3H11B

Zymogen caspase-8:c-flipl protease domain complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
229
Chain Sequence
b'DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKGKQMPQPTFTLRKKLVFPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of procaspase-8 activation by c-FLIPL.
pubmed doi rcsb
molecule keywords CASP8 and FADD-like apoptosis regulator
source organism Homo sapiens
molecule tags Apoptosis
total genus 81
structure length 229
sequence length 257
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h11B00
2XYGA 1IBCA 3IBCA 5IC4A 4NOMA 5IABA 4D3ZA 2K7ZA 1RWOA 1JXQA 1NMEA 3SIRA 1PYOA 4FXOA 4N6GA 1QDUA 4ZVTA 2C2OA 4N6NA 4EHLA 3NS7A 1M72A 4N5DA 2H65A 4QU0A 4NBNA 3NKFA 2FP3A 4NOKA 4JQYA 4QUAA 3S8EA 4ZVQA 4FEAA 3IBFA 3DEIA 1RHQA 3R6LA 5I9BA 5JFTA 4QUIA 1BMQA 4PRZA 4N6OA 1GQFA 4ZVUA 2J30A 1NMSA 3GJQA 2HBQA 3EDQA 2HBZA 3K7EA 4EHHA 4QUHA 3KJQA 1RWXA 3V4OA 2J33A 4D3YA 3DEJA 3P4UA 5IAGA 1SHJA 4D3XA 3V55A 2J31A 2Y0BA 2J32A 5IBCA 2H4WA 1K86A 2XYHA 1F1JA 2FUNB 2H48A 2XYPA 3H13A 3P45A 2CNLA 4JR1A 4ZVRA 5IAKA 4M9RA 4AWBA 2FQQA 3GJTA 4JR2A 1SC1A 1F9EA 3E4CA 2H5JA 4JJ7A 4QUGA 4QUDA 4PS1A 1CP3A 4N7JA 3R5KA 1RE1A 3EDRA 4DCPA 1QX3A 5LUAA 5LU9A 4EHFA 3R7NA 2CJYA 5I9TA 3V6MA 2QLBA 4N7MA 2QL5A 4QTXA 3H11B 3PD1A 4JQZA 3H11A 4NOLA 3H0EA 2HBRA 4NBLA 2NN3C 3KJFA 4FDLA 4QU8A 3RJMA 4JR0A 1SC3A 3D6MA 3H1PA 3UO8B 2CJXA 5IANA 1I3OA 1RWKA 2H51A 4EHNA 1RHKA 3R5JA 4HQRA 4QUJA 4I1RA 4PS0A 4ZVPA 3R7SA 1RWVA 5IAEA 2H54A 4JB8A 3ITNA 4NBKA 1ICEA 3UOAB 1SC4A 3DEKA 4PRYA 2QLFA 5IARA 5IAJA 4ZVOA 4AWAA 1RHRA 1RHJA 4IEFB 2DKOA 2QL9A 4QULA 2CNOA 1RHUA 1PAUA 4QU5A 1RHMA 4ZVSA 3GJSA 2C2MA 2QL7A 4AW9A 1RWMA 3NR2A 1GFWA 3OD5A 3V3KA 4DCJA 1I51A 1CVRA 4JJEA 3V4LA 4LSZA 2HBYA 2CNKA 4DCOA 3S70A 4EJFA 3KJNA 2Y1LA 3QNWA 4QTYA 1K88A 2AR9A 2C2ZA 4QUBA 1RWNA 1I4EB 2CNNA 3V6LA 2XZDA 3DEHA 5IBPA 1NW9B 4EHDA 5LU8A 5IC6A 4EHKA 4EHAA 3SIPA 3R6GA 1RWWA 5K20A 4I1PA 2C2KA 1NMQA 2P2CA 2XZTA 2QLJA 2H5IA 2WDPA 3PCXA 4FGUA 4QU9A 2CDRA 1QTNA 2C1EA 3PD0A 4JJ8A 3R7BA 4HVAA 1SHLA 1RWPA 1KMCA 4IYRA 3D6FA 4NOJA 5IBRA 4HQ0A 5H0IA 5LUBA 1I4OA 3GJRA 2H4YA 3D6HA 3BIJA 4QUEA 5IASA
chains in the Genus database with same CATH superfamily
1K8QA 1P9WA 5HPYB 1YU6A 4JI4B 1MAVA 1GPJA 2JJ1D 1JEDA 2VDOB 1LPAB 5MF6A 1UJ4A 1NPTO 5FWYA 1JHPA 1EG2A 1IWOA 3AY3A 3VRHA 3TKAA 1IHOA 3SEZA 1T9GR 2IODA 3OE7A 1I4LD 1E2PA 1MPXA 1FJXA 4ER0A 1E5TA 4N3GA 5ALYA 2LD4A 2D59A 2QD1A 3HKEA 3N59A 2JCBA 4LNUB 3O8RA 3AEXA 2XWSA 7YASA 4DNQA 3A9RA 4RVGA 4D6PA 1NVVQ 1Q92A 2CZGA 2E6KA 5ITZB 1F2DA 1KQ3A 1ESMA 1UP6A 4L7QA 5BPHA 1QVVA 2ZSUA 2CLDX 3U17A 5AVXA 2O3QA 4JJ4A 1VMKA 3EDCA 3EGDB 4FONA 4ENTA 2JGFA 3P4UA 1W4RA 4I46A 3DCJA 5AVJA 2FMTA 4G09A 2EFHB 4JEHA 3ZHZA 3K0CC 4JX8A 2H48A 4QYIB 5HKBA 1NQAO 2VK8A 4FN4A 1C1HA 1Y63A 3TF5A 4C6RA 1T4GA 1Q83A 4LY6A 1AM4D 8MHTA 1GQSA 5KOIA 5DI3A 4FXPA 5JQGB 2O4UX 4N7JA 2I8LA 1B0UA 2RHWA 3P0FA 3BAZA 4RLQA 4J03A 2W2LA 1UBMS 4ZHQF 2Y1GA 4DJEC 3TWOA 4ZTZB 3ANNA 1OYYA 4NYJQ 1RQ2A 2FWJA 4DV2B 3IRUA 3LF2A 1UQUA 5SZIA 5HSGA 1SHUX 3QF7A 1JZQA 2WU1A 2J9RA 2WKQA 4ND2A 1PEKE 5G02A 4ZQEA 2PZJA 3ZVMA 2YFYA 5DTEA 5MHTA 5EHXA 2XRYA 3GRCA 5G4KB 4ND7A 4BE9A 1AO0A 2XE6A 3PDJA 4NHEA 4LTMA 1OA1A 2VTDA 1E69A 4HTFB 3ZN2A 4OQEA 4CF6A 3ZDDA 1KS2A 4HAWA 2Z58A 3ZI4A 4L16A 3QKSA 2BL4A 4B6PA 1C2YA 3MB5A 1DP4A 1WUJS 4WCVA 2Q3BA 3EVNA 2IZZA 2RJ3A 4U8HA 5ALEA 2HLHA 3CLTD 1WSAA 1A95A 1OV6A 1ST3A 2RSLA 3EIOA 2RFLA 5CJPA 1N4AA 2FX5A 3JQAB 3CSSA 5TPZD 4Q4JB 4ANFA 2R1UA 4F2DA 3MS2A 4Z54A 4TYNA 2OOKA 1RLIA 2DY1A 2R1VB 4GLOA 3ZE8A 4EB3A 1XTRA 3TQQA 4UTVA 2NXNA 2JF0A 1Z7YA 3R24A 5LBTA 2R751 3FPJA 5JAIA 4CDRA 1ZR4A 1QRDA 5F33A 1QTIA 5AJUA 5ALZA 3SCZA 4A0RA 4BEBA 1I5OA 3S4YA 2WVGA 2QXYA 1T9DA 4EJFA 4AN4A 2I6SA 4MKHA 4AECA 2HJSA 3H75A 4ERXA 4OSOA 3KKNA 3WKDA 2XQVA 3IV6A 3V6LA 5JQWA 3GEPA 3ACCA 3K1AB 2C5FA 4W8OA 5IUNC 1OBFO 1ECCA 2W4IA 5BW5A 1QCZA 3JQ7B 3OG9A 1V96A 5AM4A 1WSWA 2BDUA 1ETUA 1F48A 3HYRA 3NTLA 2A9FA 4FW8A 4NYMR 1U11A 4EFNA 3C6BA 2WQ7A 3ZD7A 1N32B 3G2HA 4G1BA 1DZIA 5U4QA 2NUBA 3HLKA 1RZVA 2W22A 2WSIA 4E09A 3HUFA 1D4AA 4NAUA 3VKVA 2H5EA 1TLTA 4P4SB 4DANA 3FRIA 1PTKA 2X7XA 3KXPA 1ZUWA 4I4TF 4NJMB 4O25A 2OGUA 4ZCPA 1W0KA 1EVJA 2H92A 2ZVPX 3K20A 3NBZC 1MORA 3R40A 4TMZA 2QRNA 1GEGA 3FNIA 1IWBB 4B32A 3C8UA 5DSZA 4H7DA 4D0LB 3VR4H 3WFZA 3EXHA 3TBHA 1CUCA 1PTJA 1WCYA 1LK0A 3S3TA 5ALRA 2OXTA 2VKQA 2WTBA 4YJ3B 4BY9E 2XJ4A 4NONA 2C2XA 1KK2A 3AM5A 4OMDA 4NJOA 1TM5E 5HKLA 2XUFA 3TFQA 5BRAA 4RY9A 4ZQGA 1A82A 4N5DA 3FWPA 4B7AA 1GVHA 1V11B 4NE7A 3D4BA 2UYHA 4B82A 4IZIA 4UM7A 2E4VA 2XVAA 4L4ZA 5DBEX 1C3LA 1LI4A 1ZUNA 3M82A 4YXWA 2XB4A 4GS5A 1N1DA 1JIVA 1NSFA 3DPIA 2PRSA 3DQQA 1L5VA 1QC5B 4JJAA 2ACWA 2ZRDA 1YMVA 4DQDA 1X94A 3LIIA 1T9CA 2HRBA 2V55B 5G4LA 1A5AB 2A92A 1ENOA 2DH5A 3B6KA 2BGIA 2ODQA 3DDWA 3QVGB 4MW0A 3QH4A 4X85A 4UQLA 1GAQA 1B23P 3HU5A 4EATA 4C14A 5TMDA 5B3JA 4AY2A 1KS9A 4CU5A 1P1RA 1Q15A 5K8LA 2AXQA 3KALA 3PFKA 1Y5RA 3R6DA 4GOOD 2CB9A 1ZNZA 3EGOA 3FW1A 3N70A 4NMHA 2NO1A 4H31A 4X63A 2FEPA 3AUTA 5KKAA 3U3JA 5A06A 1EK6A 3G9QA 3AUXA 5IAAA 4DR1B 1GPMA 3PWZA 3P97A 1UK8A 4OL9A 3VO2A 3VR4D 4C21A 4M6WB 3L05A 5KU7A 2XOKD 4KU4A 5KYWB 1YE5A 5IZ4A 2MYPA 2QQ5A 1NF8A 1WWKA 1BJKA 2BKLA 1CEXA 4EJ6A 1JQKA 4G3XA 2WYUA 1L4BA 2J3IA 4ASUA 2J5KA 4BFCA 4ZEMA 1Y6GA 4N18A 1DQSA 3NVAA 1RQXA 4OQ4A 1QRSA 1HT1E 4F45A 4C78A 2IY7A 3AEYA 3CZAA 4OTZA 5A9SA 4FIDA 4F12A 1T8TA 2ROQA 2R0QC 4N0EA 1T5OA 1JXOA 1XZBA 4M36A 5ED0A 1BX3A 3CTMA 4GU5A 1XMVA 2G4LA 4E2ZA 4L8VA 1AV7A 4WD3A 5JRDS 2QRGA 4JKIA 1IAVA 4LJ5A 1YKSA 2XMCA 4JOQA 1AY0A 1QZUA 3PUYA 4AWBA 3NJ4A 3W2HA 4PONA 2G9VA 4AZ0B 1T43A 3DLCA 3JVIA 1XHLA 4GDFA 2V1XA 2WHPB 3K30A 3LFUA 4US2R 2P4EA 4AJ1A 5DMHA 3G5UA 1Z4NA 3LY9A 1P19A 2JCVA 3F78A 1SBZA 4HB3A 1TTPB 4LSZA 4WY2A 4C0AC 3IPYA 4CM6A 3AONB 1G7RA 4AU1A 1PT8A 4NC9A 5GONF 1E5QA 4R0MA 2HW8A 5JDCC 3ORSA 4EF4A 3W7AA 2DLDA 2XGOA 5FULA 3V8QA 1Z47A 2V7PA 4KE7A 3T4EA 4AX4A 2CMHA 2YV2A 2EFJA 3ER9A 3MN1A 1UAAA 2NO7A 1XZQA 3PYLA 2NLOA 1K68A 1PEYA 1XEFA 2H85A 3NFRA 2C42A 3T52A 1BC5A 1BFDA 5D51S 1BGXT 2OPBA 1Q57A 3UXYA 1PLLA 1U0GA 4B3RB 4I50F 1AG9A 3KLOA 1UJ6A 2GTPA 1ZRNA 3LUFA 4JBHA 3IHLA 4MHOA 3VGPA 2V96A 4B3BA 2AR0A 4LI0A 1F4PA 3K0FA 3NHJA 2NT4A 2VN8A 2YYYA 4IJUA 4LGMA 5HK9A 4JZKA 4YT8A 3DUWA 1OBHA 4OP2A 2XOEA 5F9MA 3ICQB 4A7PA 1GNVA 1VYTA 5DBGA 5DU2A 2EVWX 2P67A 1T29A 1T4CA 1PGPA 2A59A 2GJSA 3FHLA 4LRYA 4RPCA 3LYUA 3GFSA 3WYEA 1PS0A 3ZH9B 4NCXA 1L8LA 2XTAA 5CRIA 4RACA 5D86A 4DWVA 3WY9A 4AUKA 5CDFA 2C20A 1M2KA 4I1VA 1ZUIA 2YJZA 4IVRA 3RUHA 1BKSB 4BO1A 5AVRA 3RC2A 2G25A 3K9QO 5CNMA 3LPNA 4KAAA 2LPMA 4RD0A 3OESA 4PLGA 4UPDA 5AVKA 5G53C 1U6JA 2BFFB 4IV0A 4N0DA 1N2EA 1GPYA 2FCRA 4R31A 1Y8QA 3QU9A 4GWGA 5JSQA 3GLUA 4ND3A 5MFPA 3D0KA 4NP6A 1ACJA 1A69A 1E61A 2X5KO 2V4UA 2X0FA 3GBVA 4K9PA 4DV6B 1DKQA 1N2JA 3TRIA 1GZSA 4EP1A 3VU9A 3RFXA 3O4VA 1BH2A 4Y6PA 3NRJA 1I1HA 4IP0A 3FTPA 2Z4RA 3X2EA 3ZHBA 2FA9A 3ZIAA 4NE9A 4CODB 3K09C 5JU6A 4MW9A 5EZ5A 4BDTA 4DR4B 1SAYA 1NW4A 2RGUA 1HC7A 4KO4S 1YKFA 1Y5LA 1QF9A 3BG5A 2CJFA 2CVHA 1K7YA 1AHNA 2SHKA 4C03A 4ER6A 5CA1B 5LZ4A 2AF3C 2B2XA 3ZDBA 3BXZA 1U1CA 5U4XA 2C29D 1X1SA 3ZXSA 4ENUA 3VUFA 4KI7A 5KBYA 1ULAA 4XIYA 4CKCB 1XU9A 2Z3ZA 3NGLA 1OLSB 2CXUA 3WLEA 1NG1A 2YHSA 1E0JA 2CWWA 1JFSA 3AERA 4QFDA 2NZ2A 4KXUA 2BFEB 3S2ZA 4D0SA 1YZFA 3S6JA 3VNRA 1M1NA 1LBIA 3UW3A 4BB9A 1IZYA 1I32A 2I4LA 1XRQA 3DHVA 3F6YA 4FIZA 3RYCB 2PZAA 2Z5VA 4L85A 4FHFA 1O94C 1YNSA 1TJ5A 3KSRA 4ZMRA 4MUGA 5JD5A 1A4RA 1QIGA 2ZE6A 2YV3A 3JD0A 2IS1A 4AG6A 2C3MA 1Q1QA 1P29A 3PQ4A 4GE3A 3UWSA 5I3CA 2Q4EA 4PG8A 3MERA 2YJ3A 3NUZA 5BQXA 4K88A 3S40A 2OECA 3K92A 4AJIA 3ZCTA 5AIBA 2AJBA 1CVRA 4BLUA 2WPDA 4II3A 2ZVJA 2CMFA 4G01B 1CZKA 3QNWA 1HEYA 4Z3OA 1SUPA 3NHBA 2X9QA 1VBFA 2W7TA 2F55A 2YVAA 1QOQB 2GVZC 3QFTA 2BRUC 4BMXA 1OLXB 5KC8A 2O23A 3M5PA 3CLRC 1PJRA 1T24A 1E9BA 1GRQA 4JT9A 3SE0A 1TKAA 3MJVA 2EDCA 4IWXA 1K2VN 3G2KA 5JJBA 2BCGY 1JT9A 3RGGA 1YTUA 1X1TA 2Y67A 2ON6A 1Z5WA 2VLBA 1VDMA 4U7GA 1U7OA 1YVPA 1I3MA 5KYVA 5SY4A 1E5VA 3ADBA 1NR1A 4UD6A 4MS4A 4WL0A 4E0BA 1NWHA 3DQPA 4A2QA 4Y0AA 3TXXA 3PHHA 3JWIA 2G0NA 3CPJB 1P6UA 1XZMA 1AE1A 4KX3A 4D9BA 5J43A 4V03A 5EHZA 1NW5A 4G9EA 3TCKA 2GDZA 2H65A 5AUPB 2AUMA 1OILA 1UXGA 4ZVQA 3LQQA 1DIRA 1RHQA 1OH7A 3UMJA 2VHWA 4KZKA 3FIJA 3HJAA 1ANKA 3GT3A 3W5JA 4EL5A 4B3XA 3QVUA 3PDIA 1DXOA 3BJIC 1OFVA 3OEHD 3Q8WA 1L4UA 2O2JA 4XVCA 5JECA 1Y89A 3QITA 2RKOA 4XD7D 4NNJA 5DTQA 1GTSA 2HEIA 2WEKA 4WHMA 5DWQA 3G85A 2GN2A 1RLUA 4UAUA 3IMEA 5AKYA 4YJ2F 3B5JA 4QBGB 1TLFA 2VWHA 3L5KA 2Z8YA 2XUZA 1XKQA 4ZRDA 1ISPA 1M66A 2WYHA 2ZRPA 4TTAA 5BVHB 1WEKA 3AU8A 5LLDA 2BSXA 1QGYA 3LP8A 1UBTS 1QGED 2X4DA 2FSPA 1UBRS 2ETVA 1V2GA 2G9RA 1D2EA 1CD5A 3PGKA 4ZO6A 2YW2A 2B1RA 4MCHA 4N5HX 2QLBA 2WNHA 3COZA 3G02A 2HU8A 1RZRA 1LLQA 1TE2A 1RRPA 1HDCA 1IN6A 2E4XA 4ZAGA 2OBFA 4EIWA 3ZZUA 4YPOA 2MINA 2GM3A 2O3UA 2XQJA 3AFIA 3KJZA 1GUAA 3L8CA 2Q2QA 4MITA 2I76A 5LB2A 4ZGBA 2AI2A 2RAPA 4ENPA 2OQIA 3A14A 3Q15C 4HVLA 5KJ1A 3AKEA 1EIZA 5EZYA 3RT7A 1P1JA 2GESA 2CVPA 3RRNA 1W49A 3PZBA 5TQ0A 1X7YB 2J3MA 1VYVA 5CAEB 3GGCA 3L6EA 1G1MA 1N34B 4LXIA 4D4KA 1VFPA 2K6GA 3ESQA 3TYXA 3WXBA 4B45A 1Y8ZA 5CX1A 2H1VA 3W8DA 3R8FA 2YRFA 1ZOLA 2O0LA 2NTYC 1L8QA 1WJGA 2OXEA 2QL9A 1WUKS 3RU9A 3EIWA 3HRIA 1XDWA 4QU5A 3RYHA 3WFIA 1AH2A 5GVRA 4JL5A 5E6SB 2IWRA 3SIXA 2ACEA 2VZEA 2BGKA 2D0IA 1GWNA 2DFVA 3QQ5A 2JFFA 3CNOA 1U99A 3ZXYA 3FOBA 3B2QA 3L1VA 4NYIR 3U7EB 2P6RA 3I5UA 5DN6A 4G4IA 1O97D 5K7SA 3VPHA 1YQDA 2WOOA 3I83A 4JP5A 3UWDA 2Z3VA 3B38A 5TC4A 2MCFA 4KQFA 5AI4A 4EY6A 2FDCA 3GJ5A 4JI2B 3FCXA 1YBHA 4QFCA 1FMLA 4KQWA 4O4HA 5FUXA 3T1QA 3A6HA 1L1EA 1N5OX 1XTSA 4ZI5A 2ZT5A 1CFJA 3G1TA 3WB1A 3L7IA 2W8BB 2VJQA 2PV0A 3L93A 4ER3A 2OSBA 3BE4A 4IRXA 4BPRA 5FPPA 1OHHD 3D3JA 3UAGA 4W99A 2GBCA 1JAIA 1UAGA 3SYLA 3CRW1 1OYWA 4P82A 5T3YA 3RS7A 2QMZA 1LRLA 2K7ZA 3LDHA 3DOOA 1MC1A 4BVKA 4QJ4A 4RHXA 2FQ1A 3LL7A 2PUVA 3QLVA 5EGNA 4CKEA 3WBFA 4UKDA 3HACA 5SV2A 2JIOA 2I7VA 1H65A 2DPXA 3P0JA 1ZD3A 3L7BA 1WABA 2P3LA 3AI3A 4LJ6A 1JSCA 1RKVA 4OF4A 1A7KA 1SUIA 2GFQA 1H5UA 3A3NA 3IBFA 3R6LA 4B7CA 1WXHA 2C8LA 2F1OA 2WF6A 4JFRA 3A1VA 1VI2A 2H5LA 5JI2E 1G5RA 3NYQA 3VMFA 4D79A 1CX9B 1Z0UA 2BE9A 2WRZA 4KIWA 4BNTA 2GBLC 2EW1A 3G7UA 1WXGA 1G5TA 2QNRA 4X91A 1FYXA 3IOCA 2VR1A 1GKKA 4V2UA 4EPWA 1OJLA 3FYDA 1A7JA 1UKCA 1VG1A 2A30A 4H6VA 3V8EA 4JLBA 2YVLA 4ETNA 2JGNA 2XYHA 3FI9A 4TZ0A 1LSOA 2OBLA 1GGNA 5JNWA 3Q7SA 3IE0A 4U7DA 3EZNA 4PO9A 1X1EA 4M1TA 3OQNA 1S3IA 4MROA 3VPDA 3KP1A 2H1OA 3VC3A 4PCVA 4K81B 3SVTA 1TGYA 4YMVA 3M6FA 4NNOA 4IDEA 3SE7A 4NVRA 1XHFA 3SK0A 3BA6A 4RW0A 3ENKA 4R1NA 5DXFA 3C8ZA 5IBQA 4EGJA 4AUNA 1G64A 3VH2A 1EVZA 4REQA 4OJQA 1FNDA 2IYFA 2IU0A 1MUUA 4C01A 3VDNB 3O74A 4FHEA 4JYZA 1W1UA 1ODIA 3OLVA 1RYHA 1BVYF 3TZQA 4I08A 3KR0A 3UA4A 5FUBA 1AVTA 3BH0A 3HYCA 1R0SA 2ZTHA 1Z2AA 1OW3B 1G0NA 3D7MA 2H7XA 1K3FA 1UP7A 3ZDAA 1QOZA 4IMJB 2VZ0A 4MB2A 1T34A 3T9BA 3KE8A 2JCSA 1KK1A 1DRJA 1U0FA 4RPJA 2F1RA 3AY7A 3E9MA 1X92A 2RH8A 5H59A 3S2IA 3UK2A 6YASA 1PR6A 2ODEA 3DT8A 2CKDA 1P5FA 1N6HA 2Q5QA 2JGEA 3UIEA 3WWOA 2IIPA 4B0PA 1PFWA 1ZEMA 2GJ4A 3FKSD 2XD9A 3LECA 3R9XB 1USWA 3DVAA 2HHJA 2IPAB 3B36A 1US8A 1L5HA 4WADA 5M3BA 3WMXA 1IZZA 3BJEA 4HF7A 4Z86A 3I04M 3CF2A 1NVEA 3M6VA 4E3ZA 3PD0A 4GOND 1U2RA 4FPXA 3KDPA 5LA6A 3O38A 4IDGA 1YCDA 4BECA 1GQ2A 2ODNA 3PSAA 3WK5A 5A03A 2CNWD 4NPCA 2GAJA 2G36A 3LY5A 1NC1A 3MBIA 3OFVA 1M7GA 1VIYA 3D3WA 4FOSA 4QYMA 3DMNA 2WQZA 1Z5UA 2CJWB 1A50B 2P65A 2Z43A 3A26A 3PFCA 4L9RA 1GAJA 3STWA 4GLLA 3OOJA 2PL5A 3OC6A 5B6IA 3AP2A 2RB5A 3BHJA 3U7RA 2MTBA 2RGGA 3KHUA 4IS2A 1N92A 2NG1A 1QHXA 1M83A 2D3TA 2YVUA 4AX8A 4BVBA 3B1JA 2Z98A 2GHTA 521PA 3W8RA 3VSDA 1QM5A 3TGLA 1X7XA 3BQ9A 5F5LA 3ZCQA 1B76A 1OWMA 3NCTA 4K6MA 1SIWA 1E9EA 1F2UA 3TQFA 4DL9A 4ZVUA 3H5OA 3V8BA 1GQFA 1N9ZA 1B2LA 3C3MA 4KITB 3GLIB 2B37A 3OE7D 1Q7CA 1R50A 5H1YA 2H29A 3GLVA 3K1ZA 3L0ZA 5I8ZA 3RAFC 1EM8B 1ISHA 2QJRA 2SKEA 4WX2B 5B64A 1LTQA 2Q5LA 2ERXA 2HKIA 2BGNA 1Y8AA 2GK6A 2J5RA 1BMTA 3WSVA 5BWOA 1R64A 2FWIA 2P9BA 5JBNA 2PZ8A 2O20A 2OKCA 3EQZA 2FPWA 3B51X 3C74A 4BPBA 1WR8A 5C8YA 2OK8A 5CA0A 2C0QA 1IUPA 2XB9A 2IV3A 2X0DA 4BFSA 4XJTA 2IH4A 3JSXA 1Z6ZA 1JE1A 3JY6A 4F8YA 1J49A 5IKOA 3TX6A 2FPOA 1WA5A 2DQYA 1IOVA 3L0SA 4IYJA 3MWDB 1V9CA 3RAPR 5JNRA 4LOLA 4TSFA 2IHYA 2H3EA 4PLFA 1LS1A 4RF3A 2QD5A 1DBIA 1ZKDA 3AUKA 4JP1A 4LRUA 4QD3A 4FI3F 5ITWA 4C08A 4G5XA 5IS2A 4HCJA 4B3SB 2W2LD 4KRFA 1W6RA 4WRRA 1Z4LA 3CX8A 3SXUA 1Y82A 2VRCA 3HYLA 1R5BA 3FVWA 4TSRA 3V32A 1N2CB 2KJQA 5J5AA 2UXBB 5KX5B 5GZ6A 1XPRA 2VYNA 2FFBA 1U2DA 2BDEA 4MVYA 2X8LA 1AMOA 2RHOA 4JOBA 1ZJ5A 1X0VA 2WB4A 1RPNA 1LWOA 2IVFA 4A36A 3HDQA 4PQEA 4F21A 2L42A 1NRWA 2QLFA 2YHUA 2RJOA 4RYLA 3RSQA 4UW9A 2JGJA 3ZBUA 3JQPA 2LIPA 4EI2A 3RTAA 3HO1A 5LN1A 3C7CB 1K6MA 4RZHA 3KPYA 3IHTA 3QW2A 4H6PA 5DHPA 1K89A 3FR8A 1VKHA 3AZPA 3ESCA 4MVJM 4PZCA 3UMCA 1I51A 2G63A 1LDYA 3PUHA 1S2NA 4I66A 4E3WA 3FPGA 2FB9A 1I2AA 4WJLA 4EJ2A 5C7OO 1XPOA 4LXUA 1WU7A 5DHRA 2PO7A 3MMSA 4OLHA 1RBMA 3OCVA 3OIYA 4WW0A 4RNDB 3FSGA 2OHJA 3A3PA 4MMXB 1VJ5A 2ZSBA 5I7WA 4EEKA 4KQGA 1CUWA 1UOPA 3N58A 5BRNA 4H4EA 2B78A 1ZAKA 1TT7A 1A5SB 4KO2S 1GTRA 3MRXA 4D8YA 4TQUS 2FGJA 3NAZA 4COOA 2OOSA 1P62B 5KOHB 3RYFA 2WFLA 4MRAA 1N9GA 5HGJA 1L7RA 2FR1A 2WG0A 3Q5EA 5HRUA 1K8ZB 1XOIA 4RZUA 4YVFA 4LE2A 4NIMA 4DA8A 1X39A 2GOYA 2ICAA 1N5LA 4FGJA 4MQ6A 5IASA 3PJDA 2VPIA 3C48A 1CUXA 1ZCZA 1WULS 2OCAA 1DEKA 3H65A 1P33A 3HLYA 3Q0IA 4JSRA 4DREA 1W0KD 3VO8A 5A2QA 2ZBVA 1GU1A 2DFDA 2QRVB 1P8JA 4LC0A 2H57A 2WI8A 4MKFA 3ZE9A 4V3CA 1LSSA 2HO4A 1SHKA 4U9UA 1XL0A 3G68A 3GLKA 1XKXA 4X1IB 4DY4A 3VKHA 3L7MA 3AR4A 1P0CA 1FFSA 1XT6A 1TJYA 2R8OA 2X14A 3C3XA 3D8HA 4WOBA 5KAPA 2WJWA 2JANA 4PXAA 4GOJA 2G40A 4LI3X 4RZSA 5LXTF 3TX2A 3BL6A 4B4KA 4Z53A 2BM9A 3F6BX 5HF6A 4ZZ2A 5IJXA 3VZCA 4AZVA 4ZO9A 2J3LA 3G2PA 2WHYA 3IXQA 4IVPA 2CHQA 1QHGA 2R6FA 4YXWD 5ITZA 2HJWA 1QP8A 4GXNA 1WDTA 4QATA 3EDOA 4UFNA 1XSEA 3ZZ1A 4MUIA 4XOUA 2GBGA 2H9AA 3TRJA 2BBWA 2Z1MA 1TRHA 3KKPA 2RE8A 3ZVNA 1PLJA 3GZTB 3B60A 4CMEA 3SY8A 2NSJA 1BXGB 2NTVA 1Y9AA 2HL6A 4Q00A 4CMAA 5KC9A 4JXXA 3B13B 3B1VA 5JFGA 3EPJA 3QVLA 4H0FA 4CLEA 1R8QA 1SU6A 4NCBA 2P78A 4OA8A 1E3TA 1JJAA 2EKBA 3TW0A 1B74A 1NE2A 1Z0JA 1XVTA 3KSAC 2HCTA 3E53A 3FUWA 4CI0B 2EGUA 1C0EA 1XEWY 1X6VA 2OLJA 2QS9A 2CCJA 1I3CA 2QTLA 2VZ9A 3U56A 3HK2A 3EZ6A 3OQVA 2QL5A 3U3KA 1KI4A 1ZX1A 4WOKA 5TJ9A 5F76A 2UZIR 4GUAA 4OQLA 4S1OA 1G5QA 4XTRA 4NBLA 2VDLB 4Q9NA 2QDKA 5BSTA 4UCFA 2I2BA 1FFDA 4DT1B 1IBLB 2JFBA 5G4KA 1D9XA 2AFRA 4HS4A 1A8SA 5DCUA 1XI2A 1T6NA 1XPJA 3U40A 4KAFA 1A8QA 5EGSA 3NHZA 4Y2XA 1H9BA 4D9EA 2W71A 5CHEA 3IUJA 4QPJC 5K2MA 2EYQA 3SIWA 3LKVA 3G82C 1OIVA 1Q0ZA 5D3MB 3ZU6A 1T6BY 4QPNA 4M53A 1JMYA 1JDTA 1P4RA 4RUKA 1BWRA 1L9XA 1RPJA 1YB5A 4WZZA 4Q4JA 3S2GA 1P72A 5AI8A 3ICVA 2W48A 1BWPA 4TTVA 1W8DA 2XIQA 2XKAA 1HT0A 2HN9A 3BFJA 4PYKA 2OTCA 5GZ1A 3H1AA 2E3JA 4EEZA 1DQYA 1E6CA 4W9NC 3ZBQA 3T7SA 2IIVA 2FWRA 2KS6A 4ZAWA 3SNKA 2C95A 3BHIA 3C8DA 2WSLA 1XZAA 2JAHA 3WJAA 1FYDA 4J16C 4CI9A 3ETGA 3MSXA 5ICEA 1C8BA 3BERA 1OWLA 3AJRA 5IC6A 4FTWA 3CNHA 3RIMA 1LPPA 3QKRB 1ZH2A 3JQCA 1TJ3A 4MRPA 1Q11A 5FJIA 3LCRA 3JQ7A 5BW6B 4ESEA 4TTQA 4KIGA 5LCXA 5BYBA 3LFHA 1BS1A 2HREA 4OXYA 4N54A 1TKCA 4U5QA 5DNVA 5CCDA 1TADA 4LVNA 2JIPA 3H18A 3OTIA 4GPBA 4E5PA 2HRDA 3SGLA 4GYYA 4P4SA 1O5OA 2BONA 3F7OA 5FPQA 1ZITA 4NJMA 4KSCA 5M34A 4AI6A 3WQSB 1Z34A 2EKZA 2IZ1A 3G7NA 3DCNA 3KUXA 2Q7OE 3V1TC 2CFSA 4EHBA 3QXJA 3OTWA 5JPIA 2YINC 1YA6A 1A2BA 1KDTA 3S8MA 2VL7A 2I62A 5JASA 5HKOA 2A5YB 1OZGA 3JQFC 2A1TS 3U9SA 3FMVA 3I9LA 4KDCA 4YJ3A 4EENA 4ERNA 5I51A 1NW3A 1EFDN 1HE2A 1SU4A 2I6UA 3M6MD 3NW9A 4Y8VA 2RAUA 5THXA 1U4NA 2B3TA 1C0PA 1NBEA 3GVCA 3G5TA 4M1MA 3ZV3A 1F2TB 2FUG1 2J46A 3P9SA 2R8PA 4LE1A 1BMQA 1TPYA 2G0AA 4MLZA 4N6OA 5DNUA 3A36A 5AJHA 1YB1A 3UXMA 3LY8A 1XLWA 4RK4A 4TQ9A 3C7TA 2V59A 5ILGA 1QC5A 1BEUB 4PXSA 4X8LA 1YJCA 3NB0A 1GSOA 4FDMA 1B4DA 4GOXA 1HE3A 4A4DA 2ADOA 3G1WA 2RBKA 2I03A 2JL1A 3FCSB 4HWTA 1J8MF 1G38A 1KK3A 4K9LA 1XJCA 3QVGA 4DVGA 2D3WA 2V7XA 5FPYA 2IEAA 2IYNA 2PVSA 1ECPA 3PUVA 4IIBA 3ZWKA 3W4IA 5LZ2A 1GCAA 3VOTA 2R84A 4U2KA 5BT9A 4OLFA 1CUAA 1I4DD 1C4KA 2YWXA 1JEOA 1L4GA 3E7FA 1M75A 3F98A 4OD0A 4IFTA 4HFNA 1NZDA 2YMMA 1UQTA 2GVDC 3R7NA 1XVLA 2V5UA 1HYQA 3BXGA 3I23A 4X20A 3ZIAD 3VAYA 5BV1A 1LV8A 1NVXQ 3HB7A 1K5HA 3I73A 4M6WA 3DMFA 4CV0A 3JTMA 3UJBA 3QHPA 5C1DA 1ZLXA 5AI9A 1PHRA 4RLHA 3LRPA 4MZXA 1YQGA 4OHVA 1TF2A 1OWNA 2OP1A 4B5LA 4MUEA 3RS3A 3SVLA 2XLBA 4ZC8A 2CJXA 4OFWA 2GASA 2N47A 1QK4A 2AEMA 1BSVA 2ZAIA 3UT5A 4U7FA 3WI7A 2JAOA 3FA2A 1SBIA 4P9NA 1T5HX 3I1IA 3PC3A 4FDAA 1KH3A 1L9KA 4MYHA 3D1LA 4QELA 5ALOA 3UJ6A 4HEJA 3EZXA 3WKAA 4BLTA 4MPJA 4MWGA 2QN2A 4JITA 3ZJ4A 1FFXB 1M67A 4XM1A 3T0GA 4AZ0A 1XBTA 4HUQB 4B2PA 2IHBA 4M22A 4XJXA 4DJFC 2YOGA 1YF3A 2WHPA 1VI5A 4AIIA 1QB8A 4BFVA 3P9IA 4S04A 1HYHA 5IFKA 4K9QA 2A0YA 2CNKA 3RWMB 3QUQA 2Q46A 3FOEC 3Q5GA 5BNIA 2RONA 2ECPA 3LZCA 4PGMA 5BSWA 1KYXA 1ZVJA 3RRYA 4JSTA 2WPDD 5EXXA 1EVKA 3PC4A 3K70C 3PFNA 3K2QA 3QE3A 1L8OA 4X45A 1TFRA 2VZ8A 3I6IA 2AXNA 3O0TA 2PRZA 1RKXA 5CLGA 2L19A 3GRRA 3HA7A 2ZIWB 2QRPA 1J70A 1TYCA 2CK3A 3IFSA 5D7BA 4CL2A 1E3WB 4MEJA 5TARA 1H93A 4YUWA 3E05A 3NH6A 1L5GB 1NXWA 2I8AA 3DBRB 4JBIA 2J5QA 2AE2A 1P60A 1U65A 4R1LA 1Z36A 3FOZA 4UVHA 3LQ4A 3P20A 2H2AA 2ENUA 4MAAA 3KSMA 5HYVA 5AKKA 3CWQA 5LYJB 1FNMA 1DBWA 2YTZA 3BD9A 3PIRA 3PTLA 2FEMA 2F62A 1ISMA 1KO1A 2VXOA 3HB5X 3T54A 5E0KB 4HNRA 3PNOA 1M74A 1WMFA 1YUNA 5D1NA 4R6XA 4DYHA 2XCSB 4RWEA 1E2JA 4BBJA 3AVWA 3RKSA 1FL9A 1W5FA 2QX6A 5TMBA 3FM9A 2GVNA 1C8KA 2C7OA 1T9AA 4Q1BA 1F2VA 2ZUDA 4TL9A 2YUTA 3ZHUA 2DUWA 4KZPA 4DM4A 4YV1A 4RPGA 1R0CA 2W2QA 2DTDA 1NNSA 2NSHA 4L08A 5K3SA 3STUA 4J0CA 1CNFA 5CDGA 3BZWA 3AIMA 4RK7A 2BFFA 4GECA 3FYCA 4I9UA 2PL1A 1E3DA 1IHUA 1X1RA 1W5AA 2JAQA 3A11A 4HBGA 4OHYA 5J4VA 2O3TA 2PWYA 3EXG1 4AG3A 2YDXA 2DF8A 4FEGA 3W5DA 4NAVA 4ADSG 3HWWA 5CG1A 2PTHA 1J97A 2QZ9A 3REGA 3AFOA 4HMPA 1II8A 3L84A 3ZGZA 5KUTA 1ZI9A 5F2KA 1QP0A 4FFDA 4L75A 2PUAA 5LUAA 2V03A 3GPCA 2QTRA 2BEWA 1DO8A 3AILA 1XEWX 1S2DA 1YASA 3LFTA 5CA1A 5CP8A 1KAEA 3MGGA 1XNQB 2AG8A 3I01M 2VDKB 3UFBA 4HDOB 5JCOC 3NHAA 1R8YA 4PLPA 3GRZA 5HTKA 4CKCA 2WKWA 5IDQA 4MIKA 2POCA 2A1UB 3LHIA 1RZRD 1IJEA 1MVOA 3V2GA 4TV9B 5FUYA 4IIHA 5FWDA 3GLFB 4R98A 2D8AA 1JTVA 2BFEA 4E22A 3DEYX 5A5DA 4OM8A 4OU5A 3P0EA 3RYCA 4UZFA 3BMXA 3RRMA 3TTVA 2Z1DA 5CFOA 1R6DA 1RW4A 2P30A 3OE1A 3VAZA 5BUZA 3L01A 1O0CA 4C7MA 4Y2JA 3RS4A 2GNAA 4L6IA 1Y6ZA 2IEIA 3A27A 2YFKA 1UF9A 3CA8A 4F86A 3V7FA 4BQFA 3WGYA 3ENQA 5ES3A 4HVCA 2IITA 4Z4GA 2OEPA 3VVLA 3DVSX 4DIMA 4G0YA 4P1ZA 2WM3A 2WWGA 1WNFA 2PXXA 3LLSA 2DQKA 2VXYA 2JC3A 4XIGS 4ZQHA 4ZVKA 4J0JA 1D0SA 1H3EA 2NPOA 3N74A 4X0EA 3H5AA 1V5WA 1S9DA 3AHEA 1QGZA 1GVNB 4EPYA 3C0KA 3TPFA 4QIHA 4E2YA 3RABA 5E3JA 2OYCA 2XKJE 1N78A 1X7DA 1OLXA 2XDQB 3L07A 4JWTA 4KSYA 2MT9A 2PMFA 1GKIA 2VJPA 3V33A 4XLZA 4Y1EA 3PR1A 1QYIA 4NARA 3DNPA 2YXDA 2C5HA 3I58A 2WDPA 1JFFB 2WTEA 4EG3A 1IL0A 1OF1A 3HFJA 4M38A 1G3UA 4KXVA 4OHXA 3U3RA 3J81k 1H4SA 4FMCB 1DRUA 4HVAA 4Z7OB 3KLMX 1TZ2A 2VSNA 3T0FA 2HB6A 3WXMA 3U31A 4IGEA 4QXQA 3OFNA 4QC2A 4KAXA 4IHJF 4C1BA 2RGRA 1MV5A 3PKZA 4QM7A 4ARZB 2HPZA 2IWHA 3LNTA 3RTDA 1K7CA 1ODSA 4TV8B 4MGKR 2DBVO 4R8MA 3EH1A 3QOWA 4RIIA 3RBXA 3GLIE 2WOJA 2CLSA 3P2IA 1JHZA 1RI1A 2EZ8A 2PSEA 3LYHA 1HE5A 3GRYA 1TEVA 5GM1A 5T4HA 3OQOA 3Q2IA 4UE2A 5CLQA 5K0FA 3VJLA 3V8RA 4II7A 4NOKA 2V7GA 3QZUA 3PUXA 3N2EA 4PWYA 4RZIA 3KETA 1ZDMA 4U6QA 4WXRA 5TT1A 3ETJA 3HU2A 1OTXA 4M0MA 2YY6A 4IMRA 2BP7B 2NVUB 1AXRA 1Z4PX 4N3CA 1FSFA 2BZ0A 2NXEA 1QLHA 1IZ8A 3CRMA 3TQIA 4V0LA 2NAPA 1RCFA 1ZN2A 3SZ3A 3W9UA 2C9MA 3LD9A 1OXSC 2CD7A 1RM3A 2QRZA 1LI5A 4QGFA 3E9EA 4WFQA 4LX0A 2IXAA 3I39X 1NLUA 1RSZA 1X1QA 3QMVA 4ER5A 3MZ0A 3UV7A 3INYA 2JGDB 4LBZA 3ZJVA 4YRTA 1VE6A 2IPMA 5JD3A 4A23A 2NXCA 3E35A 4HPJB 2CV2A 3PUWA 1IHDA 3LBFA 4WKGA 1MO5A 5JXHA 1WHTB 4I19A 3L1KA 1HNNA 1D1PA 1P91A 1R0XA 3GJXC 3TZEA 2GF0A 4F9GA 2QOEA 3FDJA 1HKUA 5ECWA 1W59A 2H5JA 2GBFA 2GEJA 2I1QA 2V74B 1EFHA 4PLYA 1JDVA 4ZEWA 1N2CE 4TKZA 3UZUA 4EPTA 2X19A 1XFAA 3W5HA 3ZV6A 2IHJA 2XDYA 4BQOA 1TW3A 3KB2A 3D3KA 1UC8A 1O6CA 2RHDA 3HEAA 4GGPA 2VF5X 3MFQA 3MMXA 3QMMA 4UE6A 1PR4A 3JVEA 3X1YA 3TRFA 1G5IA 2VDJA 4Q1VA 3IIJA 5HG0A 1XKTA 2J87A 1RZUA 2FPXA 3D6NB 2EZUA 3K16A 4GP7A 4LBVA 4MCAA 5FB3A 3CUEF 4KRGA 4BO4A 6GPBA 1IU9A 1OYVA 1TIKA 2BFCB 2PYZA 3BBLA 1YHZA 1MEEA 4R5HA 5EXTA 1FJ2A 1NASA 4DPMA 1HQYE 2R1TB 3RHTA 4BRSA 2ZDHA 3GARA 1IHXA 4ZYWA 3IAEA 5A1JA 1WKVA 1MJNA 2DPYA 4FCWA 3E3AA 2PEZA 3RE1A 3WL6A 4BNXA 2QW8A 1X7YA 3Q1KA 3A3OA 3GC6A 5CAEA 3A0UA 1RR6A 1YB4A 3R0ZA 4UNNA 3NU1A 4RNCA 2AV6A 2CCGA 1AXGA 1C3JA 1GRRA 1KC3A 3IXLA 3SLRA 4C6HA 1X74A 5LFAA 3DLHA 1QFMA 4GPD1 1IM2A 4JYBA 1AQUA 1NR7A 1G59A 1OBOA 3GJSA 2TSYB 4B3CA 4EA8A 1UK6A 3FWHA 1GFWA 1RC1A 5E6SA 4ENVA 4UOQA 4H3SA 3RSGA 3WBJA 3GX1A 3DBVO 1K08A 1ORDA 4KX5A 3TEMA 4AMUA 4Y2UA 2ZUCA 4OFBA 2GCPA 5CPFA 4E5UA 1AZSC 1R88A 1X3LA 5T41A 4DM3A 4FMDB 1KJJA 2QN6A 3F4BA 3CKMA 1QAOA 4YMHA 1FSZA 5H7XA 5E95A 1FQWA 1ADYA 3O9MA 3UC9A 1WD7A 1I9CA 3GNQA 4YRCA 5EEGA 5ULLA 4BO5A 221PA 4LTNA 1OIXA 3EVCA 4I81A 5CLJA 2DSTA 2BAGA 1MQ8B 5THKA 2A4MA 4LNHA 1U2QA 4MA0A 4WOPA 4QLAA 4LF4B 1WKCA 1B0PA 2W8BA 3DB1A 3NP9A 3QTTA 2X3FA 1XB2A 5HHTA 1PJQA 4HZUB 5GWXA 2FE1A 3ZS8A 3RANA 3CLHA 4KPFC 5SZHB 4GVXA 4JENA 4MYSA 1NC3A 5IABA 3IULA 3JYNA 3G6KA 1Q3HA 2WFAA 5D1HA 5FWAA 1EBUA 4P6VF 2C96A 3HR8A 4BNGA 4JBLA 2MR5A 5BUSA 4CF7A 4BFUA 2DTXA 2WY2D 2WWYA 2PUEA 2ZSJA 3M6IA 4M1ZA 1YXMA 4HD8A 4PPQA 2XMBA 3ELBA 2REBA 9ABPA 1P9LA 1S2IA 1YHYA 3TBKA 3SOPA 2C4VA 2J9ZB 3ON5A 4G8DA 1OBCA 4KWEA 4MVCA 5JZVA 4B09A 1SZPA 4MRVA 3U6KA 4ZQFA 3GEEA 3REFA 4TKLA 1DKUA 4RK1A 1XQVA 1K92A 2ZBQA 4FGZA 4L0QA 1QXSA 3KU4A 2DJ5A 3I1JA 2ZTUA 1A76A 1E9SA 2FFQA 2J0QA 4BNFA 4WFKA 3BGVA 3TJMA 4P0PB 2UZAA 1L7MA 1T2NA 4BEJA 1KZ1A 3DZCA 4IIFA 3GNTA 2QJOA 4MV7A 2ATEA 4DIBA 4I6EA 2RMKA 5GQSA 3DO6A 3RK0A 4DWWA 5EJ5A 4PLCA 3AM3A 3S1AB 4RV9A 2JKYA 3EEYA 3G8CA 2Z30A 3WHPA 2GO1A 3BBPA 3WNCA 4OXRA 1QX3A 2PH5A 1XXHA 2YUIA 3JWPA 4LCJA 4B75A 4NTZA 4TYWA 3LUGA 1HT3A 3DF9A 5JVDB 5J2TB 1P9RA 1KYQA 2WFZA 4RKFA 1W2HA 4ZDJA 1YR7A 2Q1UA 1EFKA 3OWOA 2B6HA 4XX0B 4QOJA 2FPPA 5ALIA 1M7BA 4FMBB 3ZHCA 4GKJB 1CULC 2NN3C 4P5EA 1UKVY 1XC7A 1KQPA 2GLTA 3DKRA 4TSFD 5M5BA 5AKHA 2H31A 2DERA 3IQHX 5CYOA 2YXPX 4EJMA 4DNFA 1YZ3A 2VOEA 3WIBA 1CLEA 1U2GC 3BWCA 4JUAA 3TL6A 2Z8ZA 2HU5A 1IBKB 1ZQ1A 1YDHA 1GQRA 5HZHA 2VRCD 1KFJB 3AV0B 5KVSA 3I8XA 1JQLB 1PKEA 2F48A 3WYBA 1YUMA 2HLDA 2XCQA 2YMQA 4Q4HB 5JTTA 1TUEA 2VYCA 3OJOA 3HABA 3T3GA 1R0ZA 3L3BA 5DN6D 3EVZA 4TRNA 3QPBA 1DKLA 5KVVA 4UBLA 4M8LA 4BX2A 2FNAA 3CLSD 4H1VA 3GUYA 5TVKA 5HMMA 4LIPD 4I1IA 4RDCA 2HRZA 4NPAA 5C7IO 2OL4A 4PYLA 1EFLA 1Z88A 2X76A 3UQZA 3JQGB 3AXSA 1VGQA 4FILA 4RKEA 3E23A 3THOA 2AR9A 4NL4H 2A6PA 5FA8A 4YDQA 2GZMA 1DL5A 3LBYA 3DVQX 3KLBA 2RHMA 3CCBA 4DMGA 3R9XA 3SM9A 4GEGA 4M1YA 2F1JA 2JCXA 3H2YA 3D3EA 1YS7A 1CUIA 4IUCS 4C5AA 1JG3A 1NPDA 1O08A 1Y81A 1KEPA 1E2LA 3DW1X 4EKGA 1DX6A 4BVGA 2HJ9A 2PVPA 3QFHA 1KSGA 1MABB 3H3XA 4Q7QA 2OCDA 4L73A 1OMOA 1Q44A 3NEPX 2CVZA 1D2HA 4B6EA 1LW7A 2GUGA 3KVVA 3V4ZA 2ZS8A 2QORA 2WKPA 4L0DA 4H3KB 3MWFA 1PL0A 3AY6A 1PE0A 2ZP1A 2EEZA 1S2OA 2CJWA 3PT9A 1FNBA 3A8TA 2XCOA 1TQ8A 1DWOA 4KMSA 4QTUB 4LYHA 4CL3A 4M7WA 5JRZA 4X60A 4W6QA 3FLMA 2QTBA 4R05A 4JBYA 2J0EA 5JCJA 4I6GA 1PW5A 1U7DA 1EJBA 5L3RA 2QUHA 1NBIA 2V6FA 3UWKA 2HJVA 2PUGA 1ODTC 3B7PA 3VNSA 1P1FA 2FWNA 3AIOA 1DAGA 4GGMX 3D31A 2CWDA 3ODPA 1JN0A 4J0IA 4UVDA 4ZMBA 4P4TA 2JH9A 2HWWA 3NHSA 5DXAA 1Z8FA 2PX0A 3EZYA 4YP7A 4M0EA 4OVKA 1JDZA 2R86A 1ZNWA 3M1YA 4U0KA 4F93B 4TTJA 2ZUSA 2FG7C 3P8ZA 5LQRA 5AXBA 5LQKA 5JSYA 1K75A 3DD1A 2IYAA 1Z38A 2P68A 4IMIB 2DBZA 3RYIB 2C5EA 3IVXA 3N53A 4BN0A 4RTOA 4HDKB 3TGWA 4H7HA 3PWTA 4YDSA 3K71B 3KS9A 5I6DA 4XUGB 1GITA 1JXMA 5E4FA 1L5FA 2AD5A 1C9NA 3GD7A 2Q3JA 2ZJ1A 4FB4A 3O1HB 1BA3A 2XB2A 4YJGB 4G0ZA 1N6RA 4OMFG 4GNKA 2PNJA 2BVNA 4OX9Y 3MWDA 4L76A 1AKQA 3JZMA 4YRGA 1IBSA 4IIJF 1FU7A 4EI9A 1HM5A 4XB2A 2EOAA 4U00A 3AEQB 2VSXA 5ELLA 3NONA 3ST7A 5AHWA 1GU0A 3BFXA 3RJMA 1HLPA 5AVSA 2QRKA 1Q1ZA 2P3QA 3AHGA 2GPSA 1N2CA 1EVIA 2N0SA 4HXEB 1NLMA 4M8SA 4QYTA 4WFJA 4E5KA 4DV3B 3GUCA 3PRJA 4FHGA 4YNBA 4Q1EA 5SZJA 3T1NA 4Z4CA 2XMQA 5EJ8A 5D00A 2QVYX 3N76A 1MOQA 2EKDA 2WV7A 3KWLA 4UHBA 4YQZA 5K3CA 5EMJA 1JIXA 1JG7A 3WIUA 4AL4A 1Y3HA 4B2IA 4BMZA 1OFTA 1UXOA 2X0RA 1KEWA 1T3GA 2ZYDA 1YNOA 4DADA 4CM7A 2R2AA 3PVSA 4JHLA 1CR4A 1CQIB 2OV2A 2FY8A 4CLOB 1BE6A 5AQ1A 3II6X 2IVZA 4TRJA 1P7WA 3GG9A 4J7XA 1LU9A 1QJCA 3M6XA 3ED5A 4BX3A 4C4AA 4NMLA 4M0CA 5AUQA 4D4HA 1M2FA 1CVIA 2AX3A 3TQOA 3UJ3X 4PN3A 5HVNA 1JBKA 3UUWA 1SBYA 9LDBA 2VAVA 3OMWA 2TYSB 2XBUA 3FIUA 5AFSA 3GT0A 5JRJA 4CV3A 4TKVB 4UMFA 4XWTA 3FNHA 3BC1A 3DP9A 3DDCA 2PBZA 1B1AA 3EA4A 1R8SA 4IJQA 1IRXA 3QE9Y 1WDLA 1ABFA 1KO4A 4WXYB 5K05A 3COPA 3NIWA 4G5FA 1E20A 3LQYA 1E9RA 5CBPA 4MQLA 1FFWA 5EJ9A 5CU7A 4NS4A 4C43A 4BFLA 5AYVA 1FSPA 2OG2A 1GL6A 1UEJA 3K4QA 4Y0NA 2HPVA 5KOHA 1E2EA 2QM3A 5ALKA 1TM3E 1Q0LA 2DWPA 3I1YA 4U7HA 3P71T 4QLBA 1YRYE 2AMYA 1A5BB 3H13A 3KSBC 1GG2A 5K0TA 3MSCA 3WSWA 3LC1O 4AY5A 4EELA 1IPFA 1IK4A 1JAYA 2HRCA 3H2KA 5EFOA 4BMCA 1JXQA 1WZIA 2WHEA 1L5LA 3AW9A 2QRVA 5EZSA 1HNWB 2BIFA 4JEIA 1AK1A 1SU7A 3LX5A 5AUNB 4OK3A 4A10A 4X1IA 3JCZA 3KOYA 4MS1A 4RELA 4GMXA 4P5PA 4IDBA 4X8MA 1FPMA 3UMGA 1FUUA 1DB3A 1T26A 2ZBGA 3NNDA 3O6VA 3HKBA 2QP4A 5AK6A 1TYDE 5HCNA 1BMDA 3KG2A 2OQVA 3DZBA 5HKAA 4M55A 2XMGA 3CUUA 2NP7A 5JLJA 3OX4A 1XEAA 3LP5A 3QJGA 2Y0CA 1L7NA 3IQGX 2RGYA 5ER6A 2IS6A 4ZYTA 1GZ4A 3HWSA 4NENB 5BMVB 3NBMA 1X9HA 2VJMB 3EFBA 5HRAA 3F6RA 4DCGA 4YRMA 5K3BA 4YT4A 1UXJA 1BXGA 3M6UA 3T3HA 1V6CA 2A3NA 2HCJB 4MR9B 2YDYA 2EF0A 3THRA 3WMRA 4LPKA 4MCJA 3DLAA 1SOMA 3WQBA 3SR0A 2O8BB 4HGYA 5B3KA 5T5QA 5B6PA 5KTOA 3DO5A 4QO8A 3VKFA 3GLFE 1RQ7A 1WX1A 4FINA 4MMYB 5BNZA 3JS5A 2VVTA 2JLRA 5C1OA 4OEHA 3OI7A 3WKCA 2OXRA 5JY1A 1FVHA 1H2BA 1CVLA 1MDFA 1ZJJA 3ROEA 1VIAA 3IJRA 3KKLA 3PZRA 4C29A 4EKYA 5JARA 1HNZB 3KOZA 3UCFA 4LQLA 3HKDB 5REQB 3LT5A 2Y9MB 2I87A 4QYSA 4INOA 1E3EA 5CK5A 4M9ZA 4DNXA 3FTQA 4RU1A 4DT1A 5KJCA 1G8HA 4R0NA 4K6GA 1BU8A 3ZWNA 1KPGA 3C45A 2OZEA 4DA7A 4ZCLA 2HAEA 2XADA 3OM8A 5DYYA 3RC8A 3EVAA 2WSSA 2PMDA 1UZNA 2YWEA 5K9ZA 4FZRA 3EVGA 3IOEA 5D3MA 2NVBA 2XUPA 1S3FA 2AI3A 2AX4A 4OQMA 4OBWA 1B16A 1IVYA 4HMQA 3QOYA 1UKAA 2DX7A 2KLHA 4N5LA 3RRXA 3S0JA 1TEXA 2DB3A 1CQJB 1UWKA 4I4NA 2WILA 3OCUA 2VJYA 4GW3A 2DJIA 2YWJA 4BZXA 3STHA 5A3RA 2DFNA 1JPJA 5T8KA 3IA2A 4QRHA 4UUPA 2WUVA 4ZV7A 4PCAA 4I7EA 5H8WA 4CG1A 2Y99A 2RHBA 2QYOA 4LOKA 2O54A 4XDHA 1E2UA 1K7XB 1K63A 2VCEA 4F3NA 4MHTA 4G5SA 5LQMA 1FTGA 2VSYA 3QKRA 1IUOA 3JATA 4K05A 3B78A 2EZTA 1PR0A 1HA3A 4RXTA 3GT7A 4YCJA 4X7BA 2XRFA 1OQAA 3TXAA 1S8OA 1BH6A 2C1EA 4GI7A 4FKMA 3E3MA 1W8IA 4IDAA 5BNTA 4KXWA 5I7RA 5EJ7A 2JLUA 1DQRA 4YFYA 2HOQA 2P4QA 3UVEA 4RSHA 3C2QA 2CK3D 4AS2A 1HI9A 2HWXA 3KD2A 2DG2A 4AKSA 4JLPA 1NBME 3RVLA 2AC2A 4FE4A 2QPOA 5JATA 2EJWA 1KJIA 4WKNA 2IDMA 1I7SB 1RWOA 3H9EO 5FRDA 5JQGF 1XV5A 2KSQA 3UBTA 3E9NA 3R9KA 2WHRA 2FWBA 5FIUA 2BZSA 1T5SA 1RYZA 3EPPA 4FFWA 4IBOA 4PTLA 3T4UA 3WWPA 2W4QA 3KXDA 1DCKA 2HF2A 4FUTA 2P27A 4V24A 1D3AA 4UDOA 2HV9A 3CZ5A 2VS1A 1F2TA 2DZDA 3PXCX 5ANRB 3GJZA 1F60A 1QOPB 1E18A 1DWPA 3BDVA 3S2FA 1XPUA 1WB4A 1YL6A 1S8FA 4RMIA 2CXOA 1NXSA 1ZO8A 3WGZA 4M9XA 4B8ZA 5C81A 3C3YA 4GKKB 1K7SN 4EL0A 3QU4A 2PL9A 4DQXA 5CVJA 4D98A 1KORA 2QX8A 2QP9X 3INRA 1XZLA 4DDHA 3DOIA 5JMPA 4LHVA 4H1HA 2EBFX 1T5LA 2GSDA 3PDHA 2NXJA 1O95A 1IIRA 4B17A 3AVQA 1OYOA 4JLSA 4LJ7A 3T9DA 5L53A 2B94A 4HYYA 4JJ6A 3DP7A 4N4AA 4OA5A 2VK1A 5BV2P 2EDAA 3PYXA 3LE8A 2QB5A 5FQNA 1UEIA 4IIDA 1U5BA 2DT5A 4OGLA 4X3PA 1PR3A 4U7WA 3VQTA 4FVTA 3AJ8A 2W9XA 4R1UA 3OOWA 5C4GB 2VCYA 1Y3BE 2C04A 1AGPA 4YUVA 4DZZA 5JJIA 4RULA 1MW9X 3UK1A 1GZ3A 1Y4SA 1ZC4A 3NNSA 3PU6A 3Q1LA 3SBEA 1I3OA 1EFRA 5DO9A 5F77A 3FF1A 2M9MA 3GB9A 2I8CA 2ZS9A 2QR5A 4HQKA 5DIZA 4HNUA 5BSHA 4QTTB 5BT8A 4JEUA 3K35A 3HM9A 1Q2XA 2R85A 4OKNA 3PXDA 5I7EA 4TXMA 1BEEA 2QQEA 2PG3A 3JQRA 1POWA 3GCDA 1T5IA 3UOAB 1W36C 4F8EA 1E9VA 2R1ZA 5EAIA 1HBJA 2PQ6A 1J2UA 1X8KA 2IHNA 3LDGA 2B9EA 4MPRA 2PX8A 4EARA 3MWJA 4ARSA 4LJLA 5LKAA 3OQPA 1TYAE 4QULA 3UAZA 5KZMB 4KHZA 4ED9A 2GPJA 1OH8A 4YMSA 1XNHA 5J4HA 2ZSFA 4DMCA 3O75A 3M0EA 2E21A 2LRHA 4IQ4A 5A7GA 3RRBA 3R4CA 4QHYA 4B3JA 4LWOA 3M2TA 4H17A 3IV7A 3JVVA 4IXWA 5HJEA 1OLUB 1Z62A 3KB6A 3C39A 4QUBA 3DXXA 3GH1A 1X14A 5I7HA 2GJKA 4MA4A 1VP9A 5K8UA 1FZQA 3TZCA 2OG1A 1KERA 4BGDA 4NICA 4CKBB 1PJTA 4YASA 1IXZA 4CF4A 2XUDA 4RH0A 3QYAA 4PZ0A 5LR6A 4ZEOA 1I13A 3K8QA 1K8XB 1KSHA 1RTKA 4OJKA 4X64B 1UJ5A 2IYVA 4PC1A 1DJPA 1NUPA 4HAIA 3IERA 3RWBA 4DMHA 1RWPA 4Y2HA 4DLVA 4BMOB 3A28A 2OZKA 2J59A 3DBRA 1U2SA 4IO0A 1L6IA 2E4ZA 4IFBA 1GRVA 4C6TA 1EA7A 4HWGA 3UYKA 4AJLA 4C4PA 3L0YA 5ICGA 2YFHA 3OFND 5LYJA 2ZJ6A 3ZWAA 1ZSNA 3KUUA 6REQB 3IOBA 1DX9A 3X2FA 1U9CA 4ZOLA 5EIBD 1U8AA 1ESEA 2ZBPA 5E6RB 2PY6A 1E1MA 2HEGA 1Y1TA 2QSYA 3OLQA 1I7PA 2XNJA 121PA 2ID7A 2FN7A 2LIVA 3L02A 1J25A 3CR8A 2VQ3A 1JR3E 1RRGA 3CPSA 3FB1A 4JB0A 4Y6OA 4IUDS 5AVYA 5AW5A 5JYCA 3TTTA 1K6EA 4QUKA 4DLRA 2VDQB 4OQQA 3NM5A 4XGKA 4RIHA 1MIOB 2Z2YA 4OQDA 4QEZA 4MQ5A 4QUHA 2AHOA 2QK4A 4JLNA 5HF5A 1PFGA 3RC3A 2BR4A 5DN9A 2O5RA 2WNSA 4AYTA 2JIMA 5GVSA 1Q5PA 3CWCA 2PZKA 3N5KA 3M1IA 2P0AA 2XF8A 3MTGA 4BASA 4ZU1X 1WPQA 1IDOA 4RSGA 3AR5A 2CGEA 3DFMA 4OXNA 5DHTA 4CQNA 2IOFA 2RK3A 3G2OA 3ZH2A 5KDDA 2WZDA 5BQOA 2JGAA 2PLWA 1K8YB 4KDFA 3QPVA 4ALLA 2ZYUX 3G17A 1NFQA 3RVBA 4FJ1A 1LPBB 1OT3A 1KSFX 4RM3A 2JLAA 3OPNA 2CZQA 3CJRA 3H2GA 4IFEA 5HA5A 1EDBA 1HQDA 5I9TA 1MRZA 3NUQA 1RRKA 4NXMB 4DCMA 3KT8A 2C00A 4L0MA 1B1CA 3EWAA 4ALIA 1YK1A 4WZAB 4AB1A 5F7XA 4XJSA 3HGTA 4TUYF 4FB5A 1WUTA 4D4IA 1SIBE 2W37A 4ZHQB 1QH0A 1ZN8A 2G09A 4EFMA 4IH1A 4JVLA 4QBKA 3D2BA 3GLFA 2DR2A 3PLNA 4QQNA 5FV4A 1YB2A 1YL7A 2UUAB 3M6AA 4FWBA 1BOFA 1ZIDA 2O1WA 1ABBA 1HORA 1NMZA 2QRJA 2XNDD 3Q9LA 5CLLA 1U9IC 3ITNA 4PXYA 2YYSA 2ZM6B 2ZIVB 1GGHA 3B1XA 1XQ1A 1VSVA 2C84A 4BAGA 1QH9A 3LX6A 1NONA 3N0XA 4BQPA 3CUSA 1ZI6A 5ESDA 2CHGA 3VKUA 5BQFA 2YCBA 5JS7A 2ZIUB 2WF8A 5FORA 1W34A 2CNOA 2E4WA 2CDNA 3BQNB 5EMMA 3SHQA 4DA0A 2RARA 3B12A 2G6BA 2H0AA 1JDJA 1NM5C 1CY6A 1X9GA 3AJEA 5KSOA 1E7WA 3MT8A 5JMWA 2DULA 1TKBA 2W98A 4IG9A 4JGIA 4MWZA 5AICA 3T1HB 2XODA 4FCVA 2ZRCA 2DY0A 2O2ZA 1YQQA 3SEAA 4J29A 3FFAA 3K73O 2O5EA 4F4UA 1Y37A 3THWB 3ZEIA 2XDQA 5HIKA 4J3FA 5TXGA 5A5EA 2L82A 2QZSA 2WVJA 2LDXA 3DDZX 5GM2A 4TTRA 3DFIA 1VG8A 3FUUA 4JA0A 1JFFA 4KP7A 4KBYA 1JEQB 2XWQA 4LAFA 4U2GA 1SC6A 1XTZA 1V8PA 2OFPA 3OT1B 3ROFA 3F7TA 4WGFA 3A6PC 1D1TA 2DR3A 4LECA 1T25A 3CXUA 3K0CA 1LKZA 4WZBB 3RTCA 3UMSA 1WZ2A 1VPDA 1IUKA 3D6HA 1KDRA 1S2MA 2VUSA 2JFGA 3QVVA 4JU9A 4EG7A 1ZK4A 3NBQA 4ARZA 2PXHA 4PYJA 4TV8A 1XZEA 3FROA 4I4TB 1R10A 2VFAA 2HK8A 1NVFA 4Y2SA 1XRMA 5BWBA 3NAQA 3AHIA 4DG5A 4ZVTA 2Q2WA 2ZETA 1Y6QA 3FLEA 4HWOA 1U0NA 1P77A 3K5PA 4IQGA 3V1UA 3BRSA 3V8NA 1NQWA 4R2JA 4TMWA 5CLHA 3BYZA 4ZANA 4YRJA 3TLJA 3H97A 3MTAA 1FJHA 4J7AA 5IVPA 3S8EA 1IOLA 2OAGA 4HGZA 4D8VA 1A97A 1DADA 3I52A 5IN5A 1PJCA 4EY8A 4ZAZA 1DKRA 2F59A 2BP7A 2NVUA 4O63O 1J5XA 3F8SA 1UC4B 2AXPA 2J30A 3A2LA 2IY9A 5K3AA 1KTIA 4X6YA 1W6UA 4ZKDA 4FSHA 4LOIA 3H3JA 2IDKA 1CE8B 2D1RA 3D59A 4AY4A 2V8OA 5KOYA 2A0KA 3BE8A 3L49A 1G5FA 1XZNA 4IGKA 1JDUA 1ECBA 3ZDFA 3FSRA 5FOUA 2VPQA 3PLRA 2FRDA 2DUJA 3D2AA 4J1NA 3OZAA 4DB4A 4WLOA 3SPXA 2P4HX 2Z56A 4ZAXA 1YK0A 2GCEA 1JWAB 3TUZC 3A4IA 5AKXA 2NYUA 1X7ZA 4ILKA 5KTPA 1WHTA 1QNFA 2J3QA 2P1DA 4F5DA 1I2CA 5L4LA 3THSA 1AKTA 2CFCA 3A05A 3HXKA 1GQOA 3MYRA 4JEMA 2J67A 4WLEA 3UT0A 4C0XA 3G1UA 1FDWA 1N25A 4YJDA 5AW8A 4KYIB 3R41A 1O8CA 8AT1A 5ILQA 4QGAA 2ZRJA 1FYVA 4JP8A 4LSWA 4RQTA 1CV2A 5EIHA 1FRVA 2R9VA 1OX5A 3LX4A 4R71A 1ICIA 4OXIA 4LW8A 1NP6A 4J0QA 4CM8B 3B9BA 2QGNA 2PCJA 2XUKA 4S24A 4O02B 4ESHA 1N0IA 5T4BA 5A4AA 3ETCA 1I94B 2H52A 2P9TA 4R7TA 2HIGA 3KKEA 2BFCA 2IIQA 3LBNA 1ESNA 3NRBA 3WLTA 1IY2A 1HE4A 1ZD9A 1Y80A 3HGQA 1PK7A 3Q3VA 4P3XA 1JZTA 2AK3A 5IANA 4ND4A 3C43A 1M1YB 1NJSA 5JAQA 4FOLA 3ZWXA 4OHWA 1CB7A 1RXVA 2VNSA 1DBQA 3HDYA 4JB8A 5IDWA 2OE2A 1G3IA 1U0JA 3FMFA 2WJ6A 3NT4A 4M83A 3NHWA 3GLSA 1VL8A 1P7PA 2VWGA 3OFKA 2M32A 2OWEA 3D9QX 2XT9A 2HLDD 1X42A 1TVKB 3IUEA 1KYWA 1QDEA 4QQFA 4F97A 1L4LA 3ZHSA 2D1FA 2GEDA 4YDRA 1YJAA 2Q5CA 4EPXA 4J76A 3DPSA 4LV5B 3CG0A 4M37A 1J2EA 4BP3A 5KI6A 3I05A 5AOCA 5FBLB 5IFLA 1MENA 1TUBB 5IJ9B 5F9HA 3FTFA 1FUYB 1Q2UA 1KC1A 4BNZA 3PQ8A 1Z3IX 1Q0RA 3NZEA 4C0BA 2X2OA 1EWVA 2MU1A 2RHJA 1CUSA 1WTAA 3QIAA 4OHUA 8OHMA 5GONB 2EKQA 4ZDWA 1HTWA 4IRMA 1GDHA 4US0R 4RH3A 4QODA 4E03A 1SZDA 1J9GA 1BS9A 5EXDA 5HWSA 1F5SA 2QQFA 3H84A 3OIGA 4TLBA 1C0IA 2ZJBA 1HFWA 1W35A 4BYGA 4ZCIA 2GARA 4R7ZA 4CKYA 2O8FA 1NQOA 2ZG6A 4R1SA 2XYVA 4KLAA 2C7GA 3CT4A 4I50B 5T67A 1PSZA 2ODWA 4R01A 5C5EA 2EJUA 3U0VA 3SZRA 5BWLA 5JCPA 5LQNA 3IVGA 4RKYA 2QPLA 4GM4A 4ID9A 3SC3A 1AMUA 1R0YA 2QUAA 3N2IA 5A1TA 2OHVA 4TWBA 1AS0A 3OIDA 1D2CA 4HDAA 2ZIFA 4TT3A 3SQLA 1S89A 2GYYA 2R11A 4M7PA 1VMEA 1S6YA 5JCJD 4QRIA 3TB4A 4DSZA 2PUDA 1NMSA 3GJQA 3KOOA 4GM0A 1R6TA 3V8PA 4MAFA 4FKZA 3WIVA 1P5HA 2PQMA 4KGXA 2NZWA 4ZZ0A 1RWXA 4YAKA 1L7DA 3JRNA 4Q7EA 1E89A 4B8YA 1ZW6A 3H5RA 4AS1A 5FH9A 1TZCA 3OPYI 5IUKC 821PA 4Y2RA 4X66B 4BU1A 1IY8A 1H2ZA 2PUTA 1DG3A 1EK1A 1JR3A 4S1NA 5JAPA 5KQMA 1A4XA 3WKEA 3UJNA 2QTVB 2VWPA 3F7NA 5CBKA 5ADVA 1GNSA 1NA5A 1W25A 3BILA 5B53A 4CUJA 5CDUA 1XZPA 3CLKA 3Q8LA 1D2AA 2E6UX 3L43A 2J6HA 2Q0HA 3R1IA 1GYRA 4Z3DA 4M98A 5C31A 3S1AA 4RQUA 5L9AA 3G79A 3G0HA 3ROPA 2P75A 3EMBA 5KQLA 4B2YA 3DV9A 3M9WA 4LOHA 4MUYA 4TMVA 1IVNA 5JVDA 4MPTA 1RE0A 3QEMB 4PQYA 4UXHA 5J2TA 1WMBA 1SUFA 5A3JA 5BUCA 5LDDC 1ZAYA 3K70B 1BKDR 2HQBA 2B82A 5BV0A 1K0UA 2PE5A 2Y68A 2ZE5A 4AURA 3L4SO 1GTL1 3ZY5A 1V7QA 2FFJA 4OIFA 2WUEA 4CTNA 1R12A 1EMDA 1J00A 3P1JA 8ATCA 1VCHA 2QTCA 5J63A 4Z3KA 4JI0B 1T0BA 4I5EA 3EOAI 3RB8A 5J1SB 1UK7A 2W6CX 5J47A 5IAEA 2D6FA 1ZOSA 4EYGA 3HUDA 3ZBTA 5CVUA 3CW2A 5FPKA 4Q4HA 4PRYA 3UPTA 1VYHA 4NBWA 2JAPA 1HDZA 3FCOA 1BA2A 3LKZA 3QLJA 3M3PA 4HH3C 3WQQA 1GYPA 2CBGA 4OB8A 5LQCA 4GWKA 1RLTA 1J7KA 1XA0A 4NCHA 4D4GA 3B82A 3OEEA 3WV5A 4F5WA 4GZ3A 5FUVA 5IT5A 3HYNA 1TD9A 1ZZEA 4IF4A 3HG7A 1ZHFA 3T99A 1A8IA 3SSMA 2QX9A 2OBXA 3PGVA 3PEUA 4L57A 1G3MA 2FOIA 2YXNA 1E3LA 2X0NA 4Q15A 2QUKA 3WWZA 3VZRA 4MW6A 5EE0A 3EFOB 3ER8A 2ALJA 2VTEA 1JG4A 3BL8A 1A8UA 4C0HA 1CF2O 2CXRA 1GL3A 2H00A 2ZI7A 4JFAA 5H68A 3V8VA 3AVXA 2I2DA 1WUYA 1Z25A 2P2ZA 4KTTE 3RU2A 3V46A 4BJ3A 1DAEA 1W9HA 1B15A 1VHJA 2OCXA 4AJHA 4URWR 1MABA 2YIDA 4FFNA 2XY4A 2DT8A 3SLKA 2D0OB 3JQ8B 4KR2A 4P4LA 1N57A 2WTNA 2EW2A 4HQ0A 1U7UA 2ZLBA 1A98A 4PHFA 1NDHA 2NUTB 3OZ7A 3U26A 1WDKA 3WGQA 4DLPA 4F11A 1R0BA 4QDZA 5ENVA 5KTNA 2XBLA 3HJNA 4KO8A 4PHGA 4P2GA 3C3AA 2W70A 3DBLB 4PNHA 4TRMA 2WSMA 5MDHA 4LEIA 1UBCA 3SIRA 2PKXA 4J4BA 2PR2A 2C2OA 1LVHA 1GPNA 2I54A 5GV7A 5CB4F 2RKBA 3W5UA 3QELB 3IP5A 3GT4A 3QK7A 4ALJA 1M72A 3B7GA 1RBZA 5DSXA 1W5EA 4OYYA 3ESRA 3QOFA 2Z04A 2QTFA 3Q8KA 4HGOA 1LCIA 1TQ2A 2IXEA 3T1VA 3WBBA 1IYZA 2DBQA 1GIAA 4LWPA 2C8KA 4QXOA 2FPGB 2QZ4A 4E1BA 4DV0B 1A3CA 2A7QA 2Q2NA 4MPPA 4OIMA 3GV0A 3TSZA 3HV2A 4JJFA 2F8SA 5L95A 2B4QA 1O94A 2ZW9A 2KX7A 5JNVA 2F7SA 5EYPB 3RYIA 2W43A 4HDKA 1M6VB 2ZTLA 3I5XA 3H4VA 1G6KA 2JI6A 3PX3A 4HN4B 4LHSA 5H16A 2D54A 4TL6A 3PWKA 1PCXA 3I92A 3DGFC 4G07A 4YJ2B 4FUQA 4XQGA 4YJGA 3WQRA 2TMYA 3NMUF 1IEVA 1RE1A 3BWMA 3ETEA 4H18A 4DM7A 4Y9UA 2Q7XA 4A5SA 1C30B 1PWHA 1W1WA 4TTSA 1VKZA 3T3OA 1BFKA 3EULA 3LT2A 1S7CA 3EUWA 3KPUA 3PQEA 4LYYA 4HFMA 3TOZA 4AM8A 5C1PA 1KJZA 1BW9B 4X6UA 2XQGA 1VC2A 1I4TD 4KB5A 4IDNA 2B8NA 4NNPA 3WYDA 1DU4A 2GEFA 3NEJA 4P92A 2OYRA 2WZBA 3A6EA 1E5XA 2D5AA 2ECFA 3A04A 3K96A 3TUIC 5AJZA 4ZVLA 4D9IA 5JY6A 1P1HA 1NLYA 4JI6B 5K0EA 4BIMA 4G56A 2J85A 1PVDA 1EWKA 4HH1A 1N6LA 5A9RA 3JALA 1FLDA 3U3XA 2GR9A 1N3YA 2G71A 1MNAA 2PT7A 4MWTA 4WLVA 5IARA 2WSSD 3HP1A 1L8AA 1W96A 3KCNA 4E51A 5IX8A 2BSAA 1PFUA 1SCJA 4U2EA 4OHRA 1PZGA 1CQIA 1RBYA 3PXEA 3UHOA 1J07A 2BR5A 2OUIA 4CLOA 1CYEA 4OQFA 1OT5A 5B5SA 4KE9A 4W9MC 4YGXB 2HWYA 3DH0A 2BZGA 4LXXA 3WAKA 4GKBA 1AC5A 4WK6A 4B6GA 1QYCA 3C6ZA 3HFSA 1C7JA 2FSUA 4UU8A 5LSAA 4Q3BA 3I4CA 2V7EA 1QKKA 2LR0A 5LQDA 3IEPA 2Q21A 3MAGA 2AN4A 4J07A 4AP6A 4OBXA 3BD8A 3RSOA 2OBYA 1ODKA 3TRDA 5K0LA 3AZQA 3PSHA 3AUJB 2WFMA 2IPNA 4JBGA 4XE5A 1GA4A 4AJ4A 4EG8A 5C5CA 4G37A 4C4RA 4CTOA 2EWWA 1L4YA 1UDXA 2YIVX 4G97A 3AT1A 4UU7A 5AJWA 1X9IA 3JWHA 1VMAA 3RU3A 4ABYA 1R4MB 3KUDA 1SOVA 3FPEA 3RASA 2QZPA 5TE9A 4C5CA 3H7IA 2CMKA 4MI6A 5G1PA 4BTEA 4KVAA 4CU2A 1LRJA 3IAXA 4WCFC 2IFTA 1MQSA 3RTGA 1JE0A 1VDZA 3K0EA 3VPSA 4MLDA 3BDAA 4ZAYA 2ZCVA 1PD1A 4DLKA 1TM2A 1COWA 2FFHA 2NTNA 3COJA 4FZJA 1Z06A 2QG6A 2FZKA 3K0KA 3M6WA 1MOZA 4PPFA 5TF4A 3SWWA 2QAGA 3JQDA 2AKEA 2J7KA 1LX6A 1U80A 1WEHA 3CVXA 3AFMA 3MGCA 3DTVB 3D8BA 2H3HA 3CLTC 1QG0A 3QXSA 5DTIA 5I9BA 3UXHA 4AZSA 4LFAB 4YYZA 3D2LA 1WXEA 4UFPA 4DJ5X 1SXJC 4F2GA 1NURA 3OD1A 4M0PA 1BMFA 1VIDA 5HNKA 1MJGA 2HFKA 1U6IA 1FNSA 2R48A 3MWYW 4JLUA 4NENA 4B46A 3GLTA 1UKYA 4G85A 2HQSA 2HRQA 2VJMA 3OA2A 3H9JA 4UTOA 4XEUA 2P5TB 3V55A 4IV8A 5I7OA 2AOWA 4L4XA 3CZ4A 1PO7A 4ZVRA 1H3NA 1CF9A 3LO5A 3V1NA 4WZAE 5M04A 3FWNA 1GY8A 1T8PA 2OD9A 4MR9A 3DO8A 1AA6A 1D2RA 2GCOB 4M1EA 2O8BA 1AHPA 5M7EA 4ITRC 2AWOA 3W4JA 3WDLA 3CJQA 4CTMA 2X8WA 3GVPA 4LYJA 3WGGA 1FY2A 5B37A 1KOJA 2P7HA 1O95D 1A7UA 4DCSA 1AKMA 5LIPA 4MLCA 1DE0A 3U4DA 1MB3A 1YFJA 1R5NA 3VGJA 4W7IA 5A3QA 1KKUA 4EBBA 4RVSA 2EARA 3U6BA 1SXGA 1D09A 1MRSA 3TNJA 2WWXA 4BC0A 1C1XB 4K9KA 3HKDA 3UJDA 1ISJA 2YASA 3EG9B 1M3SA 1XUOA 2FW6A 4G1VA 2AUNA 4JLWA 2VK4A 3Q7TA 5DFAA 3UY4A 3Q10A 1UCFA 4PQGA 2D2EA 3L04A 3CX7A 2UYGA 3SQXA 2DWCA 2TRSB 2XUGA 5KJ6A 2CUKA 5B7PA 1JEYB 5FYDA 4RQAA 4CG0A 3OVMA 3E7DA 1EFRD 1Z12A 1XLUA 3I30X 5AI6A 1SC4A 3DEKA 1OAAA 2MMCA 5FXMA 4L1KA 5AK4A 5LZ5A 3D6JA 4AFNA 1E0DA 2BFAA 2FGKA 2PSDA 4J94A 3REQA 3UW1A 4OGFA 1L2TA 1VRWA 3A37A 3SJAA 5JZMA 3BOSA 4ZVSA 2HA4A 4G4GA 4Y2PA 3BJMA 2ACVA 4L3OA 1T3LA 1FDUA 4YP5A 2AKYA 1UQRA 2CVQA 3HP4A 4KN8A 2LZ0A 4C3UA 4AQYB 4EJSC 1VJRA 1FFBA 4DCOA 3V7NA 3WGLA 4UUOA 4CCSA 1QTQA 2C2ZA 4Q9JA 1EUZA 1I10A 4WUVA 3MTQA 4P22A 2REQB 3O3CA 1ZGBA 3TR0A 2LVBA 2ZJOA 4HMOA 2NU8B 3M3DA 3UAVA 3GR6A 4CMKA 4WZBE 5JC1A 4BLQA 3WLMA 1CEYA 2PQ0A 2HY7A 5G0WA 4FFBB 3LWBA 5FHRA 4NCKA 4G67A 3T7DA 1H2HA 1WVIA 2GBLA 4H9GA 5F7ZA 4BZPA 1QZXA 2QXUA 1MMFB 1ATIA 2G5CA 4XD2A 4BQRA 3INGA 4X3OA 3T5AA 4PRLA 4RENA 1MAHA 3ESXA 3Q87B 5FNVF 4DMUB 2WDZA 3L4BA 4ENSA 4WBSA 2GFHA 5TV2A 1D2NA 4Q4DA 3GI1A 5KYUB 1IBCA 1U28C 3KOUA 5JNLA 4DV7B 3IPAA 1PV4A 1XRLA 4HLCA 5EWLB 1FQJA 1ZH4A 3AHCA 2GRUA 4H0CA 3O83A 3AG5A 4NULA 3IAAA 3BSFA 4RVNA 5A9TA 5AKZA 3TAHA 4Y7CA 1GZDA 4HLUC 4GX2A 2M6RA 2JLBA 3C3CA 1LLUA 2CXSA 2QLLA 5D2CA 5BSMA 3HSYA 4NMXB 4ZK2A 3NTQA 3GROA 3T7IA 4KRXA 4M1QA 1CEQA 2GN6A 4GQAA 2F3PA 3AFGA 4FLEA 3TQHA 1CSEE 3ESDA 4HUTA 5KNBA 3NBFA 1DFHA 3QU5A 5KYTA 2ZSIA 3UA3A 2FV8A 3KQNA 5JG7A 4DKXA 4G1EB 1BG6A 4DYVA 1J5EB 1ML4A 3GEGA 3DEJA 4A27A 5H5JA 3ZV4A 4BX8A 4YV2A 4WACA 3B5IA 3AUYA 1PJ8A 3COVA 4G23A 4P3NA 2YL2A 4ZP1A 1MW8X 4CJXA 1CS4C 1QRRA 1U9YA 1Z83A 3EIEA 3D7KA 4OQYA 3C41J 4RXMA 1A7AA 1DXHA 2YWDA 3PPVA 3GJTA 5GIOE 1N4DA 2WJYA 3LXUX 3ZWVA 2DGDA 2ZRAA 1EDZA 4Q66C 4FLMA 4YCCA 1JHVA 2FDXA 2G80A 2WLTA 1M1YE 3Q9UA 1FW6A 1TAQA 2FETA 2EZ4A 2O3SA 1F51E 3CYFA 3LV8A 3GK3A 4MX8A 5ESRA 5TPWB 3R74A 3T3IA 3ZC3A 5JD4A 2JB9A 3JWEA 3PQ3A 4E7OA 3EXEB 5IH3A 1QVRA 4EKDA 2X2PA 3N6XA 1QE5A 4NZOA 2VDWB 4XIIA 4QU8A 1WP9A 1XRPA 2BR3A 2PUBA 1F0YA 2VQEB 3OPYB 1NU6A 4HFJA 2PO5A 4ISBA 5DT9A 2VPXA 2VQ6A 3H1PA 3UHPA 4A6EA 1UDRA 5A4IS 4C0JA 1S0UA 3HTXA 5GADl 1R9GA 1NXOA 1W4ZA 3IUYA 4Q05A 2G67A 1FP2A 3E61A 4E46A 5B58C 5KDOA 1DAFA 3ONDA 3GLHB 2JBAB 4OL0A 3ET4A 3T3MB 3Q72A 4LDQA 2XHZA 4MR8B 2KLBA 4AROA 4II2A 3K4HA 4CGYA 4MTCA 3OWHA 4DMMA 2BEJA 2YXBA 1IXKA 2ZBUA 4PO1A 1LI7A 4LDJA 2DKOA 5FF9A 4JC8A 4QPZA 1KAOA 2GCGA 5BYKA 1PNVA 2GNOA 1WHSA 4OH1A 3N39C 3LDUA 3OICA 1MTZA 2F00A 2BJVA 4OHFA 4NZYA 2HM7A 1YZNA 3AVPA 1SKBA 3IR6A 4P53A 3TEJA 3PFIA 1OLUA 1V16B 1VA5A 2PWPA 4IDOA 3K4PA 3QM1A 2GYVA 5KWSA 3L7KA 1AMNA 5M29A 4DLBA 4YMIA 3PENA 1VSBA 3C5VA 3LO8A 5BWCA 4NU8X 4R1MA 1P17A 3A4NA 1ZVMA 4CKBA 1YI1A 2XCUA 5DIFA 5T4EA 5E3HA 4WBNF 1ZJ4A 4WTOA 1CDEA 1YAHA 2ZKIA 4MUFA 1H05A 4RGYA 1AJEA 2EJBA 3BGIA 3C70A 3FPLA 1EFTA 1VE9A 4TMTA 3B3GA 2Y4NA 3MFYA 4QO7A 3U1VA 3IT1A 2CKMA 1X2BA 4K9NA 4N01A 5EJ2A 5IBRA 8LDHA 4KRYA 2PS1A 4RE6A 5I5GA 1JP7A 1MLDA 2EFCB 1JHAA 2B7BA 3R76A 3V34A 4IILA 4PO3X 2HMSA 3VR1A 4MV3A 1YVUA 2XYGA 4XRGA 1F3LA 3WFJA 2OB2A 3U19A 3EVBA 2A5FA 3C6XA 4EMUA 4GNRA 4G5HA 1NQVA 1TM4E 2QN1A 4OY3A 1NMEA 4Q4LA 6REQA 4QQKA 3R5SA 5FL3A 3QKTA 2EC5A 2JJMA 1MRNA 1QONA 3AHDA 4FBMA 5JI3E 4R54A 4MUAA 5E6RA 1EA5A 3BH7A 2EX4A 1H23A 1T4DA 1ZYUA 4KQ6A 3VR2A 1BXRB 4FFSA 3URMA 2G4VA 5IH7A 1V2HE 4IJMA 2J9FA 2R97A 1FYFA 3MJRA 2N42A 3SYNA 4OJYA