3H11A

Zymogen caspase-8:c-flipl protease domain complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
244
structure length
212
Chain Sequence
b'QSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASP8 and FADD-like apoptosis regulator
publication title Mechanism of procaspase-8 activation by c-FLIPL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 77
structure length 212
sequence length 244
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h11A00
5IAJA 2H5IA 1ICEA 2CNLA 4ZVSA 4EHLA 4JR0A 2H4WA 5IAKA 3R7BA 2C2KA 2C2OA 2Y0BA 2FP3A 4HQRA 2CDRA 2CJYA 4QU5A 5IBPA 4N5DA 4NOKA 2AR9A 2QL5A 4QUBA 1PYOA 2P2CA 4NOLA 5IBCA 4FXOA 3V6LA 5LUBA 2WDPA 4D3ZA 5IABA 2FUNB 2Y1LA 2C2MA 1RWOA 2QL7A 4NOMA 1F1JA 2HBZA 5H0IA 3SIRA 5I9BA 4AWAA 1RWKA 2NN3C 4PRYA 4JJEA 3IBCA 3D6FA 1I4EB 4EHFA 1NW9B 4QULA 4ZVTA 4QU0A 4EHNA 1RHKA 1RHRA 5LUAA 2XYPA 4JQZA 3RJMA 3DEIA 2K7ZA 2XZTA 3P4UA 4N6NA 5K20A 2H4YA 1SC3A 3V6MA 2H51A 3V55A 3V4LA 4PS1A 3OD5A 3R7SA 4FEAA 1JXQA 1KMCA 2H65A 5LU8A 3IBFA 3R6GA 1RWNA 1CP3A 3H11B 4JJ8A 4QUJA 5LU9A 3ITNA 1RWPA 4N6OA 3R6LA 2CNNA 4EHHA 4QU9A 1SC1A 2J33A 1F9EA 1RHUA 4PS0A 4EHDA 3P45A 2HBYA 1K86A 2J30A 3E4CA 4HQ0A 3R7NA 3BIJA 4D3XA 3GJSA 4QTYA 4ZVOA 4M9RA 3H1PA 4ZVRA 5IC4A 3PCXA 1M72A 4QUAA 2H54A 3D6HA 1RHQA 2CJXA 3DEHA 2HBRA 3H13A 4QUDA 3S70A 4DCOA 4DCPA 1QTNA 3PD0A 3PD1A 3KJNA 5IARA 4EHAA 1I51A 2H48A 2QLFA 2H5JA 3K7EA 3UOAB 4JR1A 3SIPA 1I3OA 3D6MA 1RWVA 1NMQA 1SHJA 1IBCA 2CNKA 2HBQA 4EJFA 4D3YA 4NOJA 4FDLA 4QUHA 3GJRA 4AWBA 4IYRA 2XYGA 1RWXA 4QUGA 4FGUA 3V3KA 4NBLA 1QDUA 3NS7A 2QLBA 3H0EA 4QTXA 2XZDA 1CVRA 3KJFA 1RWMA 2XYHA 4ZVPA 2FQQA 2C2ZA 4QU8A 1RHMA 4IEFB 5JFTA 5IC6A 3V4OA 1BMQA 4PRZA 4JB8A 4N7MA 3R5KA 3QNWA 5IAEA 4I1PA 4DCJA 1K88A 1RE1A 1GFWA 1NMEA 1GQFA 4JJ7A 4JR2A 3GJTA 4ZVUA 1PAUA 2DKOA 4NBKA 4N6GA 2J32A 4QUEA 3GJQA 4JQYA 2QLJA 4LSZA 3DEJA 3NR2A 2C1EA 3S8EA 1QX3A 1NMSA 4ZVQA 5I9TA 3NKFA 4I1RA 4N7JA 1SC4A 1SHLA 2QL9A 1RWWA 3DEKA 4QUIA 3UO8B 4NBNA 2CNOA 2J31A 3KJQA 5IBRA 1RHJA 3H11A 1I4OA 3EDRA 4EHKA 3R5JA 5IAGA 3EDQA 5IANA 4HVAA 4AW9A 5IASA
chains in the Genus database with same CATH superfamily
2PR7A 3FHCB 2VC2B 4GI2A 5AKEA 1PP4A 1KEPA 3RASA 5KMGA 3GZJA 3IP3A 3QOFA 4JR0A 1MABB 3C85A 4WI1A 1QRUA 4M1WA 2BFBA 4RDCA 4CCSA 3C97A 2P6MA 3KE8A 2O3QA 2Y0EA 2Z83A 5L53A 3PXDA 3TAUA 3PS9A 3AR2A 2GN0A 3CUWA 3RYTC 3TXAA 3F8WA 4EBBA 2DJIA 4V0RA 1V2HE 13PKA 2Y6VA 4RZHA 4Y8VA 3ZLUA 4NV1A 2VSYA 3DSRA 3FMFA 4TS1A 2CUZA 5IJ9A 2COUA 3HXMA 1FZTA 1IQPA 2G7ZA 3NB0A 1WWKA 1SD2A 2B8NA 2YW2A 3RR2A 3TPCA 1TXGA 3EIEA 4NCJA 3T06B 4JJEA 3TSOA 3MILA 3ZWQA 3WO1A 4IF4A 1LPAB 3E9NA 3NGLA 3KR2A 4FS3A 4G24A 5DP2A 4X8HA 4YO7A 5ALYA 1L3IA 1PR2A 3TSYA 4BRWA 3VX3A 1SEVA 2HA5A 3ER6A 4BLVA 1TCCA 3FLEA 3GFSA 3ETEA 4Q1DA 1UJNA 3T3NA 5JCPA 4R1PA 1H2FA 1V45E 3H42B 4ZK6A 3QNUA 2BFEB 5A05A 1KETA 1CZRA 4IIHA 4DARA 1T9HA 1AD2A 3O8QB 4QRHA 4X6UA 3SNHA 5K8CA 4NXMB 3NHFA 1LRLA 4K7JA 2J33A 3F5QA 5C46F 5EHZA 2G83A 3CPJB 3JQGB 5IYZA 2J30A 1YU9A 5G3YA 4HXYA 1P0CA 1ZKMA 3CRNA 2XW6A 3GGOA 3HCDA 3N87A 4I1YA 4QSMA 1BIFA 4P84A 4PX9A 4F93B 1B8OA 4BCCA 4QUAA 4RTNA 4P83A 5CDTA 4E5SA 3AUUA 3H5RA 1RPTA 3JVIA 3VVMA 1IM8A 2C5BA 3RO7A 3FKJA 1JA9A 2QVZX 4B8YA 3UOAB 2HY7A 4F5YA 4O0LA 1J5PA 2F48A 1AGNA 1KI6B 2NAFA 2O06A 4YQYA 1BKYA 3SX2A 1WCWA 1JG3A 3KZOA 5JWHA 1AH2A 5G41A 1X8LA 2FPOA 2VQ6A 4ZO6A 6PFKA 1T13A 4B6EA 1REQB 3BF8A 4O4HF 4B7CA 3CVXA 3HKDA 1UXGA 1VE1A 2QW0X 4KEAA 4TLEA 1Y9DA 2A5GA 4IH1A 1ONNA 3WFIA 3O4FA 4K6HA 1O2DA 1MOZA 1CVRA 3EZNA 1OXBB 8OHMA 2Q3BA 1ECGA 5GMOA 4P8RA 1E2LA 1HWYA 2FG6C 5BMVF 2O7NA 3RS2A 3QFTA 3Q15C 3CEJA 1MVLA 2ZFUA 2C4WA 3HABA 1OI3A 1OXKB 2PX8A 2ZWAA 3BL6A 3MT8A 4R81A 4RDXA 1M2NA 4TV9B 2GYYA 4Q9DA 3A32A 4BNUA 5JJ5A 4QNNA 3DAHA 4YAJA 2I9KA 2R6HA 1K88A 3ZI7A 5B12A 4E12A 3D2AA 2A0UA 3GJ5A 5E7QA 2D0PB 1DZ3A 2BVNA 4KYIB 3VYTB 3AEZA 4EGFA 3CR8A 3DNPA 2GF0A 3CE6A 2YC4C 2LDXA 4RD1A 5BOSB 3UBMA 1YQTA 1AB5A 4MAAA 5DPMA 4DWOA 1E2BA 1M2HA 4IW3B 5E3HA 3ZNQA 1PJBA 1M34E 5BNZA 3GUUA 5KINB 4S1TA 1G7CA 2QK4A 3N0RA 4F2HA 3RSLA 3KKZA 2J6BA 1MJGM 4FFNA 4AZSA 1CUCA 3ZI0A 4M2LA 1H05A 2XKJE 4K9MA 4RV9A 3L1VA 4DJTA 4IHJA 1CUAA 3ILYA 4B4OA 1ZIXA 4BGIA 3GBPA 4X71A 2E0IA 4PSDA 1N2SA 3AM1A 2ODBA 3Q2OA 1ECFA 1Z8DA 3Q9LA 2PWPA 1RMYA 3GDGA 3MW8A 3PC8C 4FMBB 1C81A 3RVDA 3QLVC 1P74A 1YR3A 4O02B 4N5DA 2F3PA 2LV8A 4BO9A 5AD1A 4BVBA 4EMUA 1P9RA 2CJPA 1DE0A 2F67A 3U3MA 2GLTA 3D0RA 1E8MA 2FW9A 1F6DA 5DYWA 3ZWOA 4IIJA 1M5UA 4UTZA 1WVMA 1XRLA 1JA1A 1P19A 3ZHQA 5LQCA 1RWKA 2I66A 1S2GA 3VO8A 4TMYA 3ZIDA 1TJNA 1ZN2A 2ZS9A 1JKJB 4TV8B 4XFJA 4M0MA 3WL8A 3D7LA 1QDLB 3ZCRA 4EIWA 4DV0B 3GOQA 3HB7A 4GVPA 4LRYA 4KV9A 3UMVA 4BNZA 2QTRA 4EFNA 5AJXA 5JNWA 4OIMA 3UY4A 4LHVA 3EG9A 3VNAA 3X3HA 3PQFA 4LYHA 3W9YA 3I3OA 3QXCA 5K0JA 5CT8A 1W49A 4D4KA 5BSFA 3L8YA 5LYJF 4URFA 2I7CA 3TTVA 4JJ8A 1S9HA 2QRUA 4EEKA 2DPGA 3U4AA 2PQMA 2ZSAA 1KPGA 3GLTA 1FMCA 2VF5X 4KNVA 4ACAA 4DQUA 4ZMBA 3UWDA 4EF5A 1NAIA 1NVUQ 2H8KA 2QAGA 2VF4X 1O08A 2HGSA 3GB9A 4R1OA 1R0KA 2IYEA 3QX9A 1KYYA 5F2EA 4PZZA 1ONPA 1XTJA 1EM8A 3L4BA 1KMHA 3UKDA 1KJZA 2YHBA 5E6UA 3NVDA 3T5MA 3V4PB 4Q7LA 3M9LA 1GGFA 3LX4A 1CJTC 2JARA 2YN4A 5AM3A 1DC5A 2GA9A 4TOIA 2Z3VA 3LKVA 2XOKA 3QELA 1GAJA 3K9GA 4KWTA 1BE8A 3B78A 4K03A 2ACEA 5DGXA 1NHGA 3K0BA 2EL9A 4JK3A 1HZZC 3SZRA 2VDVE 1GNRA 4JA2A 5FWNA 1XZBA 3UNXA 2HLNA 4CL2A 1QONA 5K99A 5DYTA 3O3MB 3FNQA 3BXXA 4BBJA 2H1FA 3GN2A 2PS3A 1ZH0A 3MTDA 4BNGA 4NBLA 9GPBA 1DKPA 2HDNB 2ZYVX 3BIFA 3NS7A 4XJVA 4AY2A 2O8BA 1WUHS 2VHZA 3G5AA 1A9XB 2WLTA 3PPYA 1Y48E 2AS0A 1F1BA 1XZJA 4I50A 1BHQ1 2EQAA 2KBEA 5A9SA 5ER6A 3N7AA 1GITA 1NJ8A 2CXNA 2V55B 2WE7A 2GYVA 2Z1DA 3QMPA 1SOVA 1R0LA 1X70A 4I4NA 4OQZA 4GX0A 5ARDA 4BLPA 1T8TA 2Z95A 3FOAA 5HCNA 5KWJA 2O6HA 3RTGA 4MVCA 4N3BA 1LW7A 2ZQYA 1PFVA 2PX3A 1XQYA 3FW1A 1TVCA 4UPEA 3PGLA 1EE2A 1B42A 3NIWA 4ZVUA 5KDOA 2RI6A 2VDWB 1K4MA 4PVDA 1H2RS 1UANA 4UVGA 3ANNA 3OMXA 3NR2A 1PKEA 4ZCMA 1KKLA 3LX8A 4K05A 4UEKA 3CC8A 1AK1A 3QRWA 4RKFA 2OQVA 1I80A 4ZYWA 4LFBB 3CWCA 2GTPA 4GDFA 1AS3A 4B35A 2HWXA 2UKDA 4AN4A 3PIIA 2KMLA 3WQSB 4RVDA 4KBGA 1M8JA 1S96A 2FW8A 4Z8YA 3VR2D 1Q19A 3MTJA 1OU4A 4HSGA 1QP7A 3IDZA 4YCDA 1QPZA 3OKFA 3OC6A 4F92B 1SXJD 4OXKA 4DKJA 3AEUB 4IFBA 5LWQA 2GFIA 1T4CB 2VO1A 3CCCA 3Q7IA 3R7BA 2V3VA 4ZU6X 2CDRA 4WADA 2WJ4A 4MK4A 4AZ0B 2YICA 4KWCA 3KR1A 3NWEA 4ZD6A 3DE7X 3S5UA 3IPXA 3WNZA 3KBBA 1FJXA 5H5JA 4CLEA 1W44A 3D81A 3NCHA 3WB1A 1YZFA 2BGWA 1VPVA 3IQHX 1G21E 2JD2A 3FCAA 4Z1OA 2IIPA 5B6PA 1A71A 3PL5A 4IQ4A 4XCQA 4MW7A 4RSHA 2R6JA 3A3OA 4I2NA 3DPIA 4YDHB 4DGSA 5EQDA 3AHJA 2A9KA 1MAAA 1G3MA 3OKPA 3F7OA 3QVXA 3UJDA 4B40A 3HYLA 1YRAA 5CXQA 5GZ3A 4NBTA 2G80A 5J3JA 1PFKA 3RYIB 4EPVA 2IYSA 1FSSA 2H3HA 2HK7A 3RC8A 1DFIA 3F5FA 1KHHA 5HKBA 3UJAA 2DY0A 2OA0A 1P3Y1 5JHGB 4R69A 3NM6B 5FPQA 1IBMB 3QHQA 2PD4A 4R2XA 2CNNA 4WJZA 5KHAA 3VU3A 3EH2A 4ZXFA 1FMFA 3C5CA 4RTMA 1UH5A 3O0DA 1OTYA 2PXCA 1PT8A 1Z8NA 1K9SA 1T6NA 2A9VA 2M6RA 4FE7A 5KPDA 4RHFA 4RANA 2C5FA 1JWLA 2JAOA 3U40A 2E4ZA 2HBRA 4GLBA 1JALA 3ICOA 5DSXA 5TRTA 1MEOA 1K7FB 1GXSB 2L42A 5DLDA 5FB3A 4DMLA 2WF6A 5KU1A 4AK9A 1W5EA 2QZJA 3OF3A 1N8SA 3OZIA 3S7ZA 1OXXK 4P4SA 5HEKA 3AKCA 3WGTA 1F60A 3RJ5A 3IOBA 5EAIA 3T5CA 5I01A 4ZYLA 3JTMA 1SU7A 2IU0A 3PR2B 4JXKA 3LI2A 1Q6ZA 1YUBA 2ODAA 2Z6UA 4LF8B 4Z4IA 1JR4A 2F9MA 3EBOA 4ONEA 5IM4A 2WWYA 3GLHA 5DW0A 3OEEA 1HFKA 1V37A 3MSXA 2X2EA 1YNSA 3IILA 1ZVMA 1E3EA 4G1VA 4ZVPA 2I4TA 3KXKA 4QU8A 1Q91A 5D01A 4AUNA 4BO0A 1O1YA 5F73A 2P11A 5G53C 1ID8A 5COBA 4NX2A 2WWIA 2F3TA 1OWOA 4IO0A 2I29A 2AN1A 2QZSA 2V0CA 3CPHA 2GBCA 1Y3HA 3S27A 3GQBB 3FPAA 2GR9A 1PZEA 3PGA1 4U8GA 3STVA 3RU3A 4RKRA 2F9FA 2Q2NA 3ZWDA 3MD9A 3TW8B 2HO4A 1OU0A 4U5XA 4J0JA 2P6UA 3HZRA 2JH9A 4LDPA 4U7GA 2WY2D 2BGMA 2L2QA 3BTSA 3CLKA 3GL9A 2CCKA 1GPDG 1GRNA 3A6FA 3PPIA 5BSTA 1L5HB 5KYXB 3OJXA 1M73E 2WFAA 3H7AA 1HRKA 1V6AA 2HMWA 1OBFO 3OM8A 2HJGA 5HJ2A 3DDWA 1BJKA 3I1YA 1UJ2A 3ORSA 2NG1A 4ZVVA 3BE4A 1K7EB 3ZOZA 2A6PA 5C8YA 5B64A 3BMNB 3OZRA 2FA9A 1GSHA 1R0RE 2QRNA 3ET5A 1HQDA 2NV0A 3ZWNA 3U80A 5CB8A 5L8VA 2D1YA 4UM9D 3LXXA 2ZBRA 4ZT3A 3EEOA 1WBDA 4YNBA 1BOFA 3DWEX 3IQIX 4C4PA 1NVAA 1FIUA 1NDUA 1UZUA 4L3OA 3GT0A 3IULA 3TGWA 5K5EA 4ERXA 3IOCA 3C3BA 1H5NA 3IAM1 4LPSA 3WKEA 4PLTA 4PZAA 1QVZA 3IEMA 5CYGA 1JVSA 1A5TA 2BI8A 2JLBA 3QM1A 4YT5A 1L7BA 5AOVA 2PUFA 1RLTA 3JASB 1W4AA 1AC5A 2JAPA 4B4UA 4X0EA 2L69A 1EHCA 2WF5A 1U7TA 2PRJA 2XMQA 1VTKA 3OA0A 3KB1A 4XOUA 3NRJA 5FOSA 1FJ2A 3CZCA 2FNAA 4X6XA 4ZOLA 3PL1A 4EH1A 1YIDA 5CYPA 4Q18A 3CJTA 5GGXA 2R6ZA 1DJQA 3UHPA 5ESDA 4MUNA 5IHPA 3BRSA 3LW8A 3U4QB 1HKUA 1Y8RA 4MITA 4YMTA 5B7QA 2V7PA 1XU4A 3PGKA 3VVLA 4KYUA 3MT0A 3W8EA 4NYMR 4KQ1A 4YP6A 4CZ2A 3ZK7A 2IQ5A 5CH3A 5AXBA 2UUAB 4GR9A 1NJ6A 4QXQA 1QGUB 3EOBI 4L4SA 4KIUA 1WXEA 4WZBE 4ALKA 1GNSA 2UU9B 2J08A 3D6TB 5CIYA 1SHKA 1SXJE 3DDNA 5KCZA 1TTHA 4EUHA 3PUXA 4TX1A 4UKDA 3SMQA 2ATVA 3WWZA 1QHFA 3H65A 3R9WA 3OIGA 5J2UF 5HKKA 3NVKI 4KPYA 1W581 4YAUA 4URUR 1KEZA 4HDSA 4ZA2A 2DKFA 5IDXA 2Z04A 1JDNA 2UZ0A 2HDWA 3Q5EA 1UPCA 2ZCVA 3S1AB 4QOHA 2D06A 3TLJA 5B3LA 4UHCA 3GEEA 4NJEA 3ZWYA 1KRXA 1RBYA 3U0VA 3L5KA 1A9QA 2XIQA 3LLSA 5DLEA 1R4NB 2DLDA 2GT1A 3ZZTA 3H5WA 1JEDA 3OBIA 3PWTA 3H7IA 3IT0A 4K81B 2P9BA 5HKLA 4JAVC 4EEZA 1UT6A 2ABWA 4PAOA 4FDAA 4JI5B 3DE4X 1PR1A 3P9PA 3HXKA 3SHFA 1LWOA 5BUSA 1GCOA 4HAZA 3C1TA 3H5IA 4RQUA 4BBAA 1P73A 4ZTUB 2I2DA 5ERYA 2GM4A 1XTTA 2R47A 5EOVA 3QMWA 4HEA1 4G0XA 1PNOA 4N8DA 4IGEA 5JAOA 2W5UA 3R3ZA 3ANXA 1TQ8A 3FNHA 1SB8A 1AG9A 1EXNA 1NP7A 1VJGA 1QTIA 2X13A 3PXCX 4FE3A 2JIRA 2O07A 2VZ9A 3UH1A 2CCJA 2VN8A 3F78A 3KWLA 1T2VA 4RD4A 6YASA 1CNFA 3QKUA 1IEQA 3CZPA 3K0KA 5EJIA 5E9JA 4F45A 3OQBA 4HDMA 4A2WA 3AJAA 4D44A 1KU0A 1DXOA 1KJJA 4D4LA 2RH4A 3GW8A 1DTEA 4JMPA 1KQOA 4ER7A 1RZUA 2HA3A 1R9NA 4QHTA 4RLQA 1EP3B 1BS2A 5CB4A 2JHCA 2K5UA 4PTZA 5AMXA 2IYAA 3SF8A 3K70D 5HCUA 4RFLA 2YQ5A 3N86A 3E9RA 2R7MA 1QBGA 1RHJA 2VCHA 2YXEA 1UBHS 3L2OB 1R3UA 1WU8A 1P5FA 1K6JA 1YZGA 3IS3A 4H6XA 3T7CA 5EXPA 4BX0A 4YROA 5A06A 3ILXA 3ORHA 1Y6RA 4QPPA 3TL2A 1A76A 1PCXA 3L6OO 4XLTA 3CO0S 3K09C 3OSUA 1H1TA 2QLMA 3R0ZA 4JSTA 4XYMA 2JZNA 2QB5A 4CWAA 2OBYA 4EG7A 1DXYA 5TS3A 4TS4A 5EE1A 1JXAA 2Q3JA 3TEJA 4C08A 3BDVA 1XKQA 4X60A 4UHKA 1IYZA 1IG0A 4W6ZA 1BDBA 1I6WA 1QIKA 5CDFA 2ZVPX 5F64A 3JSXA 3L8EA 3ADOA 4NFYA 4OMUA 3QYFA 4OB7A 4AKTA 1USGA 5A3QA 1XTSA 1D5CA 4Z8XA 3FYDA 4D0SA 1NQVA 1PDOA 1ZW6A 2ZYSA 4NFSA 4R9SA 5LBTA 1CUBA 1PW5A 2OXFA 3GCWA 3QI7A 4MUBA 1P4GA 2CHVA 2Q6LA 5HMLA 4GO1A 3UV7A 5JNVA 3FPBA 2PHZA 2YOHA 3EJ6A 6REQB 4OHKA 2IDZA 1V8BA 5M34A 3RANA 4RPHA 3LHDA 4TT3D 1GYRA 3CMCO 3T1YB 2P6PA 1L7DA 7ABPA 2EIHA 3X2EA 3O95A 2B20A 2GFHA 1UXOA 5JQGB 1ZPDA 3I4FA 1KZ1A 5IWAB 4D8TA 3IMKA 5E7JA 5FJJA 2P65A 1QOQB 2CF5A 3DTNA 1ZD9A 4ECEA 1A7JA 1LPSA 3QVMA 2CXRA 1OHHA 2G28A 4YYZA 4XW2A 1YB5A 1BMTA 1ZOSA 2Y1DA 4WY5A 5EKDA 3NLLA 4Q0MA 4GOND 5CLGA 5LQUA 3GMSA 1VDMA 1W35A 4CKWB 1LNZA 2WYWA 1X7YA 4Z4EA 2OHFA 3OZBA 1N6HA 4E2ZA 1U4NA 3ICPA 3DZGA 3P7MA 4WCVA 1I0IA 2ZRAA 4KQ2A 4RCYA 2PGAA 2H59A 3P19A 1SHZA 1O6BA 2F1OA 1H9BA 5CBKA 2AG5A 1NW8A 4MV6A 1KE2A 4FJ1A 3PA8A 5JDCC 2XOKD 5F12A 2EKZA 3DBRB 2WTMA 2VAPA 1SQ6A 4YMHA 5AVSA 3B85A 1PI3A 1DLJA 1TRKA 1DT3A 1KYWA 4LOHA 1UKCA 3I23A 5E4FA 5JAQA 1X19A 2IYNA 3EOAI 2FX5A 5GGYA 2WW8A 3DL0A 3Q3CA 4AKGA 3AP1A 3U1VA 3VNRA 1IDN1 2WF8A 5DGTA 4CM1A 5T4HA 4FW8A 2ONKA 1JKXA 3IAS6 1C2YA 5FULA 3ZTWA 3HCNA 3NC0C 4HWKA 1P4RA 4G4SO 4M0FA 2CLIB 1K8RA 3TRIA 1U8FO 2FFQA 4QDXA 3SR4A 1NC3A 2DRIA 4E03A 4PYOA 1FBTA 3SEZA 5AHOA 3RT9A 2VK1A 2QLJA 2GPNA 4GW3A 1N34B 1RRPA 3P9ZA 1KE1A 1WUIS 3NI2A 5DIFA 4O63O 3QEMA 4X63A 2A9RA 3UO8B 3K6KA 2BDEA 2HMVA 2GI4A 3CNHA 4FM9A 1QQ6A 1TKRA 3LHSA 4KGVA 4JNCA 4LOAA 2ZBUA 3DONA 1FMLA 2BTEA 5A02A 4V03A 1P44A 3LBFA 5D3MB 3Q5GA 1WDWB 4ZU3A 3TOVA 4DLPA 3VI3B 2IGTA 1KEVA 2CNLA 2A5DA 4AZWA 3BMCB 3GLIB 2QQ0A 1M54A 1N6LA 2Y0BA 3N39C 5FBKA 2EXXA 1M8FA 4L5JA 1E69A 4CF5A 1TVEA 3UM9A 4CR7A 3KKOA 4HT3B 5AW4A 1U8CB 1X7WA 2WE8A 1EVQA 2FEWB 2WM9B 3RSFA 1IZYA 1T8YA 3WLHA 1G20A 3KQVA 2I6FA 4EI7A 3ILHA 5CVTA 4B3BA 1P5RA 5MF6A 3MIIA 4NYJR 3OM0A 1SVUA 4JUFA 5TB5A 4UOEA 2O48X 5FCDA 5JH7F 1R6UA 1USVA 4H7HA 1ND6A 2BRUC 1EEHA 1PJ3A 2H4JA 2ZJ8A 3BDAA 1EZZA 4KITB 3FGNA 3L3BA 5SZKB 4FLEA 4G4JA 1CUVA 4RTRA 4CI9A 4CJXA 1FFCA 5T8KA 2O8VA 2RCYA 3NP7A 1K3UB 2OZLA 4P7FA 3N8NA 5D84A 4ECAA 4RS4A 4D98A 1ABBA 1O95C 1ZUNA 3R0IA 4ZEOA 4NPHA 5A4MS 1OASA 3D1LA 4HRAA 3IOYA 5J4YA 4N0QA 1D1SA 4RVUA 2CUTA 3DQQA 3JWPA 2EGGA 2HIHA 1MIOB 2XUOA 5FUQA 4L08A 2F3UA 2GPYA 3CKLA 5LB2A 3MJSA 2NXCA 3E7WA 1YQGA 3D1JA 5KSOA 1HOXA 3U62A 3COZA 3HJBA 2YXLA 4KPFC 2X15A 2CYAA 3NU1A 5C5CA 1G55A 3OPXA 1ZX1A 5ITZB 1RC1A 3VR6A 3TLGB 5KC9A 4DUYB 5EJMA 3IPCA 3CNOA 4C88A 4YCSA 3OUUA 2P9TA 2XD4A 4LHXA 5DX0A 2ZSHA 4DJDC 4OQQA 1Z25A 3DOUA 3AY0A 4AURA 1N6PA 1DBVO 5FAXA 3R7DA 4EKNB 1DG1G 1XYYA 2I4NA 2MSWA 4FYWA 1I36A 3JYQA 5G3ZA 2C2HA 3IQZA 4LMPA 2WWXA 4IP0A 3RADC 4OBXA 2PT6A 2WZBA 2NU6B 3HYCA 3M9XA 4Y3UA 5BO5A 3HA7A 2EP7A 1VG1A 4UD2A 4HNVA 2ISCA 3QVWA 4C1NA 4EGSA 4A3SA 5CVDA 5EMNA 4EUNA 5KOHA 1NUSA 2DUNA 3KHKA 3EPRA 4I46A 5CT9A 4DUZB 3H4MA 4YP5A 4G09A 2IPAB 1FJGB 3OEED 3E18A 2V1UA 3B1JA 4DDMA 3ELDA 2KBFA 1DCMA 1Q44A 4C0JA 3K9LA 4OREX 2YHIB 1CWUA 2JLUA 3D3JA 1SCUA 3T12A 4DA4A 4ENVA 5EJFA 4HLUC 1DIOB 4PQFA 3LQYA 4FQ7A 2CV0A 4LE2A 4NBKA 4H6PA 2AG1A 1LPPA 3NHUA 4EG4A 5I6DA 3LUBA 2QP3A 1SU8A 3K96A 5JDIA 1QH8B 3EZYA 3AR9A 4O4IF 4MRMB 4OLHA 4W7IA 1GR0A 1CHDA 3RRYA 3BQMB 3PNPA 4PNZA 4ZXPA 3A36A 4C6TA 5L51A 3KEFA 1G8SA 4YS6A 2G6BA 4IGAA 2SKDA 1GARA 4LGYA 1Z35A 2FN3A 1NOKA 2X23A 3IQWA 4Q3EA 1KJNA 4F6RB 1I2BA 2J3KA 3AIKA 3PF9A 5JNTA 3EUWA 1E9RA 3VC2A 2GJ9A 1AN9A 4IFIA 4PIMA 3T35A 3W5UA 3SGLA 2O8DB 2BM8A 1EWKA 1WB5A 4TROA 3RSOA 4G26A 1E1MA 1W2WB 3H9UA 2WHQA 2O2XA 1NW7A 3WNVA 1FRVA 5CEFA 4GZ3A 5JPIA 2NQ8A 4F3TA 2LIPA 4Z1MA 3ISTA 4NNOA 3SFVA 4LF4B 1TRHA 2HLDA 2BL4A 4ADSG 1J9EA 4R0VA 4RU1A 3WNCA 1B6TA 1ZH8A 3AK4A 3IR7A 4RJIA 3EEYA 4EVRA 5LM3A 2EZ8A 1NI5A 4J94A 2NAPA 1T2AA 4FC6A 2OAQ1 2JKYA 3ZCPA 4BLRA 1ULUA 3LVQE 3AG6A 3OZFA 5ICFA 1KTIA 3K2BA 5IUKC 1GZ7A 3KT8A 5LZ5A 5DHTA 3UH0A 1YZ3A 5H3CA 2C98A 1UJ5A 2PV7A 2QRPA 5EJ4A 5K20A 3UMBA 1VPWA 2PUGA 2XZLA 5FOUA 1VPDA 1ZCAA 5E9WA 3ESQA 1X1CA 2IOHA 3MEQA 1DO2A 3MUFA 3WLKX 1E63A 1ZM3A 1U6IA 1IVSA 3JAKA 3V1UA 3AI1A 4RK6A 3G0BA 5IP5A 1A5ZA 1CQJA 3KVRA 4CV0A 3IFSA 4D4MA 1UEIA 4X3PA 5D7BA 1UXKA 2HBYA 1NZFA 1V9SA 2ZTUA 3CUVA 2W2MA 2OV4A 3T4XA 1CY1A 3N2ZB 4DXDA 1I4TD 2WQZA 1GN8A 1B73A 1X8JA 1TUEA 2Y1OA 2ZK7A 1N1DA 4E7OA 3ZLVA 2DXIA 2YVKA 2CD7A 4KWHA 3T9EA 2PRIA 3RYFA 3X0DA 1B8NA 3F5MA 3DE0X 4BFTA 3I30X 4Q3AA 4FN4A 2JGJA 3VZDA 4GOJA 3N2EA 2FRXA 1NURA 1BXKA 2X42A 3A2NA 3EVEA 5IKMA 1T4BA 3CS3A 2H63A 2Q4OA 5GV8A 5JAPA 3IPYA 1DCFA 2O05A 5F52A 4AVYA 4EITA 5J2TB 3L1IA 3PDIA 1BVYF 1P61B 3VISA 3ANLA 4MW2A 1K0UA 4XLZA 4JV5B 4GZMA 2XUHA 5FWYB 1E1LA 4JLSA 3WFZA 5LYYA 4YUYA 4RZIA 3RABA 2VNIA 3V3KA 3P1JA 2OG2A 4EABA 3G8DA 1Q15A 3A31A 3NIDB 2HSGA 1JQ5A 4JVOA 2A84A 3RC3A 4B4VA 5EKTA 3PQCA 1PQUA 3GA0A 4H3HB 3KXLA 3NC1C 2Y0CA 3K15A 4GMHA 4PYMA 3K8YA 3AIOA 1Z15A 2D13A 4HBZA 3UK6A 1GEEA 1J8QA 2MOKA 4GP9A 3SYRA 5BWCA 4MS3B 4E46A 4WINA 4UTXA 2Q8PA 3CUSA 1OFHA 3OCYA 1I3MA 1K9VF 1QIFA 3QNWA 4G0VA 1CUUA 3EEFA 4NAHA 5AVRA 1BD4A 4ZPJA 2IS6A 3IQGX 2OUKA 1M1NA 4FKMA 3X1XA 2HSWA 3W06A 1KVRA 1BWQA 3B5JA 1SC9A 2G88A 3AEKB 1A2KC 3GVHA 3I9MA 2JHAA 3P4XA 4LY6A 4N3NA 5FPPA 2VNKA 2JC3A 2AJCA 1K4YA 1TI7A 3EVCA 1XYVA 3S2FA 4B6RA 4B73A 4ZAFA 4GOKA 4BYMA 4EG8A 2OT3B 2GK7A 4C14A 4DJFC 1E3MA 1MC8A 3GLFA 1H2EA 4RL4A 4MMZB 1PR6A 5G0TA 3R76A 2CMHA 1GKKA 4H1UA 2OM6A 1MA0A 2NUTA 5E6SA 4C5CA 1B15A 4E5MA 1ABFA 1FS4A 1P4AA 1TYEB 1LBTA 4YHHB 2JFOA 2OTCA 3FPHA 4L76A 1Y80A 3SJZA 1CSEE 3ZE2B 5EL0A 3OQJA 5C1BA 2QENA 4AKEA 3A1TA 5M2QA 5TSDA 3DCIA 3GARA 1NNI1 2FG7C 4PONA 4RV5A 2ALJA 3KSRA 1DAPA 1XALA 3GLHE 4L22A 4NOLA 1O94A 3IUPA 4RTLA 5JZSA 2KPOA 2E4YA 3IEIA 3U3DA 5K3AA 3OFKA 4CMEA 1LD3A 2DUJA 4K1XA 4M86A 3TTXA 4FZJA 5C80A 3DL7A 1U6KA 1VHLA 2G77B 3KXDA 4LWOA 3F90A 3VZBA 1G7TA 2R85A 3DL4A 3CRW1 1CC1S 3NHRA 4YMVA 3EFHA 1GGMA 1R66A 4MJ3A 4PO9A 3CKKA 1YBAA 1ZGHA 1R5JA 3NNNA 4FBMA 4BJ5A 4DV4B 3NW9A 4BVFA 4C1BA 4TVSA 5JTUA 4JSRA 4L27A 5AW6A 1RAFA 1NI4A 1ZSYA 3CG4A 2V59A 3IAM6 2Q8QA 3QE0A 4G86A 4MI3A 4UMEA 5T4BA 4QUJA 3TZLA 1N57A 3CNBA 4Y2GA 1GTG1 3DPSA 2X5NA 3LCCA 1Q1AA 2P5SA 1BVUA 3WJ2A 1FNBA 1RI5A 2VDKB 2VTDA 3I8SA 3MWEB 3O4GA 4Q1BA 4S12A 2NU9B 5CFRA 4MVJP 5L95A 2E21A 4CEJA 2YWJA 1O5IA 2VP3A 1EBFA 3E5RA 2P4SA 3DEAA 4E51A 5HJ7A 3L7OA 3O2NA 4P5PA 2PWAA 4D99A 4MINA 1KL7A 2PWZA 2HYDA 3IQDB 4KMSA 5CT5A 1S3GA 1G9XA 1OHHD 2HPVA 4I6JA 4NHOA 4OH7A 4F71A 4AJ9A 1D7OA 1T2NA 4PQYA 2IPMA 2JVIA 2PR2A 4JR1A 4E88A 1KPIA 1RVV1 1DHRA 1WDTA 3UF0A 4D4GA 4MWBA 4B09A 3LZCA 1YJAA 2J3LA 2RH5A 2ZJFA 1OAKA 5EQJB 4U2FA 5B53A 4PIPA 5JRJA 2GN9A 4QUGA 4IBOA 3OZAA 1XNQB 2FLVA 1SWWA 2Y8EA 4TXMA 3Q3JB 4GAEA 2NSLA 5AXAA 1QKJA 5JTTA 1RQPA 2PYDA 2C7PA 1KI4A 1PBTA 2A9QA 2YCBA 2XYHA 4ZKEA 3PUIA 2AX4A 4C4ZA 3LQFA 5CVEA 4Z2AA 2IIVA 1GQYA 1TVKB 1VBMA 1WVGA 4W6QA 1N9KA 1FFHA 1Q6YA 2FRVA 2PSEA 4N49A 4LA4A 3I45A 5GJCA 1JEOA 4A0SA 1IJFA 3AFIA 1KSFX 5HPYB 1LDNA 1Q0LA 2PA0A 1DWOA 1KQFA 1QHXA 2QSYA 4MEBA 2I99A 1NG1A 5LWHA 2JCSA 1U7UA 1XDBA 1YQ9A 3WMXA 2JFZA 1XD8A 4ZCSA 2AX3A 2IEAA 1QSGA 3FN4A 3N58A 3S1SA 1NUAA 4NK4A 3P2YA 1II9A 4J6EA 4R2KA 4WLUA 5B2EA 5BPFA 1ISIA 1J8FA 1Y9JA 4NMHA 1KVTA 2XF2A 4LX0A 2NUPA 3KJIA 4J8PA 4O4JA 1I14A 4LZPA 4LOJA 1KERA 1R74A 1RE0A 3EXIB 1W48A 2W4QA 1G64A 4M0PA 4QVKA 4CT0A 4IS2A 1NKSA 4DIBA 4AUEA 3EX7C 3P9KA 2XJ4A 5CYOA 5KYWB 2IK8A 4EQ6A 3DA8A 4BMOB 1EFHA 4QLBA 4LJ9A 1DWQA 2B9EA 4W4TA 3G89A 3X1JA 3E5MA 3REGA 5JS1A 2X7HA 3QKRA 2JGKA 5FBLB 1RPNA 3AFOA 2AVNA 4DLTA 3AGPA 1CEXA 1PHRA 2PV0A 2WMDA 3C6YA 5FRDA 4AJPA 3A0RB 4B3GA 3T5DA 2B99A 5B4VA 1JU3A 2VXCA 2HQBA 3WA6A 3VH1A 3CVVA 3LT0A 5EHQA 3YASA 1CF9A 4CM8A 4TMFA 1R18A 1M6HA 2Z4SA 3A9VA 4YV0A 5CXXA 4OMFG 5D51S 2YYYA 3MJTA 5EQTA 4AICA 2A35A 2BGKA 1TQDA 1M0TA 3I28A 4I5IA 2Q2OA 4KNWA 3SXJA 1UKZA 3THSA 3VSCA 3EVAA 3OQIB 2OQIA 2D2FA 2L0XA 4WMLA 2VHJA 4MI9A 1DAIA 2GNOA 1JQAA 1ADYA 2HCTA 3STWA 1WJGA 4IRMA 5F2NA 2R25B 1EFKA 5B3JA 4EDFA 1OFGA 4UDOA 7MDHA 3W5CA 1TC2A 2PTGA 1RHUA 3N2GA 3ON5A 1MO6A 3OIWA 5AESA 1W36D 4FEYA 4QEKA 4LNHA 3QPCA 4PGHA 1EFAA 4W8HA 4BVEA 4P4GA 3RGWS 5IC4A 2R6R1 1Q7CA 1Q1ZA 3NWOA 5F5LA 3MWDB 2WVGA 1QVAA 3E0XA 5CTJA 2CXHA 1Q22A 1YCDA 2I0FA 2Q9BA 2ZJ4A 4Q05A 4IHKA 4TZKA 4FPXA 1C9JA 3KFXA 4GIBA 3SOZA 4PLFA 2OG1A 2VYCA 4KE6A 2WA1A 2IPNA 4KQCA 4EGAA 3DMDA 3KFLA 1FVOA 3G68A 2EHDA 3OLXA 2WFMA 5EIBD 4LF6B 1PDWA 1XMXA 3U7RA 3RJTA 4QDZA 1SBQA 3EGXB 3WLSA 4KLNA 2XYGA 4GSKA 2RG1A 4PX3A 3TCXB 2F1HA 3UB4A 1SOUA 1IHYA 3NHBA 2OK8A 1PTJA 1UBLS 3LDUA 1IIBA 3SZUA 3AF4A 4PIVA 1JG4A 4ME6A 4Z9BA 3DGEC 2YIMA 3Q7SA 1X7XA 3WXBA 4A2QA 3VSBA 1UDBA 1XLUA 2ZJ3A 4G8DA 5K0EA 3NYWA 5JI2E 4MA0A 4GR5A 5KYUB 5K1ZA 1DAGA 3SPXA 3QLJA 2JANA 3UW3A 1AUQA 3TDKA 3TNDA 1KOGA 3EUAA 4GFDA 5CB0A 3BMXA 3HJFA 3VU0A 4BZPA 2GM9A 2ZUVA 3AVPA 1U8EA 5CFQA 1ISFA 5CA0A 4I5GA 4Q15A 3L07A 4MUHA 1HV8A 2PVPA 2XAUA 1UJ6A 3JATB 4TL9A 2UZ1A 1FTGA 3DMTA 2BP7B 1OSNA 5GOTA 5J47A 3MJFA 2WKWA 4OP1A 2GSDA 1JW9B 1UFRA 1IOWA 1PJTA 2GK6A 3BXOA 3QU7A 4UHBA 5EZ6B 2YOFA 4M0DA 5P21A 5THXA 5K09A 1YBFA 1A77A 1Z4IA 2WSYB 2CFOA 3DZFA 4XM1A 2WB2A 4CR8A 2Q5IA 3SZ3A 4XGNA 4DDHA 5IASA 4DBVO 4O33A 4JB0A 2DPLA 4BTEA 3I76A 2DJ5A 3FTPA 1JGTA 3SHWA 3G6KA 4ITUA 1ZL2A 3WIDA 1G5QA 1K27A 2JAWA 4Z0HO 2ASVA 1O89A 3DHEA 3ZY2A 4GL2A 2OYRA 1RQXA 2FFJA 4WERA 4DJEC 5JNLA 5AUQA 2AOXA 4GYWA 1DAHA 1HEUA 1P4HA 1RU3A 2ID7A 4Q1CA 1JTFA 3UYLA 5BQ3A 2BPOA 4W5TA 3D3WB 3D1VA 2IHZA 4IDNA 2NPIA 2FZCA 2PTHA 1TPZA 3HDTA 2JEYA 3EOZA 3HEAA 4AG6A 2HLDD 2XT0A 4XUGB 1DEAA 2VUSA 1PWZA 2VUIB 3WK4A 4CM9D 5IHXA 2GZ2A 2WDZA 4MVJA 2KS6A 2BSXA 2IE8A 3BZBA 1OXTA 1ECPA 2H29A 2FPKA 4IV8A 4BPRA 4J6FA 4JBLA 1SC3A 5K4GA 1UIMA 3D3NA 4AYWA 1FFGA 4D3SA 2JVKA 2IYOA 4WKGA 3UYKA 3SS7X 5EIFA 5HG0A 1W96A 3RJ9A 1RYYA 1Z5VA 1CIPA 1E1CB 2QNRA 3KYCA 1FYFA 4CEIB 1TYBE 3AM5A 3W6PA 1DBWA 2ZYWX 5A3RA 1X1TA 5BSUA 4HQ0A 2PEZA 3IDSA 3MCZA 4CQLA 4UVIA 2FWAA 2HWYA 3PQ7A 2J3JA 3ZU2A 3ZJ4A 4DUPA 4LW8A 1E7RA 1F5NA 3CN9A 5TQ2B 3U3JA 1GILA 1NGSA 1KDPA 4HDNA 4PGGA 1Y7HA 1O9BA 2Q7DA 3UJ6A 4BO4A 3H1TA 3VDXA 1SELA 2OV3A 1MD9A 3FHLA 1T5OA 2P30A 4EJ6A 1RTKA 1SVIA 2Y3IA 4M3NA 4CHTA 2OL4A 2AOWA 1UCFA 2ZJYA 2VQSA 4U7DA 1ZVVA 2XXAA 1GPH1 1PGNA 1U2SA 2C4NA 2XB4A 3NEPX 3PBKA 1QYIA 3BBPA 2ZXFA 5KKNB 4MHTA 3OOSA 3T5GA 3GAMA 2JIOA 2X5OA 1A7AA 1KH2A 3F74A 3NM4A 4I55F 1HEIA 5FWAA 2DMRA 4RO0A 4JT8A 5BN5B 1V26A 1KZHA 3HJRA 5DU2A 1A82A 2X0DA 4M8LA 1W1WA 1XL1A 2OFFA 1JQKA 2CJFA 3QW4B 5KTRA 2NVWA 3GF4A 4HD8A 4QYIB 3CNNA 2CLSA 4DLAA 1K7XB 4UVDA 3AVUA 1UZNA 3ACDA 3H75A 2BEJA 2GWHA 1IOLA 1VIYA 4HKTA 4P98A 1CRQA 1L5KA 3WWEA 2EC5A 4NU8X 3W2IA 1U9YA 1KYIA 2AMYA 4JR2A 3RBZA 4CYMA 1TO1E 1KS9A 3HFJA 4GOOD 4KRFA 5KQMA 1JDBB 4N7RA 4CF3A 3PEWA 5EJ8A 3AG5A 4YRFA 4PC2A 2VTBA 1JHYA 3NXKA 1HYGA 1VXRA 4HNQA 1XTIA 2VPPA 4F56A 3RUEA 2X19A 4WGFA 4D92A 1B74A 1GPNA 3ZVLA 3DOFA 4KXUA 2JHGA 2OV2A 4Q4JA 5F4ZA 1T5DX 3PI7A 4GKKB 2PSDA 3DWGA 1QNFA 1SD1A 5KX5A 4RK1A 1C3OA 4WXPA 4EYOA 2RGDA 1ANKA 2ZUCA 3WTCA 4OI1A 4RPLA 1WP9A 1AK9A 1VB5A 1ZN9A 1KBOA 1YCGA 4XWGA 3MGGA 3U4DA 3PFHA 3TR6A 2JZCA 1SOWA 2BGTA 3CT6A 1QF7A 1X80A 3KKMA 4D8VA 3LDFA 1N2BA 1SFRA 2OD7A 1KK2A 3VDQA 4J0KA 1NPYA 2RHWA 2PUTA 1KJQA 2BGRA 5BYJA 5DYIA 1C0KA 3QK7A 3QLEA 3I1IA 4H3KB 1HL7A 4RKEA 2NZUG 2XWPA 1Y4DE 1VDZA 3VR6H 1C7ZA 1RPAA 5ALOA 5AUPB 2OOKA 2C3YA 2G36A 4HSEA 3GO4A 1HK7A 2HRCA 2TMKA 2W6NA 1O94D 5CW2A 2ODNA 5DNEA 3LRPA 3GELA 3CFYA 5PGMA 3LD9A 5K8JB 1P5JA 1MENA 4NZPA 1Z5GA 4YRMA 4Q9IA 4UU1A 3EMKA 2DU8A 1Z4MA 3HN7A 3B70A 4HJXA 5CEEA 5C51B 4D45A 3KV1A 3ZLBA 2WUGA 5KU7A 4QGBA 3OI7A 4GUDA 2WD7A 3EDOA 2W90A 2R3SA 2DPYA 4YIKA 4S05A 2PMWB 1IUNA 3PK0A 1STOA 5DI3B 3IUJA 4MV3A 2NTJA 1C9EA 3WO0A 5L40A 2O20A 1SC1A 3GZNA 2Y1FA 1WB6A 4O4HA 3FDJA 2VT6A 3BGIA 4JBNA 5IZCC 4B0PA 3DZBA 3RUCA 5L3QB 4RTSA 1G2QA 1C1DB 1HE5A 1S01A 2FEKA 3B9PA 5TPZA 1HLGA 3QKSA 4Z6KA 3PR1A 1KK0A 1V43A 1EJ2A 4QYWA 1D9XA 1MJFA 5BMVA 4DLLA 3PDUA 2A9OA 1VI6A 1Q83A 3QY0A 3I12A 3SFTA 4NJMA 2YH2A 3FVQA 2AZMA 3G0GA 5EINA 2DWCA 3AFNA 3D6MA 1EWRA 2HIGA 1PU2A 4LZOA 2JGRA 5ELMA 3ZVNA 2NO4A 3MYRA 1EK1A 1PGQA 4M1MA 1QH1A 2JLSA 4KBFA 5IKEA 4DJAA 3MJVA 3A11A 2D4AA 4BBPA 1QRTA 2FW6A 2FZWA 4NMWA 3P97A 3PXGA 1KRWA 2H2IA 4YC7A 3VSEA 4CMKA 2REQB 5JEDA 1UWLA 4CQMB 2G5GX 3OP1A 3H84A 3R24A 1JHPA 4PXAA 2C2ZA 4XIJA 3K2EA 3L06A 3FH0A 2PA3A 3ZIAA 2P4EA 3ZY6A 4JZKA 1NUQA 4JI6B 1MV5A 3KQTA 1N4AA 4PSVA 4QQFA 3SSMA 2RK4A 4LC1A 1R8QA 1PL6A 2QW8A 1NSYA 2VP4A 1GUFA 3C3EA 4WASA 4BY9E 3COPA 4X24A 4ZZ1A 4DIMA 4CIAA 4DC1A 1C9YA 4B6JA 1IXYA 1NVBA 2HQRA 3RVPA 2I71A 2V45A 4B3TB 2QRGA 3AGQA 3HP1A 3L02A 4OI0A 1S3IA 3Q7EA 5HM8A 2W6MA 4MKGA 3TPFA 3NHPA 3O92A 4GWLA 1POXA 1WB9A 2JPDA 3WGGA 1XFAA 2Z0MA 2X4GA 4AS3A 2A9PA 5B5SA 2P75A 4EY5A 1NXQA 1ZOPA 2O3RA 4BO8A 3ZD7A 4O08A 1O77A 5CHEA 5D3ZA 3PEEA 3QPUA 4FT4A 1VSBA 4L0QA 4DV2B 3FYSA 3KYDA 4FYMA 4FX5A 1YWGO 3I5AA 5F23A 4UUNA 3LLMA 4IUYA 4GC9A 2I4MA 4MARA 5YASA 3VR0A 4B6PA 1YF3A 3G23A 3SX4A 2IU6A 4OQLA 2B1IA 2HEGA 4N0PA 4WCFB 3G9XA 5LYJA 3AP2A 2V54A 3NGXA 4FLFA 4X1IB 1H2BA 3C74A 3NT5A 4JUAA 2HHCA 3F4BA 3SN6A 4EFMA 2QPLA 1L4EA 2PZAA 5EZ5A 1Q74A 3HRIA 3BA6A 1L5FA 5C32A 5JCXA 4A2CA 1XF1A 3FVWA 3RHZA 1OI4A 4MO9A 2DWQA 5JAUA 4YXWA 1RKUA 1WOMA 4ACBA 4N40A 1HE2A 1SIBE 3K1TA 4ETIA 4BNLA 5G4KA 1KU6A 2EWWA 2P0YA 5G1NA 2KQUA 1PIWA 1YFKA 1P9LA 3MMSA 1D0SA 3UAYA 2HJVA 4IWNA 3VPFA 1C4XA 2XUQA 3HEBA 4CKZA 3GPLA 1A9SA 1XTQA 3N8DA 3SYLA 1CZLA 3U61B 1AKEA 5BUCA 3FHTA 4YMGA 3IBFA 2NTYC 1ZCFA 4FNGA 2PBLA 1U8XX 6ADHA 2IEZA 4ZWNA 3DB1A 3UV6A 1Y89A 4UAUA 1PJCA 2GEJA 3SHTA 1LSSA 3GLFE 1P9OA 1XCBA 3N2NA 5G0VA 2VYVA 2NSYA 3HBLA 3KQWA 3UKOA 3D31A 5A6VA 4G0OA 1AA9A 1RAHA 3D7MA 1GG5A 3SSOA 5DV9A 2IOFA 3GYBA 1RXSA 5AHXA 3ZDAA 1KTVA 1QS0B 2LXNA 2XQIA 3EWAA 4YAKA 5BORA 4AZ3B 1NMZA 1EX7A 2VT2A 3M5CA 5SZJA 1BCSA 2Y71A 2N3ZA 3EA0A 2GYWA 1QJ4A 3N5CA 3GWZA 4DCVA 1J90A 2AYXA 2PDAA 4QXAA 4G5YA 2W22A 5BSHA 3EZ6A 3BFVA 3LIIA 4Q7QA 3DZIA 2VRBA 4AM8A 1BDMA 1DB3A 3SY8A 2P77A 1FNMA 1OH7A 1DC6A 4L6IA 5BYAA 1ODJA 3KPUA 1N7IA 5CA1F 1FFWA 1RJDA 1I5OA 4B75A 1U0NA 4NV3A 4U2EA 4FQ8A 4D3DA 3ZDXB 2I6SA 4DV6B 1F5SA 4KQEA 1GZ3A 1PGPA 1T3HA 2GZMA 1WQ4A 1X1RA 4CM7A 4E14A 2B36A 3WRXC 1JJAA 3H1BA 2ENWA 2P91A 2FOLA 3DJFA 3PTLA 3FZEA 4KQ6A 2BM0A 3B6IA 3TB6A 4MUGA 3STTA 1I30A 5G1PA 2YMPA 1CJVC 3CINA 3K16A 2C1EA 3KPJA 3LY5A 4TT8A 4D4HA 3WAGA 1OWMA 3HY6A 3T3HA 1WRBA 4K1LA 2EOAA 5HKOA 1E0DA 3VO1A 4AJ1A 4AT1A 4EJSC 1RPZA 2W2KB 4AI6A 2R65A 4DHWA 1THZA 2CL0X 3EFEA 3O8LA 4BAUA 5DM1A 4BO5A 2IKQA 1E89A 1VG9B 1LPBB 5AYVA 3FOCA 3CV3A 4KQ9A 4C7BA 2I87A 3KHSA 2IEDA 5ED4A 3R0QA 1R5OA 4FMCF 1ORRA 3GVCA 2IITA 2ZLBA 4J3FA 4LDNA 1B1CA 5FNVA 1JA0A 4ESVA 4HH1A 4Y0NA 2WD8A 1VCIA 3U7QA 1N9ZA 3SI7A 4PWZA 2PL1A 3TM4A 2C99A 3HZOA 3IUNA 4WY2A 4FNOA 4GM4A 3MOGA 2B8JA 2PMEA 2R8BA 3W5HA 1AX9A 5C4IA 5TGZA 1Q0RA 4S24A 3PLAE 4DIOA 1IE3A 4IJ6A 1KS2A 4HQFA 4IRXA 4MS1A 3V2HA 3CZAA 4EELA 5TT0A 1S8OA 5IFKA 3HI4A 4FZ3A 4RH3A 1AO3A 1O0SA 3IIIA 1E32A 3R5TA 4V0QA 5K6RA 2W0SA 1DX6A 3U9SA 2JASA 4OJKA 5HQJA 4F04A 5EPEA 2LTAA 4EY6A 4C87A 2C4VA 2UYOA 3O21A 2H2AA 1I2CA 3P0JA 4U2KA 3R74A 4C5BA 3N2YA 3HP7A 4J3NA 1SXJB 4GG1A 3R7SA 4TL7A 3HYTA 2XE4A 2KYRA 3JQ7B 3PYLA 4QBHA 3S28A 3TE7A 4ALIA 4RHXA 1RWNA 2JCGA 1X7ZB 1LGYA 2VHWA 2WJAA 1NVMB 4NZ9A 2VJBA 1HG1A 1T24A 1EDOA 1NSTA 3ENQA 3PQEA 4QWMA 4RF2A 2O3TA 4KAJA 3WGOA 5HM6A 3L9WA 1FSGA 1LS1A 4RIEA 3SZGA 3GYGA 4NYIQ 4HV4A 1QPGA 5L7WA 2LCQA 3ES9A 3LV8A 3CF6R 2GJSA 4XTRA 4L8WB 2TECE 2CD9A 1V1JA 2RAVA 2HPHA 4XWTA 5LB4A 5JHHB 3WY9A 2NP7A 5DGHA 1BZYA 4BMZA 2Q1TA 4HRXA 1AZWA 3IPLA 2VJPA 2IDMA 1DMSA 4NCAA 1Y5IA 4UM8B 3WVNA 1FNDA 4XPIA 1L1FA 5HBGA 5F7ZA 1NT4A 3WDMA 4ARUA 1RXYA 4GH5A 1RP1A 3JQ8B 3K0FB 1M2WA 5CYFA 5JW6A 5ADHA 4L7VA 1JEYA 1CB0A 2ZPAA 3H2IA 3LC0A 3HY3A 4Q7MB 1WCXA 2P3LA 2ZIGA 2FYTA 4P86A 1RLUA 2WHPB 3G1UA 4PNPA 1FLVA 2H17A 4KJXA 3ZE9A 2GCOB 3K2QA 3RWMB 3VAAA 1EQAA 2YWFA 1Z4LA 4P3KA 4ZV7A 2OVFA 3GBSA 3MGBA 4HL6A 1VHQA 3QGMA 1NMXA 3IT3A 2DTDA 3EA5A 3JQCA 4C2UA 1B3BA 1QFJA 4LCBA 4OSEA 3EEIA 1SOAA 1DV1A 2OHIA 4BJ3A 4WZZA 2Q0QA 4EYKA 4E5YA 5KX5F 2FPIA 5A3VA 3TMKA 3UMRA 4V0NA 4ITVA 2XUAA 3JU3A 1BCRB 1L1RA 3GP5A 4UM7A 2AYYA 3C0KA 1JNXX 2ARKA 3PEUA 1NZJA 1T1EA 2ZTHA 2PKQO 2V3WA 4K3VA 3EGEA 1ZMRA 3JTEA 4WKPA 4RNCA 3I9OA 3SX0A 1OCEA 3SYTA 1TUBA 2NP6A 1T8PA 1MVNA 3PICA 2QMZA 2N9UA 1MC4A 1ZIOA 2BZGA 2PUJA 1H2ZA 2YXPX 2ZI6A 4X84A 5HWSA 2HK6A 3L18A 2XQFA 4EMBA 3H97A 1FFBA 2JGLA 1CS4C 2VRNA 1YA4A 2XHZA 4F4HA 5GZ1A 1SG6A 1T9KA 4FFRA 3C98A 4U6QA 4IV0A 2JFWA 3BL8A 4RFSB 3WLNA 2NU7B 3H5NA 1JILA 2CLOB 3ZE7A 4D9EA 1GD1O 5J43A 1ADJA 1UBKS 3Q9NA 1M7HA 2GHQA 1GO2A 3NUGA 2UVDA 4NICA 4XGQA 3SBDA 3UGTA 4JEUA 2Y1KA 2QMOA 2V0GA 2EW2A 1R6DA 4MW4A 4CKCB 2I9PA 2GD0A 4L8GA 3PX7A 5ECWA 3WMWA 3A1WA 5J63A 2QQ5A 4PPNA 4WGGA 4E4TA 5J2UA 2JIZA 2G9QA 2GILA 3OZUA 5KVVA 5HTOA 1Z5NA 4UM9B 1PX0A 2JKZA 4J1TC 2ID9A 4OF4A 5ERGB 1S4MA 3ONNA 3V55A 4D4JA 3JRXA 4BRSA 1BOOA 1GNTA 3HVUA 4IMPA 2P9YA 3B1XA 4D02A 5KVSA 2PUHA 1GPUA 3UICA 1SCBA 2DF8A 2O3SA 3H9BA 3R20A 4OU5A 1Y6GA 1KMQA 5H68A 4IIEA 4BQPA 3TNYA 1NL3A 1TLLA 2O2IA 1E7MA 3MNFA 3PF8A 5KMGB 5KQRA 1LJLA 4I4CA 4R1UA 2BFBB 3QXJA 3EWNA 3GJSA 1R37A 4JVSB 3EZ2A 2XDQA 1THTA 3QVJA 1ATZA 3LUKA 1SB9A 5EKUA 1VZ2A 1PSZA 2FR0A 2ERXA 2H54A 3D8BA 1PJAA 3H6HA 4QUDA 3RRFA 5JYEA 3M6XA 3MOSA 1PS8A 1FZQA 5D5QA 1GLVA 1Y42X 2V8OA 5TPZD 3TI7A 5KNDH 1EA5A 5LZ4A 2FXVA 2P3OA 3WI7A 4A6XA 4J7UA 1J8YF 2OBBA 4UBIA 4ETMA 3SYNA 4FDLA 1Y8QB 3NJ8A 3JD4A 3OESA 3QIVA 1I3LA 3ITDA 3ED1A 3K5IA 3NBQA 4DYHA 3A3YA 2FKNA 3I4CA 4U2BA 1JSCA 1VKNA 1QP0A 2ORWA 3R5HA 2GLUA 2IFTA 2IEYA 4RD6A 5FUMA 1QQ7A 2RGGA 2WI8A 2YRXA 4FCWA 4GP6A 1NTOA 2XAAA 1DAKA 3FNRA 4GBGA 4B0OA 5IT5A 3S5JA 3ETLA 7GPBA 3THYA 5AVYA 2ZWPA 2PSFA 3PC6A 5K4HA 1T6BY 3IODA 1QQ5A 4XRGA 4L73A 5IYZB 3K6JA 2OCYC 2BH2A 2B21A 3FCOA 5IULC 4REOA 3ZIAD 3Q1KA 3CZ5A 4BUZA 3IOMA 4K46A 1ISRA 1XZFA 1TGVA 2BBWA 4KDFA 1HDOA 4KYTA 2WG1A 3KOUA 3QTBA 4RGQA 2I54A 4BMNA 2H1SA 3SLKA 1V6SA 1OLUA 3FWHA 4ZU1X 2Z1NA 4U9IS 3WP1B 4ABTA 4N7JA 1OF1A 1XC7A 1N8KA 1Z2EA 2PJRA 1Y5NA 3DDOA 3L7LA 5AW8A 4MVJH 4RD3A 2PSHA 2VF8A 1O8BA 3PLNA 4M37A 3IUQA 4YLEA 3UOWA 4RJJA 4ZVLA 1UOOA 4ARZA 5IKXA 1K7CA 1ES9A 4O1MA 1X42A 3HKDB 2ZJ0A 3TQIA 1P0QA 3FRHA 4MNTA 4F4IA 1DQPA 1F7UA 1EESA 1ODKA 3OTQA 1HG0A 3I0ZA 3PNKA 5SY9A 4JXZA 1ICIA 4HNAA 2J87A 3WL6A 5GV7A 2OLJA 2EWVA 4QJ4A 1F4LA 2XCQA 4OQFA 4UXHA 4AJHA 1OB2A 1E66A 3I6QA 3BAFA 4FUTA 4XEHA 2VBCA 3T7RA 4MR9A 4A91A 4QFMA 5TX7A 1W36C 4XTCS 3ZY5A 5LUBA 3I5XA 1HBJA 2IJGX 4M4SA 1RWOA 3AY7A 2QY9A 3U44A 2HYIC 1JLKA 2Y1CA 4M7RA 2HEIA 2WILA 3EF3A 4WKOA 3PNBA 2J7KA 1I4EB 1S02A 4RM2A 3T4PA 3UHFA 2IS2A 1Z29A 4EA8A 3K70B 3AVYA 1R8YA 1USIA 1U0GA 1E2QA 2DT5A 3JZIA 3UKJA 5AVZA 2C2GA 1EP2B 2HPAA 3D7KA 4KAAA 4CL8A 4MYTA 1GLGA 2ZS7A 4YXWD 5EHGA 3FLBA 2B1QA 2INGX 2VYQA 4RV4A 3AF3A 3ZH2A 2RAPA 1TCUA 1PQPA 3JWGA 2Q62A 4UZFA 5JJLA 4LY9A 2WOOA 3WLLA 1YJQA 2C82A 4U63A 2QI9C 4LYGA 4WVLA 2HA2A 1IWBB 2GEKA 1L5OA 1DADA 1UK8A 2ZJZA 4IHJB 3OT1A 1N8NA 2JIPA 5EFOA 1JAYA 3JR3A 4J29A 4YV7A 1Z2DA 1A69A 2BCJQ 3LP5A 1X9HA 4MV4A 5ILOA 1G2PA 3U7FB 1R0BA 3WIUA 3GRRA 4H18A 3RSSA 4E6PA 5SY4A 2ZRBA 1T34A 2VYVD 4D9KA 4NCNA 1POWA 5EIHA 1N2JA 1MXHA 5D87A 1L9XA 2G4LA 4FJ2A 3K7EA 1M2GA 5G2OA 4UQPA 4QQRA 1LVGA 2ZSFA 4KREA 2AMFA 4AULA 4DM3A 1VLZA 2WMYA 4WACA 5B37A 1PTKA 2CFRA 3P9QA 4O25A 3LDAA 2J85A 2A33A 2EJCA 4X93A 1EZ4A 2OV6A 2ZYHA 5B1DA 5C7IO 1TKAA 3ZD8A 1AHHA 1U0FA 1DV2A 3I0NA 1TW2A 4ZAGA 1E4EB 2ONYA 5JDIC 3IUBA 3KJFA 3MBKA 5JCJA 1V5GA 5L4SA 3QWBA 2VBIA 4D3FA 1OFUA 3B6JA 5KKCA 1ODLA 1OFIA 1QRDA 2J46A 4MW9A 4QPCA 5D2CA 5I9NA 1BMQA 3BERA 4MULA 1EK5A 3B1VA 5AW9A 3B52X 4LUCA 3W7BA 4TSKA 4KCGA 2JLRA 3MQFA 1NYQA 1JQ3A 4OFWA 2FGJA 2QAGB 3JWHA 3GPIA 3O7WA 4KU4A 1JHZA 3KLNA 1P91A 1N5LA 4XSGA 3GVIA 3K9NA 1EM8B 4L4UA 1KMHB 4DV3B 2GPAA 5E6UB 1TW3A 4LHEA 4DQXA 4JQYA 1DJNA 3TTYA 1BHO1 3JPYA 2OO5A 3KDSE 4TV9F 3MB5A 3O9VA 5AVKA 2J0UB 2V9PA 4MRSA 4ARIA 3KVVA 1N7GA 3WBFA 3QELB 3AX6A 5IF3A 1RWWA 1RCFA 2R1TB 4FHGA 3LCJA 3TR0A 5EG5A 4UPVA 2E3JA 5AKHA 5A7GA 3H5TA 5HF8A 3PQ2A 5SYAA 1XTVA 2I7DA 1A04A 3H2KA 4CMJA 1H4QA 3LUGA 1GTRA 2DTXA 3PGXA 5CMLA 4AXXA 4B7UA 4WBNB 3WWPA 2Y4OA 1ZD2P 2P68A 3KU4A 3R09A 1CJBA 2RH9B 2MTBA 4UBJA 5DBIA 2XRMA 4PZCA 2IH4A 1I7LA 3V00A 2YOGA 3IV7A 2BGJA 1DAEA 3LDGA 2QT9A 3T15A 3BQ9A 5DNDA 4OHZA 3TL6A 4X61A 4BIIA 2V8BA 2PL3A 3C3YA 3CH6A 4FDTA 1ZRNA 1U4SA 3EARA 1IMJA 3O2SB 2X0EA 3A6LA 1RJGA 3WZLA 4AJ2A 5KWEA 4M7WA 3EGWA 4PZ0A 5LBUA 1TTQB 3M82A 1MQAA 1DC4A 2JB9A 5A5GA 7REQB 1ZI6A 2VSXA 4OGWA 3VR4A 4H7KA 1T5HX 3I9LA 4JLDA 4RZ3A 1ZSNA 1ZO8A 2UXDB 2Q3DA 3N7UA 3NFYA 1ODCA 1F4PA 1X3SA 4P22A 3HCRA 4P32A 1FXWA 3GAFA 1HPLA 4JLOA 4KZPA 3SIWA 3T3PB 5FTKA 3AOEA 3TS1A 1MJHA 1DMRA 1ZC4A 4PFJA 5SZIA 2I6UA 1AB6A 1SOMA 1Z2PX 3G8BA 4MQ5A 4PQEA 3N0VA 1UR5A 3G2PA 3GJYA 4DCCA 3P2KA 1FU7A 3QUBA 4GHWA 5DSTA 3RC1A 3RF7A 1LI5A 2IP2A 2X6QA 3I72A 3K0SA 3V2UA 3BCUA 3P71T 2BKUA 1H6CA 4OLBA 2PNFA 2BMEA 2A57A 5TEWA 5CM2Z 1GN9A 4MA5A 1S2DA 1P39A 2E37A 2DX7A 4FGWA 3T4UA 3K0AA 2WT8A 2JFYA 3II6X 1AZTA 1L4HA 4UATA 4N5LA 4ZDJA 4IG9A 4YMWA 5JAZA 2QG9A 1UMCA 4NFLA 4RCVA 4NPAA 1IRXA 1U1CA 3EMBA 1IB6A 1RXCA 2ODWA 4UBLA 1ND5A 2OXIA 3QUCA 4CMAA 1Z6ZA 2SICE 4DLUA 5I3CA 1QBKC 3L0IB 3U7GA 1COZA 2V97A 3WLEA 2I8LA 4M6WB 1YE8A 2WV7A 3KB2A 2WG2A 3R3JA 2W70A 1YHYA 1N5OX 2AFHB 4PFKA 4W99A 4O4IA 1L1EA 4ZQHA 2CV1A 4UXIA 2RHRA 3AJRA 2ZRGA 3HO6A 5EE5B 3TZHA 2ONCA 3WLMA 1DO0A 4F8JA 5JD5A 3VA7A 1ZNWA 2I03A 1DU4A 1PJ8A 3BF7A 3G49A 3N9IA 3PX2A 1GZDA 3EASA 4ND7A 4BLWA 2BHSA 1QANA 4PZYA 4ES6A 4A82A 4ZI7B 4OKNA 5EI5A 3R3VA 5T41A 3WWOA 2JIBA 2CL6X 3CXUA 4EFDA 3EVTA 4KPGA 1T9GR 2P2SA 5IEJA 3AXSA 3REFA 3L4JA 1QO7A 2F8MA 3ECAA 5HBRA 3GNTA 4M89A 4FYPA 4Q4CA 1GTVA 2IS1A 1EFDN 2QZPA 3R7WB 1U1FA 2ZQZA 3FRJA 1ZS9A 3CPEA 3I92A 4KLCA 5J59A 3ZHCA 1LBHA 1V1MB 2C9OA 5ICGA 2R5NA 4LTMA 5AI8A 3HB0A 3DAGA 5C0OE 5IUJC 1XNHA 3MUNA 4CMEC 1GA1A 2WIAA 4AP9A 1TEZA 3E2MA 1HORA 1NN0A 1KVSA 4HUQA 4A10A 3CCFA 2FWJA 2G17A 1Y8CA 1VIVA 3HDHA 1IUPA 2EDAA 2YVUA 1RBMA 4TYPA 4MDFA 1RTTA 4I1OA 4TTSA 4OKSA 4TVBA 3BHMA 3LBIA 4OLJA 4GKAA 4MI1A 2O7SA 4ZQIA 3I2KA 3ZDEA 1OIXA 2UYYA 3B3JA 3BC1A 3L7MA 3EMDA 1UK7A 2QRVA 4MPJA 1WUJS 5GJBA 1CP2A 4JCOA 2GVDC 2PZEA 2PH1A 1D4FA 3ETCA 4U2GA 1CJKC 2IHNA 3SXPA 4ZEWA 2MYUA 1YC5A 2WPDA 1GCUA 3DWIA 3DYIA 1IBSA 3E22A 3GV0A 5CXUA 1I94B 1Q1BA 3VNSA 4D3ZA 1GFIA 2Y27A 1PK8A 4PAQA 1RYFA 3DZ8A 1I7NA 4L95C 4YCAA 3GEPA 4Z9YA 2EX0A 1C0PA 1P8AA 1Z8HA 3NTOA 4OGFA 5DOVA 2QR5A 4PAMA 821PA 4U3JB 2OCPA 3F3SA 3HM2A 1SHUX 2JW5A 4QU0A 1EVLA 2IYXA 4ND1A 2H1CA 3BJZA 4R8SA 4LBVA 2G1JA 3P4UA 5EJGA 5JNRA 1FVHA 2QPTA 2I6GA 4I0WB 4Q02A 4BEVA 1GU1A 2D0IA 2O3JA 4KOEC 3SJUA 5F9MA 5KTYA 5FA8A 4ON9A 2JIZD 3O4JA 4JT2A 2LZ0A 2SHKA 2AJTA 4RA6B 3L0CA 4HXEB 1F7VA 1U04A 4LJSA 4ZVKA 4WD3A 4AY5A 5AW3A 1M1YB 4HNUA 2R97A 3R8CA 4YBZA 2DQ4A 2ZRIA 1ZCBA 4B34A 2P0AA 2GRUA 5HRUA 1HT0A 4E1AA 3BSWA 3E8SA 4IDBA 4F06A 1KZ9A 1Y3AA 2O4CA 2QSUA 1JSLA 3WGHA 4BDSA 4ND6A 4GE0A 1AA6A 1Z2AA 2GKGA 3NH9A 3QU2A 3GJ8A 4RVOA 3F1KA 2J3MA 1JYFA 3KRTA 3UXYA 1FU4A 4WN9A 4PANA 4JN6B 4RPJA 4TUYA 1TZBA 4AY4A 8ADHA 2QD3A 4E6EA 2P79A 1VJ1A 2JGAA 3QFFA 3WYBA 2BGLA 4HQKA 4WLFA 1PN3A 3W6OA 3C3KA 3OAAD 4ZOLB 2WYVA 3KQKA 4BNTA 4Y2SA 3NYIA 1XWWA 4NHEA 1NVDA 2UVPA 4FGUA 5FUYA 1ONBA 4MR7A 5DX8A 1FTSA 3SVTA 1PZNA 2QT1A 5B3KA 2JIQA 3FYUC 4GNRA 2QJOA 4DWVA 1Y8RB 1P7WA 3SD7A 2GZ1A 3HUDA 3LRTA 4W9NA 5EGNA 4BMSA 5K9ZA 1TQHA 3KOWA 4NTZA 3LPMA 3ZG6A 4CDRA 2J5RA 5LMCA 1XRNA 1WD5A 3C5EA 3ZHVA 2AA3A 1XEXA 3BH7A 4JVNA 5JSZB 1XJ5A 2Z98A 5AP9A 2PWBA 2I2BA 1L8OA 2EVWX 1YZYA 1QYRA 2O2GA 2J3EA 2MCFA 3HM9A 1MRSA 4P4LA 2XJ9A 2PU7A 1IQRA 3HGMA 3L8ZA 5EMJA 5JZ9A 2ZJ5A 1KBQA 1Q0HA 2GD1O 1KI1A 2FSGA 5B1HA 1C7RA 4G1MB 3BVPA 4AIIA 4DSZA 1BN7A 4HDSB 2YIJA 5K6AA 4MQFB 3FCCA 3LT5A 3NBYC 2G5PA 1AT1A 3BH0A 1P3DA 3BCRA 4JJIA 3RVRA 4XDZA 4NJEB 1T4MA 1TYZA 4KXVA 4W1SA 2CC2A 3T0IA 2HIAA 3JRNA 3SKXA 4FZVA 2E4UA 4ZC8A 3OX3A 3CRZA 3U48A 1G3IA 3EDQA 3LWNA 1P4SA 4RF4A 5CLLA 3RW9A 1L5QA 1YXMA 3X44A 3PWZA 2Q4BA 2FJ0A 5EWLB 2C9CA 3FUCA 3JQBA 1PZHA 3L40A 1PS9A 2FP4B 4Y1EA 2FOIA 3Q88A 4IINA 4U0KA 1P2BA 3RFCA 4IDEA 1LSUA 3TW0A 3O1LA 2JGMA 1IDOA 1LZLA 1N1GA 3SJCA 5KWIA 3P2IA 2C3UA 2AE2A 2D59A 3LPAA 2VK2A 4YJ2F 4DHEA 2NUBA 3NV7A 3L77A 1Q1EA 3M2TA 3I52A 4R0NA 5B3JC 4MRRA 2VNSA 5FOXA 4MROA 4E2XA 4BAZA 3W1EA 5BW5A 2BIFA 4JJ6A 1OBVA 2HNKA 1QQAA 2YV2A 2VATA 3ZJTA 1G7SA 4HDMB 4FS8A 1A9OA 4NE9A 4NKRA 3PV0A 1V25A 2W2OA 5FOWA 1LDMA 2BFFA 4OQDA 4CEHA 4MVJG 2CZGA 2ZI5A 3DUWA 4L4YA 5CLJA 1WXQA 1ODTC 2X8LA 3F0TA 3NT4A 5CB4B 5L7TA 3D5TA 1S6YA 3EUFA 3B6ZA 4WNAB 4AZVA 1QHNA 4MAMA 2R48A 3T1OA 3V8MA 2ZSJA 4R1TA 1Q1GA 3JQ9A 4WZAA 1ZQ9A 4BVGA 3PCTA 4JYPA 2OOSA 4BN5A 2ZYDA 5GIOE 3GFGA 2A4KA 2GN2A 4E94A 1XA3A 2UZAA 5CK5A 1TFUA 2AHRA 2B94A 3HLKA 4FSHA 4BNFA 1FSFA 2Y05A 3CLVA 1BSVA 3IELA 3NEJA 1NF2A 1UOPA 1PQWA 1TEXA 3AEQB 3N2KB 3L1KA 1HH4A 2QJRA 2YJNA 3PHJA 4KKXB 3T3EA 2PUDA 3OIUA 4BGVA 4H31A 4XR4A 5D3KA 3VJKA 4Q3LA 1QTNA 3HCOA 3TZKA 2YQZA 3W2EA 4ZT4A 3W5SA 4XYLA 1HX7A 1TL7C 4M21A 2Y2VA 3B3GA 2VIIA 2VA9A 4KFCA 4IKEA 4MLZA 5KI6A 2BSAA 3DXFA 1QGOA 1U8ZA 3PFBA 2FJPA 5AVVA 2ZRNA 3TXYA 4EW3A 3ADCA 3PTZA 1QLWA 1ENOA 2E4WA 1GTJ1 5K6TA 5AT1A 3H5AA 4WDRA 3DZJA 5MN4A 4F38A 1CZOA 1XRJA 2FETA 1JHUA 1X74A 2AOTA 5BPHA 3TZCA 5CLFA 4G63A 5ALZA 2Q9CA 2O7VA 2CBXA 1D1PA 2DH5A 2CBZA 3G5MA 1T5IA 4QC2A 3TKLA 4C0QC 4X1KA 4DDVA 1RD4A 2A9JA 2GM3A 3EGOA 3QMMA 4WKBA 3V4OA 4DLZA 1U8YA 1P9WA 2PLWA 1HL3A 2FWPA 4WOCA 2QUAA 5KEIA 1JR3A 2XQKA 2D3TA 2IQIA 5JCJD 2DT8A 1L0BA 1YGYA 3E9CA 4DSOA 1M7BA 1U0RA 1JQEA 4X41A 4OJQA 5K7SA 4TLDA 1WB4A 3OP4A 2PUWA 2ZJBA 1JI0A 4UUAA 3R5SA 5FJIA 1E1QD 3GH3A 3TG8A 2CSXA 3ETHA 2KLBA 2ZT5A 3LCVB 2EZTA 5DISB 4PE5B 2P40A 2KX7A 4YUWA 2IH5A 3M5PA 2F1RA 2PU5A 3BYZA 4U2CA 2EJVA 3GFFA 4H27A 3RRZA 2Q4DA 1NPDA 4IHQA 1X7YB 2C8LA 1BH6A 4NC9A 4FMDB 3SBXA 4EYQA 3FWNA 4DT1B 3KUKA 1YZTA 5INTA 5FTWA 4JOCA 1J8VA 3DBIA 1ORVA 5JECA 1NWHA 1F8FA 2X4DA 1EFTA 4IPTA 4U6SA 3WV5A 2O7RA 4BQIA 1YL6A 4B76A 1LKZA 3EA4A 5CDSA 3TF5A 4OYLA 1F8UA 4QT4A 1J06A 1PLKA 3RAGA 3F8TA 2PT5A 3UAOA 3VGPA 2BGNA 1HQYE 4Q1EA 4BFVA 5LD2B 3JAWA 2RGYA 1HNXB 3TLYA 3K4PA 4Z4GA 3GJ4A 4PCLA 2OO3A 1YOBA 1Q0PA 2JGDB 3HGQA 4JLAA 2JAUA 2NZWA 4XQGA 3TMAA 3WL3A 2VG8A 2VDNB 1Z88A 3G79A 2QRQA 5JZVA 2YY6A 2BMFA 4LV6A 4HPJB 4MCJA 5K2OA 4N47A 4G1CA 2F90A 1RQLA 1A4RA 1MOSA 2M1XA 2Q99A 4PRYA 1VOTA 2VQDA 1E0SA 2P9EA 4FZRA 4TWRA 4W5RA 4WFJA 3C24A 3H0KA 3PDJA 5CUQA 1NM5C 2COEA 4PHGA 3W5IA 3K72B 4J7XA 1FUEA 4YFYA 1USWA 1CQWA 2BMWA 3TRFA 4D9FA 2ZYIA 4RK7A 1KA9H 1BXRA 2V0NA 4IAOA 4KSYA 3QEMB 4N5NA 3VR4D 4BKQA 3D6UA 3ZLTA 2HHHB 3HDGA 4ENUA 2B5WA 2EBFX 3H2BA 4E22A 2VBGA 1PEAA 5TF0A 1OTXA 2BELA 3H8WA 1ESZA 2R6AA 2JEZA 3CF2A 4FE4A 1EUDB 4OAPA 4JXXA 2W37A 4N1AA 2BFAA 3KC2A 3K73O 2DPXA 2VUUA 3CUYA 4AN1A 5ALVA 5H1YA 1WLSA 2NO1A 1IK4A 3FBWA 2YDXA 1DDGA 1YB7A 4QBGB 4A6PA 5JJBA 5A71A 5DCLA 1V95A 1OUMA 4MGHA 2I5PO 1SPXA 5DEOA 4J0IA 4TL8A 5F35A 4NMLA 1GFSA 1IN7A 3WR5A 5TR9A 1G20B 3STXA 2AI3A 3AL0C 4RVCA 5GJVC 3PIDA 4ID9A 2VPZA 2YYAA 2XB2A 1S8FA 3UWPA 4TZ0A 3QYAA 2AKYA 2I3DA 1EKXA 1RWVA 5K0BA 1PGOA 3BGDA 3LS2A 2P1RA 4DG8A 16PKA 4KQXA 3CRQA 3DT9A 5DSZA 1XMVA 1Y6FA 1U0JA 2ETXA 3QNMA 4XVUA 4IYRA 1XRRA 2EJTA 4D26A 2H2WA 4K0KB 1OV6A 1RR6A 4MRNA 1L5LA 1TUGA 2CUKA 4J03A 4BZZA 4EAAA 1Z6XA 3H0CA 2RAFA 2JLAA 3Q8XB 4M7OA 4C04A 3UMGA 3AL2A 1JQJC 3D2CA 3IA2A 1C8VB 1V8DA 4KVZA 5EMLA 2MR5A 5EUBA 3S55A 2GF2A 3CIFA 3CONA 4EUSA 5LN1A 2DB3A 3RS9A 1GKUB 2IEGA 2P90A 3M5WA 4OK5A 4ZDIA 3DOEA 4BMPB 1VCNA 2P8JA 1ORWA 2WA2A 1K68A 1DBQA 2RC5A 3P94A 4GE3A 5JSKA 3W5DA 1E0AA 4WLVA 3VTAA 3CBGA 1EFRA 3GN1A 3I09A 3KV3O 1GV1A 3TQQA 2F1KA 1WKVA 3EZFA 4IKOA 3LT2A 1G3QA 2I78A 3OOYA 3VDRA 3CJRA 3ZX5A 4MKZA 2XF8A 3FPFA 4MWTA 4DLBA 3S2GA 1SQSA 1G1AA 3B8HA 3I4LA 5ISMA 2FLWA 3W79A 2RGNA 2ZVJA 3C5HA 1NBWB 1V0JA 3W78A 2E7ZA 4D9CA 4Q7EA 2CE2X 3DDSA 1RXEA 3ZV5A 4X6LA 2Q3CA 2Z58A 3DF9A 3P9NA 3BXHA 2I62A 5DXAA 1FF9A 2X77A 5LOVF 4XD7A 3QOXA 1XX6A 4Y6SA 5H81A 3FWKA 2GK3A 5KOHB 2OCBA 2VDJA 3QLVA 3MWFA 4AJOA 3BWXA 4U1RA 1E6UA 2REBA 3OZCA 2JATA 1Z75A 5AUOB 4J0FA 1JSZA 3RV3A 4LY3A 4FGJA 4MGKR 3ROZA 1ECBA 1NFFA 1WY7A 4QGHA 4PQRA 3FJOA 3D6VA 3EGDB 1LNQA 3WLJA 2IF2A 4S0ZA 1U0BB 3DZKA 3MFYA 4K9QA 5EP1A 3NETA 1RJEA 2PUBA 4C20A 2XNJA 3G02A 3ONDA 3GVPA 3CR3C 1XWIA 4BASA 5AM4A 5A04A 1JHRA 1NF3A 2Z30A 2X8BA 3HR7A 3OQMA 4J9VA 2CMKA 3DE5X 2B61A 3RLFA 2Z9DA 4C7MA 4OJYA 1LFDB 1SH7A 2HJHA 2N46A 2OFXA 4RH0A 4UCFA 1PZFA 3V7WA 1FUKA 4BRZA 5AHRA 2H4YA 4C6TB 3IVXA 1PVVA 3FCEA 2HFKA 1ATIA 2PKWA 1WY5A 5BQPA 3VOSA 4BU0A 5DXJA 5BVHA 5KVCA 1RFLA 1HTWA 2WOJA 2XMDA 5ALXA 1SBZA 1V5WA 2C84A 5BURA 2HGZA 4LVCA 4Q3BA 1DLIA 1ZH6A 1H93A 2UVQA 2Z6VA 4MLCA 4IIYA 4QEDA 2OBFA 2PJUA 2B3TA 3JYHA 4KSCA 4I55A 3RIGA 3ZNNA 4AQYB 3DDZX 1YFZA 1NUTA 4QODA 3N2IA 4RETA 5LZ8A 2G70A 1KHTA 5T6BA 3KSAC 3AKEA 4KR7A 4L75A 2F4NA 2ZULA 1W2GA 1XMPA 1C3LA 4N8SA 3T52A 4QXMA 1J23A 2JBWA 4JLPA 3ZHOA 1U5CA 4UXJA 1WX1A 1YJBA 3LUHA 2W8BA 4A0HA 4G0PA 2QSJA 4HAOA 4M0UA 1HZZA 4FYVA 2P6OA 3V1KA 3IJ5A 5EJ9A 1JPUA 5JSHA 1TO2E 2HBQA 2AR0A 3T99A 3ZH9B 5EMKA 4Z3OA 4XJSA 4KN6A 1ZP6A 3CWQA 1DDOA 1O3YA 2PANA 5AVWA 1Z3CA 3AFMA 3DBLB 4QBIA 4FFOA 2Z56A 2ZBQA 5FD8A 2EEZA 2Q49A 2VPIA 4HCJA 5DGDA 4UE2A 1AV6A 4NPCA 3PFKA 1ISMA 1CDOA 2MINA 3I01A 4ILKA 5ICEA 4L4RA 1K5HA 1OFTA 1F2UA 2VHCA 3Q0IA 3DLAA 4UEQA 1FDRA 1T2FA 3KAKA 5ER9A 1Z0KA 2D7CA 1GPBA 1Z4KA 3JAKB 3AYZB 3JY6A 1EXWA 4P0PB 1CQJB 1M33A 1RCTE 3KXIA 3RVMA 1D04A 4YRRA 4Y7CA 4YI3A 1CF2O 1S1MA 4KFSA 2WSBA 1XNJA 3UHOA 4DG5A 3OJ0A 1KGDA 3C2QA 4P7BA 2C5HA 1LQ2A 2MSKA 2ACVA 2ZANA 4GKVA 3GJQA 4YJGB 3KYJB 2WRZA 1AOXA 2YYSA 3M5DA 3VR4H 1AKYA 5LDGA 4KQWA 1EK2A 2I6QA 1E64A 2RE8A 3CEAA 4DTCA 1O97D 1M8GA 1AS0A 1XQWA 1ZRHA 2BHLA 2QL9A 2P7IA 4JBIA 4UHEA 4DIUA 1HYEA 2H4ZA 1EX1A 3RVSA 1EYZA 1O96A 1M10A 1IJKA 4DV7B 1YU6A 1XAIA 3ABSB 1N0VC 1FFDA 2AFRA 3NHAA 3OM9A 1NR1A 1XJWA 5F1KA 3WZMA 3X1KA 1GL3A 4YRAA 5C1PA 1CQIB 2JLQA 1JP7A 1WKCA 1F3LA 2Q5HA 4HZGA 1OPXA 3AJ8A 3DW3X 3IUEA 1KJWA 3G82C 2Y1WA 1FMJA 1E9AA 2XGGA 2AFIA 2FSFA 2OZEA 3E27A 3ROGA 3I04A 1TD9A 3WMEA 4Z53A 2DLCX 4P9NA 1T1GA 1XU7A 3MRTA 1WE2A 3JQAB 5DMXA 1B0AA 5FBZA 1TM3E 5TDHA 2MJLA 3KOYA 4BQSA 1KZ4A 1XU9A 1M1NB 3HMQA 2YTZA 3LBHA 1JLHA 2B30A 3C7CB 1QE0A 1S4QA 3O8BA 1K6IA 3LLVA 4QULA 1H23A 1NY6A 3THWA 1RHKA 2R96A 1J22A 3GT7A 1NBME 2NPFA 2XKBA 4MPTA 2J0EA 5DNCA 1XHLA 2GBLC 3E70C 4PM4A 1HT2E 3L4EA 3NTXA 4NABA 1V2GA 4LAFA 3R41A 4WW0A 5CX1A 4AF8A 3GQVA 2F43A 3UJNA 5HYVA 4LXGA 3OD5A 2O5EA 4YP1A 5KHOC 4ER3A 2RGAA 1QJCA 5E3IA 1JLLA 2CFTA 2XCSB 1A4IA 2O52A 4RA9A 4G37A 2GEDA 4P80A 4EB0A 3GLGA 4B2IA 2QRMA 4IXNA 4RH1A 3I58A 4CV3A 3KR0A 4N6GA 2FPXA