX B;  3O62 C;  1ID3 B;  4YS3 D;  3UTA D;  5AV9 A;  3AZE B;  3WKJ D;  4WZS B;  4Z5T D;  5DNM D;  5B0Z B;  3MNN C;  3MGQ B;  1M19 C;  1KX5 C;  3EPK A;  5AV6 D;  5GSU D;  3X1U D;  5E5A C;  4WU8 C;  3AZL C;  4CAY A;  5BO0 B;  3REL A;  4X23 D;  4KGC D;  1W2E A;  2Y2M A;  3AV1 A;  3W98 C;  3LZ0 D;  5GXQ A;  4KUD B;  2IO5 C;  4G91 C;  5B32 A;  3AYW B;  5CPI D;  5B2J C;  3AZG B;  5G49 B;  3AZF B;  1ZLA C;  5B2I B;  3A6N D;  5GT3 A;  5CHL B;  1P3B B;  2YFW A;  5C3I C;  3AV2 B;  4DRA A;  2FJ7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...