3H11B

Zymogen caspase-8:c-flipl protease domain complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
257
structure length
229
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKGKQMPQPTFTLRKKLVFPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASP8 and FADD-like apoptosis regulator
publication title Mechanism of procaspase-8 activation by c-FLIPL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 81
structure length 229
sequence length 257
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h11B00
4EHHA 2CNOA 2QL7A 2H5IA 2HBZA 3K7EA 3R6GA 5IBPA 2NN3C 2XZTA 4D3YA 2QLBA 4AWBA 2AR9A 3H0EA 5I9TA 1F1JA 4QUDA 4EHFA 3R7BA 1RWVA 2C2MA 2QL5A 4QULA 4N6GA 3GJQA 1IBCA 1RHMA 2J33A 4NBNA 1I4OA 1QTNA 1PAUA 2HBRA 3IBCA 3RJMA 3S70A 1K88A 1RHKA 2C2ZA 3KJQA 2CNNA 4QUHA 3BIJA 3R7SA 3ITNA 5IASA 1RHUA 3NR2A 2H4YA 4ZVSA 2QLFA 4NOJA 4ZVUA 2CNLA 3EDQA 5IABA 4HVAA 1NMEA 4QUAA 3SIRA 1SHJA 3PD1A 3IBFA 4JQYA 5IAEA 2H5JA 2H48A 1SC4A 3GJTA 3R5KA 1CP3A 3V6LA 4EHDA 1QX3A 2XYPA 5IAKA 4NBKA 3D6FA 4ZVQA 3D6HA 1RWOA 2K7ZA 3H11A 4ZVRA 3DEKA 4N7MA 4AWAA 4QU5A 2J30A 4N6NA 3P4UA 3V3KA 4EHNA 4QU9A 1RHJA 4JJ7A 4QTXA 2Y0BA 4N6OA 1RWKA 4IYRA 5LU9A 1SC3A 2HBYA 2QLJA 4PS1A 2WDPA 1I4EB 5IAGA 2CNKA 3V4LA 4FEAA 4AW9A 2QL9A 1NW9B 4JJ8A 4EHKA 4JR2A 3DEJA 4QU0A 4QU8A 3KJFA 3PCXA 3QNWA 4ZVTA 3PD0A 4JB8A 1RWWA 3UO8B 4D3ZA 2HBQA 3NS7A 4QUIA 5IARA 2C2OA 4DCPA 3H13A 3KJNA 5IC6A 1RWXA 5LU8A 4NOLA 4D3XA 4HQRA 3R7NA 5IAJA 3R6LA 1RHRA 2CJYA 4QTYA 2J32A 3P45A 1NMQA 3SIPA 5LUAA 3EDRA 4HQ0A 4NBLA 3H1PA 4ZVOA 4QUJA 1I3OA 1ICEA 1M72A 3D6MA 4EHLA 2CJXA 2H51A 2XYHA 1SC1A 4I1PA 4DCJA 2H54A 1I51A 2FUNB 5I9BA 1F9EA 1JXQA 2C2KA 3DEHA 2C1EA 3H11B 5JFTA 5H0IA 2XYGA 3GJRA 4QUBA 1KMCA 1GQFA 5K20A 4N5DA 4DCOA 3UOAB 4QUEA 5IC4A 4JR1A 3GJSA 1K86A 2P2CA 3R5JA 2H65A 4JQZA 1QDUA 4NOKA 4IEFB 3V6MA 1SHLA 4LSZA 2XZDA 5IBRA 4ZVPA 5LUBA 4EJFA 2J31A 4PRYA 1GFWA 1RHQA 2H4WA 2Y1LA 4FGUA 1BMQA 1RWMA 2DKOA 1RE1A 1NMSA 4FDLA 4JJEA 4N7JA 3V55A 1PYOA 4I1RA 4EHAA 1CVRA 4M9RA 3NKFA 4JR0A 1RWNA 5IBCA 3DEIA 2FP3A 3E4CA 2FQQA 4NOMA 3OD5A 4QUGA 1RWPA 4PS0A 2CDRA 4PRZA 5IANA 3S8EA 4FXOA 3V4OA
chains in the Genus database with same CATH superfamily
2GZ1A 1LRLA 3LQ2A 1ZISA 4O25A 4Y9DA 1M6HA 4Q9NA 2AOVA 1YGPA 4MJXA 4NJEA 1G2QA 2SECE 4L27A 1JU4A 3AF1A 3OJXA 2HF9A 2QN8A 1Q0PA 4P3PA 4TOIA 4UU1A 3LLSA 4E03A 3GOHA 3LDAA 3MCUA 1XF9A 5LQSA 3E61A 1V7QA 3BMCA 3SJCA 3ZHVA 4IINA 1GRNA 3JAMA 3IPRA 3U4CA 3ZEAA 5C5EA 1TQ4A 1U9YA 3IXQA 4BRZA 4JLJA 3PEUA 3CBGA 3M3PA 2OLKA 2QENA 3BYZA 3HG7A 3O1HB 5A9SB 3BDIA 2HRDA 3W1VA 3L7DA 4AYXA 4ZJUA 5KVSA 2NAPA 2P41A 1YZKA 3WOVA 2XVAA 4DXAA 5JNWA 2JFBA 2NYAA 3O9ZA 5CFRA 3ZGOA 2QW0X 2VJMB 3E3MA 4X64B 4AS1A 1M6VB 4P08A 1EA7A 2XTAA 1S5PA 2PT5A 2AE1A 3HZOA 4OHFA 4HRAA 4ZVRA 3WDMA 3KFVA 4HSGA 1YR1A 3J80A 4GYYA 1YR6A 3ED1A 3PNOA 1C8VB 3VNAA 1UFVA 3IE2A 3PNBA 5AP9A 2AE2A 3ZBTA 4AB1A 1XRLA 5GGYA 2IUSA 5FV7A 3BOSA 1C9KA 3R3WA 1IIRA 1UKBA 1VHDA 2IOYA 3FOFC 4U7FA 1OA0A 1U8ZA 2B98A 2CNKA 3HHEA 4JSTA 4C4AA 3U4HA 1KI3A 3DLBA 2LTAA 1T4CA 1HYHA 3MINB 2VJYA 2C9ZA 3O6VA 2JRCA 4HX5A 3HBNA 4QHSA 4YRLA 1VYTA 1ZCFA 1G21B 3BKXA 3FR8A 4GXQA 3T7JA 4LXXA 1SPBS 1Z4OA 3DXXA 4P84A 2FSVA 3OJWA 5ENVA 4BV3A 1T8SA 2ZG6A 1U0OC 1S7GA 4W5NA 1UKEA 1E66A 5BW5A 1L4BA 2ROQA 1V9CA 2QZ9A 4R4JA 4R7ZA 3UA3A 4M3NA 4PBSA 1JFVA 1SBIA 1K9VF 2OV8A 1U5BA 5ILOA 4EMUA 1YF3A 4ENTA 5BR4A 3F0TA 4URWR 3LZCA 4HO1X 3JQDA 2DEUA 1O5OA 1WBBA 1O97D 1RCUA 1KI7A 3DT8A 2R87A 5LIPA 4RSGA 4Q7QA 1GHTA 1EQAA 3ZV4A 4PZYA 4EI2A 2D1FA 2JLCA 2Z1DA 3GWZA 4M8SA 2GK4A 1OA1A 1Z0JA 1XNHA 2ZUWA 2GKOA 1GZ4A 3PLNA 1NVKA 3PX7A 5TXGA 4ARUA 3VR3A 4AY2A 5CDFA 3BGDA 1NXQA 1Z2EA 3PL5A 2VYNA 3KYDB 4OMUA 4UPVA 2QY6A 3TMKA 1O7JA 4G5OA 4Q02A 3P9YA 2PNJA 1WUTA 2W00A 4QVKA 3LCMA 3M5PA 1VJ5A 2Q3MA 1GPLA 1TYBE 4F5EA 3O0DA 3OH8A 4GVPA 4WLOA 5D01A 4W5HA 4CKXA 3ICQB 1KMNA 3LQYA 1GD1O 3ZZNA 4HDCA 2CLLB 2E0IA 3DV0B 5EKDA 1JG7A 1F2UA 1Z26A 4NPAA 5FPTA 4YQYA 1GGFA 3B82A 3O2JA 2IPAB 3QWAA 2G09A 3P9NA 3IR6A 1VKNA 1Z6YA 2GXSA 3MILA 4MRVA 1U3CA 5FPPA 3SEQA 1DAMA 3Q7QA 2F8LA 3QBVA 4DJEC 2JEZA 4HC4A 4RF2A 3Q1LA 3DAPA 4MA4A 2J3DA 3UGTA 3U44A 3FTDA 3I04A 1LF5A 2H2DA 4GVXA 4K5QA 2GRJA 4NECA 5REQB 1SCUB 5FUWA 5TQ2A 1D9ZA 1JZSA 3W8NA 5GGXA 4Z4CA 4XZ3A 3BB4A 3O8RA 1E2BA 4O02B 3UMGA 5KSOA 1OTHA 3U31A 3DOIA 4G01B 1IJFA 4FEYA 4XOUA 1GQYA 2DTDA 1EWRA 1LDEA 3PV0A 5K0GA 3OCJA 2HRRA 4DPKA 2VOJA 2EJCA 3W05A 1Z0IA 2O6LA 2X76A 4MKZA 2VYCA 1X0VA 2BGWA 1UAYA 4RQTA 1JHVA 2O20A 4G1VA 1UP7A 8GPBA 4WVFA 4JJAA 2YN2A 1WSDA 4DBZA 2A5LA 4LTDA 4EB6A 3M1IA 2W58A 1PK9A 1GOTA 3HJUA 3QWHA 2O3TA 3R7WB 1LSOA 1CP3A 5LYYA 3E9DA 3T5PA 1XYGA 4M22A 2Q8PA 3R24A 5TQ0B 4K81B 5IUJC 3MMSA 1EXMA 4I9NA 5F1KA 2GJ9A 3VO9A 1V39A 4DCNA 2X13A 1BXZA 5FUXA 2P40A 3T34A 4DC0A 3ESDA 3T3MB 5E4TA 1HE3A 1OU0A 5CXSA 1QFYA 1GCOA 3QUQA 1DAOA 3QX9A 1MNQA 5CBPB 3KR2A 4ARBA 2X5NA 1AKRA 4JFRA 1L6IA 5LZ5A 2FU5C 3M2TA 4P81A 5CT6A 3VKHA 1YFLA 4GD3Q 2WTNA 4YXFA 3ZKWA 1PQYA 1VHQA 3FN4A 3LAWA 1YR3A 1RWWA 2YQZA 4FKZA 2WAYA 4GVLA 4NABA 4R54A 2HTEA 1II9A 1O9BA 2CXHA 4WL0A 3SBEA 3HUTA 1GCAA 4Z1OA 4O4LA 2VSYA 1USGA 4L50A 1TK2A 1SKYE 2OC9A 4BP3A 3AO0B 1XSEA 3H3XA 4GOLD 3UT0A 1E2UA 5F23A 3N2GB 2EEPA 4XX0B 2Y1WA 3P9KA 1WETA 4Q3BA 3E22A 5G41A 4C7MA 2AWOA 1JEJA 3Q3CA 4JOQA 2J87A 4EHKA 2BONA 1L7DA 1ML3A 1OTYA 1VKJA 2C61A 2GN0A 3HJNA 4M8KA 1SXIA 3QX7A 4RZ2A 3ENKA 3VR5A 3K09C 3MS4A 1S6YA 2Z8ZA 3Q9LA 1L4NA 5FI1B 1Q95A 1M2HA 2YUIA 2W6JD 1ZJWA 3BRCA 3IESA 2R6GA 4AO8A 4JLWA 3L43A 1PJAA 1A4XA 2GRUA 5ADWA 1YS2X 1PIWA 2V6JA 2XGGA 3C6BA 1USKA 3CPEA 1Q22A 1UM9B 3OHPA 3HO1A 2H5EA 2VHTA 1WB5A 1MX9A 3B5IA 1KC1A 1T1JA 4L4ZA 4B3TB 5K3DA 1F3OA 3C5EA 4GBJA 4O08A 3ZLBA 4OFBA 1PL0A 3EULA 2PMDA 5JPIA 2ZAIA 3KD2A 1LPAB 1MAWA 1ZSVA 3A9TA 1OFUA 3FDIA 4CHGA 4X92A 3U1VA 2EATA 4RZSA 3STHA 1CEYA 4KDFA 2FN4A 1TRKA 2HK8A 1QX4A 3IUNA 1CNMA 3L0PA 2BI4A 2CDRA 2J9YB 2I99A 2OD9A 3I8XA 1IVSA 2LIPA 4LBZA 4MYHA 1H3NA 3ESXA 2GF2A 2NO4A 4CM4B 1XC7A 3OM0A 2FEKA 2BBTA 4E5VA 2VH1A 1NMZA 1JG3A 1WO8A 2RI1A 2Q8NA 2N9UA 2Z9BA 4F4CA 2QRJA 4MB6A 2IPNA 1LDGA 2C1XA 1QGYA 5I7RA 1VGRA 2C2MA 5JJKA 5JCJA 3EH2A 5K51A 5I8PA 2AXNA 1UDXA 2FX5A 1JU9A 2WINI 2XTMA 3FNQA 3G17A 5F7JA 3U61B 2AEEA 2WFLB 4OBWA 3GVIA 4NDNE 2F8TA 3AIMA 4DWWA 2NMVA 2EKLA 4HG2A 1UFQA 4M53A 1P9OA 2H18A 4TSFD 3SN6A 4BATA 4C7BA 4B3RB 2YH2A 2GERA 5KYUA 1CB7A 5FORA 1W25A 1QHFA 3L7BA 4JITA 4M9XA 2O8FA 4H9GA 4DPMA 1DRUA 1FLVA 3OKPA 4L5BA 3LUBA 5PNTA 4K8RB 4RY0A 1VHWA 4OYRA 4GECA 2XJ4A 1G8HA 2VP0A 4MGHA 1QORA 2JAUA 1RD4A 5F3DA 2VTDA 1L5MA 3UZUA 3VTAA 1DELA 2ADOA 4B3XA 3N3AC 3QU2A 2DU8A 1I6WA 3TBFA 2FW1A 2VK8A 4JD5A 4W9RA 1A4UA 5C4MA 221PA 2XUAA 2Y1CA 3LVRE 3O3CA 3BJEA 3HVKA 2OKCA 1QIDA 3K35A 3AH8A 3MCTA 3WB9A 1N6LA 3ZE6A 4HOYA 5L6MB 1R8JA 3LIPA 1V35A 1B3RA 1U4NA 3DNMA 4KG7A 4AZWA 2D6FA 4OOFA 1NTRA 1RYBA 4CQMB 5COQA 1QZXA 3KTOA 3NASA 2JIBA 5EJMA 4GS5A 3K96A 4JP5A 4BQQA 1AQYA 1L4EA 3EIEA 2J0QA 4PXAA 3IR5A 1GYQA 3JCZA 1PT8A 5LXTF 1JAHA 2CWWA 4FKMA 3I37X 4RHTA 2OYSA 4OVKA 3UWPA 2KHZA 1NW3A 4EUKA 3ST7A 5TMDA 1MOQA 3ZOZA 1JZTA 1QOQB 4DLZA 5BNIA 2CDBA 4C14A 2NXNA 3NTLA 3VKVA 1GNLA 2A5GA 3CKMA 4FIDA 1EB9A 4LECA 4NLLA 1H4TA 1U7PA 3BMQB 4Z49A 3LA6A 1NVWQ 4DYVA 3ZZTA 5HFAA 2H51A 4ENPA 5G3YA 3I5UA 1KOFA 1UDRA 4XB2A 3FF4A 4I1UA 3WL3A 4OHOA 1Q14A 4JVOA 2C1EA 2O3UA 3DKIA 4UM9B 1KFBB 3PA6A 1E6MA 3U5ZB 3TSWA 1PVVA 1GAJA 1YDHA 1D03A 4KMMA 4OQYA 5J63A 4NU0A 1DQSA 3FZGA 4X0EA 2RE8A 1JHUA 2WKPA 2DKFA 3LX6A 2BMVA 3O1LA 3PGXA 3IV7A 4V0MA 1KFCB 4B7AA 4X6UA 4LRXA 3SPXA 3VZRA 5NLLA 4GUAA 1GSHA 2XDWA 1S7CA 4P80A 3W78A 4BB6A 1JH9A 1CIJA 3N2KB 5REQA 2ZDHA 2WKQA 1SCUA 4HGNA 4ALIA 3M5WA 4PZ0A 5FEUA 1S89A 1DJLA 2NSDA 4RIEA 5EP4A 4EIWA 4E7OA 1EBBA 4ID9A 2H5LA 2YMLA 2R6AA 2IZ1A 4FYVA 5LYJA 4RLHA 3RAFC 1NQXA 1TW2A 4FB4A 1EFLA 1NXOA 2HA3A 1AS0A 3OFNA 4QG7A 3O91A 1QYRA 3MGKA 2QP4A 4KCGA 4BRUA 1FNCA 3KAKA 5KSYA 4ZREA 2PRZA 4MZXA 5BSKA 5M2QA 3RNOA 4YCNA 1Y37A 2CT8A 5K0ZA 4QQRA 1P2VA 3ASVA 1AXRA 2Z4RA 5LU8A 4DJTA 1XHFA 1ZI6A 1GGMA 4XRGA 4OBEA 4A16A 4AJIA 1IJEA 1X70A 4MUKA 3R7FA 4AZ0B 3AETB 1J2TA 3QP9A 4K9PA 1PJBA 4UM7A 2BT4A 3ONFA 1NYTA 4N3CA 1IWOA 2NUPB 4RJJA 3LT5A 3URKA 1IBLB 4HWOA 2QX4A 2GD2A 4P4LA 2X19A 3WNVA 2CNBA 4CTJA 2GZHA 3IH5A 2GJSA 5FTMA 4BFXA 4FINA 1XMJA 4GYWA 1F8YA 4XDGA 5BY2A 1QIFA 2GS9A 4QDXA 1DOZA 4TZKA 5DGTA 4HWPA 3VV3A 5CBPA 4BQFA 5B2EA 5ALTA 2BZ0A 4LWOA 4TKMA 3H11A 3RG2A 3VMMA 2GCOB 2XV1A 3N70A 3ZGNA 4G5FA 5MFZA 1C50A 2ZVQX 4FFVA 1Y1KE 2G40A 2LDBA 3ON5A 3OETA 1YZFA 4G81A 4BPRA 3O95A 4DDTA 2FGKA 1Y3HA 5LU9A 3G0IA 1W6RA 1JMKC 2QLJA 3LCJA 4RTJA 2ZM6B 3G85A 1MQAA 5DWQA 5HDBB 2R7MA 2RGXA 4QTTB 4AY4A 1RQ7A 2VRCA 4XX0A 1AXGA 3TZKA 1ECPA 4HEA1 4GRIA 4D0NA 4RK1A 3ZVRA 4UFPA 3B78A 2NSHA 2JHGA 1YE5A 1YK0A 5CJJA 2PGIA 3OJCA 2IVFA 3UPUA 1A4RA 2GPAA 3MUNA 3R7LA 1NN5A 1OXTA 2QJOA 5DX8A 4G0UA 2C84A 4EZBA 5B6JA 1R4ZA 5BQ5A 2XITA 2PXHA 5K3SA 121PA 1WLYA 5I7EA 1JQEA 2YYZA 2O7RA 3OJLA 2FWAA 1NMQA 2OPBA 3ZI4A 5EG5A 2LBPA 5DP2A 3TZCA 2N47A 3ZWCA 3BSSA 3F5SA 1UM9A 3DCJA 1MZVA 1T0IA 4G5YA 1RC8A 1T8WA 2G8NA 2FWJA 3BIXA 4XB6B 1WVIA 1GZ6A 1B7GO 3KB1A 1JLKA 3I6QA 3JQ9A 5FB3A 4DEVA 4H4CA 4A8HA 3U7IA 5GZ3A 3AXSA 4OYHA 1M76A 3TLMA 6NULA 2FG7C 5JLJA 2VTVA 2YWRA 3R77A 4MQ4A 5J4YA 1YVRA 2FPIB 2VNKA 2FTKE 5CDYA 2I3ZA 1STOA 4FE3A 5DM70 1AJEA 4MZDA 5IYZF 3CF0A 3RNLA 3H84A 2OV6A 2W6OA 3JWPA 3PBKA 4LRUA 1U94A 2PS1A 2V74B 4MV7A 3WGNA 4CM4A 4IGEA 1G7CA 2OBLA 1X1AA 1U3UA 1LTQA 4JLUA 1PYOA 3SYRA 1A8HA 4HRYA 2C9YA 4G9BA 4OK5A 1JDUA 4KQMA 1EGMB 5LXTB 4XWOA 4PQRA 2WLTA 3JQ8B 4LOLA 1G5RA 2KBEA 5HGXA 4YPFA 2ZXFA 1QM5A 3VPSA 3EXG1 2FN7A 2CCKA 1VIYA 4Q16A 1BQ3A 1GUDA 4ZP1A 3HR7A 3TZLA 3U37A 4D7AA 5G0VA 1YONA 2EERA 4DM3A 4OXNA 1O94D 1J2EA 2J3QA 1LPPA 2LCFA 2Q3BA 5H80A 4DV1B 4G84A 4MVCA 4ZQCB 2HNBA 3MUFA 3U62A 2J59A 2CGEA 3JAKB 2NLOA 2J3HA 4M0KA 1D2NA 2O1SA 2WU3A 4G0QA 4BVHA 1D1QA 4ND6A 4NICA 3W7VA 2GK3A 1CBUA 3PR3A 2ASVA 3ROTA 3LPDA 3VJKA 4ERNA 2PGOA 3ZV6A 5ECDA 2Z8XA 5L4SA 4LG1A 4E6EA 2CXTA 3LJKA 4TV8F 5IJWA 4D0RA 2ZUBA 4R1NA 4EHDA 2V6FA 2BJVA 3H5NA 3HDJA 3KSMA 4BYGA 3F6EX 2VDKB 2E1RA 3WJ1A 4WKOA 1H6CA 1JDSA 2DT8A 2B4KA 3LS2A 1DAKA 1BX0A 3KAPA 4CQMA 2R66A 3T7IA 3IQGX 1EUCA 2B6NA 4UHFA 1SB8A 1HX7A 2VA8A 1R3DA 5JMOA 3BX1A 4K87A 1BVHA 4J03A 1E62A 2UVPA 4AXXA 4B5KA 5EJGA 4HYTA 5KC8A 4MRSA 2VEOA 3C41J 1V7ZA 4J4HA 4X94A 2DWQA 5JC8A 1MIOB 4CUJA 3NANA 3BMNB 1OI2A 3I9OA 4N9WA 5K6AC 4WKBA 5I4KA 3EVEA 3UXEA 5J1SB 4MCJA 1JQDA 3P1JA 4MGYR 4RABA 2C9BA 1SCNE 3PR2B 3HB9A 3P0IA 3PJEA 5BOVA 1Z39A 1J90A 2XF8A 2IHZA 4PYRA 5F1YA 1ODIA 1LC3A 3VNBA 1EDEA 3FNGA 2DX7A 3IAAA 5HVNA 2N75A 1ZZGA 4FDMA 4LZWA 5AVSA 1IATA 4ZAZA 1WDMA 2G9UA 4EG0A 2WYHA 1E9DA 2QUHA 4MWTA 5EP1A 3G8DA 4EBBA 1KK2A 4C0XA 3C1TA 3MJHA 1G4HA 1QAMA 1Z2PX 4B46A 4QTZA 2IX3A 5JCPA 1FXWF 3AJDA 3E7DA 3C98A 3N2KA 3PUIA 3Q72A 4IFIA 3KFLA 4R7TA 3L6DA 5EUBA 4RFLA 2AT1A 2C5GA 1TOAA 3W9BA 1GUZA 2M6KA 1LS1A 4BUJA 2X4LA 2WHPB 2QAGC 3DFUA 3LECA 5K9ZA 1SA0A 3WLJA 4TT3A 1F6DA 4NYMR 5AM4A 3GRCA 4AMYA 4FB5A 3BWDD 2H1CA 1T24A 2O2EA 1N9GB 3DL4A 1EX1A 4XJVA 4UMEA 3CVVA 1J23A 4ZKDA 1V8PA 1YCFA 5DOVA 2CFTA 4FGZA 5CFLA 2YQ5A 2I3BA 1S8OA 2ZYUX 4UFOA 4TL7A 4P53A 5G0TA 3OU2A 1FXUA 2J4FA 1AGXA 3AETA 4MVJF 3RUAA 4DT1B 3RC9A 5K0TA 5HOEA 1ZN2A 2CKDA 5G4LA 4RZ3A 1J0BA 4YONB 1WZCA 3A6HA 4JJKA 2PX6A 3L7AA 3DS8A 5CNMA 4C4SA 4GI3A 1ZUD1 3C43A 2L0XA 1JAZA 3R5FA 2C07A 3L6BA 4NNJA 5K8UA 2V4MA 3E0XA 4Z7NB 1T6YA 5KTYA 3HI6A 2ZB4A 1A5AB 5GM1A 3TI7A 3DO6A 4GYJA 3QSGA 1AF7A 4ZQHA 721PA 4ER5A 2GCOA 2ZSUA 4LE1A 1TIKA 1XGKA 4UHHA 3STVA 2VA9A 3PEWA 1FMFA 2BFOA 5CT5A 1FDRA 3SG0A 4K28A 5IYZB 3AKYA 2VH5R 2Z56A 2GVZC 4NZYA 1I24A 4PV7A 3ZY4A 1CZUA 5ESXA 3UVEA 4CG0A 2TRSB 3EGIA 3FCEA 3JVEA 4S24A 4QARA 5LP6F 1LKZA 3L18A 4LJYA 2FSPA 3ZDYB 2BKLA 3IOEA 1KEPA 1VBMA 1H2ZA 3QELB 4NFSA 1M8FA 2WZQA 3A4TA 2XB4A 1LZLA 4PHTA 4BTLA 1AKMA 1EMDA 1AK9A 2PZLA 2ZANA 4O2BB 3S2SA 3ID6C 3LOQA 3RJ5A 3WJ2A 2HK6A 2PUDA 1Y9DA 2ONCA 7ADHA 3ZDCA 4RQBA 3IMFA 2IV3A 3IP6A 1QH8B 2HKIA 2LE0A 4JENA 3UHJA 2XXBA 1W85B 4H7EA 2VNSA 4YRMA 4REOA 2V58A 3ZHXA 1UK7A 2WJYA 4BTVA 4GDFA 4TWIA 4EYGA 2PPVA 1JT9A 4OLBA 2W9XA 2HK9A 5BOSB 3QYFA 3TZBA 4D80A 1TMKA 4P86A 1FFXB 4IZHA 2XJ9A 1Z4QA 4AJKA 2IEDA 4C4XA 4L08A 2ORIA 3I8OA 1J6UA 1E9FA 1R6XA 1QF7A 2QMZA 3IOCA 3M34A 4GHWA 4PNHA 4N5MA 3BH7A 3JARA 1NP6A 1PNQA 2GO7A 4YGXB 1FEZA 1U5CA 2Y2UA 1YRBA 2C20A 1T2CA 3NHUA 1EWTA 3PHLA 4B2PA 3TKAA 3VKFA 4RACA 1JMVA 5D5QA 1LI7A 2OAP1 2V6BA 4RVNA 2JCBA 2ILTA 3BIWA 4TV8B 4UTPA 2AC2A 2WSLA 3LLVA 3JQBA 2V7VA 3S7ZA 4B9EA 2CEKA 4JJGA 2E85A 1D0IA 4F7DA 5F5NA 3TFOA 4PRLA 4OV6B 5JFGA 4RPJA 3MC1A 1EK5A 2OORC 4RA6A 3C6XA 3INYA 1L7PA 5HKKA 5GOZA 5KQPA 2VDLB 2YDYA 2ZBFA 4MVJH 2FFRA 2A8YA 1XZAA 2D2VA 2PYZA 1YR9A 3JQ8A 4PHCA 1GY8A 1VL1A 3IURA 2GPTA 3NWPA 2JJ8A 3A2KA 5DPMA 2V3WA 3FIJA 4JT8A 4ECAA 4ZVPA 2VTBA 2BE9A 2BJHA 4XFDA 4C6RA 1P3DA 5EFZA 2C9DA 5C7YA 1JDNA 3II6X 4KR3A 2Z57A 2IHVA 1UDAA 2NG1A 2CXNA 1JDBB 3PC8C 4MPPA 4FMDB 3SQNA 4M7OA 3OBBA 4OP3A 3AM3A 1K8ZB 1HE8B 2H6EA 2WWWA 4P6VF 5CK5A 1A5ZA 1SXHA 3NUZA 2BEVA 3EXIB 1ZOSA 2Q5EA 5T6MA 4C2AA 4FR0A 2RGBA 1PV1A 2W2LD 2QA5A 3ZGVA 2EWMA 3A4YA 2GTHA 2VJAA 3DVQX 3IULA 4IDNA 4J94A 5HTKA 5ICGA 1ZINA 1UXIA 3LLMA 3OJOA 3PXUA 4JLVA 4RVSA 5JNVA 2OHVA 1NKVA 1GM5A 1EJ2A 4H6PA 5I8WA 4RO0A 4NBNA 3DTNA 2WOOA 1XVTA 2DG2A 3ME5A 4YUYA 3CS3A 3ZHZA 4EPWA 2EAUA 4W8HA 3H3JA 3C6QA 4BLWA 1CXZA 1PJ8A 2GXUA 2V0NA 4NOJA 1HNWB 4OHUA 4JNCA 3L49A 5K0SA 3NMUF 2FN8A 1N4AA 5TMEA 1MBZA 1BVYF 1VHJA 2W48A 5CLJA 4Y2QA 3VI3B 2R3SA 4KHPB 1F2DA 4Q18A 2QVBA 2XVXA 3RREA 4M0CA 1ISFA 2LRHA 2EBHX 4XWGA 4WBSA 2F1OA 1NW4A 2XOKA 2ZPUA 1CT9A 1BW9A 3BXEA 3DGEC 5FOWA 3RWBA 3F7OA 1G59A 3UAWA 4UTOA 1E6KA 4DY6A 1EH5A 4ZVQA 1ZPDA 3H2KA 2HMSA 1CLEA 3D6HA 3MS7A 1L5HA 1KKLA 1MAVA 4BBZA 3BMNA 4YUAA 5A6SA 2FMFA 2SKEA 1U3GA 1E3EA 2Q6KA 3AY6A 1SZJG 1S3SA 3FH0A 3HJHA 1LF0A 4HGZA 1G8MA 4L8GA 2PRSA 3S2ZA 4D4LA 1AMNA 2CL5A 3D8BA 2CLCX 3K6SB 4QAQA 4LWZA 1KETA 3LU1A 3LRXA 3ZV5A 2BY4A 5DIFA 2FMXA 2A0KA 3V8QA 1SXQA 3F2IA 1N5RA 1CJTC 4G5QA 4UMFA 1NZDA 1RLOA 3IMEA 3B9PA 3OG9A 1XVLA 1NXPA 2W22A 4A2PA 1W0JD 3LT1A 4DMLA 1B2RA 3UF0A 4F97A 2PCLA 4ZQBA 4I66A 3TZHA 2JH8A 3PEVA 2HBQA 3IUQA 4AK9A 3JQCA 3KEOA 4RD2A 5SZJA 1DAHA 1MC4A 2NU7B 1EUZA 1Q1QA 4FZJA 2P3OA 1X7YB 2H0QA 1X7XA 4IDHA 3M4JA 4EY8A 3GGGA 3O3NB 1QK5A 1Q0QA 1Y9AA 2QRQA 4R9VA 5EVJA 2C92A 3WHLA 1GQRA 4QUJA 2ZTSA 5JPDA 2F55A 1ZXXA 4B75A 1A2BA 1PL7A 1WPQA 4MPJA 3GT4A 4MUHA 1N9GA 3ZWPA 1YE8A 3HYTA 4N5NA 1XTPA 4RJIA 3TLGA 3DZGA 2RAFA 4IDPA 5CYGA 3NGXA 5BNWA 4MRPA 1PHPA 4X44A 5K3CA 4JKOA 3PK0A 4ZN6A 4V1CI 1RWBA 3CX3A 3Q3VA 5JSFA 3DZBA 1NKSA 1KFJB 2BWJA 2NO0A 3WA6A 3CUWA 2XB8A 1EVYA 4JLAA 1E3SA 2NPIA 2YVAA 2IF0A 4IHAA 2ZJOA 2XCUA 3NIWA 2J6CA 2JIDA 4RF4A 1VHLA 2X5XA 2V6MA 2CBXA 1HM5A 3EIUA 1DAPA 4NZZA 4RH0A 2JCYA 4DLBA 1QVWA 4MWDA 3WADA 4B48A 4FC6A 5HKAA 3R0VA 4AJ4A 3KV3O 4J90A 4R5HA 1DEXA 2FDRA 2V5UA 2ZRCA 4MS4B 5HFNA 5JSQA 2JIPA 3UENA 4JEIA 3U17A 3TSYA 3DDZX 2XA1A 4FC7A 3L9XA 4MUYA 3AVTA 3O7WA 1WG8A 3CM0A 3FPSA 1K3TA 5HF9A 1XVUA 4OHCA 3K73O 5B30A 4UZSA 3QKUA 2XRZA 4CMGA 1PR2A 2EJBA 1GWNA 1DZIA 4QXMA 4MHOA 3WQHA 4E70A 5IYZA 1GLGA 2AMYA 4US2R 1H1DA 2ZT6A 2GFHA 2D0PB 1Q3KA 1UKAA 1KIAA 3X2FA 2CV1A 3LUPA 2GM5A 4TTSA 1RHKA 4DJJA 1OGJA 4RKWA 4EP1A 2WU0A 2BLLA 2OQRA 2BEKA 3FGNA 3L0CA 3GFBA 2OOKA 2WUVA 3QELA 1YRYE 5H68A 3V8NA 4RTMA 5DNDA 1OB2A 4LFBB 4J75A 3DLHA 1WE2A 2JK1A 2AVNA 5CA1F 4TS4A 5JFOA 4IJMA 3CNLA 4U8GA 4QFDA 1FBTA 1K5HA 4E4YA 3ZYCA 1MNAA 1QH8A 1AZTA 3UXYA 2QDXA 1W85A 3IT1A 4KO2S 1AE1A 3HEMA 4QT0A 4IGAA 5C1OA 1P1HA 5B3JA 1XTUA 4GPIB 2W0SA 2XUPA 4J0QA 3TM5A 4ADSG 4WA8A 2PXCA 3HPRA 1E1CB 4NRDA 1LVUA 4H2DA 2AJCA 1PWZA 2YRWA 5BOSA 1PV4A 3DAOA 3H5RA 1LC0A 3NI2A 4EWLA 1RI1A 4K6CA 1DQZA 2FJ0A 3SSNA 3CNNA 2Q5LA 1UMCA 2GFQA 5CXXA 2RJOA 3A2NA 1YR8A 2GLUA 3D3WB 3E7FA 4IIUA 5BWMA 2DQKA 1JTEA 4C08A 4D56A 2POCA 3WLKX 1OAOC 1YZNA 1POWA 2Q3JA 2BW0A 5EKXA 2BGUA 5GY7A 1ID8A 2JFPA 3K5IA 4PY2A 1NYLA 4CKYA 5K7SA 1Y3IA 4TYWA 3HFJA 4TV8A 1LPNA 5DIZA 4Y0AA 1JX6A 1B1CA 3ZK9A 2VDNB 4RNDB 3D6AA 3OTGA 3LE8A 2WKWA 3WGGA 3NZEA 2ZOSA 3H2YA 3T9EA 3SIXA 3N75A 4L73A 4MVXA 3GQBB 4YMSA 1NUQA 1WPXA 3TUJC 3VJLA 4S05A 3KC2A 3SDSA 3ZNPA 2DR2A 3W6ZA 2IPLA 3LTEA 2HRCA 2ZETA 1CFZA 2Q0XA 1HLPA 4KJZA 5EXDA 3LC0A 4LVOA 2C0QA 3HJAA 4NBSA 4COKA 4RE6A 1T8YA 2AJDA 2ZJ2A 4XPZA 4PSKA 3TEMA 2QRKA 3GEDA 1KSJA 1I1OA 3HCDA 3ZWQA 2PX5A 2QMOA 1UBHS 3T41A 5AWFC 1P2UA 2GMWA 1K5PA 4YY3B 2ZAMA 3L06A 4IUDS 3T5MA 2R6DA 2ZZNA 1S02A 1I2MA 5A9RA 1TYEB 3GJRA 3T8YA 4NV1A 3BTVA 4GO1A 2YOGA 1HZZA 1P9LA 2QRZA 5M34A 3JQRA 3W6OA 3FUCA 2EJUA 2QIOA 3DT6A 3EXIA 1WW8A 2TECE 3QUBA 4TLAA 2HH9A 1WZEA 5E9AA 2IYSA 3TTVA 1HF3A 5D3ZA 2QTBA 1N8NA 2QRNA 5C1PA 1BD4A 2QMYA 4YJ2F 1DAEA 4DAOA 2RBKA 3JYNA 1FXWA 3M6XA 3VVMA 4KO4S 2BCJQ 5FWDA 2ON6A 4XTCS 5F3RA 4D6YA 3OOJA 4XDZA 2VQEB 4B45A 1BMTA 5EMJA 2RJNA 1PJ2A 1S9HA 2MTBA 1DXHA 4IS2A 3M6MD 4PGGA 4JROA 2CXUA 2R1VB 2HBZA 4ZPJA 2B7BA 2WUGA 3OZEA 1L8OA 3LKDA 2HN9A 3EBOA 3LZ6A 4YCCA 5JADA 1JHOA 4AWBA 2HSGA 5CGQB 4BNJA 2QT1A 1E7YA 5TMBA 2C03A 3RRZA 1M1UA 5D6OA 1C3XA 3ZY5A 5F51A 2C4KA 3GP3A 5CJ2A 4YJKA 4ENWA 2ZSBA 4UDYX 1YHNA 2VJCA 5IJ9A 1ESZA 1W9HA 3DL0A 4GZ5A 4LV8B 2ZYVX 1QIJA 2Q6TA 3F6CA 4JSRA 4YDRA 2IPXA 2CNLA 2ZSJA 1YNSA 3LQQA 2JLQA 3JVVA 4TRMA 2QS9A 4MVJA 3EXEB 5C8ZA 4LHSA 1T9DA 1JQKA 2K4MA 4D4GA 1R9MA 3G2IA 2HF2A 4M1QA 3DE5X 3DE4X 4ECEA 3A4LA 3I2HA 1JEYB 1NC3A 2H5JA 2CXRA 2Q07A 4XVHA 5EIFA 1G6Q1 1YULA 3ZJUA 4C0SA 3X3HA 5FNZA 2PFGA 3IUYA 4L6CA 2VS1A 1H1LB 1ZXBA 2WJ6A 2AYXA 2C4WA 2D7JA 3KPVA 4AQDA 5DLEA 2DB3A 1QG6A 4G23A 3JTMA 4C7VA 2Q1SA 3FJ1A 1M1NB 1NLMA 2XUHA 1GRRA 1A8SA 1XBTA 2ANBA 4TUYA 2CE7A 4M0UA 4YMIA 5DRTA 3TBHA 3TN7A 1AU9A 1X7YA 4TV9F 4XQ0A 3RFVA 4CV2A 6ADHA 3UYKA 3ZHOA 3FYUA 1MG5A 3AV3A 3JQFC 1P1CA 2B7CA 4QYIA 4UBMA 3L41A 4BWYA 1B8UA 5F76A 3O73A 4YV2A 5ERGB 2INGX 4XUEA 5IXJA 3WWYA 3H5AA 1W0KD 3VPGA 1QNLA 2NM0A 3PFBA 2ZXUA 2WYOA 2FZKA 3FOBA 3VU0A 1YQQA 2AJTA 1RRKA 3FMVA 4B6FA 2JA1A 2RIPA 4KVFA 1CIPA 2VFAA 4XVQA 1NBAA 4Q4HA 1BEUB 5JQGA 3A1NA 2GHRA 1D9XA 4RANA 3OAAD 4NPHA 4J29A 4D9HA 4QTYA 5CA1B 5A05A 5EHZA 1F4LA 1DAIA 1XUOA 1YQUA 4OHWA 2PU7A 3TPZA 5AUOB 4TVKA 2PS3A 2F3RA 4NAVA 1G2OA 5DN6A 2PMBA 3D7SA 2JBWA 5HSGA 3A9WA 3G9QA 2W6ID 3LA8A 1I7LA 3CEJA 3H5OA 3IUSA 4Q3AA 4W1RA 4FN5A 1NP7A 1WVGA 1RZRD 1C0EA 2BBOA 1I51A 2AN3A 3CTMA 4Q66C 4P82A 3UMRA 1SQ5A 1TTQB 5AK5A 5K0JA 2PX0A 2P2SA 2VDRB 1AN9A 3QMMA 4C87A 3LKZA 1QU3A 4EG8A 5ALZA 4Z53A 4MA0A 4BNZA 3WB2A 1JKXA 3WBJA 2OB1A 1LK5A 1XDBA 2V7EA 5LP6B 2UU9B 5TVGA 2ZCUA 4BNGA 4OQXA 4DLTA 2ZIWB 4KXFB 3CVYA 2ZVJA 1JXOA 3DHNA 3IDZA 1XTRA 5KTSA 2WK1A 5FDFA 4UHCA 3DMFA 2ZRFA 4Q1VA 4V02A 4PO1A 2W71A 1YDEA 5TPWB 1AQNA 3BE8A 1TC2A 1ETHA 1PDOA 3JQQA 3EQ8A 2YWGA 4DXHA 2R25B 3PWZA 3ZWOA 3DDSA 2AW5A 3PNLA 3O8CA 2OV2A 4DARA 5CFQA 5IWCA 4CL3A 4MEAA 1HT1E 2E4WA 4C01A 1SCJA 3I05A 5AKGA 5FD8A 5H4GA 1UBSB 3X44A 1TW3A 4L5CA 2UXDB 4HSEA 2JKVA 2ZRMA 3D4PA 3IP7A 4M1SA 1B0UA 2WC1A 4MDHA 4YJFA 4EL5A 3KX2A 1I2AA 2FR8A 3ZY6A 2FW7A 3LBHA 3N0VA 4DQ0A 3PGMA 5KWJA 3FNHA 1Y1QA 3LBIA 3DYVA 1C3OB 1O6CA 3WLIA 1J0CA 4TLMB 1A96A 2H2GA 4MQBA 2BGNA 3B6IA 3R0JA 4HCJA 4KTTE 5J2TF 3U80A 4CE6A 4CCWA 4JJFA 2AD1A 4R2HA 2CMHA 2D2EA 1HMYA 3WYNA 1SGWA 3IBFA 3CMCO 4IOJA 3CYFA 3EK2A 4TQAA 5NULA 3ICVA 2ZCVA 1GSOA 1NQOA 1NW5A 4RZXA 4YJ2B 4DRZA 4E2ZA 3QU4A 3WYDA 2BFFA 2R6R1 1GEGA 4WT7A 2IYRA 5ENZA 2CV0A 3LPNA 5KQLA 2WYUA 2CUTA 4JWTA 1CB0A 1JDPA 4F8YA 1XDDA 2GXAA 1QGZA 4DIBA 2R8XA 3THRA 2P0EA 1NRXA 2IW1A 5BO5A 1Z0FA 2FCAA 3RKUA 2FSIA 1CR6A 1CUFA 3W5HA 2OENG 2V97A 1NQAO 1OREA 3BICA 3ADKA 4IZIA 5TJ9A 1EP1B 1HNZB 3H19A 1N2XA 1YZ3A 3Q0IA 1IHDA 3UWMA 3M4ZA 1WTCA 4KV7A 1A1SA 3BQMB 4DABA 1N5DA 4D82A 2C57A 3KJFA 4R41A 5B4UA 2EL9A 3KPWA 4JH0A 4KXYA 1DO8A 2ZIEA 5E6UB 1VPDA 2PGNA 3ZD9A 3GFPA 2GN6A 4EEKA 1MF7A 1PS8A 3KR9A 4BVJA 1ENPA 5E2IA 1W1IA 5ISMA 3V42A 2C3MA 1Z88A 1IUOA 3K8ZA 3NBMA 1J00A 4G5HA 3Q7RA 2F1KA 2BD0A 1BKYA 2I2WA 2QUJA 2G6BA 4KR7A 5IZCA 4QC2A 5JTUA 5EJ6A 1RQGA 3EFBA 2EKZA 3OP1A 4V2UA 2JLRA 1BXRA 4HDNB 4Y1FA 4N0EA 5I7UA 3OQIA 3V2UA 1FFBA 1JT2A 1A98A 4HMQA 5LR6A 1IEVA 3PUZA 4FFNA 4OJTA 5FULA 4PYOA 5LQJA 2IY9A 3OLXA 5EJ2A 2IDJA 1Y4AE 5A3JA 3BRSA 2WMDA 2PV7A 3NBZC 1ENZA 1MTZA 1SELA 4P3KA 4U7TB 1GP2A 2Z6AA 1POXA 3PUJA 1DFGA 4JLNA 3L46A 4G09A 1Z83A 3V1YA 4TV9B 2BE7A 2UDPA 4RA9B 3ILHA 5EJ9A 1QRSA 1NUHA 3LHDA 3PSHA 3TE7A 4U4AA 1FE8A 3D4LA 1G3MA 2BKVA 4KU4A 3R3ZA 4MB0A 2MYTA 4HTFB 4A03A 3TFWA 2X4DA 4PFJA 6GPBA 4Z4GA 4B3SB 1U8UA 1CERA 3HL4A 3RS8A 1KEVA 1QIMA 3PQDA 3MWYW 5LZ7A 1WOYA 4OREX 1I7QB 3OESA 3QWIA 4H08A 4ITRC 4GC5A 3ZWNA 2JCSA 3DOHA 4RGYA 2BRUA 1DWOA 4MP6A 5FOQA 1AKWA 1HLDA 2XE7A 1UM8A 1VCIA 1HDOA 4V38A 1V2HE 4HNAB 1IWPB 3AFHA 3TZQA 3WK7A 1J99A 1MDBA 1E6LA 4NMWA 1IZ8A 2ZVDA 3TZEA 2NTJA 3GFOA 2MOKA 1VXRA 2F2TA 4EJ0A 1YRLA 1ZHOA 1I5RA 2D13A 2JI6A 2AYZA 2DFPA 3LIIA 1JEYA 2J0SA 4QBTA 1W88A 2CDAA 1N25A 4XIFA 4DL9A 1AUVA 1DX6A 3GLSA 3RVRA 1QLJA 1B74A 3IELA 1H1LA 1UH5A 1X94A 2NIPA 3GPCA 2J8ZA 3AG5A 3I5AA 4ND3A 4QL3A 4ZO8A 1Y3DE 4PC2A 1TUIA 4X3PA 3SR3A 2AQ8A 2IC5A 1J06A 3I8SA 1YBAA 2DYKA 1P45A 2FGJA 2P9JA 1B0AA 1B0ZA 1W2GA 2ZJ3A 5GP1A 3P0FA 2PZJA 4EQZA 1G63A 3WGJA 4ARSA 2I6GA 4P83A 4X7BA 1JDJA 1Y98A 3UAXA 5KYGA 3HNRA 4GLBA 4AJJA 5KJ6A 1IU9A 3KOOA 4JC0A 2F1JA 2GN1A 1GNTA 2V59A 3IKLA 2GESA 2Y93A 4HN2A 4CG1A 4KRXA 4YYZA 1VP9A 2DHQA 4H3HB 1CRZA 2XZOA 1IOLA 1RM3A 3U3JA 1G4UR 3PTAA 4LNUB 3RS9A 2R4QA 4FEGA 3SC4A 4DQLA 2C04A 1JWAB 2EFCB 1XWWA 3IP3A 4AY3A 4X6XA 5FQNA 3TAUA 4O5OA 1H4VB 1U1CA 1SC3A 5FXMA 1R9NA 1KI2A 2O2YA 2CLKB 3E03A 2FQ1A 1G9TA 1ZUWA 2IYXA 2PT7A 3M7IA 4PO3X 4RNCA 1XT6A 4A0QA 3GPLA 3HXQA 1XMXA 4DQXA 4U8HA 1PZXA 1NDHA 4V2IA 1JKJA 1GU1A 1JA1A 4R9SA 1T5TA 3W2GA 2TYSB 4LC1A 1PGQA 4JYAB 2OGTA 5I48A 2V65A 2OKGA 2VRWA 2KLHA 2HOQA 2ZYSA 1ONSA 2ZUVA 3VUFA 4C3UA 5ELLA 2HZBA 5HM8A 4H60A 3QEMB 1N8KA 1Z2DA 2YR0A 4MAFA 1J21A 3AX6A 3FKSA 3JWJA 2IIPA 4TXMA 5J2TB 1YZYA 2G83A 2QD4A 3T1HB 1SY7A 1GKKA 1G21E 2VJPA 2WJGA 1OI3A 3G1UA 3WYFA 5LP6A 4Q9DA 5FBQB 1IRIA 5LDDC 4NENB 1NX6A 2GCEA 2H11A 4RH1A 3D0KA 4F96A 1VG0B 1Z4LA 2PFSA 2YHSA 3MTBA 4M88A 2AG5A 2VNHA 1V8FA 2C2KA 3IB6A 2PUCA 3UQZA 2VSFA 2DFLA 4UMDA 1RBYA 3AB7A 2YIJA 1XD2B 3KE9A 1L7NA 2BFPA 1Y7IA 3I2IA 3WK6A 1N9ZA 1C5KA 1K86A 2I6FA 2PH7A 3ZE0B 4AD8A 5KTTA 4YP7A 1ILWA 4WW0A 4CUZA 2QQFA 2I4MA 1GV1A 1XTJA 1R74A 3JQ6A 5IBRA 3V2GA 2WB4A 3LWDA 5I8ZA 4N01A 4R2WA 1CRLA 1EM6A 4RTQA 5JANA 2R84A 4Q5IA 4FNMA 5K3AA 3DKRA 2DHCA 3UATA 3L1IA 4ICIA 1MHPA 5JYDA 2GPWA 2RBGA 4QNNA 3LRPA 2IZ6A 2C2WA 5G1NA 3SOPA 3KKNA 1ZIPA 3I2YX 1BE8A 5D6NA 3TDKA 1QH1B 1C3OA 2IIBA 2ZIXA 3D7RA 4FNOA 3SSOA 4BEBA 3SYLA 1B2LA 2VWHA 4AICA 5CXUA 3W7AA 2XNHA 3NV7A 5HRCA 4UBLA 4Z2YA 3ZUPA 4WVLA 3ZC3A 2VCYA 3K6KA 1V5WA 5EJ8A 2HMYB 3D3KA 4AZTA 2NTEA 4MV3A 3M2PA 4LJ9A 5ALEA 4CTKA 3PNVA 3QFHA 2QRVB 4V0ME 4N6GA 3OC0A 3CNQS 5EN4A 2W2TA 3V4VB 3ZHTA 1PJ3A 4KGZA 1TJYA 4EG1A 1HL7A 1P0PA 3QVOA 1AKEA 4L8FA 3I4FA 3JQAA 2COUA 2G71A 2H92A 3RIMA 3WXBA 2ODWA 2PLFA 5BVGA 1XZFA 5TPZD 4RXUA 1OT3A 4EW1A 1T2EA 1NBIA 3NFRA 4GH5A 4OSEA 3R7AA 1FF9A 1HYGA 3SIRA 3ZV7A 1GPWB 5AVQA 3WFJA 2OHGA 2HR1A 1ULHA 3ZTTA 2J67A 1SC4A 3O1JC 4Q9AA 1UODA 3PC4A 4U9IS 5A5VA 1G60A 2IBTA 3KQOA 1M2VB 2HWYA 4V0KA 3U48A 1UIRA 2D8AA 1KO8A 2J3IA 1ODLA 2GEJA 2WFAA 2Y1GA 3CVJA 3LL7A 3P71T 4RL6A 3VOSA 2ZRJA 5KTNA 4HB3A 1W29A 2ECOA 4IEEA 5KVCA 5E6UA 1VYHA 1EFRD 3NU1A 2AJ8A 2Q5FA 1A9QA 3AEUA 3GDWA 1QIEA 1YRAA 4YB8A 5AXAA 5KTMA 3C7CB 4GEGA 4EAAA 4CBVA 3HXTA 4E5DA 3BSYA 4L8VA 2QE7A 3S2UA 3RODA 1PSZA 2DCUA 4DSZA 2H2WA 2HYIC 3O4JA 2YXBA 4YT2A 3QE9Y 2CHGA 2I1WA 2Q9BA 3A27A 4LF4B 1ZN9A 1IUPA 1FU7A 4EFNA 3L05A 4A8PA 2GM4A 1JDBC 4I1SA 3EXAA 4PR0A 1CQZA 2YX1A 3FTNA 3RBVA 3MRTA 2QVLA 4XUGB 4C4ZA 1QANA 5J2UF 4IAOA 3MFYA 5BQ3A 4N7RA 3PITA 5EQJB 1TX4B 3C4VA 5JD6A 4BUCA 2PRIA 1X8KA 4TSRA 5ALVA 4MI9A 5T41A 1IUKA 1E2KA 3DV9A 4G37A 2AMJA 3BE6A 3C8HA 5LNK1 4RA9A 2PU5A 3PVCA 4Q4LA 4R1PA 4GDMA 1OLOA 1GADO 4CF3A 2RHCA 4JBIA 1PD0A 2VDWB 1MRSA 2W2NA 4KNYA 1X9HA 4EDFA 4Q00A 5KSWB 2CYCA 3GAZA 5CW1A 4W5RA 3PGLA 3WYCA 4F4FA 1HTBA 3FSJX 4KE9A 4ZIRA 3U16A 4JI7B 1XAJA 3CLTC 3W5VA 1YMVA 4CF4A 3Q0TA 3F4LA 1NW8A 1JLHA 3LKVA 3R6DA 2PSEA 2EXXA 4CLOA 1CR4A 1COWA 3EAFA 4Z9AA 5DYYA 3DOEA 2VUTA 2E87A 3DUWA 1QKJA 2FN3A 2PS9A 2ZIZA 4OMCA 1HKHA 3F9RA 3RQIA 1EWKA 4UZEA 4O2AF 3D8NA 4MR7B 4CXMA 1Q7RA 2O2DA 1GA6A 4XUCA 3RHFA 3UBTA 2H9IA 3ANTA 4HQNA 3T3HA 4KV9A 3TSOA 4MSUA 5EHGA 2YRFA 3QSYA 1U2QA 1QP0A 4B8ZA 2XLBA 2ZPTX 1R5OA 1DCFA 3IPCA 1JSRA 4ZCRA 1B3BA 3BJMA 3UUFA 3IERA 1C9EA 1XTIA 3W0LB 4XIGS 1X80B 3UJ6A 3DFKA 4J7XA 4WZAB 1V1RA 1ZU4A 3A11A 3IOBA 1ENYA 2BKEA 3R3VA 4YRDA 2L42A 2G67A 2IXDA 3DFFA 3FJYA 3BBLA 3V97A 1GTSA 3INNA 4KDRA 3LC1O 1J42A 1I33A 3EQ2A 3FVQA 1KSFX 3UN1A 2J3EA 2ZUDA 4RK6A 3ZR4B 3B60A 3GVHA 3S1AB 4CLHA 2BEJA 3K4QA 2QBYA 1D2CA 4KE6A 3JZMA 3ZH2A 5A7GA 5T4EA 3K9LA 1RPNA 2P5TB 5AK0A 2XDQB 4MVJM 1A5TA 2PJUA 2NYVA 5BV8A 4G26A 3CN9A 3EGCA 2CNWA 5K0BA 1J09A 3T3EA 4BDTA 1BFDA 3B6EA 3G0HA 5AW3A 3NEAA 4NBUA 4GXTA 4LFCB 4O4JA 1CSEE 3WV5A 1P5HA 3NH6A 1OHHA 1XI2A 3DAGA 4HBGA 4YRIA 4JBLA 4D45A 2A0XA 4LWQA 1ZH0A 4EO7A 1FUEA 3LHFA 2YJTD 3T3IA 1TYCA 5JQWA 4KAXA 1MVOA 1U0HC 2WE8A 4IDBA 1XKXA 1YU6A 4H15A 3HADA 5FP0A 5FX2A 4A8JB 3FDZA 3TINA 4CZ2A 2NYUA 1XTSA 1SQSA 2Q5CA 5E6RA 2XAAA 1WHTA 1X2BA 2HLDD 2HXYA 2WQ6A 2W2KA 2WD8A 1RVDA 1MVNA 4YECA 5IJAA 4FYPA 5IU6A 3F47A 1EU1A 2WD7A 4PX5A 5EXSA 4RJ2A 3GWGA 3OTQA 1U9ZA 3RANA 4XDYA 3SK0A 1TVEA 3THYB 1WMEA 3K8OE 1ZH4A 4G1BA 4G89A 4NENA 2FZGA 4M4SA 4URYR 5B6IA 4RM3A 1UPUA 2BF7A 3U7EB 4BUZA 5EJ7A 1EUQA 3HVIA 1XN1A 3HVJA 2IHTA 4L0MA 1AIPA 1P1KA 2JAQA 4QM7A 3FPHA 4CG3A 4ZHQA 1QZUA 4QQFA 1CR2A 1LQUA 1I2ZA 5DKFA 5JWHA 3RVJA 3FCAA 1XD2A 2C2GA 4WADA 1GO2A 4KTVE 1GAXA 3L4EA 3PT9A 5FA5A 4Z1MD 5K99A 5LLTA 4FLEA 5B53A 1F38A 1XXHE 1C1XB 4FX5A 5AVWA 1E89A 3K6RA 2XYQA 3WIEA 2XUOA 4PAGA 4O3FA 4XD2A 4CLRA 2FLWA 2P2ZA 1P1FA 4X41A 1BDJA 3HKBB 3HN7A 4G4IA 1KZ9A 2QB5A 1PKEA 1WQ1R 1IN8A 1ZJ4A 4LRSB 1VJ1A 3D9QX 2DGDA 2Q5JA 3Q7SA 5IVPA 1KC3A 4L6IA 1VJGA 2QUIA 1K27A 3F78A 4XB1A 1AQ6A 2IV7A 3ELWA 1I4LD 1V47A 2GKSA 1M2GA 2CLIB 2I55A 4PRYA 1NI4B 1JYFA 1PFWA 3G68A 3PIRA 2Z09A 5U4XA 4FR5A 1JLSA 2GBLA 3IDFA 4DLWA 4IXNA 1VL5A 2X8LA 4MW9A 4Y6GB 2HSWA 3VKGA 2CFRA 2QUZA 3BAFA 1WXXA 4CKCA 1IEXA 1W87A 2RGYA 3AHEA 3GC6A 5KJFA 4HGOA 3LT2A 4IUBS 1PNVA 5J2UB 3TJZA 2GVDC 4K6FA 1FTYA 2BEWB 2O52A 5KYXB 1PJQA 1TTTA 3RYCB 4PO8A 4F3NA 4N6NA 3GDGA 1F2VA 3GRVA 3PUYA 4B3DA 3QI7A 4QHTA 4LGVA 1YRWA 1MJHA 4ZEMA 3A32A 3GDHA 1MJNA 1Z34A 3QXGA 3T15A 3DZIA 4OXYA 3ROZA 2ZS7A 5KOJA 3OA2A 5HMMA 1U2GA 1HT0A 1U3DA 4AKSA 1I7SB 4US0R 2R5NA 3T54A 3I4LA 3W8FA 4GI7A 2FJPA 4BB5A 2GEBA 1HQDA 2ZJ8A 3FF1A 4FCWA 4ZVSA 4CEHB 3R40A 3H1FA 2C4NA 4BN5A 3AINA 3DWGA 1M83A 1Z25A 1N8TA 1BX3A 5JD3A 3GH1A 3RC3A 3SZ3A 3WWPA 4DZZA 2ZRIA 1Y8ZA 4FQ8A 3G0GA 3RC8A 5HF6A 2FVYA 3UB2A 2QV7A 3ZNNA 1S1CA 4O2AB 3KQNA 4W63A 2GCIA 1JECA 3L7MA 4DLNA 4DIEA 4GR5A 2Q41A 3AIKA 1KORA 1TMOA 2WDZA 4DG8A 2ZJ0A 3AESB 2IQ5A 3I9V6 1AS3A 2PS0A 1IN7A 4QU9A 3AL0C 4EATA 5JDIA 3IEIA 4JJ7A 2AMLA 4FJ1A 5KHOC 4KFUA 1ENOA 4RC9A 1VIAA 4IDFA 4AAYA 2RC5A 2NO9A 5A4FS 2VHJA 3GXBA 4XIIA 3GEBA 5JALA 5LVAA 5F4ZA 4F71A 1RXYA 1W4CA 2BZSA 2PX2A 1SXGA 3U7QB 3VR0A 4LYHA 1ACLA 4RWZA 2R4UA 3AUXA 2RHRA 4FOOA 5I01A 1CC1S 3UO8B 2HSJA 4U2GA 4JEMA 3I9LA 4BBPA 5HK8A 3ZE1B 1GKIA 3T1NA 2HZ7A 1UMDB 4MEJA 5FR1A 4ROSA 5C32A 5M5BA 3UAZA 1B00A 2A9RA 4XQ9A 3RVMA 3SSAA 1H0KA 5CYPA 1RHRA 2VAWA 2ZIVB 2ZRKA 3BXXA 3NC1C 3QF7A 4I08A 4NYIR 4PANA 5M7EA 1D07A 2KE5A 1ZAKA 2YHAA 2P6PA 4I14A 3GMDA 3LUAA 2JI7A 3FTFA 3EZ9A 2NO5A 3SKVA 2HHLA 2G9RA 2OR3A 1W8IA 1U7HA 3INGA 1P1RA 2X7XA 4PLVA 4E5UA 1FDWA 3K20A 4MR7A 5JCXA 9ABPA 1DJOA 1E1RA 3F8WA 2A1TR 5BWOA 2IP1A 2H31A 2XYGA 1NFRA 1S4QA 2F9LA 3ETLA 3IA7A 5J5VA 4L28A 5T3YA 1FP1D 2X0IA 1R0XA 5CVJA 3ROFA 4K26A 4DVJA 8OHMA 3RK1A 1WDLA 4QEDA 4W82A 4MW1A 3E9CA 2OHHA 3IBGA 3MSXA 3VISA 4OYLA 1OFHA 1IHUA 4U2KA 4XR4A 4AN0A 1JR3E 3FKQA 2O1EA 3MCWA 5AW1A 3RFUA 2Y1LA 2HHJA 4I1RA 5COBA 3KYJB 4CLDA 4P5DA 5I7FA 4EARA 3KQQA 5JY6A 3LQ1A 1KH3A 1E1QA 1HNXB 1H3FA 1XAIA 3MERA 3L0SA 3QWBA 2GARA 4YDSA 2ZZKA 1BYUA 2E89A 4LISA 4YRNA 1MH1A 5L3SB 3MAJA 5JZOA 4PNZA 3G9UA 3SR4A 3GARA 3QFSA 1E3JA 1FTNA 1HR0B 2FI1A 3IAS6 3MIZA 3NXKA 1HEYA 4MJ3A 5D51S 2HIGA 4QX6A 4DTIA 4LS3A 2EOAA 3L6UA 4DWJA 2ODTX 4EA6A 4ZGBA 1R0CA 3TGLA 4QPJC 1MGPA 3HQ4O 4YCSA 4RPGA 3NHWA 3W5CA 3HXOA 1UQUA 1AS2A 4R8MA 4Q93A 3E3AA 3RK4A 4TMTA 1L5YA 3HV0A 2L19A 2Z6VA 3OY7A 3UJHA 3IHKA 1V8OA 1ZGCA 4GP9A 4A8JA 1JIXA 5JS1A 2BN4A 3O8OA 1U4OA 3QMPA 5CHEA 4B8YA 3HCRA 4Z4EA 1Y8QB 3I09A 3DWFA 2QUKA 3E18A 5FF9A 4ERXA 2H3EA 3QXHA 1HQKA 5DM4A 3R7DA 1C3EA 1D4FA 4C0BA 2J0UA 4CW7A 1E2JA 2WMYA 4KXWA 3I01A 5FBHA 1AY0A 4YAGA 1EK1A 5JSUA 2H8GA 4PYQA 1CY1A 4NBTA 3O31A 3F6PA 1PTJC 1TJPB 1Y9EA 4HLUA 3WJ7A 5LOVF 3QZUA 4NWIA 1PD1A 5G53C 1CCWA 3LQ4A 2A2ZA 4E5MA 3COJA 3GLGA 1RHJA 4K0RA 4UKDA 1HDEA 2EKBA 2GBFA 2YYAA 4N6OA 4OH1A 5JAQA 4Z9XA 5FWAA 4Q1CA 1U8FO 2FHSA 4QDTA 1IH8A 3HXMA 4GKAA 3QEOA 1K9SA 3NM6B 1E6CA 2G7MC 2VAXA 1NXSA 1Y6RA 2JFXA 4FEEA 4YJGB 2C3UA 4UTVA 4B47A 4TSFA 3TB6A 2UZAA 4OL9A 2H1WA 4J49A 1FS4A 3A04A 4H77A 4MYUA 3IKTA 1ISJA 1Q50A 3HH8A 1ORHA 1T4BA 3KJIA 3OQPA 3PD0A 1GITA 2ZRGA 3FBTA 3D6UA 1ND5A 3HCNA 2O8DA 3WSWA 1WXQA 4D8TA 1L7EA 2FQWA 3OT1B 4H6XA 2XUZA 3HKBA 4E1VA 4OHYA 3IQIX 1EA5A 5EYPB 2HWKA 1QDEA 3CR7A 3IAM6 1CE8A 4MYTA 3DH0A 5CNJA 3UKOA 1W52X 1YZVA 1FUYB 3VC1A 1VJDA 1YTUA 1ML4A 4JB0A 4YMHA 1W2WB 1ZL2A 3ILXA 3IAXA 4TTIA 5ESWA 3ZD7A 2J9ZB 2IY8A 2B37A 3JZDA 1KAHA 1XDUA 3DDNA 3I6ZA 4M86A 3S55A 2BHSA 1JBQA 1JPJA 4GZLA 1XP8A 4KXLA 4GRDA 4E14A 3H9GA 4A1FA 1V16A 1QH9A 3GV0A 4P3XA 1KOGA 4FZRA 2FF7A 4Q3EA 1QNFA 3RW9A 5J2UA 3OZVA 5JSHA 5AI9A 2BEWA 5LMZA 1VIDA 5CLQA 1PGNA 1NXWA 1EP2B 1KJYA 3ZZ1A 1CS4C 1R0BA 1FDUA 4KWCA 4YS6A 3DBRB 2YV2A 4G0XA 1DI0A 2HT6A 4YR9A 2I54A 3PXEA 3FETA 1MAUA 5AW7A 1Z56C 5F21A 1JB1A 1T5HX 1KE1A 4ZOAA 2FPGA 4V3CA 3AVWA 3PFNA 3C14C 3EEIA 4R8VA 1K4KA 1THZA 3HMKA 4ZAYA 4ZC1A 1SVWA 4ESHA 1BXGB 1KXJA 2OXCA 4EHJA 1MPXA 1UEJA 3KZKA 2YIMA 1ZL0A 4UCFA 5FNVA 4L07A 5GIPE 4DWVA 2JJYA 4UVHA 1OIXA 4F4HA 9GPBA 1OR8A 1W8DA 2XNDD 1AK1A 1RHMA 1QMGA 3FGOA 1ILEA 2YASA 1YSCA 3KT8A 1M9NA 1U6IA 3I5XA 2DLCX 4GKJB 4BASA 2ET6A 2E1PA 2PL9A 3CH6A 3IILA 5AO9A 2GI4A 4ZOBA 5FOSA 4EW6A 1NT4A 1I3LA 5K3OA 3GLKA 1Y8RB 2HTFA 3PHGA 1UEXC 4RIGA 3S5JA 3KYBA 4XI9A 2EZTA 2XMCA 2JAPA 4J1TA 1GT91 5E9QA 4JN6B 1P4GA 5TRTA 3HEBA 2IYZA 3NDBB 5FO1A 1OV6A 4V03A 1SRRA 1TE2A 1KKUA 3M33A 4CNBA 1B93A 3LHSA 1NLZA 3NOXA 1GIAA 4H1WA 4B09A 3VSEA 3JQGB 3WDSA 3DF9A 4DMGA 1BE1A 4D57A 3U7QA 1GFIA 4WZZA 2JJQA 5FWYA 2A1UB 3DVRX 5I51A 1P81A 4BN4A 1JBKA 3ZDZB 2JASA 1OZGA 4LSWA 1PKXA 3T1OA 2BV3A 2O2ZA 3AU9A 1IY0A 1G5IA 2AK2A 3KKEA 1K7XB 5A1TA 2J9XB 4RK7A 1P80A 3L8YA 4DC9A 4RFVA 5AVTA 2A4MA 3K31A 4K9MA 1CY7A 3KCQA 4QU8A 4MO2A 1O5TA 1NN0A 3NHAA 1RKUA 4ZVTA 2IS2A 3A3PA 4L9AA 4OP2A 4C4TA 4TKUA 1R50A 1DG1G 2QXUA 2JH9A 3MWEA 2B0JA 3TB4A 3ZZMA 4II2A 4EB0A 3AVPA 3FR7A 1WMAA 2PWAA 2WZDA 1Z08A 1VM6A 3A7EA 2P3QA 1ARZA 4B6SA 4EPXA 3SI7A 4UUMA 4FTWA 4PBRA 1C80A 3HXKA 4AKTA 4GG1A 1EXNA 2IYTA 1MO3A 4MUMA 3SIPA 4CMAA 1G66A 4ZVOA 4JLBA 4EFKA 4PZCA 1Q0UA 3EODA 4Z9YA 4GSKA 3RAGA 3AFOA 1BKSB 3DLAA 2QW1A 1PWYE 2VK1A 4P5EA 3UKDA 3CY6A 1T9AA 2PA3A 3BRQA 4WXYB 5LOVB 1SKUA 2PJRA 1EI9A 3SY8A 1KDZA 5T57A 3FZQA 4IHKA 4YDQA 2F4VB 1DQYA 5K0NA 3T9FA 2P4UA 1N2CB 2MWMA 4XGRA 2MINB 4YCBA 5AI4A 1WHSA 3JQEA 3COPA 5ARDA 4ZI7F 4QFCA 3ICWA 1LJUA 4N3AA 2AGVA 3IV9A 2C95A 4I5EA 1N2HA 2CL0X 4GPAA 2C58A 4ZU3A 1FL9A 1PE0A 3C24A 4NS4A 1R10A 5F9MA 5L3SA 4PVCA 3AT1A 4BMXA 4B76A 1KI6B 4FYXA 4X97A 4I55A 2JLXA 5A0TA 3E9RA 1NVXQ 2HYDA 1DBPA 4WXMA 1ODCA 2X2OA 2R7KA 2X15A 2Y6VA 2YZ2A 3KQMA 3B8EA 3PRKE 4TXHA 5JXGA 1II8B 3KLNA 1TYZA 4NH0A 5SZHB 2WJ3A 5DCLA 3GLTA 1BDMA 3AZPA 1DJMA 2H06A 1OX4B 2Z2ZA 1CZKA 1QRRA 4I0WB 2X58A 4EEXA 2IODA 4D9NA 4F5WA 2X86A 1KTIA 4ARIA 5D87A 1CQXA 2PR7A 3W04A 4GEKA 1Y8QA 3MT9A 1W5EA 4NMXB 2J33A 4LPKA 1DC6A 1DRJA 2R6JA 5JSZA 2RGNA 3CR3C 2II6A 3B89A 1X92A 3BFXA 2CNNA 4IVRA 2MSWA 3NCHA 4IWNA 2R48A 1H22A 2BIFA 3WGHA 3M1YA 1H69A 1N2EA 1XCPA 3QPUA 2KI5A 4MUIA 2EKPA 3H2HA 5C0OE 1G1MA 4KQFA 4MW7A 4MMXB 3EIXA 3LNCA 4MRAA 4WNAB 3A6ZA 5DMXA 4PLCA 3CSUA 2OLJA 2WJ4A 4R6XA 3SM9A 3V4PB 3ZX5A 3LVBA 4YJ3F 5GONA 1CS0A 1BQEA 1SHJA 3AHDA 3WLTA 4ZAFA 1Q0LA 4H18A 3OCVA 1X7ZB 4LGMA 1J7KA 2A86A 2OZLB 3HUUA 2BSXA 2D4AA 4K2AA 3OQMA 2LIVA 1XA3A 2IY7A 3AHFA 2P2LA 4FOLA 4R98A 2AKEA 2B8EA 2OCPA 3DAYA 5CLLA 3TD6A 4YRGA 3RUHA 3DDUA 4CETA 2IOHA 3BJRA 1U9IA 1O94A 1US8B 1NJ2A 3THXA 1KJNA 2IEZA 3K71B 3MNFA 2HPAA 3G2QA 3OKFA 1E2PA 1WMSA 3R41A 1LDYA 1PSWA 4LHXA 1GGJA 4AP5A 3T9CA 1HV8A 2GBCA 2HBYA 3MLBA 4HLQB 4UEJA 4FNAA 3L8HA 3ND8A 4KQJA 1M66A 1OWNA 2WM9B 1ZEMA 4IIVA 5EYPA 3K16A 4W6ZA 1ZD3A 3OE5A 2GCPA 2RH8A 4D41A 2A59A 2IX9A 1GUFA 3EA5A 5HCUA 4ASUD 3X1YA 1K3UB 3GNTA 1B42A 4G1FA 4Q4AB 1UZUA 4Z4FA 1SN7A 2VDOB 4ZYZA 3SBXA 3OX3A 3AIIA 3WKCA 4HNRA 5CAEA 5K3EA 3GGOA 4F86A 3ADCA 2CVFA 1X9IA 2WFMA 4QXOA 3HB4X 4OEHA 4OQDA 5DM1A 3SX4A 3P45A 4S04A 3L4KA 3LG2A 4J0FA 1QTIA 3ZBUA 5DGCA 1NG1A 1T9HA 4RUKA 1PR3A 1RLTA 1R6AA 4OYYA 4HRXA 4E31A 2I22A 2W2XA 3D4BA 3LO5A 3B9RA 4R2LA 3WLFA 1OLSB 4MUGA 5DASA 5ECGC 4JKIA 2A0FA 1BU8A 4PCAA 5KAPA 1UBRS 2N3ZA 3EVZA 4A0SA 2MSCB 1WCYA 3KWLA 1F9EA 3BQNB 3FBGA 5KPDA 4BLQA 4ND2A 1HT2E 3E5RA 4YH1A 3GLIB 4MS3A 3MWGA 1Z0KA 4H1HA 4ON9A 4AI6A 5AUPB 1H85A 1ZM2A 1MTOA 3WQBA 4N9QA 4MIOA 2IF2A 3S27A 4EA9A 1U2GC 4XKJA 5JZ9A 2FHPA 1JA0A 4ZJYA 1IK4A 4AWXA 4OJQA 1KVUA 2X3UA 4B4WA 4FGUA 4FN4A 1BXGA 3WGUA 3FKJA 4BC0A 1FJ2A 4MQ5A 2IZZA 2VZEA 3V4FA 4DQDA 2YHIB 2EFYA 4ZOCA 4PG8A 2JA2A 4EPVA 1UXOA 4PQGA 1FRFS 1KY2A 8ABPA 4KLRA 3HLTA 4AMGA 4N8EA 2XUIA 3HUEA 3GIDA 1RPAA 2J3KA 2Y4OA 1N5JA 2YJNA 3DBVO 3QLVA 4INAA 3TIVA 1J0XO 3U3OA 5FOUA 2H0RA 4N3BA 3W1WA 5JRZA 3WYEA 5DCUA 2WEKA 5AKZA 1GAWA 4M49A 5EQDA 3L0DA 5EZYA 2O3QA 2ISQA 2QQ5A 3KPYA 2ZIAA 1XD8A 1IXSB 4HYEA 4MHTA 4NATA 3AOEC 1SBHA 4Y2YA 3OLWA 1Z5VA 3EQ7A 4CMJA 4K1XA 2H1SA 4GI2A 1EFHA 3HBJA 3P2IA 2C3OA 4BEWA 2NNLD 1ZD1A 3GPIA 3LUJA 3O4FA 4D6XA 4FP9A 5F7OA 3E23A 1F4PA 5JISA 1A97A 3EC2A 2PYIA 3MQFA 3MJCA 4L78A 2F9MA 4ZI7B 1UBGA 3O2QB 4RTNA 2ZRPA 1BJRE 1P91A 1M6NA 1QHNA 5J47A 3HRIA 1YCDA 3OJEA 4INZA 2XMDA 4EUHA 1XPRA 5DX0A 1CV2A 4GMDA 3ND6A 4ZZ3A 3TXXA 1ZN8A 3GUUA 5B1SA 3L4JA 1MO4A 2O3RA 3D4NA 4ZT7A 3H2SA 3RUCA 1TQDA 3D6FA 3CV3A 4OUDA 2FPOA 5DBIA 4GMKA 4A6XA 1E7QA 1PDWA 3AB8A 4DB2A 3SQXA 3SC6A 1L7QA 4RGVA 2X3FA 5AIAA 4PNEA 5AVUA 1SCDA 4Z9BA 1VGQA 1NVAA 1R6TA 3OZWA 4ZANA 2ZAOA 1BCSA 3NHPA 1E3WB 4NPCA 1QE3A 1RRMA 1NBOA 1Q16A 2ZBDA 3GCWA 4IKOA 3IXMA 4JP2A 4UNSA 3JW8A 1G4AE 1NGSA 1SD2A 2GNOA 4UUNA 2FAXA 4AM8A 1AQIA 3FYSA 3P8ZA 1B6TA 4P4GA 4QELA 3T7AA 3QKRB 4XR9A 5EWLA 5EIOA 1V3TA 3A05A 4MW0A 1M1XB 2VXCA 1BOOA 1UADA 3COZA 3CW2A 4HDKB 2HHHB 2FG6C 3WDLA 7GPBA 1U99A 2J7PD 5LIRA 1G8JA 4Q21A 1Q0SA 2QVGA 3AILA 5TS2A 3REFA 1II0A 5FTKA 1WKBA 2C3YA 2HGSA 3H4VA 4GSYA 4OXQA 4JLDA 4RKQA 1O9HA 3MB5A 1OSNA 2WIJA 3T94A 3QKTA 5FBZA 5BSMA 4YJ3B 5JAPA 2PIAA 5AK3A 3SJBA 4KQIA 1SD1A 2IKQA 2MINA 4LQCA 4Q1FA 1SVUA 3WGVA 1ZNYA 4GBMA 4OATA 1TCBA 1GU0A 4CCYB 2R6FA 2FKNA 3OIVA 2B4RO 4Y7DA 1Q77A 2YVQA 3SHQA 1WV0A 4FFWA 3DMTC 4MOWA 4UNQA 1GPDG 3E7PA 2Y92A 3ENZA 3FHOA 2CD7A 3SZGA 1N0WA 1NW6A 4OXXA 3T4EA 2HJGA 4K86A 5BQOA 1O58A 1UKZA 2FEXA 3ESAA 4LJLA 1W93A 4ZYYA 2ECKA 4G36A 1TKCA 1CRQA 1KQNA 2G76A 1J8DA 2OP0A 2WNIA 2FQXA 1GXSB 1PYDA 1Y7HA 2I2DA 1QO0D 1YVPA 4I4TF 4JI8B 4F3YA 1A88A 1X14A 3WLHA 2P11A 3FA2A 3F8SA 3IJ5A 3P0EA 3BZUA 5JROA 4W5OA 4M9RA 3N39C 1TVKB 2HREA 5EPEA 1DFHA 3QVTA 4LGYA 5CH5A 4WJKB 5EQTA 3VNVA 1E0AA 3K92A 4KL8S 3RLIA 4DKXA 2R7AA 3LGAA 1UL1X 2HRZA 2XQGA 4QOIA 4WCFB 4PTZA 5WRFA 5DJ5A 1UZLA 3WP0A 4BEJA 7MDHA 2H5IA 3EMVA 1F20A 1R0RE 1F4VA 1I80A 1N5LA 1OYVA 1JE0A 3O3MB 3V8BA 4C7XA 2I1LA 1SKQA 4QUDA 1A9SA 3I0NA 4N49A 2RGUA 4S12A 4BV8A 3TX2A 4RMJA 5CEFA 1X7ZA 3JD2A 2XBUA 1CUVA 3VTKA 1M34B 4DE5A 4L4UA 1NBHA 3BA1A 3BWBA 2PHZA 4ZEXA 2LCQA 2XBLA 3BFVA 4WUTA 3SYMA 3ZD8A 1ZOIA 3ITNA 2R2GA 1TZKA 4LXHA 4LZJA 5JLAA 3RYTC 3U5TA 5HS6A 3DZFA 1RM5A 2BR5A 3MTGA 3B85A 4QWWA 1I4DD 4G0OA 3DR3A 2QPTA 2PMKA 1K08A 3K1AA 4OH7A 1KDTA 2E3JA 5KKAA 4B7XA 1Z2NX 5FJJA 3V8PA 4QJ3A 2ZVPX 3ICPA 1P7CA 4GLJA 2EDCA 2FW8A 3I01M 4OM7A 2RH9B 4RF5A 4JBNA 4L2IB 2V7UA 1QX3A 1V37A 1Y8AA 2QYSA 1H0RA 1MEOA 3LW7A 2P2DA 2W2LA 3HZRA 4IMIB 4MQEB 3DV2A 5DGXA 4MAAA 4E1BA 3GLVA 1GTJ1 4NMHA 1NC1A 1WR8A 2XRFA 4FCTA 1E4OA 4Q4AA 3U49A 1ZZEA 1BA3A 4J3FA 4AULA 3AF4A 3IALA 4PU0A 1OD6A 3KUDA 1GPH1 1DWQA 2NTVA 4XVCA 1KNQA 2A0WA 3GUCA 3DOFA 2MYUA 3OOSA 2H57A 3S8MA 621PA 4D6PA 5J3JA 1NATA 1A2QA 3OTOB 1TLTA 4Y2UA 1JR6A 3UT6A 3ENNA 4PCLA 1YH3A 3RS2A 1VLMA 2Q4EA 3VOTA 1CWUA 1FXSA 2EHDA 1E9RA 1RLIA 3DVLA 3UMFA 1ISIA 4JAVC 4K03A 2LWIA 3BD7A 1GTZA 4Y9UA 1QQTA 1LJ8A 4ZVKA 5K1ZA 3VJMA 3FWZA 4D81A 5IK2D 1N3YA 2E21A 1IN1A 4KAAA 4FYYA 5FL3A 5AYVA 3A31A 2OEPA 1SHZA 4GR9A 3MRVA 2BR4A 3G9XA 4JOCA 3KLPX 4U00A 1XNQB 4F21A 1NQUA 3OT5A 4FFOA 1JFSA 1ZD4A 2LV8A 4OQZA 4NG5A 2WAOA 4A36A 2RI6A 1SG9A 3Q2KA 3PL1A 1C9YA 1Z5UA 2RK4A 2Y68A 5A0FA 2EWVA 1X1CA 4WLEA 4DCJA 1UK8A 1IQ0A 1KGDA 4BRWA 2QOEA 3ECCA 4LCJA 3V48A 4F12A 2NU8B 2YHIA 1TAQA 4NNPA 4ALMA 1MU0A 2B4YA 1D6JA 1W0JA 1XPOA 4QOFA 4UAJA 2GAAA 3KSZO 2OBMA 5KQRA 2PUEA 3G49A 1ZUIA 3LK7A 5J9FA 5D00A 3EY9A 4HAUA 1O6GA 2BSAA 2GPYA 1DLJA 4ARCA 3VXKA 1JI3A 2H65A 3C3JA 4N5IX 3BWXA 5CNIA 4LF9B 1UWLA 3RSCA 1HOXA 3BZWA 4S1TA 1G8AA 3W2FA 3CH4B 3DKKA 4B40A 2Q50A 3D5QA 2HU2A 3GOQA 4FLMA 4NH4A 1XZIA 5BSRA 4CIDA 4QFMA 1E5LA 2BI7A 2GSWA 4D4JA 1ZVKA 1RWNA 1FW6A 1EUDB 1M2JA 1YQXA 3RVSA 1J4AA 4ENSA 1KTVA 3DHWC 3THWB 4MPTA 3LCRA 5A5FA 1LPSA 4AJPA 4HBZA 1ZNWA 4ZI7A 4UM9D 2J9FB 1G9XA 5HZKA 2K2QB 3KKQA 1EQ2A 1FC0A 2GDZA 2ONKA 3HXLA 3ODPA 4FX2A 2YYYA 4RENA 5EGSA 5K03A 4MGEA 4NBVA 3B3FA 2WYVA 5A71A 4ACAA 2CUZA 1ANKA 4NE2A 3FXAA 5K3BA 3EEOA 1KSHA 1RU3A 1XEFA 3B1KA 1QK3A 4CT4B 3K9FC 4NE7A 3QOXA 3QTTA 4QGSA 4TVSA 3ACCA 4IO0A 2UUAB 1C9DB 2Z3ZA 4QHYA 4CKWB 3EJWA 3WNQA 4D3DA 4G0ZA 1WXHA 1BEEA 1CR0A 3QH4A 4G07A 4RTSA 3D6TB 1S3GA 1K06A 4I4TB 1KAGA 3GLQA 3VR6D 1QKKA 2QG4A 2R00C 4IY1A 3UOGA 4E5KA 1H2EA 1ND6A 2E49A 5LB2A 3DVAB 4GC9A 3S1LA 1FTQA 1E2QA 4BJ1A 3OOHA 4RDCA 4BZQA 5HF5A 1OH8A 3N2EA 3PXCX 3QKRA 4RGQA 1ZIDA 3NWJA 1PGJA 3P9ZA 5EPOA 2QAIA 1C4XA 3NXSA 2V1XA 4HDKA 4E7PA 1CEEA 2FSGA 3O74A 4RHYA 3ORYA 3P4UA 1RWQA 1JQ3A 1WUKS 3PUKA 1GUBA 1T36B 2YDXA 2BYTA 4DRYA 5BVHB 5KIAA 2G4CA 1EG7A 1HDXA 3IVRA 2ST1A 1PF7E 3OPNA 4ZALA 1QF9A 3KEFA 4KPEC 4LVNA 4NESA 1FP4A 4DYHA 1DADA 2QPAA 4Z8YA 3A1TA 4YJ3A 1ACJA 2VBFA 3V46A 4RTKA 4MCHA 2JD2A 1Q6ZA 3HDGA 3PQ4A 1UC5B 4HEQA 3T7RA 4MS1A 5AI5A 4HZUA 4LJKA 2IYOA 2J3JA 1R8XA 4DLAA 1T5BA 1Z3CA 1J97A 3NRJA 4O3MA 1KZ7B 2WTUA 1J0AA 1V1MB 1F14A 3ES9A 4FZ3A 2EZ9A 4YJHB 2KSQA 5TGTA 1FQWA 3EG9B 2EIXA 3CCCA 1B23P 2DSNA 4WZBB 3BL8A 2A9PA 2HV9A 1CUUA 3K32A 3HGQA 3KNZA 2IV2X 1YA8A 2I8AA 4E88A 1AM4D 3P96A 1J07A 1Y5MA 2GJKA 5ECWA 3R6TA 3A1DA 1O3YA 1AUQA 1PBNA 2EBFX 4XLTA 4TRRA 1GV0A 2QJFA 3NBYC 5FTWA 4B7CA 4DA4A 2GPBA 3F9CA 3E9NA 5EUMA 5LC1A 5KDOA 4W4TA 4YACA 3OUUA 1VDMA 2VF2A 2CHQA 3VU8A 2HMVA 4JDPA 1TVKA 1V11B 3SF0A 2C1ZA 2R751 1D8AA 1NM5C 3BE5A 4XLLA 3NV9A 2IJGX 2PCJA 4WCFA 2PXAA 4F93B 2AQIA 2WUEA 2YJ5A 2OHFA 3LV8A 5LWHA 3CW9A 3H8SA 2H4WA 3ZY3A 4PVDA 5CTAA 5H3CA 4YTEA 1ESEA 3RBXA 1EZ4A 1QK4A 2ZFUA 1ZI9A 3LHKA 4PN7A 4I8IA 1JJFA 2XWQA 3HB7A 3HLKA 3LY8A 1PS9A 1QBKC 2D3TA 4HAWA 2X14A 4LOIA 3X0DA 1I7DA 2V7GA 3V9PA 4DG5A 3N3BC 2ZKIA 4ZOLF 2P8JA 2Q3HA 4G0VA 1M5RA 1H23A 1TYAE 1JEDA 2DTEA 4F46A 1EDBA 2AFIE 2C0CA 2MSLA 2YTZA 3GT3A 3IMKA 3DYIA 4BLOA 3QEAZ 4B44A 4TN5A 4AIIA 2IOFK 3GX1A 4JFAA 3VZPA 1E4YA 4WNYA 4B34A 4LV5B 3OE7A 4O2LA 1R8YA 4DA8A 4CM8A 3N2NA 5BN4A 4IJKA 3WQRA 4NKRA 1YUBA 2RAVA 4R3WA 2H2AA 1OBFO 2ZRBA 1G6KA 3WNZA 5HOQA 2OGZA 1LTHR 4EX6A 2Q49A 3OIDA 3KL2A 3RVLA 1BC5A 1EFKA 3HY3A 1JTVA 4GLFA 3QHPA 4E51A 3L7KA 4M46A 3SHOA 3P9XA 4OQEA 2GZ3A 3MTEA 4FFPA 2VP5A 2FZ4A 2PQ0A 4TM8A 5I45A 1F2TB 2L2QA 4OQ4A 4AF6A 1XZMA 4MQUA 3S7TA 1F7VA 3ADDA 4Q4JA 4JQSA 3Q3GE 4KYVA 3F46A 4B1FA 1U0GA 1HDZA 2XVYA 4YIHA 1QR6A 4EJ2A 4DADA 3PX3A 2VWQA 4KUEA 5SV2A 5CFOA 2ARKA 1S8FA 3EIQA 4L5IA 1T1SA 2G88A 2FFQA 3UA4A 3QITA 1CJUC 5KQMA 4WPGA 1Y6QA 1A71A 1ZJZA 2FOIA 3AY3A 2DPLA 2PFKA 3AR7A 3C7TA 3HGTA 2ZROA 3JXEA 1D4OA 1ZN7A 4J2HA 4U6QA 2O5RA 1ESNA 5IXYA 4TKLA 3U7FB 2OCXA 1DTEA 4L72A 4NYJR 1V96A 2HLPA 4G0NA 3AV0B 3D8HA 5I4CA 5JAHA 5CD1A 1QE5A 2LVBA 4LDRA 5E38A 1VKRA 3JRXA 4RBNA 1NNI1 3PVSA 2OYCA 5DLYA 5LQCA 2XT0A 1QDLB 4MTLA 5JEDA 1ULZA 2ODPA 4D4MA 1SXJD 3QVLA 4EVRA 2D1RA 1SZCA 3NUGA 4D2IA 3HCOA 4FR2A 2NU8A 3ZK8A 1DTWA 4DGQA 1BDBA 3L1VA 1PJLA 2DQSA 2V8BA 2ZI9A 3LO8A 3D3JA 4PG4A 2YWXA 4L16A 2X7HA 3ONDA 2PBRA 2OE2A 4IP0A 4MCIA 3C1OA 2IXGA 2ZR8A