3H11B

Zymogen caspase-8:c-flipl protease domain complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
229
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKGKQMPQPTFTLRKKLVFPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of procaspase-8 activation by c-FLIPL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords CASP8 and FADD-like apoptosis regulator
total genus 81
structure length 229
sequence length 257
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h11B00
4ZVUA 4I1PA 1PYOA 2CDRA 3GJQA 1I3OA 2QL5A 3BIJA 1RWNA 4JJ8A 1SHLA 1JXQA 1I51A 2CNNA 1RHQA 4NBNA 4QTYA 4EHNA 3SIPA 4FXOA 4IEFB 1RHUA 2C2ZA 5K20A 4QUJA 2QL9A 4QU9A 2XZDA 3R7BA 1K86A 4QUIA 2HBZA 2XYHA 3V6MA 4IYRA 4DCPA 1QDUA 5LU9A 3D6MA 3GJRA 1CVRA 3PCXA 2WDPA 2C2MA 5IBCA 2CNLA 2H4YA 1RWWA 2AR9A 3RJMA 5JFTA 3P4UA 2XZTA 4JJEA 4D3ZA 4EHAA 1QX3A 1RHRA 2HBRA 5IBPA 4LSZA 4EHFA 3D6FA 4QU5A 3H13A 3V55A 4QUEA 5LUBA 4JB8A 3IBFA 2H48A 2J30A 3E4CA 2H5IA 4JR0A 4AWAA 4N7JA 5IC4A 1M72A 1K88A 3SIRA 4N5DA 1F1JA 3R5JA 1NMEA 4FDLA 1I4EB 1RWMA 2J33A 3S70A 4D3XA 2P2CA 4QULA 4N6GA 2C2OA 3H1PA 1SC3A 5IANA 4JR2A 4HVAA 3UOAB 4AW9A 5IASA 4D3YA 4N7MA 4EHDA 3EDRA 4DCOA 2CNOA 4JQYA 1RWKA 4NOLA 3V6LA 2K7ZA 1NW9B 2NN3C 4QUBA 5I9TA 3ITNA 3R6GA 2XYGA 2FUNB 2Y1LA 4QUDA 2H4WA 4QUHA 4I1RA 4ZVSA 5IAEA 2XYPA 4N6OA 1QTNA 5IABA 1RHMA 1SC1A 3PD0A 5H0IA 2QL7A 4JQZA 3GJTA 4ZVPA 1RWVA 1NMSA 4N6NA 2QLJA 4QUAA 1GQFA 3UO8B 1IBCA 3OD5A 4NOKA 4HQ0A 1I4OA 2DKOA 3NKFA 1RWPA 1SC4A 4NBLA 2HBYA 3D6HA 5IC6A 3EDQA 3K7EA 4NOJA 4PRZA 1RWXA 2H5JA 2C1EA 1BMQA 3DEJA 3KJNA 5IAKA 3QNWA 1RWOA 1F9EA 4QU0A 2J31A 4FEAA 4DCJA 1GFWA 1PAUA 4EJFA 3KJQA 1ICEA 3R7NA 3R7SA 3H11B 2QLBA 4PS0A 4M9RA 3S8EA 3DEIA 3H11A 5LU8A 4QUGA 3DEKA 2HBQA 3V4OA 3NS7A 2Y0BA 4EHHA 4ZVRA 1SHJA 4ZVOA 4JR1A 1CP3A 4HQRA 3GJSA 4NBKA 4QTXA 3P45A 4AWBA 3DEHA 3V4LA 4NOMA 2CJXA 1KMCA 3R6LA 3IBCA 1RE1A 4JJ7A 2C2KA 2CNKA 2J32A 4QU8A 4ZVQA 3KJFA 2H65A 4PS1A 5IARA 3H0EA 4PRYA 4ZVTA 3NR2A 5I9BA 5LUAA 1RHJA 5IAJA 5IBRA 2FP3A 4EHLA 1RHKA 2FQQA 4EHKA 3V3KA 5IAGA 3PD1A 2CJYA 1NMQA 3R5KA 4FGUA 2H54A 2H51A 2QLFA
chains in the Genus database with same CATH superfamily
2P5TB 2H8KA 2XTNA 2IU4A 5LCXA 4CIAA 3IEMA 3UB2A 4AIIA 3N6VA 1R6BX 4I4TF 5CXXA 1TZJA 5FA6A 4D6PA 4GZ5A 4YMUA 4A36A 1FYXA 2ZPTX 4IG9A 1SWWA 2P3SA 2GO1A 4RA6A 3VPAA 4BFCA 1E4EA 3WA7A 1E2LA 2OXRA 5LLTA 3EXHA 3PUKA 3PQ8A 1E6KA 5GJWC 4BQOA 5GADl 4DVGA 3H1TA 5B5SA 2DHQA 2WA2A 1AKUA 3PUIA 3TUJC 3EQ2A 4J0HA 4WNYA 5CVUA 1UEIA 1WHSA 2YCLA 1IY8A 4A4DA 5KWIA 1IUPA 2R751 2OXIA 1RWWA 4J2OA 4D4MA 4DCGA 1RP7A 1JDBC 3WWOA 2YOHA 5HE8A 3BJZA 1FLAA 3GGDA 4EG8A 2YC4C 5JI3E 3EZ9A 1UJBA 4IXWA 2CXNA 4ICIA 4CN8A 3HUUA 3I5XA 3CNBA 3D8RA 3EVTA 1I3MA 4N7RA 1FUKA 4IQFA 4Q19A 1LEHA 2DPGA 3ABSB 1VJGA 3TLYA 2EW8A 4CQMA 4M55A 4ZOLB 3L8HA 2VRNA 3HEAA 3MC1A 1OA0A 2CDCA 1YHZA 4X97A 4LKOA 2AZMA 1WV0A 3O9ZA 2G6TA 3SNHA 4QFMA 3FUUA 4N6GA 4AJOA 4GUDA 5B4UA 3OO1A 4LTMA 4FE7A 2LDBA 1A8IA 4BAGA 3FM9A 5IASA 5CXUA 3AF3A 3QW2A 1GZ4A 4PWYA 3OEHD 1P0QA 1S6YA 1ECJA 1RWKA 4X60A 5TPWA 1U0TA 4WBNA 5FPPA 4E3ZA 3FMOB 3ONEA 2RK3A 3PCTA 1QK4A 3IRVA 4PX3A 5A0VA 1YQXA 4X1YB 1M34B 3K20A 1YFLA 3FLEA 3LMKA 4I1OA 2ZSJA 1GTJ1 5ICEA 4WL0A 1PJBA 3KXDA 4FOSA 5B30A 3NU1A 1A5AB 1K3TA 2BRUC 2DYKA 2WMYA 3DL7A 4H08A 4JLSA 5IJ9A 5A0FA 1QTQA 5JADA 3Q0EA 4RV4A 2DERA 1T5LA 3AU9A 3AGPA 4FFWA 3ZK9A 2VPPA 3F7TA 4BN4A 1C8BA 1SVLA 4ZQIA 3QOYA 5JDIC 1EUZA 2ZK7A 3NM4A 4QRHA 2NP6A 1RLJA 1E1YA 1LKZA 3UOGA 3CR7A 2VK1A 5DT2A 3JQ9C 1PJCA 3QE9Y 2JIZD 1Z5ZA 4RIIA 1XDSA 3UCFA 4BP8A 3QVSA 3GBSA 1ISJA 1EK2A 4W7IA 5GONA 1TT5A 4TTRA 4DXHA 5I4KA 1BOFA 3DLBA 4LOHA 3UW3A 1Z83A 2KWIA 4K9LA 4BBPA 4RDIA 2R3SA 3NP9A 4H2DA 2DKNA 2V3CC 4HWSA 3NASA 3AV3A 3Q40A 4LRXA 3V4OA 3CB4A 4AS3A 4DANA 2HJHA 3NBMA 1QRAA 5FULA 2DWQA 1PD0A 1Q1NA 3NONA 3AUUA 4D45A 3TZKA 3TI7A 3N59A 5IN4A 3ZZ1A 3WQQA 1TCCA 3GL9A 1JDNA 3QSGA 3I9LA 2XCRB 2NLOA 1S02A 1A9QA 1YQUA 3GFVA 1JSLA 1J0EA 1CQPA 1JU3A 2ODNA 3AXTA 1YCDA 2CFSA 2PY6A 4UPVA 5REQB 1W4BA 4LF8B 1G38A 3JWGA 4MS1B 1O4WA 3TE7A 4B45A 2ZTUA 3G5MA 3CNOA 1V8PA 2P2ZA 4B7ZA 1FPQA 2CJYA 1EUQA 4X6YA 1CNFA 1GU1A 1UBHS 3GLVA 2BZSA 4LZWA 4S2UA 2CLHB 3RIXA 3TLAA 1MCZA 5DI9A 2BE7A 2WTBA 2Z2KA 3RSOA 3D7KA 4JELA 2WYHA 3CRZA 3RVSA 4E33A 5JMWA 4I4LA 1GQ2A 2Z30A 1F8XA 2ZJZA 5LQJA 4B75A 2YVAA 3K53A 3LYUA 1K86A 3UQZA 1BEZA 1FQWA 1RYZA 3EF1A 3F5SA 1XKTA 2QTBA 3HDHA 1F7UA 1S9HA 2CFOA 2WKSA 3OKAA 4CMCA 3OKPA 4UFPA 1ISGA 1P1FA 2OKCA 4ZKDA 2W0SA 4ESVA 4DV0B 1HOTA 4HL6A 5AO9A 1WABA 4XI9A 1PR4A 2OXFA 1R6AA 3ZU5A 4B6QA 4YNBA 5GPBA 1YVDA 5IC5A 4B81A 5EFOA 1T9KA 1D9XA 3A32A 3EGDA 2QGFA 4UCWA 4UZEA 1GDTA 3OT1A 3Q7QA 1YU9A 5B7QA 2FETA 1YC2A 3RYFB 3Q5GA 3WFZA 5KWJA 1EXDA 2DUNA 3CUEF 1Z7EA 1RRKA 4EPYA 1UOOA 5LPNA 1GOTA 5F7JA 2ASVA 2CVZA 2QRUA 2Z2ZA 1UXGA 2GJAA 2QTMA 2A1UB 1Y33E 4G09A 4PBTA 3A4LA 1CJUC 2SCUA 2J07A 4DUGA 4CF6A 5DRYA 1W87A 2V7TA 4J3NA 2V3VA 1G8PA 4WLVA 3KSDO 4YRJA 4Y67A 1R00A 1NVMB 4WA7A 4B6SA 5U9CA 3IVMA 3KZKA 2ST1A 1JXOA 2RGAA 3ND5A 4Q1EA 3VH1A 3O38A 5KI6A 1FK8A 5TRTA 5G0TA 1FYFA 4WZAB 4BEBA 2YN4A 1X1SA 3KHKA 1J7KA 1GFZA 2PBLA 2XYPA 3OQBA 1TTHA 3VZDA 1MB4A 3RU3A 4RTRA 1T5OA 4HX2A 4N01A 1QKJA 1NQWA 1Z35A 4FCWA 1WSAA 3G23A 1NMSA 4J6EA 4J0DA 1GT6A 4KXYA 5ICFA 2G72A 4ZODA 4D42A 4UBJA 1P31A 2FPLA 4O5OA 3L4JA 2PJUA 1NRXA 4POAA 1L1FA 3WS7A 3JWIA 4AYWA 1PL0A 3ZBTA 4DDVA 1VL2A 1M1NA 1X1DA 3NDIA 3O83A 4R71A 5BPFA 1P5FA 1V8ZA 5CDYA 2GXSA 5CITA 4ND2A 1ITZA 6LDHA 4S0XA 5AJHA 1UEXC 2OZLA 4A2QA 4Z0TA 2QZ9A 4UDYX 2PT6A 4A3SA 3VSDA 1ZK2A 5TQJA 1BE1A 1USGA 2HCFA 5JYCA 4DR3B 1EG2A 3IIMA 2BFCB 3B2EA 4ITRC 1V41E 1DAIA 1ORIA 4FB5A 3C85A 4KX3A 4RCZA 1G20E 5EA2A 1HK7A 3Q3GE 1XPOA 2BJVA 2VTKA 2WV9A 2LZ0A 3RAFC 3ILYA 4D9EA 1OWPA 2PG3A 5TF4A 1GM5A 4NSNA 2V7QD 3C3KA 3LL4A 4I55B 3SICE 3FMFA 1Z73A 4ZYYA 3IDQA 5KJFA 2R5WA 4JENA 1FP6A 4MUYA 3R8FA 1CU1A 1HQKA 2VUSA 3DE0X 1OYYA 4U7GA 1HFEL 1FA9A 2X41A 2WF5A 4QPDA 4N8SA 3EXHB 1Y7HA 1JEQA 2HDWA 3UPDA 5C8VA 1QPBA 1ZQ1A 4D98A 2VHWA 3STWA 1H6AA 2YHUA 4AD8A 1FF9A 5C8YB 2O8FB 2XDWA 2Z2JA 5DTIA 3OPVA 4DKJA 1C7RA 3G2QA 1NI5A 1D7AA 1TO1E 3ZPXA 2FMIA 5K0EA 3UMVA 1O3YA 1X7WB 1D2NA 1P9WA 1SBCA 1Z47A 2PL1A 3BA6A 3EUWA 3JARB 4MR7B 3V1YA 2VRWA 4GPEA 4BFYA 1N8NA 5BXYA 2QTVA 2XOKA 5SZKB 1YMQA 3GRVA 5GAJA 1WLSA 3ZDYB 3N2ZB 2ZUUA 2GK4A 3DNFA 3SXJA 4BV9A 4JVSB 3R7AA 1XMQB 3D1VA 5ICMA 4LBYA 4MI3A 2QD5A 2RG7A 3DCJA 2PKQP 2VYFA 2WKRA 3HR8A 1UT8A 3LC0A 3L7AA 3IEUA 4GYKA 5LB2A 2NVUA 1JZQA 1P45A 1SCQA 3PGLA 2ZS8A 3B2QA 5C5EA 2Q2NA 1WDKA 3UWSA 2JFZA 3LGXA 3OFVA 1WP9A 3BTOA 4J94A 2IX9A 1ABFA 3AERA 5KOHA 1WDTA 4CTJA 3ZX5A 3EY9A 2FN3A 1ODTC 1ID1A 1NXSA 2ETVA 3L6OO 4PXAA 4PZ0A 2X4IA 4S1VA 2VZ0A 1N5IA 5EQTA 4E3WA 4JLOA 3U7QB 3LU1A 3FHOA 3R7DA 4KR2A 5FI3A 4RGVA 4GR4A 3ZGZA 4OREX 1O9BA 4FFLA 1SD1A 5AUQA 3D43A 3N75A 1IQPA 4OHKA 1EA7A 5ALLA 3OHPA 2R1TB 3PDWA 4YAEA 1T1SA 2QV0A 4GPIB 3AZOA 2WMOB 2OCGA 2AD1A 3L0CA 3W79A 5FUQA 1QU3A 4LNAA 5DWVA 2NU7B 1EFDN 1VE6A 4WECA 3LYHA 2EFHB 3ESYA 4WSOA 4WVFA 4Z3OA 4HH0A 5ADVA 3M6UA 3L05A 3KAQA 1AKTA 2R8ZA 5BUQA 4Q4JB 3ER6A 3KELA 5E2BA 5FOXA 3KJEA 3LJKA 1T2FA 4IJWA 2YYAA 4O4LF 5C2JB 3E1GA 1GZDA 1N92A 3QQPA 4XIYA 3H04A 1U28A 2F8MA 2VRCD 3OWHA 3W34A 4RENA 3G3EA 3K5PA 1C3EA 3QYAA 5AK0A 4EH1A 3OT4A 1R9NA 1KDTA 5DTMA 1QU2A 5J2TA 4CEJB 4UEWA 2RAVA 3MJSA 4HBGA 3TIVA 4QBHA 4RVOA 5CJPA 2RKBA 4MK4A 3VI4B 4ARZB 4JL6A 3JZFA 1UBFA 4ZREA 3MD0A 4A0QA 4HNSA 4KDFA 2P2GA 4M21A 5IBQA 4BMZA 1SHKA 4HTFA 3S2YA 3EVZA 4FWIB 4JVMA 1CE8A 4HRYA 3V3TA 2Z8YM 1CQJA 3VPXA 1E1CB 3PHLA 5JSYA 5JVDB 3WLEA 4D2IA 2YRWA 1W4AA 1RKQA 3CSSA 2PCJA 3Q3HA 3H5IA 1Z6PA 1E7RA 3LW7A 1Z6AA 1FZQA 1JH8A 4G3XA 5HS4A 4YCNA 1F38A 1JLLA 3AI3A 2FP4A 2VF4X 4GIBA 1EWTA 1GUYA 1TQDA 1GRNA 2MYNA 1YVRA 1Q57A 2HMSA 3VU9A 1Y8RA 4PTZA 4KRFA 1PG0A 2YZKA 2CVPA 2OGWA 1R4MA 1UZNA 2V58A 3DDCA 1FP1D 1HMYA 2FJ0A 2JCVA 2R47A 3VR3A 2ZUVA 1PRYA 4KBYA 2UXBB 1II8B 2IOYA 2QB5A 3O9MA 4QGAA 1R0RE 2FP3A 4YRCA 1XZNA 4NZNA 2QYTA 2FGKA 3STHA 5K5EA 4QL3A 4XCQA 1V95A 1Y1TA 3QP9A 1KFEB 2X8WA 4D0GA 4NI5A 2C7VA 3OEEA 2Z98A 3K5HA 4Q3EA 2F48A 4C4RA 4EG6A 1Z6XA 3V7NA 1NDQA 2J9RA 2CUZA 5KWVA 4N41A 5H9WA 3NBYC 3ANSA 4NMHA 3NORA 3W3ZB 2F59A 1NT2A 2FCRA 3QXHA 3L8ZA 4OXIA 4B2YA 4CV0A 3IVAA 5F2NA 4IJKA 1XZMA 4OGFA 1B0PA 3SR4A 3HZZA 1SXJC 2JH9A 3JVEA 4TS9A 1ZN8A 4DKXA 2IUEA 1J2RA 3TDKA 2CK3D 1E0DA 3IQEA 4QLAA 3LDFA 2VT7A 1DBPA 3DPSA 13PKA 3GRRA 4TSKA 3GHYA 3JAKB 1CV2A 4ZARA 3RV3A 3VTAA 2BGWA 2HBRA 4P3KA 4YMLA 1DIOB 1TU0A 1TZ2A 2E1RA 2EARA 3FSGD 3TMYA 1O8BA 2P78A 1NNSA 4LC9A 3DBHA 1WSBA 3RLIA 3OZ7A 3UICA 2QT0A 3Q3EA 1I7DA 4K86A 5DLQC 1LS1A 1BRMA 2JATA 4GVLA 4CMAA 5IC4A 1ZIOA 1YGPA 4H4DA 2ID7A 3VR5H 3SIXA 4IMPA 4BCCA 4DZZA 4Z4CA 1PHPA 1VL8A 1UJCA 1YC5A 2PA0A 3D6VA 2F1IA 4FGLA 4LXYA 1JPUA 3SR0A 3W7AA 2W93A 1YJBA 2C2OA 4GW3A 1XGKA 4CIVA 2EATA 4J7XA 5HQTA 3ZNPA 1I3KA 3VO2A 4WPGA 3T3GA 3C4JA 4EITA 2PZ8A 3D4IA 4FTWA 4WVLA 3WO1A 2QEQA 1E96A 4DWJA 4IVQA 5ECYA 4P4LA 1AM4D 4XEHA 4N6OA 3BBLA 3R9XA 3BSYA 3SVLA 1L5FA 1U7DA 3ANXA 1PNOA 3BE4A 3JASB 3OZIA 2AMVA 1CY4A 1XV5A 3BBPA 4R5HA 1E2JA 3VNUA 1ISPA 1H9AA 1HLPA 1XMSA 2ZJ1A 1ESZA 2CSUA 2CZCA 2BFOA 3QE2A 3RBXA 3ZY3A 1EP3B 1FQOA 2O50A 3VH3A 1N2CE 4IMRA 3JQ8B 1BXKA 2FQXA 5ESXA 1ZVVA 1RWXA 1KZHA 2W48A 3ROEA 2QVBA 5GGYA 4E2YA 1EK1A 1JE0A 3ICOA 4U9IS 1A2KC 3LI2A 2O8BB 5HZMA 3BF8A 1WETA 1FZTA 4HXEB 2IODA 3V8EA 1GILA 5KB3A 2OCKA 3A6GA 4PYQA 1ECFA 1LRLA 1Y9ZA 5EJ7A 2HHLA 2P41A 1KRXA 4DYDA 2ZIZA 3W8RA 4MKFA 4ZWNA 1CB0A 2DHCA 3LWDA 4G9GA 4R2IA 4D9MA 2XBUA 2PD4A 3L1JA 3HY6A 2WT4A 2I91A 4ZVOA 1VQ1A 3FYDA 3O4HA 3HDTA 4KPFC 2CT8A 2B61A 1W49A 4X1IA 4Y1GA 4ID3A 3UJ7A 4C1BA 2WJGA 1EKXA 1AKRA 2FR1A 4E2XA 2C88A 3FHCB 3PJEA 5DHUA 5ENZA 4EABA 2QTVB 1OFIA 1Q2UA 2J6CA 1DXQA 3GT4A 3HP4A 3MM4A 4FYXA 5I4CA 3PZRA 3RGGA 3K0CC 2Z4RA 5HF5A 4A6EA 3NFYA 1KK2A 5I7WA 5SZIA 4COOA 4MQ4A 1V35A 2JKYA 2BSAA 1GGMA 4GP7A 5GZ3A 4E30A 4O59O 3GP5A 1I9GA 1G6Q1 2ZI3A 1U3WA 4QEZA 2IHZA 1Q20A 3FFXA 3QK7A 2WM8A 3ACDA 1QHIA 4KO4S 4BCBA 2IP4A 4PZEA 3A9WA 2FN7A 2AR7A 3BD9A 3JPWA 4WZBE 4TWZA 4PIMA 1WEHA 3EAQA 3AP3A 1YQ9A 2O3QA 4EJ0A 3EASA 4JNKA 5CR9A 5JMPA 1K75A 5FNVF 2OG1A 1F5SA 3TZEA 1FYWA 3LCCA 1EUCA 1UPAA 2YWHA 1KJWA 2I71A 1A2QA 3G9ZA 1R8XA 4H9GA 3UUFA 5LMCA 3ZDAA 3ZHXA 3G2LA 2PZEA 2I1LA 5ITVA 5CP8A 1KO8A 5J9FA 3IKJA 5JNUA 3QU5A 2NU6A 4B34A 121PA 3GD5A 1TB4A 1AH2A 4MV7A 2CDBA 4XJTA 1MAUA 2JFUA 4KNWA 3A9CA 5I5EA 1QOPB 1V8DA 5JH7F 2AFIB 3DDNA 1GKKA 3KU1A 4LRUA 2D1YA 2QT9A 3FPJA 1ISFA 3GLUA 4TS1A 4IO0A 2QJWA 1YQEA 5GZ6A 1XRRA 4DMGA 2CYAA 4QBGB 2W43A 3S1AB 5EFZA 3LLSA 4P4TA 1YACA 2AHRA 1C4KA 1C14A 4RA6B 1BHSA 1N75A 5FOUA 3GGGA 4PG4A 1OGJA 4DCOA 4C76A 2J8ZA 2WVJA 4FXPA 4OUDB 2LCFA 1NN1A 3AC0A 5J23A 5FBHA 1TMGE 4F21A 2IYLD 1KBQA 4BVHA 2YINC 4ZOLA 5IDYA 5TT0A 5KYVA 3FYCA 4OHPA 5BOVA 3TJMA 3ZV4A 2BFBB 3N2YA 2I3AA 4GP6A 4QASA 2WJ6A 3UB4A 4ZYTA 1B0UA 1CUCA 1K08A 1N2ZA 1EM8B 1NL3A 1RWVA 3IUQA 5EIHA 3SC3A 3ANMA 4DIBA 3VU9B 1CIVA 1N6LA 3MBKA 3WGNA 2G82A 3X1WA 1NQXA 3C5HA 4IGEA 1SG6A 1HDGO 2UYYA 2W2MA 4JBGA 4KFCA 5AI0A 4ESOA 4HZIA 2QP3A 4OBBA 3P0HA 5CLHA 5ELMA 4NOJA 4ZYWA 2VP3A 2G08A 2QSJA 1NKTA 4MYDA 2BELA 5AKEA 4YRSA 1GEEA 2IOQA 1ND6A 3BRQA 4MGYR 2R96A 4F4FA 2HY7A 1RABA 4P33A 4ZT6A 3TB4A 4CM7A 4CEHB 2IPLA 3SPXA 4LVCA 3HR4A 4ENVA 2EG5A 1QYWA 2BMFA 5F5LA 1HQCA 2Q2QA 2ZAOA 1DVRA 5FA5A 5BNTA 4TZKA 1XR3A 3IQDB 3PDIB 1XROA 1LUAA 3HL4A 3UB3A 4R54A 1M5RA 2HJRA 1E2FA 2JFOA 1JYSA 4IJUA 3CUTA 1EBUA 3EXIB 1L5HA 5BN4A 2Q5QA 3R44A 1CRLA 3HJNA 2FUKA 1DX4A 3OFNA 1KH1A 2AVDA 3I5MA 4FT2A 4MZXA 4CVNA 1D1TA 5FLKA 3W2GA 2W90A 2ZRKA 3ORYA 2JGRA 4MI9A 3OOYA 4TPKA 4HLCA 4UU0A 4ASUD 1SXHA 1ZOPA 2FEOA 2RGWA 4JA2A 3MAJA 3TR0A 3B1ZA 4JXZA 4PLHA 2HV8A 5FUVA 3LA6A 5IARA 4DIDA 3PEYA 1UBRS 2VC2B 2DPYA 4RFSB 3FPKA 3SKVA 3AETA 3LQ1A 1KJQA 2OECA 3N53A 3PQ2A 1U8EA 2P6RA 4G4SO 1BU5A 4LMBA 3O6VA 1L4MA 2QVGA 3B78A 1SC6A 3SZ3A 3FFBA 4L8FA 4KQMA 3RSLA 5JZBA 4LGYA 1ADBA 4MAAA 1B42A 2FPGA 4NYMQ 1AB5A 5T67A 1YAHA 3G1UA 3C7TA 3LBAA 3N0VA 1LX6A 5ULLA 1CNEA 2OV8A 4GHWA 2D1FA 1E7WA 3DWGA 4MX8A 2CN1A 2C96A 3LGAA 3L43A 1R18A 2ALJA 3QYJA 3OWOA 1R4AA 1D09A 3IOEA 3K35A 4WN9B 1DKNA 2AMFA 2ZUDA 4A1OA 3FZQA 1FX0A 1ZDMA 2VYNA 4KX5A 2XITA 5HZGA 3QKRA 2WB4A 4HMQA 2PD6A 2H08A 3Q3VA 4EUHA 1R9JA 2QW8A 3SU8A 1TNDA 1C2TA 3GK3A 1X19A 4L9WA 5JD6A 3GVIA 3SM3A 4OGKA 5F35A 4F4DA 1G17A 5MN4A 3JALA 1T8UA 1EWYA 2P7HA 2Q4RA 4LRWA 5B6JA 2J30A 2PNFA 5B2ZA 4R68A 2DHRA 4YI3A 5FQNA 1VM6A 4HK4A 5LXTA 5KSPA 5FPHA 1JU4A 1QHEA 4IS3A 3VHXB 4TMZA 3O82A 2CNWA 3KHSA 5I9IA 1HDZA 1RPJA 1Q1GA 2XB6A 4PHHA 2XUZA 3LC7O 2NACA 4GX1A 6CHYA 1R9GA 4PGHA 1Q0PA 4FWTA 1V6SA 2AHOA 3T1YB 2YXNA 5KOJB 1WY5A 2VHCA 4Q7LA 1SD2A 5DVZA 4NJEB 3PKZA 4NJMB 4PXYA 1KAHA 1QHNA 5AH0A 4BRSA 1YE3A 2GLUA 1JUDA 4LZPA 3H1BA 3ETGA 3M70A 1BD3A 2H6EA 4JYBA 4DMRA 3HM9A 1M2EA 1XQ1A 3CX8A 2AMYA 5LMNB 2WUEA 3EDYA 1TC2A 4CM4A 1N9GA 4ND1A 2YZ2A 1M3SA 3Q8MA 3MQ2A 1VSBA 1EDDA 8GPBA 1RWQA 2P9TA 1KKUA 2MYPA 4XJXA 1Z75A 2VNHA 1OYOA 4O3MA 5IC6A 1T2CA 2H0RA 3GLFB 2ZE8A 4LEIA 1LK5A 1U99A 3M2TA 4Q82A 2I2FA 5G4LA 2AOUB 3KWMA 1GP2A 1IVNA 5A6SB 2C7BA 1K6JA 3VC1A 1HFJA 3DOUA 1RIFA 3TKYA 4FS8A 1XMIA 3V2UA 3DPIA 2ZETA 4GQAA 2NAPA 3I4CA 4YAOA 1IU9A 1S1MA 2WUWE 4PO3X 1GL3A 5IKPA 4RFVA 5E6UA 4MRAA 3RC2A 4RXUA 1YBAA 1ZWLA 4GBGA 4C7VA 1KFJB 1Z13A 3AF0A 3O4FA 2PZJA 1KARA 2X9NA 4YGXB 3SHFA 4MW4A 3UKJA 5CD1A 1GTRA 1E3MA 4XYGA 1O95C 2JI4A 4TTTS 4F6CA 2C4NA 1RLIA 3EHDA 5EIWA 3T7CA 1NW3A 4X6XA 3HABA 1J97A 4GVPA 4P92A 4R2XA 3SK0A 3GRKA 2ODQA 4FGKA 1LTQA 2JAQA 3CWCA 3DMNA 1I0IA 3NIFB 4E11A 2WUGA 2YR0A 2G1UA 3SS9X 4M7PA 4ENSA 1I94B 1E5XA 3ORRA 1YV9A 3K0BA 2BI4A 2FH5B 2BEVA 5K3AA 4ZHSA 4YV0A 2D7JA 2GYYA 1HEUA 4ZI5A 2GBGA 2GEBA 3PD1A 4FNOA 3VR4D 3VISA 1JHMA 3U4HA 3FBGA 3KEOA 1E9FA 2YW2A 3EQ6A 1XVIA 1Y5IA 3AOEA 4C0AC 5FYQA 5B3KA 1O89A 2WUDA 5FBWB 4EGAA 3IOCA 2EFEB 2O0KA 1M74A 2B1GA 3HO6A 2QL9A 2WHXA 4ZU6X 4NY1A 2D4HA 2VQEB 1P2FA 1G8GA 1M8PA 2PT5A 3L82B 4G63A 5AQ1A 3M49A 3D9QX 3BFJA 5FOWA 3TOVA 5PNTA 1PDWA 4W1QA 1ZN7A 3ON5A 5T8KA 3QWFA 1DCTA 3OHMA 4V3BA 4KYVA 3N2GA 3RJMA 3NDRA 3PFGA 4J29A 5I6DA 2KPOA 3RRJA 1VJ1A 3C3BA 3DW3X 4CF5A 5DV9A 5CDGA 4NMXB 3EZ6A 4HXGA 3U7EB 4CQNA 2GTPA 3L0SA 4YDQA 2VP9A 4MVJD 5FOTA 4PHCA 2PUDA 1SJ9A 2NSDA 2Y1CA 3EGXA 1OB5A 1DHRA 2H7VA 2W2TA 1O5IA 5AW4A 5GJCA 3P26A 5JATA 4X65B 1TFUA 4WY8A 3U5TA 1OYVA 2QG4A 4CL0A 4JLJA 3KXPA 3OX2A 5AHXA 2QE7A 2ZAIA 1R6UA 1Q0ZA 5IYZA 2N3ZA 4KAJA 3SVTA 1A8UA 1KC1A 2Q1XA 1GNVA 1R5JA 1U2PA 1P3Y1 2ZRQA 1FOEB 3NANA 1RXCA 4YMSA 1MAVA 4Z4QA 5B1IA 1K8XB 3A25A 3LIPA 1XTPA 4LWOA 2GJKA 1Z8HA 1U7OA 4YWHA 3TPCA 1FMJA 4BAUA 3CE9A 1I0LA 3RYCB 4JJ6A 1R0CA 3E05A 3DTVB 3QUTA 3AIMA 4B8WA 4BJ3A 1Z56C 1E3SA 1Y80A 3ECAA 3HJHA 4OI2A 5BSFA 5ICSA 1CR1A 1CJVC 1J09A 4UOQA 2CLFB 2AXEA 1J8FA 2I34A 5AW2A 2WM2A 2QTFA 3OBBA 3P2YA 3BL5A 3X3HA 1J07A 1I7LA 1HO3A 4L4UA 3I12A 2GJ9A 2FMHA 1GY8A 2YHAA 3HP1A 3HB9A 4JEUA 5K6RA 4FEAA 1BQ3A 1JA9A 1L4FA 4O29A 4PV7A 2AN4A 2J3IA 1PJ3A 4QXOA 5LOVF 1J0BA 3LSTA 1LJLA 2G06A 2KW5A 3FB4A 5KJ6A 3CVWA 1DDGA 3F98A 3K96A 3JAMA 3H2SA 4UJ3A 3MJRA 4XWGA 3ENZA 1WJGA 3AETB 2V6JA 1X7GA 3K2QA 4GYYA 4Q7JB 3QH4A 2PQ6A 5K0BA 3S4YA 5SYAA 1RXIA 1E9RA 1JX6A 1M5TA 1B6SA 4IZOA 4MJLA 3T8YA 3EEBA 4RSRA 4EAAA 2Z43A 1T1IA 3ZOZA 1JJVA 2RGUA 3QKRB 4KFRA 1Y9AA 3VHRA 4V0OA 3D3JA 3IT3A 3QFCA 4CKEB 2WHEA 5FH9A 1FFAA 3OX3A 3NWOA 4KPYA 2GXAA 3FRJA 4V2UA 3TDMA 1CQJB 2OQRA 1V6AA 3ZDXB 3UC5A 4RL4A 1NZJA 2M1XA 1GDDA 1EZZA 1R0WA 2GZAA 1Q50A 3L5OA 5DCYA 1SUFA 1N2GA 2QXUA 3PG5A 4LZJA 1JR2A 2GM5A 1QBKC 2H7CA 2XQKA 4B4WA 4EF5A 3PQDA 3KR2A 5SY6A 3THYA 2QPTA 1PYOA 3X43A 2QDKA 3DFIA 3FF4A 4JJ8A 4ENRA 2X2EA 4EGCB 1OX4A 4XUEA 3UGKA 5CGQB 2AT1A 2Y1EA 5B1YA 1KVTA 1Z36A 2BKUA 4N0EA 4DRYA 3N5CA 1DC4A 4IPTA 1Q95A 3CKKA 2LP4Y 3GUCA 3M81A 1RC1A 4RGQA 1DS6A 2F00A 2WU4A 4INOA 3SSAA 1U3TA 2QY9A 1DBWA 1DFGA 4ZCQA 4IDCA 1WMDA 4GLBA 1JLLB 3CTPA 4P7GA 1E3EA 2I6GA 2G28A 2O2EA 2Y92A 2WJWA 4WFJA 3TD6A 2CK3A 3AIIA 2W9XA 1DAGA 2G77B 2N1MA 2AOTB 3KKEA 4TKUB 4X71A 4HWTA 4PFKA 3PF9A 1U3FA 4QA9A 3L5KA 4TWAA 3FPLA 3VKFA 3V7FA 4CFSA 2CFIA 2PWYA 5FAXA 1C80A 1DIBA 2JAPA 3I0MA 1IHDA 5HK8A 3GDHA 3MQ4A 1ULBA 2GSDA 4XDHA 1MRZA 2BE9A 3K0CA 3M4YA 4PNZA 2NIPA 4R51A 4EYGA 3AKDA 3I64A 3ZOKA 4DIMA 3KLOA 4DOMA 3OLVA 3LDHA 4NBRA 2PLNA 3ZIAD 1C3JA 4AJ1A 3QI7A 4EKNB 4YCLA 2R8YA 3QPCA 1GN8A 3LP6A 1RJWA 2DRIA 5IS2A 2BYTA 5AR1A 2EBFX 4O4HB 2D0DA 2B9VA 4PZPA 1D07A 1VDZA 4XDZA 1Q1EA 2IFTA 4NOLA 4NPHA 2C2HA 4M7RA 2X1MA 3F8TA 5K8JB 5CLIA 5DZSA 3ZS8A 2IYVA 4S1TA 3IL2A 5I8WA 1GR1A 2OGUA 3MZ0A 2R6DA 1UMBB 1ZG3A 2B8TA 3LGSA 4FD3A 3W06A 1GEGA 3ZKWB 2HWWA 5I4BA 2Q6KA 3FNIA 4ZT5A 3F4BA 5T5QA 1F17A 1R5NA 3AEKA 4NBTA 2ZUEA 2H85A 2X6QA 4A91A 4Q9HA 2JLSA 3HUEA 1QO0A 3HY4A 5HMMA 3WTBA 4ND3A 1EGHA 1FJ2A 4QQ8A 2IX3A 3H6KA 4CM1A 1L1EA 4F5YA 1J0DA 1U2EA 1U9JA 1V1RA 1W9HA 3USES 3F5QA 1AUQA 1Z37A 3LVQE 4URZR 3AILA 3VM6A 3Q8LA 1OH8A 1FFGA 2E82A 4PCAA 3ZWNA 4KQFA 5JC1A 1J5EB 2HXGA 4OHOA 7MDHA 2A3RA 2J6HA 5DHQA 3UK7A 4UAJA 1ZL0A 5GP1A 1GNQA 2DCMA 1SC9A 4S1WA 2B1JA 4TLEA 4LXIA 2GYWA 3CZ4A 2I6QA 3UC9A 4DARA 2ZOSA 3GAZA 4QFCA 1POXA 3AKEA 3OQIB 1OLSB 3KYCB 1UOQA 1F1BA 2GNPA 4GLLA 4MIEA 3M9XA 4HCJA 4M1QA 3U16A 3AXSA 3O4RA 4M3NA 1S8AA 1Z4KA 1SIOA 1XTRA 3GARA 1T5IA 3PGKA 1IY9A 2BGRA 3IBSA 4P7FA 2ZFUA 3ANLA 3CVXA 3EJWA 1IAQA 3I05A 4KG7A 4LIPD 5G53C 3WLPA 1SM4A 1ZXBA 1WPRA 1M33A 1P7YA 4MUNA 2FJUA 3AR4A 5TJHA 4EYQA 5A7GA 3B48A 3UNXA 1N2HA 4L74A 3NVDA 1YAJA 3UVEA 1RE1A 2XRYA 3GNLA 3PHBE 3Q3CA 4JLMA 3AU8A 3CZMA 3S5JA 1B16A 2OE2A 3GVXA 4XEUA 3T7AA 1E2HA 4QELA 1A5ZA 2VHYA 2CVHA 2IZ5A 2ZRFA 1U5AA 1UBNA 2ZTMA 3DJYA 3EZ2A 1YS4A 3G82C 4HH3C 4ZOBA 5DMHA 5HCIA 4QOIA 4W5HA 2G25A 3VZPA 3ZIUA 4BATA 4QGSA 1CDDA 1KEEB 2YV4A 1NQ5A 3PYXA 4P81A 5AIBA 1IVSA 2QRHA 4FGUA 1NUQA 1T5TA 1Z8DA 2JGFA 3W5AA 1MEOA 2MT9A 4EB8A 4BNJA 3GUHA 1RHQA 4IUBS 4RTPA 1QUEA 4Q4DA 3W5IA 1JLKA 5BUZA 2JBWA 3DHEA 3F2IA 3AB8A 3UAOA 3EDMA 4JIGA 5DCWA 1H2YA 4R8SA 2A0YA 1W59A 3LFHA 4TQ9A 3ZEAA 4HWGA 3K1JA 1NVVR 3E22B 1NTOA 1QDUA 3L1HA 2R84A 2FOXA 1E8MA 3WGMA 4W9MC 3ZTTA 1JIIA 2HH9A 1OX5A 3D0OA 2FUG1 3E7FA 4ZOCA 1KZ6A 4BNNA 1NR5A 4MW7A 1V7ZA 3TNDA 3HC7A 4X1IB 3CJRA 1TAHA 1NLMA 4NCIA 4PF1A 1C7QA 1GTVA 3IV9A 1T8PA 5LQKA 2J3JA 3CWZA 2BM1A 3R3SA 4BV3A 4PHGA 4FLMA 1YB2A 1N6PA 1QV9A 3M6AA 5BW6B 2XX3A 5BYBA 3GPDG 4Y7DA 4AM8A 1QPZA 3CZRA 3O7WA 4E70A 3MGCA 1O6BA 1K4KA 3UMSA 1DKLA 1R6DA 2P8JA 3KTAA 3QU4A 4OL0A 3ZUPA 1D04A 4AP9A 5JAPA 4AURA 1Z16A 2NU9B 2O05A 3X1KA 4I81A 4MCAA 5KTYA 4LMAA 3IA7A 2O8NA 1C7JA 2FX2A 3NBXX 3DD1A 3OQVA 2C9ZA 3GYGA 1Z28A 1T0JB 1TCBA 4CLHA 4CKCB 2BCGY 4TX1A 4AJ9A 4FD2A 4GWLA 4WZAA 3MUOA 4DILA 3QNMA 2PWPA 5B58T 1XDDA 2R7LA 3ITNA 4XYLA 1L6IA 2GS9A 2FUNB 3PCRB 5CHYA 3P0FA 4JT2A 3L7NA 2QIOA 3FAKA 3RU7A 3RU2A 2FEPA 1YKFA 2DUJA 2XBMA 1QSGA 3NG1A 2YV1A 1UR5A 3CYFA 5K2OA 4GC9A 1G5IA 1MOQA 3RIMA 2A58A 3A6EA 2I2BA 2RK4A 1ANKA 3K8OE 3QG1A 2ZDHA 1FB5A 1G6KA 2R6CA 1FFYA 3KCNA 1RXUA 2FNAA 2PRKA 2FHSA 1FRQA 2ORWA 3IMCA 4X66B 2CLEB 1FY2A 4ENWA 2B9EA 1NDHA 3BWEA 3GA5A 5EKDA 1JBKA 2W6JA 3H97A 4RF3A 1BN6A 4LWZA 1ZZEA 4NBUA 4LVUA 2P8SA 3ROKA 4MTCA 4F04A 1KWGA 2XOEA 5AVYA 1GYRA 1VP3A 3E4DA 1H2WA 2D4AA 4X9XA 1GGEA 4JC4A 4Z1OA 3CLHA 2O48X 1RMTA 1U63A 2VQDA 1IJEA 4ZHQA 2L2QA 1J20A 3NEYA 4GPAA 4YV2A 3CRRA 1RSZA 1E2KA 4G85A 3H11A 2Z1DA 1LF0A 1FJGB 2HK6A 3L84A 5BRJA 2R0QC 1H05A 3QWAA 4H0CA 1NI3A 4Q7KA 2C8JA 5A5DA 1OGIA 1Q91A 5EJ2A 4ERXA 2Z95A 4ENUA 3AUJB 5IAOA 2VG8A 1MTZA 2AOWA 4DDKA 1NQTA 2RHTA 5BY2A 4MQLA 4DBLE 4DQKA 5JVDF 2WSYB 4K9KA 1ABEA 3BZUA 1C8LA 3EMVA 4JJGA 3NC1C 3A2MA 3FCOA 4RX1A 2QRQA 4E12A 3I01M 5C8XA 1MR3F 4LRSB 5KNCH 4XUGB 3NOVA 4NEQA 5C8ZA 3I0ZA 4KN5A 1CYDA 5FPSA 1OASA 4KXNA 5JO9A 3F78A 2L82A 3TCNA 4A23A 2D5AA 3NHJA 3NWJA 4DSZA 4EL5A 4ZDJA 1TAUA 1QC5A 2ZSEA 1HE1C 3TXAA 4F5ZA 4CMKA 4Q3AA 2P1ZA 4D8VA 2E48A 4E46A 3AUTA 1ZH0A 2AFRA 3B1KA 2VBGA 3D7NA 5DLPA 3TTXA 4EBFA 1NIJA 4CM8B 5BMVB 4GBED 1E2QA 4F4JA 2BT4A 3CLRC 2G1KA 3FRIA 1CF9A 3S1SA 5COQA 3U56A 1UZAA 3MCAA 4KLNA 3DDUA 4P5DA 3A10A 5ALKA 4H15A 5AVRA 1A3CA 1PFWA 4WCFB 5B4VA 2VQSA 1I4DD 2JHAA 2X5NA 1BDBA 4I9UA 4NEHB 5K6TA 5E6UB 3L0PA 2A7QA 1TTPB 2WOJA 5CDSA 1QK3A 1O2DA 1RCUA 3N2EA 2PMCA 5THKA 3UG6A 1Q3TA 5EMNA 3LQYA 4ZVNA 5BSWA 5LNK1 1DEOA 1VKZA 1ZK0A 2IIPA 3U7JA 3ONNA 5F2EA 5FCDA 3K1AB 1M72A 1W88B 4FPXA 1K3FA 4QYIB 1D1QA 1EBBA 4UQLA 2IXDA 5E9WA 3RUAA 5LLDA 1XKXA 1F51E 2ZBRA 2XMRA 3PICA 3HNPA 4MUJA 3NMUF 4OGWA 2LTAA 4U9HS 2ZRBA 1DNPA 1TO2E 4ZQFA 5EZYB 3WNDA 2GPTA 621PA 3K0FA 3FOFC 4L6CA 3JU3A 1PTKA 2O7NA 4GRAA 3N2KB 4Y6GB 1UANA 2HF9A 1P6XA 2JAHA 3OE5A 2QJFA 2O0MA 3MTQA 1NATA 4FE3A 5DWQA 3U1BA 3N28A 2B6NA 1T25A 1ZJZA 1PZHA 4BPRA 3ZQJA 4EFDA 5DO9A 5LXTB 1IHPA 4PLWA 3F97A 3L4SO 3QG5A 3UJPA 5ITZA 1A4XA 3LG2A 1KFCB 1YOVB 2EKZA 4FLFA 4RIHA 4WACA 2RC6A 4NBVA 5BNFA 5ERGB 5IJXA 3B1WA 2XLCA 1L7DA 2B20A 4OMFG 5KMGA 3J7AC 4R83A 1RXWA 4JI0B 3ZJ4A 1J00A 3AEQA 3DT6A 4KIFA 3UT5A 4JAVC 4ZPXA 3R5FA 1W36C 4M53A 3SZMA 1XKLA 5FBKA 2W2PA 1G41A 2NSLA 3NO4A 2C31A 3RR2A 1Z74A 5LOVA 2BDEA 4EF4A 4BEWA 1XD9A 2LW7A 2VYCA 3U0BA 5K0JA 4DIKA 1WW2A 2VYQA 3SC6A 2AQIA 2HWYA 1FDTA 3L1UA 4RKWA 1FDVA 5K8VA 3EWAA 1NFRA 1M6YA 4P38A 3UA3A 2O0JA 5KVSA 4C3VA 4DL9A 2FFJA 3CIFA 5NULA 5KNDH 3B70A 4LJ9A 2DU8A 2YASA 1BG6A 2CHVA 1T6XA 2PMFA 4G36A 1E59A 3AR9A 3ICVA 4TMXA 4TVBA 3WDSA 3JYOA 2Q1WA 1CIPA 5H16A 4QUGA 4Y2UA 4CTOA 1YR9A 1GNSA 4HB2A 4DMFA 3LIIA 1Z7GA 3B5EA 3AERB 1J2EA 4MYSA 4MWDA 1KMHB 4XWTA 5DLYA 2GSWA 3HEBA 5H02A 3TI9A 1T9BA 4AK9A 2ZT8A 5K09A 3TOCA 2AEEA 3HZHA 2V54A 2XMCA 3FYUC 5JBIA 2AD5A 5A4DA 5EWLA 1JB9A 4Q05A 1UAGA 2GOYA 1Q15A 5B7PA 1KYZA 1Z8NA 4YP7A 4W9NC 3DZJA 2JCBA 2GRUA 2WYIA 3HVJA 4ND4A 3QF7A 5IBRA 1Z29A 1EB8A 2SBTA 2H4ZA 2O7SA 4QICA 1U0RA 5EYPB 3WK9A 2VH2A 2QDXA 3FNRA 3V32A 2GFIA 2CW5A 1NJ6A 1E9DA 1JIQA 2WHRA 3B7PA 1F0YA 1N0UA 1P2DA 4BMPB 5BV2P 4FLEA 4D9CA 4FIDA 2AWNA 1P1HA 2JGJA 1IJBA 2M32A 4MXDA 1TYCA 1V4VA 2R6JA 1VFNA 3M4ZA 3EC1A 2ZE6A 4XVQA 4E5PA 4GUAA 1ZUNA 1OT3A 4BGUA 3AI1A 3NBQA 1WHTA 2GKGA 4HNHA 3H5NA 4HRAA 4UBMA 5EPOA 4D0RA 5AVWA 3PE6A 4EJSC 5CXSA 3PCXA 2EG9A 1IY0A 3PDHA 5C7IO 2D5LA 4G2TA 5A7FA 1U1FA 2UKDA 1JG3A 5EHNA 2COUA 4CEJA 1MDBA 1EIZA 4YO8A 4IXNA 4RZXA 4BN0A 1CR6A 4X3CA 1B26A 1FSFA 2ATEA 2ZTLA 4ZCRA 1QG0A 2WYWA 1JV2B 3BHJA 3A6KA 4FMCF 3TINA 3WL4A 1GYQA 1XJCA 3RIEA 2NO0A 3RH0A 1ATIA 3V55A 4DUZB 2QY6A 3A58B 4YV7A 4BRZA 3AZQA 4U7WA 4DQDA 1FUIA 1W581 3GLHE 3G2PA 3LXRA 2HYDA 4JDPA 4BTVA 1Q0QA 1GRVA 1CUBA 1XLUA 5JVDA 4RAQA 4C0HA 3WLJA 1V48A 2V6MA 1NMEA 5MGNA 5CIYA 1P77A 2WZBA 4EL0A 2WY2D 3ZHOA 2VZ8A 5LXTF 3OTOB 1L6RA 4IKPA 2J3MA 4DRXB 1J2JA 3MB5A 4NONA 3BRWD 5TT1A 4M1WA 3Q8XB 2V7EA 7AT1A 1X14A 4IMIB 1BE8A 4MV6A 3ND8A 4X00A 2V7QA 3H2KA 1LSSA 2LD4A 3OOJA 3PX2A 4J03A 2QW0X 4N7BA 4KH0A 4PYMA 1QHHB 2Z58A 1LNZA 3GJXC 1SHTX 1SC1A 1WZEA 2I8CA 1SK8A 1TW3A 3H9BA 2Z5GA 3PC8A 4L07A 3RKSA 4EUNA 5FB3A 4YUWA 3EODA 1C41A 1JT9A 4X91A 3AONB 4ZO8A 4QDJA 2H11A 3IR6A 3WX0A 5LSAA 4KKXB 1UAAA 1C9EA 3BWYA 1XALA 1XRJA 5EUBA 3EW7A 4ONEA 3A1TA 4Y1RB 1HV8A 3QVKA 4H7FA 2O2CA 4KVAA 4UBIA 2TRSB 2O3RA 4H18A 2WE7A 2G0AA 2Q3CA 1PAUA 2P6NA 3RS5A 4ZAZA 3TYXA 2E5WA 1SVKA 3QIAA 1YZYA 2G5GX 3IQXA 3P9CA 3DYIA 3T3NA 4Y2QA 4EJSA 1YT5A 1E6CA 1OWMA 1GCIA 3QKWA 3RYFA 3SBDA 1QKKA 4FJ1A 3E53A 4YAKA 3JQBC 3F49S 2NZXA 3G0GA 2Y93A 1ZAKA 4MLZA 1D2CA 1ECLA 1FLNA 3L46A 4XFJA 4JC8A 2E4AA 1M75A 1SKAA 5KDOA 2YWGA 4RGYA 2WNHA 5CAEB 2DLCX 2G0TA 3EUAA 4R2WA 5KREA 2NVWA 1WZ2A 3ZD8A 5B6IA 1CHDA 1PF7E 3COPA 3KKKA 3MINB 4G26A 3ORHA 2REQB 1LFDB 1Z82A 2QMHA 3O84A 5E6SB 5BWCA 2AJCA 1IXKA 5C53B 1WDWB 1ENPA 3EZYA 3LLMA 2VTVA 2HT6A 1IQUA 5HKOA 3S2EA 1U6KA 1IZ7A 2CMFA 3HVUA 3IPLA 3PEUA 4K1LA 3RVMA 1PR9A 3T3HA 4Q48A 3E35A 4G65A 1C7ZA 4XWKA 5JIBA 1NPTO 2DG2A 1B1CA 2X8BA 3ABOB 3BIJA 3HYSA 2XEXA 4E51A 5L3SB 4ZO7A 2HIAA 3W04A 4BMCA 3EIWA 2FMFA 1THGA 3BAZA 1DEXA 5CRIA 3VZRA 3RREA 3UN1A 4Z0PA 2XB4A 2XNSA 4ZEXA 1C1HA 4TYNA 4DCUA 2G3YA 3FE2A 2NQTA 3JVVA 2GUGA 3TTVA 2GZ3A 4F12A 4R31A 2A57A 4CG3A 4I2VA 4WCFC 4OQDA 4EA9A 5K01A 1GWNA 1X1AA 1EVZA 3QJGA 3IO5A 1T2NA 1C4OA 4FSHA 3ZWWA 3M89A 2B36A 1WQ1R 1ZRHA 1OBVA 1UMCB 3C6BA 4M38A 4C3UA 3DUFA 4H3KB 4MRNA 3RTDA 3RC8A 1B15A 2BEUB 2FSFA 2Q2OA 2Q62A 2QMEA 1AXGA 1E89A 1P80A 1RWMA 4F4IA 4HWKA 1VKOA 2APJA 1RYMA 3U3KA 4IG4A 1Z2OX 3D2CA 4A7PA 5JV5A 4PQEA 1ZSNA 5IT9A 4Z9YA 3OECA 4XR4A 5H59A 3UOAB 2JIMA 2PSEA 1JXMA 1DWUA 4XB6B 3DE4X 5TMDA 3LWZA 1T3TA 3UJ3X 1AKWA 1WXWA 2INGX 2L18A 2G07A 4LHYA 5CYOA 2QN3A 1L4YA 1VKHA 1LBHA 4S1OA 4OLFA 2R4UA 3Q6IA 3G59A 5B2EA 1DJLA 1DQPA 1MXHA 2OHJA 3TSAA 2IXGA 3W2IA 5U4XA 1HZJA 2O8VA 4L5IA 3OFND 2AOTA 4LOLA 2IKSA 3K9CA 5EE1A 4P7BA 1YZKA 2W6QA 3OD5A 5JQGB 1AHPA 1QXSA 3PFIA 3VC7A 3VNBA 4RHYA 9ABPA 3WWCA 5FTMA 5DNYB 3A9TA 3WB2A 1LS6A 3E8XA 4FQ7A 4J6FA 5BSVA 3D8SA 3RFFA 4WEQA 3RJ5A 4CDMA 1HDXA 2ZQZA 4FMDB 2JLUA 2C5FA 1H2EA 3AO0B 3H7AA 4BNDB 4HDRA 3AKCA 2OCDA 1E2GA 5A4MS 2I80A 1KQPA 4L5YA 1MC8A 4Z0NA 1XQ9A 4CR6A 1PTJA 2HMAA 1LD3A 4X1KA 1Q0LA 1U28C 1MB9A 1P8AA 4V1CB 3DD5A 1NSTA 1UFOA 2CWDA 4IYJA 2WMDA 1EVIA 4NZYA 4OSPA 4UNIA 1P2BA 1UMDB 1M73E 2DJ5A 1YR3A 4FSDA 3Q0IA 1C0PA 4MWBA 5UKDA 5HRCA 4E94A 1G64A 3QXGA 1KI9A 3H0CA 1YZLA 3TZ6A 2QZSA 2HZ7A 4HAVA 3FDJA 4NH0A 2EQ5A 1IZ0A 4WOKA 4L2IA 1VJCA 4ES6A 1P19A 1PGJA 2UUCB 3BF7A 3NTXA 3NBZC 4G5QA 4J9VA 3M1LA 4AUNA 4DWWA 2M6SA 4EAQA 5TJ9A 4PYJA 3QUAA 4PYLA 5I7SA 1J49A 4DSUA 4BN5A 4B3XA 2UU9B 4UDXX 2GTHA 4DNPA 1IG0A 3PDJA 4EIWA 3DT9A 2H06A 3UMRA 1ECPA 1KL7A 1P9RA 2CDRA 2R7AA 2O8CB 5DYGA 1XXHE 5IRCD 1WCXA 3DOEA 3O0DA 4A0SA 5KSYA 1W96A 4PY2A 2QX9A 2POCA 1INLA 1MLDA 4FZJA 2WWGA 2B2CA 3K6JA 4LDPA 1DARA 3I6QA 4WN9A 5ALZA 3AYZB 5AIAA 4A6XA 2QQ0A 1TMKA 3O2QB 3WLHA 3T41A 4BVBA 1XDGA 3VO8A 1PK7A 1MHPA 5CFPA 5ADUS 2R25B 1CULC 3BWVA 2WM9B 4M0FA 2VCYA 2ILVA 3L6RA 3PJGA 3PVSA 2HWXA 3Q7RA 4AZ3A 2HC9A 4IF6A 4MP8A 1JEQB 5T3YA 3PR3A 5IBPA 6GPBA 2JHGA 3BH7A 4ROTA 1ZL2A 4EJ2A 4L02A 1LV7A 4LQLA 1QDLB 4XM2A 3MPOA 1B3BA 3AW9A 3FETA 1WUYA 1ZM2A 2OKGA 3ET5A 3QJYA 2BSQA 2B6HA 3PHCA 4U2FA 2I99A 5EZ6B 2EX0A 3NVMB 2P91A 1E6UA 3HCEA 5JDIA 4QGGA 1PGOA 3LUDA 1BOOA 2GM4A 4A2CA 1A77A 1I3NA 4BLPA 1UZUA 2HA5A 4OBXA 2WOOA 4RTQA 4O4IA 3EFBA 4JBIA 4XXHA 3MT7A 3E9DA 3PQ7A 5AOBA 1QV6A 1TQ8A 5MN6A 2IXBA 4IRXA 1BXRB 4C7BA 1CS0A 1PBTA 2WABA 4W1RA 5F1YA 1EFKA 3RS4A 1YI8A 2V98A 3DW1X 3OOSA 2XUFA 3FKSA 5FFMA 3QYFA 3KALA 5I4IA 5HCNA 3I32A 4ETWA 3J81A 2AC7A 4ARUA 1GZSA 2C2GA 4M54A 3UGQA 5BYKA 1Q5PA 4CIYA 1H4SA 5K2MA 4YLEA 4F2HA 2OOSA 1NYLA 2HK8A 3H2BA 1N2JA 1HKUA 2CLKB 1WWKA 1CDZA 1Z0UA 2I66A 4IV8A 2Q2WA 4ZV9A 1N0IA 3RAPR 3VJKA 5EHXA 1EUDA 4XGRA 5C5CA 4P2BA 1QOQB 2FMXA 1E7QA 1GR0A 1LDBA 1XTZA 4D7AA 3H8JA 1UDBA 2JJQA 5CT4A 2QW1A 2NT3A 3BZBA 3FYUA 3WJ2A 3DLIA 3DR3A 5EJEA 3ZU2A 4JI4B 4LI3X 1RQXA 1UBKS 1ZMTA 4G23A 4UTPA 1PNRA 1E6LA 3B6MA 2BTEA 1G7TA 2RARA 3RRXA 4C6RA 2NU8B 4QM6A 1GQOA 4OYLA 3HDJA 3UT6A 4HDAA 3KEQA 3IAM1 1AOXA 1J8QA 1E20A 2F9MA 2FVYA 1KERA 4EATA 5JZSA 4N39A 4D3FA 3OJ0A 3PQ6A 1KGSA 3C39A 3G0BA 3RTAA 4MDEA 1AS0A 3GYBA 4P83A 1JWAB 1XAJA 2L17A 5DLEA 3RO7A 1I2CA 1EK0A 1HSOA 4ESHA 1JLMA 1VE7A 1HSZA 4XSVA 5J4YA 2IGTA 2BFMA 4UXHA 3PQFA 4UU7A 4D8UA 2HRCA 4KIWA 1WSDA 1BWSA 1MP0A 1F6BA 3AHHA 2PUTA 4G5SA 4DMCA 4BMNA 3RARA 4EG4A 3FTFA 4W5OA 5B12A 1SUBA 1R10A 4Y9RA 3RYTC 1VCMA 2FGJA 1QAMA 4XQCA 4GVXA 1CUJA 5F76A 5CCEA 1GAXA 5DJ5A 1XNRB 2QSUA 5H3CA 2XMZA 2FSHA 5C5IA 5IHXA 5DASA 3VQTA 1A9XA 1E1KA 2ZSBA 1N9GB 4FZVA 3NH9A 2EJUA 3FF1A 1B8NA 3HDYA 1D0IA 3OP1A 4XTCS 5DW0A 1OF1A 3E9NA 1P0CA 1GG8A 2ID4A 2LCIA 4ABTA 4C0LA 3WYCA 4P2GA 1LQ2A 4Q4AB 1FNSA 1TOAA 2Q9AA 2W2OA 5EZQA 5FJIA 2ACEA 5AKKA 3GLFA 2FX3A 3P4UA 5TGZA 2A5GA 2PL3A 5DXAA 1XZQA 4JI5B 1YBMA 1FP7A 1QCCA 4L51A 3IDZA 4JUCA 4OJTA 1VIMA 1SU7A 1SVIA 2IPOA 2L69A 4N4AA 3HLTA 1XTTA 4IW3B 4MICA 1ULHA 2H48A 2J45A 1IM5A 1Y5MA 2W2XA 1H8HA 4KKVA 3C41J 4LKRA 4KE9A 3B1XA 2ADOA 5HGJA 5EXPA 2WILA 1MIHA 1HOXA 3R0QA 4H1UA 5C5DA 1AVTA 4QDOA 1YQWA 4NCHA 4ZQCB 3V1UA 4MA0A 5INTA 1SZCA 3ISJA 3OCVA 2PEZA 4O4JA 3VV2A 4JR2A 1P0MA 4BNDA 5JZMA 1K98A 3PQ5A 4EG3A 3TVYA 2OD7A 3ZWOA 4BWVA 2ZBQA 2CNOA 3ADKA 5J4VA 3BIWA 3N6RA 1PI3A 1WDLA 3KZXA 4YA6A 2QTWB 3OA2A 1D0VA 1DMRA 4M99A 4AF7A 3NAZA 3LD9A 2HNAA 4G0QA 3P4XA 2RJ3A 1NMXA 5EE0A 5JW6A 4QYIA 5IEBA 3DHYA 4GBJA 3VX3A 4OGGA 4CQLB 2JDID 1FRVA 1LZLA 4MKRA 3ZGNA 3LKBA 2NUBA 2JS7A 2OFPA 5CDTA 3QY9A 2HYIC 1WRBA 1XRQA 4PC1A 1YZVA 2CBXA 1N5LA 1VXRA 2HIHA 1RZVA 2VJMB 2FDRA 3OM9A 5E95A 3RBZA 4DAEA 4PG8A 3I04A 3KXIA 1TIBA 2VCHA 2B8WA 3LYAA 4AMZA 3QLUC 3L0BA 4YR7A 4Q66C 5AM4A 3AFGA 4H7PA 4TVOA 1SUEA 1ZWKA 3QBVA 4U2DA 5FI0B 4ZXFA 5AVQA 3KQVA 1XZBA 3LZ6A 4KQ1A 4ER0A 3LC1O 4N0MA 4YREA 4JBYA 4NAUA 5F3RA 3E9CA 4JLPA 1PT9A 1GSHA 1U11A 3EMBA 2CD7A 3JAWA 2GLXA 2DZDA 1AGRA 1EFTA 3GGSA 5L3QA 5DTRA 2OMKA 4KR9A 2GEKA 1LSJA 2NO5A 2MIIA 4LSGA 4PCUA 5A5VA 4I6GA 5BR7A 4UHFA 2HBQA 3R6WA 1ADFA 1W75A 3OLYA 1S7CA 2GN0A 2OWDA 5IM4F 1EU1A 2IELA 1CP3A 1DC7A 2BLLA 3VHQA 1FDRA 1GZUA 3OCJA 4XLTA 3HXLA 3H86A 1JR4A 2C82A 3JQ9A 3QVLA 3BYZA 2NUPB 2Y6UA 3A28A 4QGBA 2VHTA 5LL6P 3R2JA 2GFQA 1LPSA 2ZUBA 1QCZA 4P0QB 5J5CA 1U8FO 4UBLA 2EEZA 3HB0A 2PRJA 3EJ6A 4RNCA 4C04A 1JZTA 2BR3A 1Z2DA 4PQYA 5KJCA 4W8OA 3VPSA 2OQVA 4L3VA 2VL7A 1OFUX 1A9TA 2NV6A 2NV2B 1KEUA 3BXXA 3IOYA 4YP6A 3V33A 4XWOA 2XGJA 5CVJA 4BLVA 4OHYA 1J4AA 2W4IA 1R1DA 4G8JA 4HBZA 4YI5A 5E4FA 1EQAA 1G42A 2FPOA 1U9IA 2WMNB 1UMKA 1I6MA 4DCVA 2ASEA 1G4AE 4ZVVA 5LZ5A 3WICA 1Z26A 5DHPA 4KN9S 5DULA 3IVRA 5KJEA 4CKXA 4LFAB 5F7ZA 4C0SA 3HU3A 4S2EA 3KWFA 4YUAA 2ZIVB 1H0HA 4KE8A 4KEAA 4LNHA 3RBVA 5JCXA 2JH3A 1RLMA 2XXAB 4MV0A 4MS3B 3NKLA 2B7BA 3GLIA 2H52A 3JQBA 2Z08A 1F3LA 1KPHA 4G0ZA 3LK6A 3K70C 1UBGA 4U0JA 5TXGA 5EI5A 4CODB 2Y27A 4BQEA 4G1VA 1DL5A 1W76A 3MCUA 1H1TA 2FW9A 1NBIA 2I6TA 3UJAA 3G9QA 2Z6UA 1D4FA 1EE1A 3HWRA 3KM0A 4EHFA 3EOBI 3AW8A 1NFFA 1MVNA 2VWPA 2H59A 3Q1LA 1JEAA 2XVYA 3HB4X 1DDOA 1BROA 4JSRA 2OK8A 2C5GA 5EPEA 2V7WA 2ZUSA 1T5DX 4LY3A 3RD5A 3SIRA 3UV6A 1U80A 3MA0A 1BHQ1 4TRJA 3SC2B 4CNQA 4QULA 2NYRA 3WLRA 4Q9LA 1KIAA 3ELUA 1WP4A 3KSMA 4MAFA 2MOKA 2IDZA 1BDJA 4ZGWA 3U3MA 4LF4B 2C97A 5JCJA 1Z39A 2HRQA 1XK6A 2UYOA 4RPHA 2ZJ3A 4ND8B 4ODIA 4KOAA 4IVPA 3HB5X 3ZKWA 5M3BA 1VCOA 5EWJA 3O94A 5JNTA 1CEQA 1MH1A 2EP7A 2XYRA 5E7QA 2REBA 1P6QA 4UEQA 1T5BA 3GRZA 3U40A 2NU6B 1N3LA 1IC6A 1KQNA 1UZLA 1O97C 2G9VA 1QYIA 4OXKA 2AJTA 4PM4A 4Y3UA 5FL7D 4CN9A 4ER6A 4PAOA 1JHOA 1I3CA 3F8SA 4J1NA 2W42A 1DKUA 4L8WB 2N42A 2VTDA 4CLRB 3MIZA 2A5FA 3BERA 1ZRNA 1PGQA 3E23A 1GPH1 3E15A 1CERA 1K68A 4DUPA 4G1FA 4E4TA 5L6MB 1Y6GA 3ITDA 3TM5A 1ZGBA 4A16A 4WINA 4D82A 1OWNA 2F1JA 2IT1A 3ICWA 2VJAA 4P3XA 5C1IA 1DIHA 1HDRA 1CTQA 3T7TA 6ABPA 2IQIA 3PVZA 1R3UA 3FIJA 3W5DA 3EC2A 1URPA 3O3MB 3QBDA 3UJ6A 2ZJYA 4B6EA 4EB0A 1G0NA 1OLOA 5F1PA 2Y0EA 1ZGHA 2GCGA 3CJQA 4UREA 4V0ME 4CW7A 3NM5A 5IF9A 5EKUA 2VTEA 2IH4A 1ACLA 2QUJA 2QLMA 2RE8A 1QIEA 1Z45A 3HWSA 4EW1A 5K99A 2FW6A 2YDXA 1GZVA 3U6BA 2PKQO 4BBAA 3UATA 4L0QA 3K1TA 4YP1A 2CL0X 4PAQA 4RZ2A 3WP0A 3WYNA 5KTSA 1ZMRA 4NK4A 3DDWA 3AR7A 1RMQA 5CLGA 5AKHA 4BNKA 1FSSA 4Q34A 1KEEA 2SCUB 5FTJA 2VDKB 1RZRD 4RHXA 3RVPA 4B9AA 2I2XB 1B8UA 2R4QA 1VDMA 4W5NA 2BISA 3RUCA 4LF9B 5DPMA 4HFMA 4Z1MD 3IMGA 1E79A 3LQKA 3GGPA 3IYLW 1CX9B 3KB1A 3M6IA 2H1CA 4DJTA 3ZBQA 3OZBA 3THWB 1X74A 4ETNA 4IUDS 4OP2A 2OFFA 5FHQA 4G4IA 5A5EA 2VCEA 1NVKA 5CK4A 3U49A 4LE2A 2D3WA 4RIGA 4BUCA 4U6SA 5A02A 1GNPA 1D6MA 2H4JA 3V6MA 5B4TA 1GPLA 4F5EA 1V6CA 3K4HA 2FZKA 2VNJA 4RM2A 1JA0A 1U0LA 1RAAA 4KWTA 4GMDA 1GQQA 3D81A 4ZC8A 3D3WA 3IDSA 4YO7A 4D74A 1KJ9A 1P2GA 5AVUA 4UM7A 1FDWA 4CZ2A 1UPUA 2IOHA 1G2IA 3JQ7A 4LHSA 1G5RA 4B5LA 1Z17A 1J22A 2QVLA 4M49A 3ESXA 5J2TB 2J3LA 3P9ZA 4NU0A 3ZDEA 3GP8A 3NTQA 1XP5A 1O03A 3JATB 2HZBA 4BO3A 2ZWMA 5CM9C 3E2IA 5F4BA 4GKVA 1BO6A 3TRFA 1K4YA 3EEIA 4J4TA 4WKPA 3FKJA 3TSZA 3VU8A 2V7UA 1LVUA 4F6RA 3ZW9A 2QZPA 3EUEA 1HKHA 5T3UA 4JVOA 5IVPA 4ZYLA 5HSGA 3OMXA 1MA0A 2X1LA 4RVUA 1E69A 2B8EA 2UVDA 2VYVD 2W6IA 1AQNA 1NONA 3NHAA 2CJWB 4HMOA 4LECA 1E5VA 3DGEC 3WL7A 3UBTA 2WQ7A 1N0WA 1KE1A 3DUFB 1FBTA 4S35A 3SJBA 5HEKA 3KL2A 1TX4B 4IWXA 1K06A 3BWMA 1MAHA 1HG1A 2B69A 4MKIA 3VH2A 4X24A 3K32A 3QEJA 2Q8QA 4A8HA 4QVIA 2HX1A 4E7OA 3QLVA 3RJZA 4Q16A 4KI0A 4DBZA 3Q9NA 1EJ6A 1XCPA 1IBCA 1M10A 2N47A 1JLRA 2JDIA 3EX7C 3OPYI 3MAAC 5EUCA 2RGYA 1S3GA 3HWWA 1CY1A 5B53A 1NXXA 2VDRB 2D5IA 1IYZA 1U02A 2XUPA 2I6UA 3KJNA 3L7JA 3SVZA 4AYTA 5HFJA 4TGLA 3ORQA 4ZMRA 1HL7A 2ZIXB 3ZDCA 1N8KA 1IN4A 5DSXA 2ZI7A 1W19A 3TLBA 4I9NA 3F6RA 4CL8A 4RZ3A 1QH8B 1AIPA 1KAGA 3A6ZA 4OBEA 3RTBA 2BHRA 2H1LA 2I6FA 3S2GA 4DF3A 2QVYX 1TUEA 2IYEA 4NJMA 4XQ9A 3VO9A 3FTDA 2RHRA 2CFCA 1IWPB 2CXHA 3PPYA 5TLSA 1YR8A 3ZHUA 3KPVA 2SNIE 4DNOA 4BNFA 3DMRA 4MS3A 5M5BA 1HORA 2QTHA 2XHZA 3SXUB 1CVLA 1J06A 3JXEA 1NLYA 3FTNA 2AC4A 3NTRA 4HTAA 5DNAA 5FFNA 4WBNB 5FTKA 5CVDA 3PQ4A 3U0VA 1AQJA 1AUVA 1ZICA 4YMIA 2V6FA 1U9IC 3TLKA 9MHTA 4IIJB 3CX6A 1E1LA 1YD7A 2QT1A 4GI5A 1RIIA 2GVNA 3VDQA 2IZZA 3HHEA 3P2IA 2V74B 4BB6A 3F4KA 4XDYA 2QE7D 1ZSYA 1E3WA 3UGJA 3PI7A 3R3ZA 1XEAA 3RNLA 5HJEA 1KDOA 1PIWA 5AXAA 1YI0A 5HUQA 4LDNA 4JOBA 2RSLA 1MJHA 1SHLA 3LRXA 2O1SA 4OM7A 4CM9D 4EEXA 3WIEA 1OW3B 4CMIB 5JS6A 3FKQA 1T15A 1UIMA 2JI7A 3UAZA 4A0GA 2PEYA 1QYDA 3A1WA 4D9JA 1E60A 2HO5A 1K3UB 1UJMA 1YS2X 2Q46A 1XI2A 3GJ3A 3D6NB 1CUUA 4MH0R 4QUIA 2A0XA 2H1SA 4YDSA 4DM7A 4YYEA 2H1RA 3PE4A 4II3A 2C2MA 4P3YA 2VPXA 3TAXA 4I1IA 3R0ZA 4F9GA 4NATA 2P4QA 4P3NA 4WY2A 5AW5A 3DEFA 4JJEA 3AFOA 2C8VA 4R8KA 2WIFA 4MP3A 3LQFA 4B43A 5A4FS 4MQ6A 5LQUA 2W22A 3MTAA 4NHOA 4F38A 4Y9UA 4A26A 1Y6QA 2A30A 3E5RA 3FJYA 1SUWA 2ZIGA 3AB7A 3KR9A 5EWJB 3EEFA 2G80A 1JHUA 3RIGA 2FVXA 4F3YA 4N3AA 1RRCA 1D2GA 4I1YA 4PXSA 4XYMA 3S70A 2XVMA 3WVNA 3WSVA 2H31A 3FZEA 1JG1A 4LWQA 3OIGA 1H5NA 5K3DA 2R7MA 4ZCIA 2I33A 2PBZA 3MWDB 4JQYA 4NDAA 4EMSA 2PLFA 4BX8A 3CRVA 3PSAA 2W4MA 3Q12A 3I73A 4ITVA 3SZLA 8ADHA 2P9GA 3F0TA 5D2CA 2FG6C 1IOWA 3AVOA 4DA9A 6ADHA 5AW0A 4QOFA 5K0CA 4PQGA 5BWLA 5KTKA 1UWCA 1NX6A 4GZMA 1KP9A 4B33A 2JLZA 2CSXA 4I5GA 3BRSA 4IV5A 1SVNA 1Y8QB 4B3TB 3FXAA 3T4PA 2PGJA 1JT2A 4YRLA 4NBLA 1KDRA 2F43A 3EPPA 3IE2A 1VTKA 4YT5A 1FDOA 4FDVA 3TW4A 1F8FA 3A4MA 1JRLA 2G7MC 1PWYE 3EQ7A 3UT0A 1CQIA 1AZTA 3TNLA 3ZK8A 1G8KA 1P5JA 2VS1A 4EYEA 1XEXA 2X2FA 5LC1A 2F1KA 1ZVJA 4C2BA 3RYCA 1CETA 4UAGA 4UUBA 5ERYA 3TLXA 2OZKA 3VNRA 4B32A 1W0KA 3ZWKA 5JISA 1NNEA 2AJLI 3I52A 3GB9A 2ZB8A 1FPMA 2F8LA 2ZWOA 4H0FA 2MSEB 1TIPA 4HDRB 4X84A 3GJ0A 3QVGA 4PO8A 3SE0A 3UAYA 3WNVA 3F6CA 3BZWA 4R0NA 4K26A 3I37X 1JPNA 3DE2X 3R0IA 3WRXC 5DISB 4GX2A 5IJ0A 2J6IA 2M1ZA 3FMVA 2UZ3A 3DBVO 5L9AA 2BEWB 4BGIA 5AW9A 3O3OB 2WIKA 2GNAA 2X8JA 5TGTA 2EU8A 2CNDA 4DMLA 3EBOA 1Q14A 2QMYA 4B82A 4U2BA 1H22A 3IVXA 4PS1A 2X9QA 2ILTA 5D1HA 3UXYA 3C6KA 1Y3HA 4PLFA 5KTRA 1KRWA 2O20A 4DWOA 2B0JA 1GA4A 4P08A 1IXSB 3LF1A 3NXKA 1U2GC 1JKJB 5IFLA 2JFXA 3U61B 4A27A 3FLAA 3FX2A 4YQZA 3F7MA 3AUYA 2GH1A 2OSBA 4GBMA 5I7EA 1P1IA 1NW8A 2RGGA 2SKEA 4PC2A 4TXHA 5ALWA 5E9QA 1JALA 4UE3S 5FI1B 3K2IA 1NGSA 4BQQA 2VDLB 5LDDC 1BC5A 4J76A 2ATCA 1DO8A 4Y0AA 1LXCA 1KIMA 2XYHA 4AZ0B 5LMZA 2CFTA 4M1TA 4Q5IA 2L19A 5DM2A 4NICA 4R4JA 4ARIA 1KJIA 1X1RA 5J2TF 3W5HA 1JLHA 3ADOA 2F6RA 3QLJA 2GPBA 4C5AA 5KC8A 3RKUA 3PWZA 2EAUA 2VYND 3SX2A 3RRNA 3ULKA 1W6UA 3ZI0A 3FNQA 4BKRA 1FJHA 4BLUA 1FP2A 4Q9IA 4BAZA 4AQ7A 3VR6H 4ZRMA 4ND5A 1S2LA 2DFTA 5IJZA 2NMVA 4HO1X 2MSLA 3CF4G 1JTEA 5DX1A 1UKEA 1CR2A 3EPLA 1HLDA 1UOPA 3OQPA 1ZI6A 3T5MA 1H3EA 1D4AA 5KU1A 2R85A 1CY2A 3CF0A 5A2GA 2HHAA 4HUTA 1NE2A 2QJTA 3OFSA 3WB1A 2CL5A 2DWCA 4UD2A 4UNSA 4HMPA 1JDVA 4WN3A 1NWHA 2PV0A 1NJ2A 4K8OA 4YBZA 3TBKA 2OK7A 1X7XA 5C52B 2Y9PB 2O5RA 2XNCA 3CVYA 2Q9CA 2NZYA 4KLZA 3RUIA 3T15A 2MMGA 1SVSA 5IAAA 5J4LA 1B14A 4IQ8A 2E2WA 3FNGA 2LWIA 1X7WA 3JARA 4ZEWA 5LNK6 4GZLA 4IOMA 2ZRHA 5U4QA 5JJKA 2GDJA 1YNOA 5F33A 1N6OA 1TM7E 3HSYA 3IAXA 3NLLA 1JTFA 4YYZA 2J0VA 2PUHA 3BK7A 4TXLA 3PFKA 1R9MA 4A8TA 4HUQA 4V02A 1Z4MA 4RM3A 1FTGA 2O8EB 2ZUWA 2ZIAA 4M8IA 1IQ0A 3FVRA 3LT1A 1KQ3A 4L27A 3LC2O 2AN5A 3HBFA 4FIZA 5T64A 1WD5A 4P82A 1XXHB 3EAGA 3RODA 4BO1A 3KJQA 1Q7BA 1W4ZA 5HGXA 2NW6A 3B6KA 4PR0A 1D4OA 1V39A 3KQWA 5J5AA 3TFQA 3AM1A 4JI6B 4MCHA 3DEIA 2VBCA 1J5XA 2P1DA 3VYVA 3N8KA 2JGLA 5HQ3B 2IPMA 3EPHA 3OZAA 7REQB 4F7DA 2ZVPX 2VAPA 4WFQA 3M83A 4AQYB 2C4WA 1UBUS 1UCFA 3U7RA 1ZLXA 4JI2B 2H57A 1USKA 1UKBA 2JIDA 2BZ1A 1WVIA 2NXNA 5HM6A 2XMQA 4MP6A 5AP9A 1EDEA 3HZOA 4MKZA 2G9NA 4DIUA 1QNFA 5G2OA 5K3CA 2Q50A 3ZCRA 1DKOA 3FDZA 3SE7A 3KKLA 2WSSA 3N3BC 3ZYZA 2FPIA 2VRBA 3ZVMA 3NRBA 3WLOA 4DRXA 3RHZA 2CLCX 2IU3A 1DQZA 1FUYB 2PRYA 4NE7A 3LQRA 3V4ZA 1C81A 1G21B 3C1UA 3L6EA 3L7CA 1N7IA 1GA6A 1EMDA 1PQYA 2ZYRA 3PQCA 3KZNA 2A9QA 4K28A 4KAFA 1GV1A 2PZMA 3S2ZA 1JQBA 3E7WA 3MCZA 5JZVA 3PUWA 4C88A 4EWLA 4DVJA 3ZGVA 3QSYA 3AKZA 4P36A 3WGLA 1V2HE 1NXPA 4G1MB 5KBYA 3SBEA 3ASVA 1IY2A 1CRQA 3LPNA 4IO1A 3VVCA 1GQRA 2KE5A 5KQSA 5DNEA 1CVRA 3ZV5A 3KD3A 4RWEA 4TQAA 2DQKA 3MTJA 2VQFB 3S6JA 3ZHQA 1WB6A 5ER6A 4PFQA 3ZXIA 3TQRA 1JQLB 4BTEA 2AGVA 4NARA 4BMDA 1U6IA 2DF8A 3B1FA 1FVOA 2XGGA 5CFRA 2FPRA 1NNI1 1ZVQA 4G0MA 1P91A 1EJ0A 2Z8XA 3HXTA 3SR3A 4M9CA 2ODBA 2FZWA 3OZXA 4JLAA 3A26A 3L8CA 1HEIA 4UARA 3UK2A 2GBLA 1L0BA 3N0WA 1SBTA 1T4CA 4X5OA 4AZVA 3QQ5A 3VPCA 4IOKA 1G5QA 2ZT5A 3LRPA 4YJFB 1RAHA 3A0RB 4I3GA 4L73A 1KZYC 2C5HA 4TQUS 2UVPB 3CVVA 2YY5A 1K5PA 3KOZA 4O4LB 2JRCA 3CCBA 3G0CA 3M6LA 5DNDA 4TS4A 3HUFA 1AKQA 1DV2A 1SURA 1JECA 4P3PA 2PRIA 1FRNA 1ZD1A 1Y5RA 4MW1A 1JJFA 4UXIA 2XXAA 1DBRA 2OPBA 4WBXC 3GJ5A 3VJMA 1I5OA 2R44A 4UUQA 4M9SA 4EB6A 4GG1A 2WJZB 3IP7A 1L7VC 3Q1KA 2X8JB 3HJUA 2VZLA 3H05A 1OBFO 1KDVA 3UPUA 3IAM6 4IIHA 1KY3A 5CX4A 2NYAA 5F9HA 4FW9A 4AN4A 3SYKA 1WPQA 3O8CA 1AD2A 3P9NA 3K9QO 4RY2A 1PWXA 3C45A 4OY3A 1MAAA 2WSMA 2X3UA 4V0KA 4NWIA 2EZUA 2L0XA 2JJ2A 2Y2VA 3SQOA 2EV9A 4IX1A 4DCJA 4OB7A 1N2CA 4BC0A 3F90A 5B3JA 1N5DA 3PWSA 3DCNA 3X2FA 4LOJA 4KV9A 4BTLA 1CUZA 2OAQ1 5FP0A 1M0WA 1RPAA 5KCMA 2QRGA 4HADA 1MENA 3LAWA 4KTTE 4RV9A 4UQOA 1XEWX 2C5LA 4OKIA 4LK2A 3BC1A 1IDOA 4LYFA 5TGDA 2CXTA 2VP4A 1Z15A 1AUPA 4CT4B 4X8MA 3TRHA 3CRQA 3X1JA 4ARAA 1VGQA 1CY7A 2R8OA 1QZTA 1X8KA 2F8SA 5M29A 3DEHA 1WBDA 2XT6A 1GYPA 2FPIB 3PHHA 4AX4A 4A8JB 1MB3A 4WOPA 1VL0A 2V45A 1H4TA 2BI7A 2I8AA 1Q1BA 1YJ5A 3DMGA 3HCBA 3TAUA 3TCKA 2JFYA 3QOWA 4RZQA 1ULZA 4LHXA 1V7CA 3BXEA 2QE6A 1GFSA 3BL6A 1V3VA 2HJWA 4FGZA 5FBZA 3RM3A 2OL4A 1JJAA 2OCBA 4OEHA 1LDEA 4EO9A 4RK7A 2FP4B 3PC3A 1YRQA 2QQEA 4LGVA 3T1NA 2JGKA 5HZKA 5JJCA 1MC4A 3ZEIA 2B7CA 2EJWA 3DO5A 3QF4B 1Y9DA 1YR7A 4MGKR 4NBNA 4LJAA 5FBRB 2WPDA 3F6PA 1R4MB 2QORA 3EOAI 4FYWA 2X86A 2HCTA 4P0TA 1E1CA 3HCOA 1JP7A 4E5UA 3EF0A 4ZN6A 5J1SB 2D8MA 1E0JA 2PL5A 4NRDA 4QOGA 3UV7A 4HB4A 3HACA 1R0XA 3R0XA 4MARA 1DQSA 3MT0A 3LLVA 1HFWA 2A1TS 2IVFA 5BSTA 3BWDD 3CUSA 4YCBA 2FMUA 2SKDA 3BVPA 2W70A 4WY5A 2DPLA 3FUVA 3VDNB 2DFKB 3WGIA 3KLBA 3D0KA 1TTQB 1QF7A 5J5VA 2NPOA 3PC4A 4P4UA 3T5TA 2X77A 4J4HA 1KKLA 1PLKA 3DDHA 1C7IA 3KKMA 4X94A 4XD7D 4YCJA 1Y8ZA 5A2QA 4YHHB 1A1VA 4BJHB 2JBAA 4A6PA 4I9HA 2GBIA 3A11A 2P9CA 1PFGA 3O2SB 4LSMA 1BIFA 4US1R 3WMFA 1ZU4A 1RW4A 3EAFA 1WOYA 1H93A 4UE6A 3PJRA 1G2PA 1UP7A 1SU8A 4BO4A 1LFAA 3CLSC 3JAKA 3WHKA 3MTDA 2BGNA 1R12A 3EWNA 4D97A 4N1AA 3IJPA 4GPD1 2CHEA 3I1YA 4IGIA 1ID8A 3GLHB 4YCDA 2XWQA 3LT0A 3EZLA 3DZKA 1V11B 4RQUA 2LVBA 4ALIA 1TM5E 4OQLA 2C5SA 2V3WA 3CPJB 4WK4B 1KO4A 2C8LA 3CR3C 3I3OA 1P3JA 1QFMA 2JASA 2X5XA 4LJ5A 1MU0A 4DPLA 3VKWA 3IURA 4BQNA 1W0CA 1LBIA 1X42A 3KO8A 1XDZA 4DZTA 1SIBE 3ZJYA 2C78A 3HY3A 2JD2A 5CVVA 4DR6B 5H9VA 2H16A 2JIQA 3HDVA 1KNXA 4UU1A 3SCZA 1QHYA 1UP4A 3IQHX 4FBLA 2RI0A 4B6JA 2J9ZB 2VHVA 4M8NE 5BT9A 4MR9B 1LPMA 1OILA 1Z5OA 2PJZA 3TXYA 3VXKA 1VP9A 5BRNA 4F85A 3H8WA 1H1LA 4WZBB 1YA8A 3JQEA 3MSXA 2IEYA 3R41A 5GONF 4RTNA 3DC2A 4BLSA 4DCSA 5DNUA 3R3HA 3L41A 4WLFA 4FDMA 1GFWA 1VXOA 2VZEA 2W6ID 3AH8A 3E8SA 4WXRA 2FMTA 5HF6A 1A8SA 1JQ3A 5L4NA 2X2OA 5DRTA 5EP3A 3IXMA 3KG2A 1F8YA 3K4PA 2JARA 1DAFA 5EAIA 3KJHA 5LQRA 3P0RA 2F3PA 1YK1A 2WFLB 4RK5A 4KUHA 2IU6A 5LA6B 1DG1G 3ICQB 4ERNA 2CXPA 4NK5A 4B3FX 2QNIA 3O91A 4PX9A 1I7NA 3S1AA 3BMQA 3RKRA 1HEYA 2ZRJA 3C8UA 3FVVA 4CQMB 1KAEA 1KYVA 3DVAB 5CW2A 3UK0A 3OCXA 3VPHA 1IXYA 2PDAA 1KR2A 4Q9KA 4D8YA 3ZJVA 1OBHA 3RUDA 4L5JA 1K6IA 2BMDA 2ZIEA 5T4BA 2Q3HA 4JGGA 2V5AA 2IOFK 2JAUA 3AFHA 3WR5A 1KQFA 2O54A 3QWBA 3NR2A 2Z9BA 1MUUA 2OSVA 3OU2A 4O4IB 2HCBA 1KAMA 3KKZA 5FBQB 4M0PA 1CRPA 2R60A 2Y05A 4I66A 2NM0A 1WEKA 2P4HX 3DAYA 4P34A 4PZAA 2R6ZA 1A27A 1MVOA 1JH9A 3FCSB 1ST2A 1MX3A 1XPUA 4I1SA 4BO7A 3O95A 5EJ9A 2GETA 3WKAA 2UUBB 1TJ4A 2GF9A 2Z2IA 1JW9B 1YQDA 3MJ4A 4NG4A 2I67A 3M33A 4JX9A 1TMYA 2GHIA 3UPTA 4HGQA 1DFHA 2AK3A 4FOPA 3P0IA 4FMPA 2XKBA 1ONNA 2AA3A 3GFPA 4ZT3A 5KYTA 2GERA 4IFBA 3W6ZA 1J5PA 4JYPA 4F5DA 3F5MA 1FTNA 1ZMOA 2HWKA 1SGWA 2X4LA 4PBRA 1OC2A 1BD4A 1QIJA 2UVPA 3CEJA 3K09A 3OETA 4GH5A 1L3CA 4L72A 1G8AA 2I7XA 3IAFA 3L93A 2D59A 3TF5A 4RTSA