3H0XA

Crystal structure of peptide-binding domain of kar2 protein from saccharomyces cerevisiae
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
ADVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 78 kDa glucose-regulated protein homolog
publication title X-ray crystal structure of peptide-binding domain of Kar2 protein from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 41
structure length 150
sequence length 150
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3h0xA00
1Q5LA 4EZWA 4HY9A 2QXLA 3C7NA 7HSCA 4EZVA 1DKXA 4R5GA 4B9QA 4F00A 2KHOA 1DKZA 4EZYA 4FL9A 4JWIA 4JN4A 4R5LA 3DPQA 3DQGA 3C7NB 2OP6A 4E81A 4JWEA 4EZZA 3DOBA 3N8EA 4R5IA 4EZPA 1DG4A 4JNEA 3D2FA 4EZXA 3DPPA 4JWDA 1CKRA 1YUWA 1U00A 4JWCA 4PO2A 3D2EA 4HYBA 4WV5A 4EZUA 4EZSA 3H0XA 1BPRA 4EZTA 4R5KA 4EZRA 4EZNA 4EZQA 4R5JA 4F01A 3QNJA 2V7YA 5TKYA 1DKYA 4JNFA 4WV7A 5E84A 3DPOA 4EZOA 2BPRA
chains in the Genus database with same CATH superfamily
1Q5LA 4EZWA 4HY9A 2QXLA 3C7NA 7HSCA 4EZVA 1DKXA 4R5GA 4B9QA 4F00A 2KHOA 1DKZA 4EZYA 4FL9A 4JWIA 4JN4A 4R5LA 3DPQA 3DQGA 3C7NB 2OP6A 4ILGA 4E81A 4JWEA 4EZZA 3DOBA 3ZEFA 3N8EA 4R5IA 4EZPA 1DG4A 4JNEA 3D2FA 4I43A 4EZXA 3DPPA 4JWDA 3SBTB 1CKRA 1YUWA 1U00A 4JWCA 4PO2A 3D2EA 4HYBA 4WV5A 4EZUA 4EZSA 3H0XA 1BPRA 4MQDA 4EZTA 4R5KA 4EZRA 4EZNA 4EZQA 4R5JA 4F01A 3QNJA 2V7YA 5TKYA 4ILHB 1DKYA 4ILIA 4JNFA 4WV7A 5E84A 3SBSA 3DPOA 4EZOA 2BPRA
chains in the Genus database with same CATH topology
1Q5LA 4EZWA 4HY9A 2QXLA 3C7NA 7HSCA 4EZVA 1DKXA 4R5GA 4B9QA 4F00A 2KHOA 1DKZA 4EZYA 4FL9A 4JWIA 4JN4A 4R5LA 3DPQA 3DQGA 3C7NB 2OP6A 4ILGA 4E81A 4JWEA 4EZZA 3DOBA 3ZEFA 3N8EA 4R5IA 4EZPA 1DG4A 4JNEA 3D2FA 4I43A 4EZXA 3DPPA 4JWDA 3SBTB 1CKRA 1YUWA 1U00A 4JWCA 4PO2A 3D2EA 4HYBA 4WV5A 4EZUA 4EZSA 3H0XA 1BPRA 4MQDA 4EZTA 4R5KA 4EZRA 4EZNA 4EZQA 4R5JA 4F01A 3QNJA 2V7YA 5TKYA 4ILHB 1DKYA 4ILIA 4JNFA 4WV7A 5E84A 3SBSA 3DPOA 4EZOA 2BPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5L A;  4EZW A;  4HY9 A;  2QXL A;  3C7N A;  7HSC A;  4EZV A;  1DKX A;  4R5G A;  4B9Q A;  4F00 A;  2KHO A;  1DKZ A;  4EZY A;  4FL9 A;  4JWI A;  4JN4 A;  4R5L A;  3DPQ A;  3DQG A;  3C7N B;  2OP6 A;  4E81 A;  4JWE A;  4EZZ A;  3DOB A;  3N8E A;  4R5I A;  4EZP A;  1DG4 A;  4JNE A;  3D2F A;  4EZX A;  3DPP A;  4JWD A;  1CKR A;  1YUW A;  1U00 A;  4JWC A;  4PO2 A;  3D2E A;  4HYB A;  4WV5 A;  4EZU A;  4EZS A;  3H0X A;  1BPR A;  4EZT A;  4R5K A;  4EZR A;  4EZN A;  4EZQ A;  4R5J A;  4F01 A;  3QNJ A;  2V7Y A;  5TKY A;  1DKY A;  4JNF A;  4WV7 A;  5E84 A;  3DPO A;  4EZO A;  2BPR A; 
#chains in the Genus database with same CATH topology
 1Q5L A;  4EZW A;  4HY9 A;  2QXL A;  3C7N A;  7HSC A;  4EZV A;  1DKX A;  4R5G A;  4B9Q A;  4F00 A;  2KHO A;  1DKZ A;  4EZY A;  4FL9 A;  4JWI A;  4JN4 A;  4R5L A;  3DPQ A;  3DQG A;  3C7N B;  2OP6 A;  4ILG A;  4E81 A;  4JWE A;  4EZZ A;  3DOB A;  3ZEF A;  3N8E A;  4R5I A;  4EZP A;  1DG4 A;  4JNE A;  3D2F A;  4I43 A;  4EZX A;  3DPP A;  4JWD A;  3SBT B;  1CKR A;  1YUW A;  1U00 A;  4JWC A;  4PO2 A;  3D2E A;  4HYB A;  4WV5 A;  4EZU A;  4EZS A;  3H0X A;  1BPR A;  4MQD A;  4EZT A;  4R5K A;  4EZR A;  4EZN A;  4EZQ A;  4R5J A;  4F01 A;  3QNJ A;  2V7Y A;  5TKY A;  4ILH B;  1DKY A;  4ILI A;  4JNF A;  4WV7 A;  5E84 A;  3SBS A;  3DPO A;  4EZO A;  2BPR A; 
#chains in the Genus database with same CATH homology
 1Q5L A;  4EZW A;  4HY9 A;  2QXL A;  3C7N A;  7HSC A;  4EZV A;  1DKX A;  4R5G A;  4B9Q A;  4F00 A;  2KHO A;  1DKZ A;  4EZY A;  4FL9 A;  4JWI A;  4JN4 A;  4R5L A;  3DPQ A;  3DQG A;  3C7N B;  2OP6 A;  4ILG A;  4E81 A;  4JWE A;  4EZZ A;  3DOB A;  3ZEF A;  3N8E A;  4R5I A;  4EZP A;  1DG4 A;  4JNE A;  3D2F A;  4I43 A;  4EZX A;  3DPP A;  4JWD A;  3SBT B;  1CKR A;  1YUW A;  1U00 A;  4JWC A;  4PO2 A;  3D2E A;  4HYB A;  4WV5 A;  4EZU A;  4EZS A;  3H0X A;  1BPR A;  4MQD A;  4EZT A;  4R5K A;  4EZR A;  4EZN A;  4EZQ A;  4R5J A;  4F01 A;  3QNJ A;  2V7Y A;  5TKY A;  4ILH B;  1DKY A;  4ILI A;  4JNF A;  4WV7 A;  5E84 A;  3SBS A;  3DPO A;  4EZO A;  2BPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...