3H12A

Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
392
structure length
392
Chain Sequence
b'SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGMKKEGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mandelate racemase
publication title Crystal structure of putative mandelate racemase from Bordetella Bronchiseptica RB50
rcsb
source organism Bordetella bronchiseptica
molecule tags Isomerase
total genus 127
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3h12A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3h12A01
4HYRA 3BSMA 5FJOA 4YWSA 3SJNA 1PDZA 1JDFA 4KWSA 4MKSA 2DW6A 3KUMA 2XH2A 2GGEA 4GGBA 3D47A 3I6TA 3PK7A 3TW9A 5FJTA 3V5FA 4H2HA 4IHCA 3T9PA 4H19A 3OP2A 1EBHA 2HNEA 4H83A 4A35A 4DHGA 3N4FA 3V4BA 3UXLA 3Q45A 4A6GA 3H70A 2PTZA 3OTRA 3TWAA 4HN8A 3IJIA 1MNSA 4J3ZA 2FYMA 2PCEA 3RO6A 2XGZA 5ENLA 2AL1A 3R1ZA 3SSZA 2PTXA 1TE6A 4GYPC 3DESA 3UJEA 1KKRA 3T6CA 3PWIA 4EWJA 3VA8A 2ZC8A 4KEMA 4ENLA 2QVHA 4Z17A 2GL5A 4GFIA 2XH4A 4E6MA 3H7VA 3DEQA 2PS2A 3GY1A 3K1GA 3I4KA 3N4EA 4KT2A 2QJJA 4Z1YA 4GMEA 3DG6A 4M6UA 3JW7A 2XH7A 3FXGA 3IK4A 3N6HA 7ENLA 3BOXA 3CT2A 3QN3A 1MDLA 2GSHA 3DG7A 4MGGA 3NZGA 3H8AA 2DW7A 2P8CA 1DTNA 1ELSA 4H1ZA 4HCHA 3V3WA 2OQYA 3RGTA 4DYEA 2AKZA 3VC5A 3ES7A 4ROPA 4GIRA 1KCZA 1PDYA 2O56A 3ZVHA 2OG9A 3DIPA 4HNCA 3UCDA 2OFJA 4ZA0A 1SJAA 3QPEA 3GO2A 3N6JA 2HZGA 2NQLA 2XSXA 1ONEA 4IL2A 1WUEA 3R0KA 1EC8A 2PP0A 2XH0A 3NXLA 1P48A 3ZLHA 2OZ8A 4HNLA 1W6TA 2P8BA 2PP3A 3H12A 1JPDX 4DWDA 4HCDA 5FJUA 4GISA 3DG3A 3JVAA 2CHRA 2OX4A 4G8TA 2OKTA 3TCSA 4E8GA 1ECQA 3ZLFA 3RCYA 4IL0A 1FHVA 1SJCA 3DGBA 3STPA 1NU5A 3CB3A 1TZZA 3VCNA 5FJPA 3SN4A 4K8GA 3FV9A 1XPYA 3R25A 3TWBA 3T4WA 3DFYA 4F4RA 3UJ2A 2PMQA 3MUCA 2PU1A 3THUA 3TJIA 4DXKA 2PSNA 3GD6A 2ONEA 2ZADA 3QTPA 2RDXA 4JN7A 3FYYA 2PGWA 2OZ3A 4IZGA 1KD0A 3PFRA 3R10A 3DFHA 2QQ6A 2FKPA 3MKCA 3TQPA 3I6EA 1TKKA 2AL2A 3CAWA 5BOEA 2OPJA 3NFUA 2GGJA 4ZCWA 4K2SA 3R11A 1YEYA 3TJ4A 3HPFA 2PU0A 5BOFA 3DDMA 5EU9A 4X2PA 3ZVHB 2PPGA 4MMWA 2I5QA 3RITA 2P0IA 2HXTA 3Q4DA 4FI4A 4IP5A 2QJNA 3MQTA 4A3RA 2QGYA 1EC7A 4J1OA 3S47A 3U4FA 1SJDA 3MSYA 3ENLA 3FJ4A 1XS2A 4KPLA 4JN8A 2QJMA 3B97A 4HCLA 2OQHA 3RRAA 1L8PA 2HXUA 3GC2A 3R0UA 4E4UA 3NO1A 1EBGA 2QDDA 5J04A 3MZNA 1F9CA 3TOYA 2P88A 4DX3A 3MY9A 3S5SA 2AKMA 2OO6A 2GDQA 2GGHA 5FJRA 4IP4A 3V5CA 1OEPA 3SBFA 3UXKA 4G7FA 3EKGA 4GYPA 3FCPA 1MDRA 3VC6A 1MUCA 2MNRA 3VDGA 1R6WA 3CYJA 2OLAA 1JPMA 1JCTA 1NELA 2P3ZA 3QLDA 3UGVA 3P0WA 1R0MA 1BKHA 3CXOA 3VFCA 6ENLA 3ES8A 4E4FA 1FHUA 3SN0A 3UCCA 3P93A 1BQGA 3DERA 3SN1A 3UJFA 2AL2B 3TTEA 3UJSA 3PWGA 4K1WA 2PODA 3QKEA 2GGIA 3SQSA 2POZA 1KKOA 5IDZA 2PTYA 3EEZA 3JZUA 3OZMA 2PGEA 3U9IA 4DN1A 4GGHA 3OPSA 2QDEA 1RVKA 1MRAA 3IJLA 1EC9A 2MUCA 4IT1A 3MWCA 4M0XA 3CK5A 4E5TA 3ZLGA 3OW1A 3ZVIA 4FP1A 3RR1A 3BJSA 2GGGA 3T8QA 2OZTA 2PA6A 1P43A 3D46A 2PTWA 3P3BA 1E9IA 1WUFA 2PP1A 1IYXA 3IJQA 3UJRA 3VCCA 1SJBA 2OVLA 4JHMA 3OZYA 3FVDA 4HPNA
chains in the Genus database with same CATH superfamily
3H21A 4H6RA 3BE7A 4MB1A 5KTLA 3CT7A 4QG8A 1E0TA 2J8FA 3BMWA 4IJBA 1NOFA 3A5FA 2V5BA 3WD4A 4AIOA 4MDPA 4C5ZA 1TTPA 3ZYZA 2HE8A 5HWNA 4A35A 3LXDA 3Q67A 2DQXA 3KCJA 5CC6A 4S3GA 2Z1BA 1AZ1A 1DXIA 1VHNA 2EPKX 1AQMA 2E6FA 1O7AA 5KZ6A 3AYRA 1U5HA 1Q6CA 3D5HA 5G2WA 2ZXBA 3QF0A 1AA1B 2QCHA 5H2ZA 1EJWC 2G95A 3VKKA 4EMWA 3TONA 3DYPA 1DBTA 4YLWA 1SW0A 2J24A 1JRCA 3UPMA 4TUFA 3SJ3A 3NL2A 2JKPA 1T6MA 5HNNA 1HO1A 1VQZA 1JCLA 3ITGA 5F2GA 2ZYFA 9RUBA 1TUXA 3PZTA 1M7JA 3W1LA 2QMJA 3XINA 1TTQA 1NP0A 3PZNA 1OFDA 1RH9A 3COTA 1ML1A 2WVTA 4GQBA 2PS2A 4X3ZA 3REQB 4H04A 1ZY9A 5J5RA 4H4WA 4J5NA 2AQVA 3AZSA 2Z6JA 1MXDA 2Y61A 1B54A 3VPLA 1LWJA 1B3ZA 3GD3A 2PUZA 3L66A 4JTGA 4IUGA 3NPUA 3M0XA 4HZMA 1YTDA 3P0XA 4HCHA 5AHIA 1KCKA 4O17A 1XX1A 2CLMA 3MCOA 4ROPA 4WF7A 1ODUA 2EQ7A 2VHLA 1RV8A 4CCDA 3CQIA 2OFJA 1FX6A 3FX4A 1AJ0A 2WMHA 3IVTA 4B5XA 4D6JA 1XLBA 3B06A 3EDJA 4ZQNA 3FDGA 3G1XA 1WUEA 2V38A 2WKLA 4AHOA 2OEJA 4QSFA 2FVLA 4J3UA 4H8HA 4QDPA 4AYGA 2AAQA 1FO4A 4HCDA 4G1KA 1EDGA 1JD7A 4E0CA 3BLOA 4GUGA 2Q6ZA 4GX8A 1NU5A 5JMUA 2H6RA 3LUTA 1XBZA 2Z28A 3AYSA 4DRSA 5GJNA 4ACZA 2ZRVA 1V02E 3PAOA 1XIFA 2VC5A 1RK5A 1LP6A 5FA5A 5FEPA 1DE5A 3THUA 4HNTA 4ZE4A 4Z08A 1E70M 3NRZB 1ME9A 2D73A 8RUCA 1DNCA 1EHAA 1EP2A 3M4HA 3AXMA 1FH9A 1W5OA 3WNNA 4DWSA 4CQBA 2PGWA 1PSCA 2CLIA 4RZ5A 2C19A 5DO8A 3PFRA 3ITCA 2YL9A 4OUEA 2QQ6A 1MZHA 1YBQB 1XYCA 4G5DA 1E0UA 4W4QA 3H55A 4MWAD 1F8IA 4O0KA 4QQ3A 4MY9A 4P7NA 4M6VA 2YW3A 4MMWA 3ZO9A 1L2UA 4IISA 3GXIA 4ZZ9A 5F4SA 3OVGA 1EKOA 2VFIA 3I3BA 3Q4DA 4US5D 2QJNA 3S2JA 5CGTA 3RO8A 2Z1WA 3S47A 3M6YA 4FMVA 1UZ1A 3I3EA 1G94A 1TJ1A 3LCIA 4GKTA 3A64A 3KL0A 4B5SA 3TA6A 1PHWA 1Q8AA 2BVTA 1E4NA 4XD6A 3UWWA 4B91A 4Q8OA 3MTWA 1SW7A 1RLCL 5CPTA 4F2BA 1E1EA 1RHCA 1J0IA 4EF9A 5IHRA 1H1NA 1KRAC 2HV5A 3GTXA 3TOYA 2P88A 4WKHA 4XZHA 1W5NA 1F6PA 3GKAA 4IOTA 2WC3A 3KP0A 3L12A 4GVHA 1NWUA 1DJNA 2XVNA 2DSWA 1SFLA 3HQ1A 4PBFA 3LYEA 3E5PA 1U1HA 4S3AA 2XHYA 2G41A 1KC7A 2UY5A 3SFWA 2C13A 1ZZMA 4GBDA 2B81A 4OOUA 6A3HA 4V33A 3KP1A 4Q8UA 2REQA 3T44A 3WQCA 4J7RA 3UZYA 4ERAA 4TX6A 2HK0A 2QAFA 4Y9AA 4JTKA 3GHUA 4GHRA 3SR7A 3JZUA 2XGBA 1TMHA 5MKGA 2EG7A 1PV8A 3L4XA 2WJEA 5H8PA 3DH7A 1L6GA 1ZALA 4MJ4A 4QG6A 3EDEA 3G1HA 5D37A 3OW1A 3RF9A 2V81A 2QMKA 1FRBA 3R13A 3B3DA 2OXNA 5CBBA 4CNUA 3M46A 1PAMA 1V8EA 5K7JA 4H4UA 1PB0A 6PTDA 1D8WA 1EIXA 4KFPA 1BGAA 4EANA 4HMCA 2R8WA 3G1SA 1HGWA 2PTWA 1QW7A 4O19A 1FWDC 8TIMA 3B8DA 1HXJA 1V79A 4LEFA 2PE4A 3PANA 4JHMA 4XD4A 1SR0A 1OYBA 5FCZA 5M17A 3RLHA 1GVYA 5IBXC 2JALA 3HGOA 4QS6A 5EMJA 4PFMA 3TSMA 3KUMA 3K4DA 3O05A 1EOMA 3GVWA 3RRXA 2Z2UA 4OE7A 2QT3A 4ERIA 3GHTA 2X0YA 1KLYA 5HINA 4H83A 4PCPA 3TIMA 4IXHA 3ZJ8A 5HNTA 2JK2A 3VNZA 1BYDA 2J79A 4HA0A 2FB2A 2X1IA 1OYAA 3NQ7A 3VOJA 3E1F1 3AIWA 2NVCA 1MYRA 3IJIA 1MNSA 4ZO8A 1E72M 1GONA 3WQ5A 2V3EA 2ACQA 1RQBA 3L4UA 3UR5A 5DT7A 1DJYA 4LCRA 4UMAA 4ZO7A 4PMRA 5E9XA 3II1A 1K6WA 1KFJA 3R1ZA 1LWIA 5IM51 4I6VA 2YR1A 2YAUA 3PBMA 3EXTA 2DEPA 2ZICA 3DESA 3Q94A 4U2ZA 1YIXA 4UB9A 1EGZA 4QAIA 4PCFA 3LPPA 5HWJA 1OX5A 1OCQA 1HX0A 5CSYA 1XIDA 2GSJA 1LOSA 3SCUA 1ICPA 3ANVA 3WBWA 4MTVA 4LV4A 4GFIA 1QI0A 1BVNP 2CBUA 2VEMA 3QV6A 4J3VA 3R89A 3NM1A 3W73A 2I5GA 3MYOA 3TMLA 4BQ5A 2J8GA 2Y88A 4TX8A 2INFA 2QJJA 3I7RA 1ZENA 1WP6A 3KOYA 4NZFA 1JYNA 4AEEA 3LGEA 3E2VA 4R34A 1MDLA 2YOCA 4IQDA 3CMJA 2C1IA 2YDQA 3S1UA 3OVQA 1CGUA 4JYEA 2W5FA 1WDSA 3B0YA 3P67A 1UWSA 3F4DA 5U1OA 1W3LA 2W3ZA 4FSAA 3W6LA 4PEEA 1H2IA 4GIRA 5HMSA 5JUVA 1S5TA 5JCMA 4KPRA 2Z26A 3GVVA 2GFTA 3S5YA 2HVMA 4Q4RA 1KNWA 1XBXA 4GRSA 4FHAA 4CNPA 2A21A 3LCFA 3GZAA 4O4VA 3N6JA 3TTSA 2FLIA 1R38A 2YYUA 3UESA 4RKAA 4QS5A 1DJGA 2CC0A 4RW5A 3U2ZA 5G5IA 5EA9A 4JY9A 1RCXB 3PF3A 2VR2A 1DHKA 3BL3A 1Y7VA 1ZKQA 1E4LA 1Q6GA 1L8NA 4G6CA 2GK1B 2OX4A 5CGQA 3TCSA 4H9TA 5LNVA 2HWGA 2QAPA 4BI7A 2V63A 1JAKA 4HZ8A 4BV6A 4MY1A 4RNJA 2QF8A 5FJPA 4YHGA 4HT3A 3BQ5A 2I17A 4YS1A 3QY6A 1PS9A 3T0CA 3I7QA 2ONEA 1NY1A 2E6YA 2VEIA 4U2YA 3VX1A 3PVFA 1P0BA 1MWOA 3CGBA 1QPQA 2IPGA 1H63A 3GDLA 3VIFA 2GUUA 1EFZA 2GYIA 3HMJG 3IGSA 1THFD 5ABEA 5I23A 2ADAA 5F7UA 1KD0A 3LERA 1X8CA 2V6AA 2VRKA 2E4TA 1DORA 2E5AA 4MIMA 3TJXA 2DP3A 2A3BA 3DHUA 2A3CA 1KTCA 7REQB 5H1WA 3R11A 2Q8LA 3FS2A 5D03A 4EAMA 5CBIA 1TQXA 3H53A 4GIAA 1AH0A 4HTYA 1O12A 1U83A 1A3WA 3P8IA 1ENUA 1E43A 4X60A 2D3NA 3AU6A 3MSYA 1A80A 3FJ4A 3SRHA 1GWJA 3REQA 3QJAA 1Z48A 2UWFA 3KX6A 3DFSA 3WELA 4MWAE 1HKWA 5I00A 1DOSA 4MYAA 1CENA 3B97A 1ZXIC 1OG0A 1TSIA 5A2BA 4HNNA 2VENA 4AEOA 2ZZ5A 4HK5A 4K8EA 1M03A 3LZ3A 2HCVA 2RUSA 4IFKA 4AZBA 3AIVA 3GHSA 1UPMB 4JTLA 2XG9A 1A3XA 3AS2A 2ACUA 1AL7A 1LWHA 5IDIA 3VAVA 3ECQA 4GI8A 1W1IE 4A3UA 3PJWA 4L65A 1P6WA 1SMAA 4LX4A 1IGSA 2G4FA 3A21A 4O57A 4IPLA 1CYGA 2D3LA 1CGVA 2MNRA 2DDXA 2Z1XA 3T1GA 4A29A 2GR0A 5JH1A 1H1YA 1N62C 4MWAB 2HRWA 3EX4A 3CXOA 3VFCA 3HN3A 1E56A 1PPIA 2WSYA 4RZ4A 1I6NA 4CD6A 1G4EA 4L4MA 1H7XA 3VTRA 3SECA 3NWRA 3WL1A 1CXLA 3QSRA 4PEKA 2TPRA 4Q7NA 3W75A 4EACA 3UJSA 2VWSA 4A3HA 5AFDA 4UR7A 1EEPA 2A3HA 4B5NA 4Y9MA 1KBBA 2BS9A 4CCZA 2GZXA 3TXZA 3LB0A 4M8UA 3EMZA 1TV5A 3U48A 2DORA 3AYTA 3NDYA 2V5JA 2VL4A 3C52A 1OJXA 4KEZA 3SIMA 3B8UA 1YMYA 1P7TB 3RR1A 3ZIZA 1CX9A 1ZNNA 3MUIA 2OZTA 1A5MC 3SUUA 4B3ZA 2QR6A 2I9EA 3EPOA 1E6ZA 5LZLA 2OEKA 4MZYA 1YBQA 3BURA 4RDWA 2YSWA 1XIHA 2YYTA 2ZC1A 2E5CA 2OR2A 1S2UA 3A4JA 3QW4B 3BH4A 3TW6A 3GG0A 4EQWA 4PUMA 3BSMA 3FW6A 1KXQA 1IXPA 2C6QA 3SFKA 1STZA 3R6IA 3AZRA 3URBA 4O1EA 5AVNA 3WMSA 4GXMA 2J75A 2D2JA 1KRMA 1U33A 4Z1DA 1TX0A 4H6KA 3AXIA 3H2AA 4ZQRA 3DENA 2YL8A 2WM1A 3Q58A 4Y6GA 3LN3A 3QOKA 1K7XA 1S3TC 4JICA 1GRFA 3VKBA 2NLYA 4KERA 1JDEA 2NUXA 3N4FA 5XINA 3NGJA 1KBJA 2NQ9A 3G8EA 5BW6A 3FEMA 3NEHA 3RUBL 3MHGA 1QBAA 4LC6A 2WVVB 3NIYA 2BOFX 3GVQA 4LFYA 2VFDA 3FJNA 3CAVA 5CZJA 1OG6A 1OGGA 5HATA 2RGMA 1L6SA 5GJMA 3LLFA 1DVJA 5GRTA 4GYPC 4DLFA 1CECA 3CB8A 1UW9A 4KKXA 3CQ0A 3VDAA 1C9DA 3T6CA 2YXXA 4I6KA 1Q7MA 3VUSA 1XG4A 2XH4A 3QSTA 1ZCOA 1R2RA 3M7WA 1EHNA 3WMLA 4TV5A 3LCLA 3ABQA 4AMAA 5I77A 2G4JA 2Y4SA 3BOXA 5D2WA 3EOOA 4GCAA 3OZPA 5T9CE 2XM2A 1DIKA 3EAOA 1IGWA 2C14A 3H4GA 1EJTC 1W37A 3PPGA 3H8AA 2QDGA 1REQB 4XD3A 2Y5SA 4HP5A 4YWIA 5C9XA 3S9IA 2AKZA 3DOPA 3VD5A 1QPKA 3WF1A 1EWDA 3GNRA 5HQEA 4L64A 2OLHA 4RW3A 1ISZA 1W9DM 4AX7A 3GHRA 4O15A 3GC5A 2A3AA 5A8NA 2HZGA 1JOAA 2C71A 3I3DA 2XSXA 3T7VA 1GOQA 3GXPA 5DMLA 2DUZA 3GH5A 3ARSA 3VGBA 5LA0A 2YCKX 3B8TA 4NF7A 4OQVA 5AVHA 5C2GA 4TTUA 1ZB5A 4ZO6A 4IF2A 2J66A 4GCXA 3II4A 2DZPA 3TFCA 1CLKA 1OT2A 4GLEA 2JEQA 1UC5A 1VBHA 3DGBA 4MAZA 4W5ZA 2BOGX 2HEJA 3BGGA 4Z2LA 3CL8A 2FZBA 4W5UA 3TH6A 1E5JA 1W91A 1B90A 4O1BA 1DJXA 3INPA 4OVXA 4WY0F 4Q4PA 4PTNA 3W0KA 1TPEA 4LF2A 4CNOA 3BAIA 4DXKA 3TE9A 3G18A 2XIMA 2XINA 5D02A 3TN5A 3Q2DA 4ILSA 2BHZA 4NZ3A 3AI0A 3AXXA 2PRMA 4U4MA 1KA9F 2UV8G 3ALGA 1X1NA 3DFHA 3H2FA 3OVRA 3MWAA 5HAOA 1RBOB 1NHSA 1W5PA 4EIVA 5SWUA 1GVIA 4M56A 1OIMA 4J9JA 1XUZA 3NVWB 1M65A 3LNMA 4LUTB 1UP3A 4H00A 4X2PA 1A50A 1PHQA 3ZVHB 5PTDA 3D3AA 4RCXA 1M9HA 3ONBA 4O18A 1I2PA 3VKDA 1WA3A 4LVAA 4NZJA 1LG1A 1HJVA 4IIHA 1EA0A 3KBMA 1Q5MA 4J1OA 4Q33A 1V3JA 1UP2A 3GX9A 1XFBA 1Q7ZA 4DI8A 3UP8A 5KZMA 4GH1A 3I10A 3MPGA 4CKQA 2PF8A 3QMTA 1KTNA 1W1A1 2BFGA 3RRAA 4EE9A 1RBAA 1HJSA 5LIKX 1E73M 4GI9A 1SSGA 3OLIA 4IG2B 2A8XA 2W54A 5HR7A 1OHLA 3WKZA 1IHIA 1Y65A 1SZNA 1F7BA 4K7YA 4DUWA 1ZP3A 3W2MA 3TYEA 4O53A 4YL2A 2BASA 1WZAA 4IFRA 5DCEA 3L0NA 3T2OA 1TV8A 3GC4A 2BBFA 2CNCA 2WMKA 4IIGA 1V7AA 1J79A 1GCYA 1ME8A 1F3PA 1MXSA 5CH9A 4UNIA 3OIHA 2NQHA 3EOEA 2R6OA 3KWXA 4FLSA 2AMXA 2X2YA 4ZR8A 4HMDA 1KM1A 1UWUA 1BXBA 3LXCA 3VGHA 1SO3A 3TC7A 1ZDLA 1R86A 2WCAA 4JDYA 4NI3A 4O52A 3LZ5A 3BAXA 3C2FA 3IVUA 1YXCA 4MPQA 1E6SM 1E9YB 2D0FA 5FF7A 3WBXA 1G6CA 3WO8A 4DBWA 4XKMA 3TC3A 4DN1A 1FWTA 2CWXA 2VUNA 3WK0A 1EQCA 4N6FA 3N2TA 4C6EA 2NW0A 2J77A 2AAAA 2WOIA 4PCTA 2ZE0A 3W26A 2BY3A 1FOBA 2WBKA 1KQZA 4LUSB 1QI4A 1VJIA 4A2RA 1F3EA 3L65A 4S3DA 1QK2A 2R1NA 2BHUA 3I6RA 2PGRA 4LYPA 3AJXA 1KB3A 3PUDA 3D46A 4L9XA 3LCWA 2FVMA 1SYTA 4NX0A 4UTFA 2PDFA 2VT0A 5A6JA 1H7RA 1UA3A 1JZ7A 3UVAA 4PMOA 4REQA 4ZB2A 7REQA 3N6QA 1EUNA 2YKKA 4P8XA 2QS8A 5HA7A 3LMYA 3LPOA 3VOIA 1FXQA 4G1NA 1JEZA 1UZHA 4JCMA 5I5RA 4D6CA 3O07A 3V75A 2GGEA 3KOXA 3LSBA 1NOWA 2P5NA 5F2MA 4JTQA 1ZJBA 1W54A 3EDFA 2FPVA 2VGBA 3IUHA 3NTYA 3VNMA 1NAL1 1H61A 4IPIA 3M43A 1VCFA 3EYPA 1YXDA 1IEVA 4YPJA 2FPTA 3UWEA 3SCTA 3EWCA 3ME3A 3RFAA 4ZOBA 1O1ZA 3S4TA 2CZEA 3NGFA 3BMXA 3UZ5A 1OK6A 5F1VA 2ZZ1A 3DFTA 3AIBA 3NUKA 4IFOA 2WM0A 5AYXA 4HQVA 2GUBA 3WLMA 4V1XA 4JOMA 3WFLA 5EMUA 4G56A 2QJGA 4Q8VA 3VZXA 3QMRA 4YVVA 1E6QM 1O4UA 3LV5A 3GG1A 3SCRA 3RMEA 2OWXA 2GLKA 3DC8A 3WDJA 2VX4A 2O7QA 3R8HA 4TR9A 4E6MA 4H8VA 1R3QA 3TAOA 1JUEA 1P1XA 2RH9A 3THAA 4XAZA 1RJPA 3T0AA 4H4VA 2G0WA 1XXXA 1R7OA 4LTSA 2D23A 1K4GA 3SADA 2XVGA 1Q45A 3NZGA 5KMYA 2DH2A 2WSRA 3PB0A 1IXQA 4UFIA 5T9BG 2H8ZA 3PZGA 4S3BA 3VGEA 3M0HA 1K8XA 3HOJA 1UD3A 3VIKA 3C5QA 1ZK7A 3C3UA 4XZBA 3NVDA 2OG9A 3LRLA 4D6IA 2O9RA 4WOQA 1TYPA 1UKSA 3O6DA 2V69A 3FFSA 4ORIA 3TFXA 3CO4A 3OBAA 1FWAC 4LUYA 3C4UA 3VGDA 1DV7A 4GD0A 3QYQA 1AMYA 1JF6A 2OZ8A 3DK4A 2X42A 1QRQA 4MM1A 2E77A 3HJZA 5BYWA 5DT5A 5D05A 1V3LA 1IIHA 3DI1A 2QNEA 1KBKA 3FSUA 3UG8A 3T4CA 3K13A 2V3GA 2EG8A 3EA3A 3W7LA 5JIPA 3EOLA 1XGDA 3A22A 4GIYA 1BFNA 4JTCA 3O63A 2G5WA 2QJHA 4M1BA 1F5ZA 3K5XA 4HMEA 3C8NA 2X1RA 3W3OA 4NX5A 2AGKA 2NPXA 1AZ2A 3W07A 1R5YA 1O5RA 2PLCA 3UY8A 1I2OA 3WMCA 2YBUA 3ITOA 4OHQA 3U2OA 5C9WA 4GUFA 1XGZA 3MCMA 3WH9A 3AMDA 5CPSA 2ISSA 3CLWA 2WVVA 3HG3A 3V36A 2JFEX 3TEVA 1I0BA 1T40A 4CN4A 1GVOA 1ICSA 1YYAA 4F66A 5H6HA 2EPHA 3UVIA 3CIWA 4ADSA 4YTSA 4GACA 2G97A 3W24A 3A7RA 2DZTA 1CLVA 5AYIA 4P7LA 1U22A 5BWFA 3ZR6A 4MG4A 2Y7FA 2BC0A 1OWQA 2EQ6A 5JRBA 3GFYA 1K3UA 2PPGA 4XK2A 2NQ5A 3TYZA 5K9XA 3LK6A 4WD0A 1HQTA 4GNKB 1Q6LA 3LM7A 4FI4A 4IP5A 4XAGA 2OSXA 3A3XA 1E1CB 4LUJA 1KGWA 1SJDA 1JI2A 1XRFA 2V2CA 1RY8A 4HSHA 1F8WA 1V6TA 1TPB1 2OLSA 4M5PA 3C86A 4WK9A 3PUGA 3B9NA 3P80A 4HCLA 4UTTA 1VLIA 2X8HA 1OZMA 2AOSA 1A5NC 1OFOA 1W1ZA 3MZNA 2QCDB 1RJRA 5D9OA 3TN6A 4XSMA 1M41A 4QDWA 4AIBA 4JY8A 1S2WA 1DEDA 2GGHA 4JTDA 4J3SA 3V5CA 4OIFA 1WDRA 3VXGA 1W3KA 3ERPA 2VFEA 3UXKA 4NT0A 2E1DA 1MNZA 2VMFA 1I4NA 1Y5XA 1SFTA 2WZTA 3NVYB 1FWFC 3CV7A 4GE8A 1J18A 1TR1A 3VM7A 4L4OA 2WV8A 5I07A 1LRNA 4FALA 1V3KA 1IZKA 4PSPA 4UQEA 3KCOA 1CGWA 4X63A 1TPWA 3PZQA 2XGIA 3GIQA 2VGGA 5MHBA 5BNKA 1GK8A 4LYKA 3UQNA 3LTSA 1KKOA 3W01A 1R3RA 2PTYA 1MEIA 5LKYA 1K8YA 1V6XA 5I7GA 1KW1A 2GJRA 1T3QC 1GNXA 3ZJ6A 1CGTA 1W3IA 1DWAM 3VIIA 4AG0A 1UR4A 1T99A 3C8FA 2YPIA 4MY8A 4YVPA 5L9FA 2IQ0A 5BXPA 5K4ZA 1DYSA 4Q22A 4KFOA 2P76A 3GM8A 3WNOA 2PA6A 3H4WA 2ZZBA 4K8HA 3GXDA 4PULA 3QM3A 1EIBA 1XKJA 4AZIA 1AVAA 4XIMA 4JQ1A 4Y7EA 4ZENA 3ICJA 1IEIA 4JBRA 5CBJA 5LGZA 3JZEA 1HKKA 1AW1A 4HPNA 3KXQA 4HYRA 1WKDA 4YWSA 2Y7EA 4DJFA 2GVLA 4H01A 1NQ6A 4TO8A 2DVTA 3I6TA 1WO2A 1XYAA 3TW9A 3DECA 3M0VA 3FLUA 3T9PA 1CBGA 3HV9A 2HNEA 2V2DA 4I3GA 1JQVA 2IXVA 3PTQA 4DHGA 1FCUA 1CB2A 1TIWA 1B3WA 1LDCA 1DPMA 3STEA 1OT1A 2X09A 4HOXA 2CESA 1KRCC 1VCVA 3G8RA 1C29A 4GUHA 3GDBA 3CGTA 5E93A 1H7WA 3EX6A 4ZOEA 2B7QA 5G5HB 4DUOA 2QAEA 1X1ZA 5LNSA 1FDYA 3W87A 4XZ9A 3VUPA 1JFXA 2BWGA 4C6DA 1G7VA 3UJEA 3ZWTA 1B5TA 4LPCA 2WLZA 4C6KA 4RE3A 1MZRA 4IIDA 2W3SA 1E71M 1ADDA 1JVNA 3TA9A 2OB3A 3EUB3 4PB3A 3O6YX 1Q6OA 5AHNA 3VMNA 1F05A 4J56A 1GTHA 5A6SA 2CZDA 1U1UA 3W7NA 1Q63A 2DV0A 2VFFA 3KL5A 3TN4A 3DHPA 3KW3A 4HB7A 3N4EA 1LCOA 2JBMA 4GMEA 5A1AA 4D8ZA 2XIBA 1UH4A 4H9MA 4V27A 5DEZA 1PX4A 3PFMA 1UYQA 4CQ8A 1HJWA 3OLEA 3POHA 4A8LA 4MGGA 7A3HA 1GJUA 5A8MA 5EGRA 4LH8A 1O5QA 1UQYA 4FX7A 2OQYA 4P8UA 1KXTA 4DYEA 1KFBA 1KM2A 3TV8A 5KSWA 3WD3A 5D2VA 3R58A 1WBHA 4JYDA 1SJAA 4FOJA 4Y8EA 4GJJA 3T2PA 1LRTA 3PZMA 3E0VA 1B3VA 5A2CA 3HQPA 1I75A 4D8AA 1GVRA 1Z89A 1ZBKA 3ZLHA 2O9OA 1XIBA 1UR9A 2DT0A 1R2TA 3H26A 1ZBWA 1A47A 4RPQA 3XISA 5EBKA 5FJUA 4PB4A 2XSBA 2V30A 1V6UA 1G7UA 3NXFA 1YPFA 2CHRA 2DT3A 3WLPA 1PCWA 3AAMA 2HVOA 3BLEA 2RFGA 1P0NA 3LHYA 3W1AA 3EB2A 1MEWA 1KQYA 3W7CA 4UQCA 3PPCA 4Y8FA 4AAJA 2ZZ6A 4MHBA 4DO7A 1UR8A 1XPGA 3B05A 3URQA 3QVQA 1CGXA 3W7OA 4GZ7A 1W1B1 3KAOA 2J88A 4GO8A 4W7WA 1TWIA 4JX4A 1BAGA 4LNCA 8XIMA 3SRDA 1M7XA 1GJWA 2PSNA 4PUDA 4MJ2A 3A4XA 3BV4A 4F79A 1S7MA 2IKIA 1Q8JA 1YTKA 2KZHA 3N25A 1UH3A 3WN6A 2X0SA 3BG9A 5E6YA 2CFFA 1O5XA 1SPQA 5C8BB 1VHCA 2ZA2A 4I9TA 2TODA 5FESA 4WXZA 3T09A 1PIIA 3IV3A 4K7VA 4DWSD 4DY1A 3C2EA 1EP3A 2PDUA 4BURA 3R07C 4GK8A 3S46A 4C6QA 1NWSA 4BK9A 2GDUA 2VELA 4O1CA 4X0VA 1RM6B 3TTOA 4JTEA 2EPOA 2D2HA 2XN0A 4CGTA 2XVKA 1N55A 4PTXA 3U4FA 4E2OA 1LUCB 2FDSA 1XGEA 2R1PA 4LS0A 2BZNA 3IIXA 2VEGA 1XR2A 4F0KA 4HD5A 1N8IA 1H7OA 4F9JA 5IOBA 2PWFA 5HNRA 3CZKA 2FZ8A 4HMNA 1WZKA 4HNVA 3RPTA 2HPIA 3AHVA 2PWDA 3QR1A 1ZMCA 2Y7GA 2ZFAA 2WZEA 4LBUA 3ANUA 3LNPA 1P0DA 3DI0A 3HMCA 4AC7C 4FIQA 5BWAA 3KVKA 2OO6A 1W3HA 2GDQA 4TVYA 3H4KA 1OEPA 2X30A 1JPKA 3VC6A 1AG1O 4M7SA 2DJLA 4ZOAA 3QV8A 2OLAA 1UJQA 2XFWA 4AX6A 4B9ZA 2Z29A 4AIEA 3WDQA 3VDBA 4PUEA 4MKVA 5E70A 1Z69A 1FKWA 1YNPA 3MB9A 3M6DA 2WK2A 1HL9A 2A0NA 3NO5A 4F2UA 2I9UA 1K4HA 1RD5A 3M0KA 3DGRA 3HU7A 3VMOA 3HQOA 1EPXA 3QKEA 3E0WA 4F0MA 3EA2A 1ZL1A 4YCOA 2J9XA 2GJLA 3P6LA 4HA4A 3SUTA 4ZMGA 3CUHA 4PSRA 4QDMA 1GHSA 4H4ZA 4HOWA 4QFUA 4ZSUA 1EJSC 4W9TA 2FH8A 3TTYA 3P8JA 2QUMA 3GTNA 4X61A 4K8DA 2NX1A 2VRJA 1R9YA 3ZXWA 4RLIA 3LSCA 5CCZA 2VZTA 3VIPA 4O14A 4F0SA 1VH7A 2WC7A 4Z2GA 1ITUA 4XD5A 5LA1A 1PKYA 1XLJA 2ZDSA 4DZAA 4AXKA 1RUSA 3WLOA 3MYPA 2YQUA 1PJ9A 1F2JA 2V82A 1ZAJA 1GRTA 4KRZA 2Y1HA 3GTFA 1OFBA 3FVDA 2ISFA 4Q7IA 4E3TA 2ZOXA 2XM1A 4J40A 4ZQMA 1WDQA 2V5DA 2O55A 1SU5A 1JR1A 3N19B 4JTAA 4HZ7A 3RXZA 3FVMA 3V5FA 4LT9A 3SRKA 4QTGA 1E1CA 1PYMA 2WWDA 3VCRA 1R3VA 1EBHA 1GUVA 2PFHA 5A6BA 3HFYA 4O1AA 4B5VA 2J47A 4Z2IA 4ZQOA 2UY2A 2VD8A 1FWWA 3DFOA 3BAYA 4S2BA 3VD3A 1V3IA 3ETRB 3V4BA 1SQ7A 5KZEA 3T0DA 2PRLA 1MQQA 1ZX9A 3CUGA 1UR3M 3FGCB 1KBIA 1GORA 3RX3A 4GNJA 2E8ZA 4ZVJA 4IQLA 1SM9A 4X9YA 4DPQA 5I24A 3BO9A 2YLAA 1CB7B 3OQ8A 1IEXA 4S23A 2CXEA 1QVBA 2QUUA 5CZ0A 1CDGA 3WF0A 4LU0A 2PTXA 4J27A 1VFLA 4XIAA 5LIYX 5H91A 6ALDA 2WSKA 1B4KA 5A8GA 4EWJA 2VYOA 3JRKA 3OHIA 5HQMA 1AW2A 1JCNA 4LVFA 3GKFA 2X8GA 1JYXA 4OT7A 5M3WA 3VE9A 4ATDA 4B3KA 3CHCA 1ZMDA 1DQXA 4Z1YA 1UC4A 3DG6A 1GYMA 1XD1A 3TDFA 2F84A 4UTIA 1F61A 2X41A 3AJ7A 4H4PA 2PD5A 3SCOA 1YDNA 3KE0A 4QCFA 4ACYA 4WKFA 1QOXA 4C90A 3WJXA 4CEXC 1N7KA 5BCAA 1W3NA 2PDPA 1UMLA 1NHPA 3GXFA 4DJDC 2WPGA 3WYZA 4CN1A 3VC5A 4AC1X 5I3HA 1KCZA 1UHVA 4Q6JA 4QJ3B 2VRQA 1B3OA 5D8ZA 3O8AA 3UWZA 3DJGX 3K2GA 7TAAA 3ZQ9A 2XYLA 3W76A 1MXGA 4LAKA 3F03K 1EX5A 2W67A 4MNLA 3B9JB 5CXPA 4PMVA 3N9RA 4H41A 4F40A 3EMQA 3NJ3A 2Z2BA 2P8BA 3QR3A 3DYMA 3CWHA 3CIVA 2Q02A 1GZJA 4IMAA 4OFCA 4AQLA 1S5VA 4JQAA 1LQ2A 3V16A 2JEPA 3NA8A 5CLWA 3PNUA 4O4WA 1M6JA 3VDHA 3OA3A 5HANA 2VEFA 2PDNA 3SN4A 4XZLX 3B0PA 5FACA 2QPXA 4M7TA 3TLLA 4NNAA 1HGYA 3Q65A 3AHTA 4H2CA 4AZ5A 2X40A 4AD1A 2W55A 3MUCA 1Z41A 1T8XA 3WENA 3BCJA 4H4IA 4E2DA 3GUGA 3KTCA 3C0SA 2E0PA 1IWBA 2Y85A 4FLOA 3EWYA 2POTA 5JH2A 2XVPA 4JIEA 3GG7A 4B92A 4IM4A 3K1DA 3MBFA 1ZJIA 2NWSA 4Y90A 5F2LA 2INZA 2ZXAA 2ZKMX 3UW6A 2AL2A 3CEPA 1G67A 3T81A 2C15A 4TMBA 3P5ZA 1NP2A 2WOQA 2DGAA 3E2QA 4K68A 4R85A 2GOUA 1TV4A 3NQAA 1K03A 2ISVA 3BW2A 3U2CA 3SIZA 2W63A 2O9PA 1XLFA 3NM3A 3WJWA 2A7NA 3B9DA 1FA2A 3TZNA 2HS6A 3W29A 4XAFA 1DE6A 4H7ZA 1R30A 1N8WA 2PCQA 4ECLA 1EC7A 3NQ2A 1ITQA 4QGCA 2F6KA 2RKXA 5HPOA 4KWUA 1M7PA 2DSZA 5BRQA 3V0TA 4Z1AA 4W7UA 1TV7A 1CW2A 4JX6A 4Q7BA 4WOZA 5HJXA 4QXIA 1FXPA 3VNLA 4KRUA 4E4UA 2PDBA 1XSKA 1J0HA 3CZLA 3CGCA 3W37A 1E51A 3PTMA 1F9CA 3EWWA 3GYEA 1TRIA 1N2VA 1QNRA 2J7DA 3KBVA 4UQBA 1V93A 5HMEA 1O6IA 3IAQA 2CIPA 4LV9A 1RZMA 2H9AB 3CC1A 5CZKA 5CPOA 1RA0A 3LOTA 1VFMA 1Y8BA 3GDKA 4NEVA 3SM0A 2AQOA 4UTTC 1HTIA 2ANUA 1ZS2A 3E0LA 3QLDA 1E3ZA 3DHDA 4CU6A 3T07A 1GW1A 4R88A 4IX0A 1BWVA 3JS3A 1QASA 3E02A 3E96A 2O4QA 3RAOA 2DSKA 3WJSA 3MI6A 2VEKA 1A4LA 3H23A 4UTHA 3CH9A 3SQSA 3ZR5A 5IDZA 3P62A 4YMZA 3HPSA 2I14A 2XUCA 3LHZA 3UG5A 1ECEA 3IJ7A 3U2EA 3OBEA 2FDMA 4Q8TA 1UKPA 1FEBA 5G1MA 2YDSA 4L9YA 3OODA 3WJYA 5I3GA 3PZ9A 4AZCA 1FH7A 1OBAA 3E49A 4NJHA 4E5TA 3G6LA 1KWKA 3W83A 4ONVA 2OT1A 4LNYA 2F38A 3VOHA 2FGLA 4OZOA 3GW3A 1I60A 3RR4A 3TAKA 4F48A 1V97A 3LADA 3UU0A 2WVSA 5T26A 3EAUA 3QFEA 5A8OA 1HKIA 3W7IA 2YCEA 2ZZ0A 4FDCB 1RQEA 2WXDM 4XZMX 2VNCA 3VINA 1UP0A 1GKPA 1SJBA 4OBRA 3AS3A 2FPYA 3R5EA 2XU2A 3TU9A 3HW2A 1IT7A 2FQIA 1POKA 3QXBA 3NQCA 3NS1B 1TVPA 3PTDA 3QGVA 3FKRA 4KWSA 1G1YA 1O5KA 3BCFA 1D7FA 2XH2A 1V3HA 4IMFA 3LLDA 2NSXA 3IC9A 3CV6A 3ZSSA 1NDAA 2E67A 1K1DA 3KRZA 4H19A 1LUCA 1W0MA 4PODA 1VFHA 1J5TA 5BU9A 4I8DA 4C60A 1Q2RA 3N9SA 4GO9A 4OBSA 1RP9A 4BEUA 2JK6A 4DJFC 1HF6A 3QKZA 4BF5A 2W0HA 2D20A 4AEFA 2FYMA 4BS0A 4NNBA 1HFBA 4BCEA 2C3DA 1RCQA 2QCCA 5CQ1A 4Z2JA 4O1DA 4KWWA 1Q1RA 4JTTA 2XJ7A 1V4YA 4FXSA 5C9UA 1PKLA 4D1JA 3OBKA 3BGJA 5G1YA 3UG4A 3B4UA 4C6JA 1OX6A 2R9RA 4O10A 3GNPA 2ESCA 3VA8A 1AL8A 3BARA 5A8QA 5FAJA 4NAEB 4Z17A 2IUZA 3EGJA 2WP6A 4WSHA 2HROA 2WC4A 1PL9A 4GUJA 4AZ7A 5HWMA 3S5NA 3APGA 4LAUA 2PDHA 2VZOA 3A4WA 1TPUA 6XIMA 4APNA 4GZJA 3UPBA 4BY3A 1ODZA 1UASA 3B04A 3L4TA 2OWWA 2VZUA 3WEMA 2CLKA 1JYWA 2BVYA 2P8CA 4TVCA 2FIQA 1B2YA 4RV3A 4FO4A 1TJ0A 4QJ1A 3DGHA 4YIWA 4KCWA 1S2AA 1ESWA 3V1PA 1XCFA 2P1FA 2VZSA 4NEWA 2CPUA 5F4XA 4UTLA 2X0HA 3TK7A 2FZDA 2VC9A 1W32A 2XH0A 3WF3A 5LGXA 1FVPA 1W6TA 3EDDA 3QH2A 3H12A 1UJPA 4L61A 3QY7A 1DJZA 2X8RA 3SY5A 3KVMA 2NVAA 4O0QA 3M0JA 2OU4A 1Y5VA 3CUJA 4PTVA 1XV8A 3RIKA 3WLIA 4FOUA 3OOQA 4F0RA 3F4VA 3IK2A 1U2YA 4W7VA 4FX8A 2PDGA 4NJGA 3TP4A 3SUWA 4JQ3A 4H9VA 1XP3A 2F2KA 1W8GA 1B31A 1Y0EA 1W3TA 4K37A 1GHRA 3WX7A 1VPQA 4FEZA 3O0KA 2GDVA 2PMQA 4LB4A 3FNDA 3L68A 3GFXA 3PWAA 5BXRA 1D7KA 2WKGA 1FCBA 3CL7A 2PDQA 4KGLA 3P84A 3NYDA 5D2XA 1XD0A 3CQKA 1IZJA 3L9CA 3PJUA 4MB5A 5JVLA 4L56A 3VYLA 2EJAA 3FGCA 4D6DA 3CUZA 3D3FA 4P61A 3UY7A 3MHFA 1TKKA 1M68A 1M53A 5BOEA 1Q7QA 3VIMA 1W9XA 3NQEA 3VKCA 1MW2A 1ZY8A 3S6OA 4HSOA 4LJ3A 4HPHA 3GDTA 2JKAA 1XH1A 5GPRA 4MKNA 5EPDA 1OX4B 3HZ3A 4XB3A 1QI2A 3W23A 3W6MA 3ARXA 1UD4A 1ZBVA 1IXNA 3MMWA 3GNOA 1JFHA 3CHDA 3XIMA 3K8MA 3ZT5A 1E40A 3J7HA 3P14A 3SCPA 3V1HA 3AMGA 3H2NA 1MOKA 1MW3A 2C16A 1EWEA 5K2ZA 3C61A 4JTIA 3WY1A 3T08A 3BLIA 4OECA 2R94A 3RU6A 3URHA 1A5BA 4FR6A 2XWEA 5AC6A 3NZRA 4ASTA 2CLHA 3B8WA 3F7JA 5G4EA 3KEHA 1AK5A 2F6XA 4GFSA 5AOUA 1KFWA 1ITCA 5D09A 3TQVA 1PX3A 1EUAA 3B0VC 1BLIA 1PZ3A 3DKJA 4GYPA 3FCPA 3ZJ7A 3BVJA 4O16A 3CMFA 1EYWA 4GJIA 1R0MA 3VD7A 3FKKA 2WPCA 1VB9A 1HNYA 5C71A 3M44A 1HKMA 3A9IA 1JD9A 3ITYA 3UCQA 3KL3A 4Q8MA 5CSRA 1XIJA 1UB3A 2ODOA 5FF2A 1SSDA 4IIFA 1XBYA 2DQWA 5LHEA 3M07A 2HBVA 3QEZA 5D33A 1HZYA 2E6AA 4AZ6A 2W91A 1M3UA 1WV2A 3CNYA 3MI2A 1VYPX 3EEZA 3EMCA 3OZOA 3U9IA 3LPFA 1G5AA 3AROA 4NG3A 2ZZCA 1JJKA 1GZGA 3AMCA 1RVKA 4IPJA 1DWGM 4HHMA 2MUCA 3CPUA 3SDOA 3L2MA 3VIOA 1V5XA 1I8JA 2GWGA 2OT0A 4NU7A 3MP4A 2FHFA 4J2PA 4AD2A 5AECA 2XDFA 1WKEA 3PJXA 4C6MA 2RAGA 5CSUA 1E5NA 5I03A 5CG0A 4PR4A 3U5YA 2Y0FA 3WQFA 3I7SA 4DYKA 2G3JA 3LTPA 1BSIA 5CAHA 3VVGA 5FSEC 4IFKB 3WD0A 4NZ4A 1J12A 2FMOA 3NVTA 2NQJA 3MSRA 4FOKA 5AC8A 3OZYA 1MFUA 1GW9A 2CZFA 2NX9A 2QULA 4LANA 4ZE5A 1K8ZA 1K02A 3TZFA 3QPZA 1XDMA 2QGHA 4FNRA 2Y5EA 3NZPA 2J62A 3NQBA 1XBVA 4L6HA 4B4FA 1FWJC 3LMZA 4DIAA 2IPFA 4J57A 1KFEA 1LT7A 2VCBA 5ABTA 1CXEA 5XIAA 2HE5A 4TX9A 4PE8A 2BGNE 3KTSA 1UMYA 2I56A 1YNYA 3WLLA 5DCBA 2PWEA 3MDUA 4R27A 2MANA 3GH7A 3OTRA 3TWAA 2PWHA 1TELA 2TPSA 1B3XA 4ZBCA 3RO6A 4LVBA 2PF0A 2YFOA 4DZ5A 3OVPA 3N2XA 1PEZA 3H22A 4Q4MA 1H50A 4AZGA 1YNQA 1ZGDA 3DBPA 1S5WA 3HQNA 2QCFA 2H9AA 4GYFA 4KWVA 3W2KA 3QRHA 4E3VA 3UA4A 4XKYB 4WRHA 5BXSA 1MO0A 2EPMX 3W22A 2ZC8A 2FMNA 1H62A 2GL5A 4Q8NA 5A2AA 1I45A 1UD2A 4P7QA 2CDUA 3G0UA 1X98A 1LL4A 3K1GA 1QPOA 1WE5A 1TUFA 2CBJA 2JKEA 3F2BA 1ZSXA 3SCQA 4AIUA 4DJDD 4K39A 1UOZA 4I5RA 1IWPA 1NF0A 2A85A 3BZJA 4RE0A 4GY0A 1KXVA 1RVGA 1MO9A 5LIUX 2EKCA 3WK3A 1O68A 4H1ZA 3H24A 1OFEA 1ZLPA 3MUY1 3VNJA 2X50A 5JU6A 2ZUNA 4U5KA 3HG4A 4HNCA 3MV01 4PMUA 1AMKA 3F4NA 4B4HA 2ZCGA 1V6YA 4L4LA 4Z0JA 5H8UA 3W82A 3IJ6A 3WQ4A 1ZJAA 4GG9A 5CJ5A 5DXYA 3IJ9A 1W1VA 2VEPA 4WX2A 4JIPA 4LUIA 3W7QA 5FOOA 2W62A 1EL3A 1LBMA 2GH5A 1JPDX 4GY1A 3A7AA 1CEOA 1E4MM 3NQGA 3B8VA 1P0KA 2WCGA 2E25A 4IL0A 3KRSA 4PL2A 1EOKA 1KWGA 3KVJA 1VKFA 1ONRA 3VCNA 1LL7A 3VI2A 4Z1BA 3V7PA 4AW7A 5L6UA 1UWTA 4H3DA 3LHUA 3W27A 1VLWA 5E0KA 4HNOA 1QNVA 3AMLA 1W9VA 1JZ4A 3WLJA 4HPGA 4U28A 4HYVA 3DH9A 4F2TA 3ARZA 3WL0A 1F4AA 3QTPA 1WX0A 5C9ZA 2VJXA 4NYUA 2RDXA 1VF8A 3CO8A 1XLHA 3P2VA 1DXLA 5A8PA 4DVOA 1BHGA 5A95A 1UUQA 1TA3B 3WDIA 5HJYA 3ABRA 3TR9A 1GETA 4PTWA 3WQ6A 2C91A 5C6MA 3HIJA 3CAWA 3V5OA 1US2A 1KGUA 1R3TA 4UMCA 5G1TA 3VMPA 1YEYA 4MZ1A 1RBLA 2PU0A 2W0UA 3WLNA 1XH0A 2PDWA 1UKTA 2NUWA 1UZDA 1UCWA 4LCQA 1HG3A 2WMJA 2A7PA 3AXKA 4NAEA 2Z25A 4MJMA 4A3RA 1H7PA 4D8LA 4YVXA 4EXAA 3IANA 3O06A 4QRNA 3CUIA 3ZR4A 1R9ZA 5I06A 3KOWA 4D6EA 1JNDA 5G5GB 5EMYA 5EYWA 4DJEA 1ZCCA 2WOVA 5RUBA 2B4GA 3MKKA 3NZ1A 2PBOA 1GZ1A 2ZVIA 1AH3A 4XWUA 3V0UA 2HPMA 1IF2A 4N4QA 1NWRA 1F3WA 3PZUA 2BHYA 3KRUA 2QDDA 3NCOA 1AFSA 3P81A 1DJQA 1MI3A 1UBPC 3RHGA 2BGSA 3RX4A 1UD5A 1VRXA 3QQ1A 2CHOA 4XAPA 2CW6A 3KBSA 1H0IA 3N2BA 2ACRA 3WLSA 4KIRA 3ZOAA 1BF2A 1S1PA 3MMUA 4JKLA 5FS7A 3RPDA 1LROA 3ZT6A 2BXZA 4AD5A 3S2NA 1GTEA 2P3ZA 3HJEA 1MQPA 2DZBA 1N63C 3G1FA 3CMGA 4CQAA 1FWNA 2WMFA 3ES8A 3SO7A 4ES4A 2ZVRA 3L5LA 3MO4A 3HF3A 1G9HA 4GI4A 5LNWA 3S6TA 3F5JA 4DQWA 1K8CA 2EO7A 5FEZA 2BODX 1OM0A 3APTA 2PODA 2PTDA 1NHRA 3M5XA 3E2RA 2RHGA 4RR4A 3LDVA 1L6WA 5BRBA 3FOKA 4H50A 3RN6A 7PTDA 1NIUA 1N5WC 4CVWA 2J4GA 2ZXQA 1AD4A 4M0XA 2D2GA 3CK5A 3UNDA 1UPPA 4GC3A 1YQ2A 2CEQA 3POCA 3BJSA 1EP1A 4FLQA 2DU2A 3MC5A 2I7GA 1OB0A 3VNDA 2YFNA 4G2DA 3TNBA 3VM5A 4FF7A 3KLKA 1KXHA 5AZ1A 1VFSA 5EFFA 2PLMA 2Z27A 1ZU8A 2E8YA 2J9ZA 1E55A 2NV9A 2BXVA 3IRSA 3VE7A 3WEOA 2W9MA 1RJQA 3MJYA 2X8CA 1OC7A 3KTXA 1PDZA 1XISA 2GPTA 2NUYA 2WHJA 3RJYA 2V3BA 2YA0A 4JXCA 4RE2A 4MB4A 5FJTA 5TF0A 3IUIA 1OX4A 3TSBA 4L9ZA 4R3UA 4D6FA 1A5LC 1M5WA 4JFSA 1JF5A 4XG1A 1H0GA 3ALFA 1FUYA 2IKGA 4DJFD 5FMHA 1KM4A 3M5VA 5DQPA 3SGGA 3URAA 4DUVA 2EBNA 2OGYA 3WH6A 3E74A 3E0FA 1XKYA 3OLDA 2GVYA 4JGDA 4WHBA 3HRDC 4Q3MA 4QLJA 4HN8A 5F1UA 2J25A 5AYYA 2YB1A 3W9ZA 3SY1A 1QUMA 4PYSA 3UYIA 5U7SA 3GG8A 1PXGA 2NX3A 4R7JA 1CXKA 2QPUA 2HQMA 2NXIA 3EEGA 3OG3A 4O0ZA 4CCCA 4OBTA 2NZLA 4XBKA 1JG9A 1OABA 4MADA 1QO2A 4W87A 5C7VA 2PB1A 1NSJA 2E09A 3GAYA 1UG6A 4NNCA 4ENLA 3LCHA 3LBMA 1JZ3A 1FWSA 2CBIA 5U4NA 4IXXA 2PDLA 3QC0A 2HVNA 5FJIA 1QBBA 1WAWA 5BU6A 4UTWC 4NZ5A 1BQCA 4KT2A 3TNOA 4REQB 3N6HA 1VYSX 2HMCA 3TR2A 3CASA 3WBAA 3LA4A 3QN3A 1UD8A 2PDMA 1CXHA 2Z7KA 3A13A 3E5BA 4IX2A 4XAYA 2C1HA 2SFPA 4OU1A 4F8XA 2DW7A 5EBUA 5E6ZA 1Z7AA 2JGYA 1VEMA 1TZ7A 2BGQA 3FXYA 5FF4A 1YQZA 4ROQA 1K9TA 2BV9A 2Y8UA 2E9LA 3M5ZA 1GVEA 4PMDA 3S1VA 4H9ZA 3O0HA 2P53A 4FXJA 3W1RA 5REQA 3C6CA 5ABHA 9XIAA 3K46A 1EBDA 3DFQA 1F8MA 1K9FA 2IMRA 4TQTA 4CD7A 2FTYA 2DY3A 2WQDA 3WQEA 1ONEA 3HGRA 4IL2A 1U5JA 4MAVA 2CYGA 1Q6RA 4EPBC 2X16A 4RL3A 3DG3A 4JTUA 3N18A 3TCEA 2YBVA 3ARUA 2HTMA 5BXTA 4XISA 2ALDA 4DXXA 3CV1A 4I5UA 4O8RA 1QI5A 3LGGA 5IRPA 5HULA 4BWLA 1UWQA 3CB3A 1TWSA 2YBTA 4HU3A 5GQBA 1RR2A 2IS7A 1MVYA 4GH3A 4CQCA 3BC9A 2A2IA 4GABA 3A23A 4L1WA 4DZHA 1FWGC 1XPYA 3TYCA 4A21A 3R25A 3SCWA 1T41A 2WHLA 1CGYA 5K3VA 5A6MA 3WD2A 2XFRA 2ZADA 1J0ZA 1XRTA 5EMMA 4OUIA 4LW7A 3FYYA 4GI6A 2FTWA 1QNSA 3R7MA 3TOPA 3WNMA 3O0FA 1NARA 3SGZA 5CPQA 4D1IA 2Q3OA 3OB8A 3IAPA 4KQNA 3S5OA 4PA8A 3NFUA 2WSQA 5TR3A 1C91A 2Y24A 1BVWA 3DGZA 2OELA 3WNKA 4DNMA 4QISA 4QSHA 4PL1A 1EJVC 3H2EA 4PGLA 4M81A 4XKYA 4UUIA 4XSLA 1QNQA 4W88A 2BY0A 3MQTA 2WWCA 4H4RA 4XUGA 1J10A 2Z00A 4A2SA 3ABXA 4GYJA 1HJXA 2YXOA 3SUVA 3QZEA 2QHAA 2NV1A 2VURA 1EQPA 2B0MA 3AYVA 4U33A 1Z42A 5KVIA 1J9YA 2J7GA 1D3CA 4DBDA 1OVDA 2WBGA 1AQFA 3EX3A 5I0DA 3O6CA 3CPRA 1A5CA 3GU1A 2XFFA 3TC6A 3WQ8A 2FZ9A 4O54A 2BY1A 3S5SA 4JHZA 1M6IA 3RU8X 5AYZA 1XLLA 1P0EA 1W1PA 4RNIA 2ZX6A 1DJIA 3R0DA 1C8YA 4KRTA 4LF1A 3EKGA 4LS1A 4OGZA 3ATYA 3DUGA 3IGHX 3UXAA 3QLLA 1GRGA 3LD5A 3MT1A 4JIHA 2CFYA 2NT0A 4AISA 3AICA 1FHUA 1T0OA 2DZXA 3S1XA 3UCCA 1TPFA 3DERA 3H4XA 1KR1A 2I57A 3TVAA 1TV2A 3B40A 1WKFA 4HPXA 1A5OC 3JR2A 1W1YA 2ZZ2A 3LG3A 3LHWA 5F2IA 5A6LA 4K1WA 2ZRZA 2VFHA 2NT1A 1SVDA 2C0HA 3MJMA 4IQEA 3L4VA 1LL6A 3OPSA 2VCAA 3QV9A 1OCNA 3QY8A 1BWCA 1TZ9A 2HJPA 3M0ZA 4E38A 1A5KC 3M9YA 3MWCA 1NFBA 1P1MA 4GR1A 3H54A 4O11A 3ZLGA 3ZVIA 1XSJA 1H09A 1H49A 2BDQA 2OOGA 4RV8A 4AHQA 1B30A 4RX0A 2Y8KA 3ARWA 3LQGA 3GIYA 1GKQA 4JIQA 3MP3A 5B7YA 3W7KA 1TA3A 4DUXA 5JCIA 3PTKA 3P60A 4ZL1A 3BSHA 2I1OA 1ZBCA 1ISXA 2C7FA 2PDIA 3IJQA 1RALA 5I02A 3BICA 4LWWA 1S2CA 1OFAA 2PI6A 1CZ1A 4QLLA 1FWEC 2P10A 3SJNA 3MUAA 1TPDA 3EWDA 3S1WA 2DW6A 3RCMA 2J78A 1IWAA 5EBAA 4RXFA 3NQ8A 1XIIA 3CUFA 4BQ4A 2GJPA 3W4RA 5FF3A 1KLZA 4C6FA 5AHFA 3VK5A 2A79A 5DANA 5AN7A 2ZUUA 1QNOA 1Z8AA 5TAOA 2VQUA 5C9RA 1Z32X 1TR9A 4IMEA 3PBGA 2PDKA 4EMIA 1HW6A 2DIJA 4LVDA 4AD4A 1LVLA 3UZZA 2WP5A 1X97A 1MMFA 3BXWA 5FAGA 2WNQA 1XYMA 1KFCA 1AQ0A 5A6BD 3G5EA 2YXGA 1FDZA 4LBSA 1GOKA 2VM8A 3VIGA 1US3A 4GIEA 4B3LA 2WJZA 3ZZ1A 1OY0A 4ZEPA 4ZO9A 2NSOA 5KEZA 2AL1A 5JQ9A 3NL5A 1VS1A 3FN9A 2NXGA 1JI1A 1XIMA 1T8QA 4ERGA 3STCA 2VUYA 1B9ZA 4KCTA 4PMYA 1SFJA 1Q66A 5HUPA 2BVWA 4UFKA 1TYTA 3W38A 1KO0A 3BOLA 4UQ9A 1QPNA 3PG8A 2A3LA 1NVMA 3FEQA 3H7VA 2CCRA 3MU7A 3NQMA 3GY1A 1BVZA 2ZRYA 4I9AA 4INFA 3G0XA 2VKZG 1ICQA 4GPNA 5CC7A 2XH7A 1DWHM 3IK4A 3UXIA 1XC4A 2YA2A 4TVUA 1OINA 3SURA 5A6KA 2ZZ4A 3U7VA 2FB3A 2XIJA 1Q6DA 3EZ4A 4H4XA 4PMQA 3P82A 2WPEA 1NH6A 2CLPA 5BMWA 1M01A 3ARQA 5DRCA 2WCSA 1QJWA 3W2NA 4IMDA 5JXQA 1KV5A 1PIFA 3K4AA 1OK4A 4MLRA 1FBAA 3VO0A 4NHVA 3ELFA 4HNLA 4GVFA 4HKPA 2PP3A 1A0DA 1XANA 3T40A 1UR1A 4ML9A 1ZHAA 3UA3A 3GW0A 4FX9A 3CTLA 4HU8A 3SW6A 1H60A 3BDKA 1X6UA 2VX5A 4AY1A 3RJXA 5LIXX 1GYLA 2TMDA 3WF2A 4ZFCA 1TZZA 4Y9NA 4CUCA 4BQ3A 1QFEA 2WNNA 3R94A 3TQ0A 2IXUA 3M1ZA 4IP7A 3WUGA 3DK9A 2A6NA 2WO5A 3UJ2A 3AUOA 4US6A 2VC6A 2UBPC 3CGEA 4FR1A 2HQAA 2ZXDA 5TD4A 2B7PA 2BCPA 1UWAA 1PBGA 2IPJA 4IGMA 1H1ZA 3UXDA 2ZWZA 3L4YA 2QCNA 9CGTA 2NQZA 4IZGA 1GKRA 3E12A 2F7FA 4B5UA 2X1TA 4UR9A 3ZS4A 1WYGA 4TMCA 5CKSA 4ZCWA 1XHGA 3OHMB 3N4AA 3W88A 3HPFA 2YCLB 5AB3A 1R85A 3GK0A 5BOFA 1G69A 3P74A 4E2BA 3KBJA 2I5QA 3RITA 2P0IA 1JULA 1FTXA 3DU0A 4XQ6A 1QHPA 3UD6A 5BOOA 3MKVA 3P7YA 4UFMA 3NSXA 3BK0A 1BYCA 1W3JA 4QE4A 3N17A 3IVSA 3S1GA 3PSVA 3G0SA 3QBUA 3RM8A 3GNDA 4KPLA 1GERA 3CYVA 4IMGA 2GRTA 2RABA 2EKGA 1EDQA 3WBEA 4HTBA 4EXQA 3VILA 2JQXA 3TJLA 4MFDA 3L8KA 3KLJA 4AMCA 1V77A 3S3GA 4LY4A 4KESA 4S2CA 1H41A 5CLTA 1J0YA 1VBGA 3GNNA 2ZTJA 4YXGA 3L4WA 4KH2A 4LA1A 3TQKA 4CD8A 3VABA 4C1LA 3SBFA 4K38A 3ARTA 4IIBA 1AOGA 4DJEC 1NFPA 2ZIDA 4UTMA 3C0QA 1E15A 2Y63A 2J9YA 4LQ1A 5HMDA 2BOEX 1JZ2A 3HURA 3BLPX 5I3FA 3HB9A 4MSSA 2VR4A 2DUAA 2WVUA 3ONCA 4EQXA 4JPGA 1X6LA 3F5KA 3NYZA 4YTQA 5AY7A 1K7EA 3SN0A 3BPWA 3WUEA 2ZBTA 3A4AA 3IPWA 4AVNA 1IZCA 1C8QA 3SN1A 5B7ZA 3VGFA 4QNWA 3AN1A 3W25A 1ZTVA 1AH4A 4RZBA 4Y96A 4A05A 3EPNA 1QOQA 3MVTA 4J28A 2HS8A 1FFRA 5XIMA 5M5DA 4HJFA 4UFJA 3OZMA 4JTHA 4GGHA 2VQTA 5C70A 2O92A 1G01A 1QI3A 4DJDA 3QPYA 1XLKA 2W27A 2WNZA 5HDRA 4M6QA 3PBYA 4NIRA 4JDBA 2E5DA 3N3MA 3V35A 1GXFA 4J4KA 1QR7A 2QCMA 4FIRA 1YX1A 3PJTA 4HIBA 4TU1A 5FJJA 3AWNA 3TSDA 4AUBA 1PKNA 3QFBA 1FKXA 4DI9A 4CNNA 1JROA 4Z2KA 3OA5A 4ZXOA 1WUFA 3CAKA 2ZUTA 3MO7A 3VDCA 3LEPA 1A53A 4NAFA 3GE7A 4FAMA 1EJRC 3A47A 3UR7A 2VTFA 1K4QA 2ABAA 2Y70A 3WLRA 2PLJA 4M19A 1B9BA 1U30A 4CVUA 4FF5A 3AQUA 3IGXA 4Z1CA 3C2YA 4HZ6A 3AO0A 1IEQA 1NDYA 2XZ7A 4BHYA 3VZYA 2XZ9A 1W31A 1M04A 2QUVA 4A4AA 3LX9A 4H9UA 2XIIA 4GVGA 4JFWA 3DYOA 3N34A 1TWWA 3Q45A 1OF6A 3H70A 3BWWA 1R3YA 1CCWB 2PTZA 3UEQA 1BG9A 3HTWA 4C1NB 2D2OA 4POCA 4HHHA 3G22A 4IIEA 2PGFA 2UY4A 4UC5A 5ENLA 2VFGA 3EDKA 4S3JA 2FHBA 3IEBA 3RK8A 1TB3A 2J7CA 3JUGA 3SSZA 2ACSA 4I5XA 2QUTA 3LENA 4JIIX 3C0LA 4KCVA 2KAUC 3EX2A 3V0SA 4QJ4B 3W1UA 1U5VA 4KEMA 5CGMA 2QVHA 1YPIA 3VD4A 4F0HA 3OQEA 3VU2A 4G7EB 2G3FA 4ALDA 5HMFA 3MZ2A 2GJNA 1MW0A 1GEUA 1KFKA 3WCZA 4DEFA 1O60A 4QITA 1BTCA 4EPEC 2PDXA 1GOOA 3C56A 3OG2A 5DX7A 3W72A 3TUUA 1EYEA 1DL3A 3TXVA 1S38A 1XUUA 2GSHA 1GT8A 1S46A 4P8WA 5KINA 1RA5A 3KRBA 1XH2A 3E0IA 1XDIA 1Z6KA 1JCJA 3W1TA 4IH3A 1FECA 3H6OA 4HBKA 2RDWA 1H4PA 1HVXA 2YCJA 4W8BA 1XYZA 1QWGA 2JF6A 4WZHA 3UCDA 4QBXA 3QHOA 4NL1A 1K77A 2OJPA 4YTRA 3B9EA 1D7YA 3MBDA 4AY8A 2EAWA 3GBDA 1TWDA 1F76A 2YVJA 1UA7A 3B0XA 5DELA 2A5HA 3L4ZA 1EC8A 4S3KA 1TX2A 4HN4A 3WH5A 2AAMA 1E9LA 4GA8A 1DXFA 1YDVA 3PB2A 3TTQA 4DWDA 4UZSA 4JS3A 4JEQA 3H7RA 4IGSA 1J11A 1NQKA 3PG6A 3O7UA 4ZGYA 4EQSA 2G3MA 3G3DA 1JPHA 1N61C 5AZ0A 4IMCA 4S39A 1KM5A 2WW5A 2V5LA 1K9EA 5D9MA 4JFUA 1SJCA 1GREA 3STPA 1E0VA 3BLDA 1H51A 5I09A 2J3NA 4RDYA 4C7FA 4FA3A 5A5WA 4AH7A 3E3HA 3Q37A 5FSDC 5I6SA 1GQIA 1FFQA 2NLIA 4UQAA 2ALRA 4LBRA 1YDOA 3TWBA 2BG5A 1EGVA 4W86A 3WQWA 2E5BA 4EK7A 1HVQA 4QIUA 1D3GA 3TJIA 4FNUA 1YDYA 3WDPP 4QNEA 5D8WA 3TKFA 1TREA 3SCVA 1ME7A 2OOFA 3ARVA 3DC0A 5CPMA 3S9ZA 2OZ3A 3MMDA 1JCXA 3C0JA 4BWLC 2R9ZA 3R10A 3W02A 4HVXA 3VOFA 3GR7A 3CHEA 3GXTA 1GOWA 2OPJA 2OQLA 4JL2A 4K2SA 1WOBA 1RSCA 2J6VA 1FWRA 2H8XA 4IUOA 1ONWA 3YPIA 4W8LA 2PC8A 3BCDA 4MNJA 3AZTA 4DXVA 3NZQA 2J7HA 3L21A 1XLAA 2H90A 1JNEA 3CPGA 4CD4A 4QROA 4FNQA 4OTKA 1TVNA 4Y9PA 4EKJA 3THQA 3MDWA 4FK9A 4GC4A 1KRBC 3E38A 1W1TA 1OZQA 3VNYA 3WH7A 5C2XA 5BRPA 4J3XA 2CLLA 2Z24A 3NO1A 2GVGA 4EF8A 1IXOA 2E6DA 4HK7A 5CG7A 3A5VA 1FFUC 3USZA 3KHDA 4ZXLA 1VFOA 5J04A 1TJRA 3PC0A 2VWTA 1SB3B 3LBCA 2RGLA 4N7QA 5GNYA 4GY7A 3QMSA 3R2GA 5HR6A 3W84A 5FJRA 3DAQA 4I9JA 1GVFA 3A3HA 3HGSA 1Q2SA 3WLTA 2QVNA 3N12A 2BTMA 3W7EA 3HG2A 3GDMA 1NELA 5T8GA 1JZ6A 3CH0A 4K6AA 4QEEA 2BVDA 3SQLA 4XV0A 3AIEA 4E4FA 2VP8A 1C8VA 3O16A 3THDA 4ZOCA 3WMBA 3B0UX 1BQGA 2G3IA 5EMKA 4XO6A 1VAHA 8XIAA 1AJZA 1KM3A 2AL2B 4NQ1A 4LOCA 4XO7A 2Z0IA 2ZE3A 1JXJA 1WDPA 1ZAHA 4GOAA 1C7SA 3N29A 3MP5A 3IWPA 1AODA 1GVQA 4JZ5A 1YPXA 2CITA 2ISWA 1LOLA 1MUMA 5CZSA 5LHFA 1W9PA 3OGSA 3LQLA 1J5SA 1J4EA 2W79A 2ZA3A 4H7VA 3U7BA 1D9EA 1EC9A 1VEOA 3OEXA 4IT1A 4C6PA 3B9OA 3S83A 1WCGA 3ZWSA 3LLXA 4O1FA 1RCOB 1XYLA 1E3XA 2OYKA 2C3CA 2GSEA 2DSVA 1NDVA 1XCWA 2XPKA 4B16A 1MEHA 3T78A 4X9SA 4A22A 3EANA 3SEPA 2DZAA 3IS4A 4Z2HA 1UUOA 2W66A 3P61A 1JAEA 1J6PA 2PP1A 4JFTA 1IYXA 5AKQA 4JHOA 2W4XA 4MOZA 1BWKA 4PMZA 4C6CA 3VCCA 4A8IA 2BP1A 3LY0A 4RJEA 5LNUA 1X7IA 3LBOA 2X7WA 4JAWA 4FNSA 2YCLA 3G24A 4QEHA 5TIMA 2CXGA 4N02A 3WQVA 2I5IA 1JRBA 4XZWA 3H2OA 4XZNX 3FAXA 2A6LA 3NQVA 4H6EA 1CWYA 1EF3A 4Q8QA 5EFDA 1IT0A 1ONXA 4H2HA 4L1XA 1GRAA 1QTWA 5E5CA 2FVKA 3OP2A 1C9WA 3CWOX 1BPLB 1PTDA 1F3XA 4XTDA 2B7OA 1PTAA 1ZQ5A 4GQRA 3BMVA 1HJQA 1R7AA 1XIGA 1CLXA 1LPFA 4HGXA 2CKRA 2J7EA 1VPYA 1E6PA 4CNSA 3UYCA 3S5ZA 4AVFA 6REQB 3A7UA 2WZIA 2GQAA 5JBEA 4JYFA 4ATWA 1QW9A 2F9RA 4DF2A 3FJLA 3DCPA 1NWTA 3L2IA 3OLGA 4E8DA 1GG0A 1LQAA 3ZJKA 3UGRA 3N9KA 1HUVA 4I8YA 1EB3A 4Q4QA 1FHDA 4B2DD 1LLZA 5ECVA 2OSYA 1AW5A 5I79A 2ATSA 3ITXA 3LHTA 4AZCB 1X2GA 3FDKA 2PC4A 1MW1A 2HDJA 2RDTA 4JL1A 1C7TA 1DIEA 5FKYA 2ZRXA 4ICMA 1HT6A 2AGTA 2YL6A 4HJWA 3ANYA 4I9MA 3USBA 5CSSA 3G3MA 1M7OA 4DNAA 4S38A 5D30A 3CT2A 1ISVA 1BYAA 1FY6A 1OIFA 5TQLA 4WGXA 2V2HA 3DBNA 2V3DA 4X2RA 3VX0A 2F2HA 5D38A 4C1KA 1OD8A 1UUMA 3V3WA 4IWWA 4WDWA 3ES7A 4KIEA 1V02A 1PDYA 4GINA 1LBLA 1MSSA 2WKJA 2TSYA 2GR2A 1TTIA 4WJEA 1F73A 4DPPA 3C2VA 4M29A 4YTUA 3M5YA 2GOKA 1CI1A 1ZUAX 3WLQA 2YJQA 4FB7A 2QIIA 1VC4A 1HJUA 4LS2A 2O9TA 3EKLA 1EEXA 2QZRA 1OFPA 5ER0A 3N73A 2OX1A 3ZFHA 4CLMA 4GISA 3VKAA 1TFVA 3A6OA 5FS9A 3T42A 4GVIA 1R9XA 2Y62A 4CU7A 4TV6A 1GQNA 1Q6FA 2RJGA 4TVDA 1D2KA 3LCGA 1JEHA 3RCYA 1FHVA 3U57A 1NDZA 4Q4OA 4KETA 1UZ4A 1I2QA 4JDRA 3NPWA 5IFTA 1TMLA 4K8GA 3KWSA 3GAKA 1JGMA 5G2IA 1GRHA 3S2LA 3FY1A 3UF9A 1E0XA 4HPJA 4AY7A 3AMZA 3R79A 5HBFA 3GD6A 2XIQA 3E9AA 3IIPA 3W28A 1Z9AA 3CQJA 1XQKA 1CIUA 3GH4A 4JN7A 3G1AA 1XM3A 3SCSA 4C1NA 2IPWA 1VFFA 1RPXA 5I3IA 1V51A 3N04A 3U0HA 2VX7A 3I6EA 1TMQA 3K8KA 4EX4A 2WANA 2GGJA 3A12A 1H5VA 2DIKA 1TJ2A 1O66A 4J2MA 3UWVA 1I1WA 3MW7A 3Q6JA 3AOFA 4WVXA 2J7FA 4MJZA 1VPXA 1ZFJA 1WBJA 2X2GA 3PAJA 2XSAA 4UTUA 1N60C 4G7EA 1XFCA 3LB8A 4C7GA 2EF9A 1UH2A 4NSBA 3GIPA 4BEQA 5CJNA 4JN8A 3GYCA 3O15A 2PDCA 2DJXA 1V59A 2XISA 2RDUA 5EMLA 1EZWA 1JUKA 3DHFA 1DWIM 4J3WA 4WJXA 3R0UA 2DVXA 1PKMA 2CBVA 1Y5WA 1US0A 3PPHA 5M1TA 3BGAA 3IIZA 1H2JA 3UERA 2AQWA 1B3YA 2X1SA 3KLLA 1TYGA 4S3CA 1XRVA 4DJED 2VR5A 2BXYA 3EXSA 3WFZA 5DRIA 1QMLA 5E9AA 3IJDA 2E1WA 3WLHA 2FFIA 1YRRA 3ATZA 1J96A 1XSIA 5AYBA 2CWNA 4JD4A 4AHPA 5AC4A 3MUZ1 1S3HA 4JNZA 3HPAA 1K70A 3CYJA 5E09A 2R14A 2VXNA 3UGVA 4KFNA 5M03A 3WSUA 5K9CA 4GRTA 2J74A 4K3ZA 6TAAA 1TRDA 2CLOA 1HN1A 3WNPA 4WEVX 1GPFA 1S5NA 3TTEA 3FG2P 2Q01A 3L5MA 3NURA 4Q4SA 1FHLA 4BI6A 2GWNA 1D8CA 1FFVC 3G77A 2IKHA 1CXIA 4EAYA 1BTMA 3KHJA 1OC5A 3OYZA 3B03A 4KW2A 1UIPA 1N5XA 2C79A 1OSEA 4X22A 2QV4A 1E4IA 3N13A 2VDIA 1NDWA 3T05A 4A8RA 4UOZA 1SFSA 2J13A 1W9UA 3S2CA 2JF7A 1ZPTA 3CUXA 2PD9A 2Y7DA 4PFHA 2Z2AA 1LRQA 3N2OA 3HO8A 2FJUB 2H3BA 4H8UA 5HNUA 4DWSC 4JTFA 4S3EA 1NTHA 2IQDA 1JCYA 1S1RA 1FCQA 5H8MA 1A0EA 4JNMA 4UFLA 4NASA 3GD4A 1XRSA 3EWZA 4Q8WA 3TYAA 2UZ9A 1NF7A 3AISA 3MUXA 1PUDA 3W81A 4EMJA 3SRFA 1DQUA 4PN2A 1TVLA 3GVGA 2VGIA 4UTJA 1JZ8A 3NVZB 1F07A 5FJOA 2DSUA 4N2YA 3LRKA 3W1MA 4W89A 4GGBA 5A69A 3D47A 2OCZA 4LALA 4FXRA 3AFBA 3FA4A 1BG4A 4Y2WA 7CGTA 4FNPA 4WDUA 1OC6A 3WK2A 2DZUA 4H9XA 4IPPA 3GS6A 3PM6A 1EJXC 2NVKX 2ZX9A 1KCLA 4CEUC 5B80A 5D32A 2Z4GA 3THCA 1ZAIA 5G2HA 4K7ZA 1LZOA 4F9DA 3SSJA 1HO4A 1OYCA 1TQJA 1ADSA 1EXBA 4EM4A 2QPSA 3SQMA 3SGUA 4AB4A 1DWJM 1L6YA 5FI8A 1H6VA 3NNTA 2PCEA 4F3HA 2GQWA 4M3PA 1SMDA 2GK1A 3WFAA 5CAKA 4AD0A 4EOUA 1DTUA 3CZEA 2ISDA 2YLLA 4AXNA 3R12A 3L67A 4IGNA 1TPC1 3BZGA 3C2RA 3RDKA 1DKWA 2WMIB 1YXYA 3FAWA 3F2CA 1J0KA 1XLEA 1V08A 3NO3A 3TW7A 4AD3A 5C0QA 1XDJA 3UZJA 3C2OA 2YVGA 1HL8A 4MZ8A 1X8FA 4LSBA 1EJ7L 1TE1A 2WHMA 4GXPA 1XIEA 1B4EA 4UCFA 4YYCA 1V0LA 4LGXA 5I78A 5JCLA 3TYBA 1S39A 4C6BA 3DEQA 1YLVA 4JCLA 4XUYA 3D0CA 4DBSA 1EH9A 5I3JA 5HQLA 3LXBA 3DZ1A 1U1JA 1X7FA 1ZP4A 2CLEA 2E7FA 3NQFA 2ZDRA 3MHUA 3LGDA 3JW7A 1Q1WA 4ADTA 3K4WA 3TMQA 2ATMA 4PUUA 3GU9A 1ZJHA 1T7LA 5KVHA 1O94A 2ZA1A 2BX7A 3AHXA 3R8RA 3DG7A 1LG2A 4YU1A 4CQDA 4PRWA 4BZYA 4O50A 3LHVA 3L7RA 4ZFMA 4JQ9A 1AD1A 4V1YA 1GESA 1RAKA 2O7SA 4PUWA 3F1QA 3S9YA 4H4QA 3KS5A 5HXMA 3DIPA 4JQ2A 3S6DA 2YZ5A 4E2VA 2DVUA 3OIXA 3HPXA 2PRHA 4WXYA 4P7RA 4KS0A 2V0TA 2VVNA 3FYPA 1ZRQA 4IGHA 2IKJA 2PP0A 5AHLA 1P48A 2WJFA 3M0LA 1X6NA 3P5YA 4ML4A 1R3SA 1XDLA 1HKVA 4H4SA 2F6UA 1AJ2A 2ZX8A 4M52A 4UFHA 5LSMA 4M82A 3IIVA 7ODCA 2OKTA 4QE5A 4E8GA 4D6GA 3R43A 1J93A 2NVDA 2Z6IA 3WNLA 4CN6A 3EOUA 3B4YA 4HNUA 1EDTA 3QYSA 1WQ5A 2ZZ7A 3NPXA 1W9BM 2YW4A 3VD9A 3ZMRA 1S5MA 3IV8A 1O1HA 3SCNA 3GRSA 4W93A 3FV9A 1VCGA 1MQRA 4N0RA 1BSLA 3PS7A 2PDYA 5BZAA 3KOFA 3CBWA 2X7VA 4UZUA 3QZAA 1G0CA 3WD1A 2FGZA 1JL8A 3GDRA 3RPMA 4MWAA 3T2QA 5GNZA 2NV2A 4N9DA 1GSNA 2V5CA 4LAMA 6REQA 2FZNA 2VI0A 4HU4A 2V5KA 3MKCA 3NVVB 1VBRA 4PRRA 4US5A 2WMGA 1SZEA 3GNXA 4DAFA 1JYVA 1W5QA 3DDMA 2OEMA 4B9YA 1XQLA 2EPLX 3AIQA 3I65A 4MDOA 1GVSA 3F5LA 1G4SA 2HXTA 3VNKA 4GX9A 1EX1A 3E6EA 1DQWA 1VDVA 2AMGA 4MNMA 3U6WA 1HP5A 2C8NA 3O3RA 4LAOA 1TV3A 1QWKA 1GOIA 3AS1A 1XS2A 1W17A 4CU8A 3QFAA 3KM8A 1YHTA 2G37A 1P7TA 4BF9A 4JKKA 2I16A 3GC2A 3HG5A 1J2BA 2FGBA 2DUXA 4C65A 4NKCA 5BROA 4KCUA 3GLCA 3W70A 1JCMP 1YE4A 1LORA 4XZIA 1K9DA 5FF0A 1WZMA 4B5WA 1XLGA 3BG3A 1XLIA 1LLWA 4IJRA 4G7FA 1X39A 1KCXA 4CNTA 1AUSL 3RLVA 2OODA 4RDVA 3QHNA 4N42A 1JIBA 1JPMA 1JCTA 1GOXA 2D24A 4UWMA 3P0WA 1PX8A 5HK4A 4AVOA 3N1AA 1TO3A 1I9CB 3EKZA 2Y89A 1GEQA 1YKWA 1SO5A 3W2LA 1ISYA 2YDRA 1WOAA 2BSLA 2Y2WA 3KZPA 4HOZA 3CWNA 4UTWA 4NY2A 3CZJA 3UJFA 3W7PA 4R33A 3CEUA 2F8QA 1LT8A 3LXAA 3A9BA 4PBEA 2YIHA 2WOWA 4QG9A 5D04C 4UIOA 5C5YA 3ARRA 1VJSA 3CAQA 1CT5A 1YTEA 2OO0A 1NOUA 3DX5A 1C3FA 1UQZA 3UZXA 4KWOA 5CEWA 1TG7A 3ARPA 1UKQA 5AHMA 4GZIA 3FYOA 3GVRA 5LIWX 4AF0B 1QNPA 3BAWA 4MUZA 1RXOB 4D6HA 1R46A 4IICA 1TTJA 3N2MA 4FX6M 2C18A 1NHQA 1I1XA 1VFUA 4FP1A 3GR8A 4Z42C 1EA9C 4TXEA 1SZRA 3OO2A 1Q4WA 4AYSA 4DZIA 3T8QA 1VJZA 4I90A 1H3GA 5DMMA 1P43A 3T0TA 1XCXA 3GWQA 2YDAA 3B9AA 2DT2A 2CZ5A 1E9IA 2E40A 1JGIA 1OCJA 3PZVA 4PUKA 3RMJA 1A49A 3SI9A 5E0FA 2XN1A 2E9BA 1RP8A 4BKNA 2ZRWA 1FP8A 4OKDA 4GQGA 1KN0A 4UOJA 2V67A 1WPCA 4GYKA 1JDFA 4WUIA 1PZ0A 2Z1SA 4L7ZA 1REQA 1PYFA 1Z44A 3RYSA 1FCVA 4DF1A 3W7GA 3M64A 2D69A 4WSKA 4A3YA 3CS2A 4BFAA 2CETA 4DBEA 2F5ZA 2YGYA 3EF6A 3CHVA 1GPWA 3BOFA 4LYQA 1WDWA 6CGTA 1FWIC 3UXLA 4KBXA 1I0DA 4O8AA 1VEPA 2R24A 2CKSA 1XLDA 1FH8A 3HBLA 3U3HA 4F0LA 4HA1A 4URIA 1GV4A 4JQ4A 3HFTA 3O9NA 3W6YA 2ABBA 4C91A 2XGZA 4MYXA 3PHAA 4GWEA 1WXYA 3EWUA 3I68A 2V3FA 1V7YA 1B1YA 1FDJA 2GQ9A 3MANA 3WBYA 4X0NA 1UBSA 1Q4NX 1TE6A 1EGMA 2D22A 2RJHA 4BI5A 5DBUA 4RE4A 1UKOA 1KKRA 3V18A 3PWIA 3WQOA 3OYXA 4J3TA 1VZWA 1N8FA 5IXEA 2GR1A 4MB3A 4RNFA 1OGBA 2QW5A 2VOTA 3SAZA 2GVJA 4JX5A 3WEZA 2DZVA 1W56A 4BJHA 4HYWA 5EY5A 4FS9A 4A8NA 3DFNA 3FXGA 1WKYA 1PZ1A 3GFZA 5C55A 3QFWA 3UPWA 3FK4A 3EB4A 4WDTA 1J01A 1G4TA 2P0OA 1OFQA 1R87A 1RD6A 1MRQA 4AZHA 1M1BA 5HOSA 4ICCX 5K4XA 5JBDA 2WHKA 1JRPA 2EEXA 1WNOA 4XVEA 1LF1A 4LUTA 3O2LA 3M47A 3ZVHA 3WK1A 1FWBC 2WLYA 3MSDA 3IARA 3CIXA 4BA0A 3SY8A 3QPEA 5DY3A 2PBGA 4WDXA 1BD0A 1BWLA 3GO2A 3NQ6A 4QJ5B 3F4WA 1J2WA 4NZ1A 2NQLA 5DFAA 2YZRA 4FPSA 1OADA 2QYGA 2WZMA 3LCXA 4G9PA 1S2VA 1XI3A 4NJJA 2W92A 4P7OA 5FS8A 4AWTA 3WUFA 1RK6A 3WQDA 1WXZA 4YJ5A 2CHNA 3W74A 2EG6A 5ECUA 1UR2A 3CZGA 4ADUA 4W85A 4IG2A 4H6QA 2QV5A 3A24A 3UWYA 3N15A 3PULA 5DXXA 4H4YA 3T55A 2G96A 4LB3A 4GUIA 4UMBA 4ADWA 4NXSA 2NWRA 2ZX7A 2F61A 1DJWA 1L9WA 4GXWA 3GU2A 4WQ6A 3WDRA 4DYJA 2HISA 4WSJA 3HPZA 2R1MA 4O28A 4ZOHB 2INEA 4F4RA 2WYSA 4WCJA 3MVIA 1Q6QA 1MFVA 2XIOA 1W2VA 1R47A 2EPNA 3K30A 3IRDA 3D6NA 4L80A 5TNVA 1TWZA 1VBJA 1XC6A 3MCNA 3W7RA 1EZ2A 2VVSA 3KZSA 2WZHA 1FIQB 4DF0A 4KF1A 4ZB5A 2HNHA 4N4PA 2FKPA 3GRIA 5T91A 3HM7A 3PUEA 3QZ6A 1WZLA 4QM1A 1T5AA 2VOM