3H12A

Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
392
structure length
392
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGMKKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mandelate racemase
publication title Crystal structure of putative mandelate racemase from Bordetella Bronchiseptica RB50
rcsb
source organism Bordetella bronchiseptica
molecule tags Isomerase
total genus 127
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3h12A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3h12A01
1PDYA 3IJLA 1TE6A 4GYPC 1JDFA 2OO6A 1KKRA 4H83A 7ENLA 3ZLGA 5FJRA 2QDDA 4MGGA 3U9IA 4GYPA 4HYRA 3V5CA 2PTXA 3N6JA 4IL0A 2GGEA 1E9IA 1IYXA 2QJNA 1JCTA 2GGGA 3BJSA 3TW9A 1MUCA 4K1WA 2CHRA 3CB3A 3P93A 4HNLA 3EKGA 4E4UA 1P43A 4E4FA 2PU0A 2OG9A 3FXGA 2XH7A 3VDGA 1ONEA 4A3RA 3MQTA 2RDXA 2MNRA 3DEQA 3NXLA 2HXTA 3R25A 3UXKA 4KEMA 2PP3A 1WUFA 2PCEA 3DESA 3VCCA 4DYEA 2OPJA 4E5TA 3RR1A 1MDRA 2PU1A 3SJNA 1KCZA 4JN8A 3QKEA 4H19A 2GDQA 3R0UA 3UXLA 3MWCA 1W6TA 3UJ2A 4IP4A 3IK4A 5BOFA 3VCNA 3QLDA 3DG3A 3IJQA 1BKHA 1XS2A 3CXOA 2OQYA 2PPGA 3P0WA 3ES8A 2AKZA 4IT1A 2ONEA 1TKKA 1SJBA 3H12A 2FYMA 3I6TA 2QJJA 3T4WA 5J04A 3N6HA 3Q45A 3ZVHB 3DERA 3DG7A 2PA6A 2QVHA 4KT2A 2AL2B 1RVKA 4X2PA 4HN8A 1FHUA 4GGBA 3S5SA 1KD0A 2P8CA 2GGHA 3RCYA 3CAWA 2OZ8A 1MDLA 3DFYA 2PP0A 3K1GA 2P88A 4M6UA 1EC8A 2PTYA 3EEZA 4HNCA 3B97A 3TQPA 1R6WA 1ECQA 2QJMA 4JHMA 3RGTA 3V4BA 5ENLA 3H8AA 3SQSA 4MMWA 5BOEA 3R1ZA 3PWIA 2PS2A 3DG6A 3TWBA 1F9CA 1MNSA 3Q4DA 1BQGA 3UCDA 3D46A 2GGIA 3VC5A 4E8GA 5FJTA 3H7VA 3GO2A 4K2SA 4GFIA 3STPA 2ZC8A 4HCDA 2PGWA 2AL1A 1FHVA 1ELSA 4FP1A 3RO6A 4DX3A 3TCSA 2XH2A 4IL2A 4K8GA 3T9PA 3VFCA 1EBHA 3MKCA 4IP5A 6ENLA 3VA8A 2GSHA 2GL5A 3DDMA 3U4FA 1YEYA 4J3ZA 2OZ3A 2PMQA 3DFHA 3N4FA 4JN7A 4A35A 1SJAA 1MRAA 1EC9A 4HCLA 4YWSA 4GMEA 2QDEA 3MZNA 4GGHA 1P48A 4GISA 2P0IA 3D47A 3S47A 2NQLA 2OVLA 1KKOA 2HZGA 3UJFA 3N4EA 3SSZA 3QTPA 2MUCA 2OZTA 3THUA 2PSNA 3ZLHA 3CYJA 3UJRA 3ES7A 4J1OA 4ENLA 2XH4A 2DW7A 4G7FA 3SN1A 3OW1A 4HCHA 3V5FA 4IZGA 2HXUA 2AL2A 2P3ZA 5FJOA 4FI4A 3UCCA 3SN4A 1JPMA 4H1ZA 3HPFA 1WUEA 3ENLA 3GD6A 3MSYA 3JVAA 2OLAA 1XPYA 1SJDA 2O56A 4A6GA 3I6EA 3OP2A 2P8BA 3JZUA 3MY9A 3OZMA 3RITA 3R10A 5FJPA 3T8QA 4KPLA 1L8PA 5IDZA 3CT2A 4DWDA 3TJIA 1NU5A 1PDZA 3JW7A 4ZCWA 3NO1A 3OTRA 3V3WA 3TTEA 1DTNA 2DW6A 2PTWA 2XSXA 3GY1A 3QN3A 1SJCA 4ROPA 4MKSA 2HNEA 3FYYA 3GC2A 2PTZA 2FKPA 3BOXA 2PGEA 3I4KA 2AKMA 4KWSA 3T6CA 4E6MA 3TJ4A 3FCPA 3UGVA 2OX4A 5EU9A 3DIPA 3OPSA 3FVDA 4GIRA 3R0KA 2I5QA 3VC6A 1EC7A 3UJSA 4M0XA 3NZGA 3PWGA 3TOYA 5FJUA 2PODA 4IHCA 4Z1YA 4H2HA 3RRAA 2POZA 3MUCA 3DGBA 3FV9A 3NFUA 2XGZA 2GGJA 3PFRA 1NELA 2QGYA 2OFJA 2QQ6A 3ZVIA 2ZADA 2PP1A 3QPEA 3CK5A 3ZVHA 3OZYA 1R0MA 3SBFA 1OEPA 3FJ4A 3TWAA 2OKTA 3ZLFA 3SN0A 4G8TA 4DN1A 4Z17A 1EBGA 3IJIA 4EWJA 3H70A 4ZA0A 4F4RA 3BSMA 4DHGA 1TZZA 3UJEA 3P3BA 3R11A 1JPDX 4DXKA 3PK7A 4HPNA 2XH0A 3KUMA 2OQHA
chains in the Genus database with same CATH superfamily
1CGYA 5TAOA 3G1AA 2VQTA 1GPWA 2HS8A 3SW6A 1LUCB 3HGJA 5C0QA 5G1YA 4D2JA 1M03A 3M47A 1G1YA 5DMYA 5CC3A 3P62A 3WQ6A 1WXYA 4XQ6A 4IISA 5AKQA 3VOGA 5ABEA 1E0XA 4GYFA 2WWDA 1KA9F 2Z4GA 2VXNA 2J62A 5IFPA 1W1B1 3S2NA 1DHKA 4CU7A 3L0NA 2XVKA 1E73M 5C54A 4NAEA 3UA4A 4O14A 1E4IA 1FVPA 3LTPA 1F7BA 1A80A 1PIIA 1Q6LA 4MJ4A 4LC8A 4H4ZA 1SFTA 5IRPA 5BCAA 4HSOA 2V2DA 3KBSA 2PP3A 4X63A 2FGZA 5AC4A 2PCEA 4QCFA 3DH9A 1XR2A 4KQNA 4X0VA 3EPOA 2ZUWA 3BCJA 3HF3A 4PTWA 3RR1A 4Q7IA 2PWDA 4PBEA 3CWOX 1AZ1A 3LDVA 3W28A 1I2RA 1V6TA 2WJZA 3UCQA 2ZUTA 3Q58A 3AXMA 1T96A 1Q6DA 1XUUA 1NFPA 1UW9A 4B5NA 1GW9A 3GVQA 4XZMX 3ZT5A 4LAUA 1OFDA 5AC5A 1EEXA 2VKZG 4Y90A 1JG9A 1W5QA 2QUVA 2CBVA 3LNMA 1XIEA 2BOGX 1LOSA 1SJBA 2X7WA 3M0XA 2HV5A 1YKWA 3W2UA 3ABQA 3B9DA 3AMDA 3DXIA 4DEFA 1VHCA 3II4A 3TH6A 3B8SA 1Z89A 3C2EA 1KM6A 2P8CA 3WNLA 4ZODA 2FFIA 1EZWA 2WOVA 1DJNA 3VMPA 3NSNA 4FNQA 2BVDA 5JBEA 1WPCA 4LTSA 3K13A 2X50A 2G3JA 3CUZA 3R7MA 5CH9A 4G1KA 1LP6A 1TRIA 2R1NA 3W7EA 4RK8A 3AN1A 2NX3A 3TWBA 3LMZA 2VTFA 3QHOA 2FFCA 1K4QA 3ELFA 1XG4A 3ALFA 4HCDA 4IOTA 2V9DA 3WEMA 1JDDA 2J9ZA 4PTDA 2ZDSA 4HA1A 3BUVA 3FX4A 1QAPA 3QY7A 4J3VA 1V0MA 1A4LA 3VVGA 2E1WA 4UZSA 4L7ZA 3PBUA 1OC5A 4CQBA 2Y89A 1SZGA 4G1NA 2OZ3A 3HBLA 1LRNA 3H2AA 3BE7A 3PM6A 3V5OA 2Y2WA 2ALDA 4XAYA 2FJKA 4U4MA 1WKDA 1AODA 4WXZA 2Q8LA 4UQCA 4J40A 3TP4A 4IQEA 1ZK7A 4I6KA 2G37A 1UWIA 4U5KA 4WHBA 3UJRA 3H53A 4MNMA 1E56A 4PMDA 4FLQA 2ZUVA 1J18A 2VX7A 2E25A 3OGRA 4BK9A 2BNJA 2RKXA 3SN1A 4D6JA 2QUTA 4L6DA 4CNNA 4DELA 3TYEA 2AL2A 3BCDA 3BANA 4RDVA 4QROA 1BHGA 4JTQA 3W74A 4PYSA 3E0VA 3B4YA 3SN4A 1X38A 3BCFA 3C2VA 1THFD 1A5AA 3L5MA 5D2TA 3UZ5A 1VFFA 1PTAA 3VCRA 1AG1O 4H6QA 1M7XA 4FXJA 2Z1BA 2YL8A 5AHMA 1L8PA 5IDZA 3MUAA 2GVJA 3KOFA 1O4UA 3FA5A 2Q02A 2WAGA 1UH2A 5D09A 3JW7A 2YB4A 1DTNA 1KFLA 4IGMA 1A0EA 5AY7A 3RPMA 4LUJA 2BFGA 1R30A 3CZ8A 5K4ZA 2R1MA 3EX1A 4GD0A 3FYYA 3QF0A 4MYAA 3INPA 5AZ0A 4EQSA 1HJWA 1QJWA 3L4WA 1GORA 2SFPA 4PMZA 4S2CA 4J3TA 2P5NA 2XFYA 3G1FA 1P4CA 4W87A 4MNJA 2OT1A 3RPDA 2W55A 2V3AA 3FVDA 4MF4A 3GNOA 1AH4A 4NJJA 3LTSA 5HQMA 4PMJA 3WQEA 3PS7A 4GVGA 1JYWA 3BQ6A 3GXPA 1NSJA 2AQOA 2EQDA 1Q2RA 3TN3A 3GDBA 1EJXC 1JGMA 4XVEA 3NQ7A 1ZGDA 4G56A 2QGYA 2ABAA 4W7UA 1RPKA 1XIDA 1OD8A 3S5ZA 5M17A 2VWTA 3AYVA 1JJKA 2Q8XA 4HSNA 5CC6A 3CAVA 4CNSA 3PUOA 4LS0A 1U22A 4BS0A 2OR2A 4G8TA 3TR2A 1US3A 3IGSA 4FXFA 1CB2A 3Q94A 1GVYA 5E5CA 4Q8WA 4HHPA 5DF0A 3DJJA 3C0QA 1LWIA 2NQZA 5A3HA 1U1UA 3K8LA 2PDWA 4NILA 3DKJA 5GJMA 3SIZA 5CZ0A 2DZBA 1W3NA 4V1XA 1T0OA 2ZZ6A 4HPNA 2XH0A 4MG4A 4XAZA 4QDWA 5M3WA 5FAGA 4ATLA 3IJLA 1C91A 4F0HA 3A13A 4UFIA 5LA0A 1MNZA 4WDTA 4E8CA 4RE4A 3HGSA 2VEKA 4KGJA 3BGJA 1P6BA 2QDDA 5EFFA 5G5IA 1W1YA 2J7BA 3RX4A 2H90A 1YBQB 2VX4A 2NX1A 1C7TA 2V38A 2VDHA 3AYRA 3QFEA 3CQKA 1VGAA 4UCGA 4YWOA 3LADA 3FXYA 1FCBA 1MUCA 4TVYA 3AMGA 3SQMA 3DYPA 1OT1A 1K9FA 1EXBA 3LD5A 4E4UA 4XIMA 3UBPC 4E4FA 1ZHAA 4YTRA 2YYUA 4LYPA 3LB0A 4J57A 3H2OA 1DXLA 1IT7A 3AUJA 3C52A 4ICNA 3W7CA 3AQUA 5AHIA 3B04A 1HZYA 2C14A 3MI6A 3LTYA 1B9ZA 5D30A 2ALRA 4C6EA 4XX6A 4P5UA 1OFOA 3WNKA 2A5HA 2J24A 1PTDA 4ONVA 3V35A 3WLKX 1WUFA 4PUUA 3UWVA 4H4WA 2HSAA 5T91A 1U2YA 2V82A 1OFBA 2CLLA 1W8GA 3QKZA 4BJHA 1ZNNA 1CXKA 4DJEC 1XYBA 3B0UX 3Q2DA 2IPWA 4QISA 1ITQA 3CTTA 4GG9A 4H6KA 2BOFX 3HA1A 4DJFD 1XD1A 4FR6A 4QLKA 3B9AA 1JUEA 5HWMA 4NNBA 4AWSA 1AVAA 1V77A 4LBRA 4JQ4A 1CLVA 3P0WA 3HG3A 1KGXA 1Q2SA 2WSKA 3NAVA 3TAKA 1KM4A 1BGAA 5REQB 5CAHA 4LV4A 1B3XA 2A7PA 2PLJA 1XKYA 3LCHA 4JNMA 1KBKA 4UOJA 4KT2A 2ZX6A 4C5YA 3GWQA 1GVFA 1HGWA 1VCGA 1W1IE 1IV8A 2XWDA 5IM51 4OV4A 1FWTA 1KFBA 4QE1A 4LT9A 3V16A 4R3UA 5C2XA 1V7AA 7PTDA 3UY7A 4HYWA 1WA3A 2F2KA 3GTHA 4AXKA 3MKVA 4GVIA 1WX0A 1EIBA 5MKGB 2OWCA 2HVMA 1ECQA 3RGTA 2X0HA 3PTQA 1TTQA 3DHPA 4JD4A 4XBJA 4PTNA 1TQJA 2BS9A 5HWJA 2VHLA 3GUGA 3OU8A 1F3WA 3N9RA 4GI6A 2Z1KA 2RDUA 1XI3A 3STPA 3G1DA 3IWPA 2V30A 1MUMA 4F48A 1HKVA 4GI9A 1QI5A 1M9HA 4EACA 3BLIA 4OOZA 3A6OA 3MBDA 3URQA 4WRHA 3M64A 4ZSTA 3BGAA 3NVDA 5I3JA 3GHUA 2NWRA 5JIWA 3CS2A 3VKBA 5I77A 3T44A 4MAZA 1E6ZA 3I65A 5TNVA 2C16A 3XISA 4BI5A 3FJNA 3EMCA 3VA8A 4BKNA 4CN4A 4QG9A 5DN1A 3U4FA 3WZ0E 3VZZA 1IHIA 2I5GA 2PF8A 1ZAJA 1ME7A 1ZP3A 2OCZA 3NURA 4J3ZA 2O7QA 1AD1A 3R4IA 5H1WA 4HNNA 1JQVA 6PTDA 3S5NA 4GXWA 4YU1A 3AIQA 2O4MA 4GGHA 4HKPA 4UTJA 4MNLA 2P0IA 2QCDA 1UR4A 1Z44A 1KKOA 4DUOA 1VP5A 3MVIA 1GG1A 3KBVA 3SRDA 1GRTA 3TK7A 2AQWA 4GQ0A 1H2JA 3IJ7A 1HL2A 4AZCA 3GAYA 3EDJA 2AAMA 4OJYA 1MI3A 4RZ5A 3CHVA 2BY2A 3ARRA 3EMQA 3V18A 3N9SA 4NJGA 4AMCA 2GK1B 4ALDA 2VJXA 4MADA 6TIMA 4C6QA 3BARA 4RE3A 4NNCA 4ERGA 2PWVA 1R3TA 1S1RA 3NWRA 3SUVA 1YYAA 3SR6B 5K9CA 2GVLA 3KS5A 4LGXA 1H50A 1TUXA 3KRZA 4LU0A 2QMKA 2WJDA 4Z08A 3UU0A 3U5YA 3U57A 4DJDA 4IFRA 5I3FA 5BW6A 3WH5A 3RM9A 5LNUA 2BXVA 1J93A 3T55A 1X1ZA 2ISVA 3PF3A 4H4RA 1R3RA 2J79A 2Z29A 2EJAA 3TLLA 4DBSA 3NQVA 5A6JA 5I24A 3AWNA 4CQ9A 3OOQA 3AI0A 3WUGA 3GY1A 3ZSTA 4RE0A 1VBGA 3VGGA 4MKSA 1F4AA 4A21A 1FDYA 3DHUA 4LVAA 4Q8UA 3RCMA 2H8XA 3PAJA 3WBWA 3GG1A 3GFXA 4GCAA 3STCA 1RP8A 4YNGA 4IM4A 3F7JA 4ZOBA 1B57A 3GS6A 4YIWA 1XIFA 3MUXA 1ZCOA 4ORMA 4EPBC 3USBA 2ZRWA 3FGCB 3G1HA 3BLKA 1W9BM 3VILA 2PODA 3VM7A 3BLFA 1VZWA 2WMFA 4LUIA 2YVGA 1J5SA 5BNKA 1NHRA 3F4CA 1NELA 3T8LA 1T8QA 1Y7VA 1M3UA 2QQ6A 3I68A 4UQBA 3S8HA 1RQBA 1GVQA 2HISA 2C8NA 1P0BA 2O9PA 1ZBCA 1ZUAX 1XGZA 4UOZA 4YWIA 1OEPA 3M9YA 4R85A 2E5DA 1XFBA 4Y8EA 1JYVA 1GOQA 4KIRA 3SM0A 3IJIA 4MYXA 1T6MA 4EWJA 1AZ2A 3H70A 4ZA0A 1GQLA 2QUMA 5I2UA 5EBKA 4IGNA 4MZYA 4LUYA 1XYMA 3P3BA 1UIPA 4TV6A 4I6VA 1XCXA 4FNUA 4PRRA 2A4AA 4OVXA 4UTTA 3APTA 1FKWA 3KUMA 4O16A 2VEMA 3KXQA 5I6SA 4B3KA 2GUYA 3KE0A 1M1BA 3IANA 4RPPA 1U5HA 3ZJ8A 4C6IA 3ORWA 4EM3A 3L68A 2GRTA 1ZTVA 3SCOA 3RMJA 1HNYA 1CNVA 3NXFA 5DMMA 2Y8KA 3L2IA 3N6JA 4UBPC 1ZZMA 2CPUA 1O5XA 2GGEA 4R9OA 4GJ1A 4NI8A 4ATWA 4JTAA 4I7VA 1GKQA 1OK6A 3ZWSA 4FB7A 7TIMA 3N2TA 1ONRA 4KCWA 4Z0JA 1I2NA 3P93A 1W9DM 8XIAA 2XINA 5I0DA 5C6MA 1XLDA 1A0CA 4C1LA 2OT0A 2GQWA 3DFPA 1V6UA 3IK2A 4R7OA 2BODX 5LA1A 3BLLA 1BRLA 4Y7EA 4LFYA 1FP8A 5A8PA 1H7XA 5DCEA 4J2MA 5A6KA 5A8OA 1MYRA 4U2YA 4J9JA 3SO7A 4S3GA 4O4WA 1XLJA 3M5ZA 3SY8A 4JICA 3AU6A 1YQZA 1PHWA 3VCCA 1EB3A 4E5TA 4QXIA 3T7VA 1TB3A 1CXFA 2PU1A 1PZ1A 4PSPA 2ADAA 2FVLA 1KM2A 1YDOA 2G5WA 4JIPA 3NS1B 4IMCA 1ZKQA 3WQCA 1BPLB 3B9JB 1C3FA 3W76A 5EL1A 3L2LA 1H7WA 4AY1A 3U8GA 5DCBA 4RCXA 3W2NA 1HJUA 1TKKA 3CMFA 2PLCA 5K9DA 1TCMA 3NGFA 2VZOA 2G95A 2PC4A 1MW1A 3NPVA 1NQKA 2DV0A 5HA7A 4JXCA 4JYDA 2QVHA 3E2RA 1PVNA 1YRRA 1WZMA 4FX7A 4W85A 4C90A 3UEQA 1H5VA 1N2VA 1OX5A 4MLRA 3B03A 1ISXA 1H4PA 4WY0F 3NQFA 4KBXA 3K4DA 3I3EA 4QNEA 1PWMA 4BV6A 4MWAC 2BP1A 5CBJA 3KRSA 4FIRA 5ENLA 3W07A 5EYWA 1WDPA 1R38A 1PYMA 3NIYA 3A5VA 4GQGA 1A53A 2BZNA 5C2CA 3SY1A 1KRBC 4TO8A 5DBUA 1J6OA 3GXMA 3LCLA 3WJXA 5A6BA 4M8UA 4PN2A 2AL1A 3RUBL 4LVGA 1H60A 1TV8A 4EP8C 1EDTA 4O12A 5KVHA 3WUBA 4MAVA 1T40A 2BMBA 5ABFB 1CB7B 1EHNA 4J28A 4XD4A 1SMAA 5CAKA 1H0GA 3DN5A 3NYZA 1XX1A 2ZDRA 2PDJA 8RUCA 1WDRA 3GM8A 4LF1A 2W63A 2WBGA 3KVMA 1IXQA 4NZ4A 4A3QA 1YEYA 2B7QA 4JCLA 1T7LA 2WXDM 2VO5A 1SJAA 1EDGA 3V0UA 4H4PA 4LCQA 1J2BA 4HCLA 1T41A 4AD4A 3SCWA 1OIFA 5C7HA 3MZNA 5HR7A 1JCXA 4Q33A 1SW0A 2VOTA 4PTMA 1J96A 3THQA 4Y9OA 2E8ZA 1JXKA 4HMDA 3T05A 3V0SA 1F3TA 1VC4A 5XIMA 3LHTA 4C6KA 3K46A 4TU1A 1X97A 4BEQA 1PB0A 4Y6GA 3O6DA 1IZKA 1EP3A 2DZVA 2VR5A 3V5FA 4IZGA 1LT7A 1JAEA 4JTGA 3CM4A 3GXTA 4FI4A 3NJ3A 1OX6A 2GSEA 3EWUA 4BHYA 1JROA 2WPGA 4UTIA 3WQ5A 3XINA 4IUGA 1AQFA 3KBNA 3DX5A 3LENA 3MSYA 3K2GA 4PUDA 4RUBA 4ZENA 3RCNA 5TF0A 2YPIA 4NZ3A 1HVXA 3A3HA 1GPFA 2C15A 4FIQA 1VLIA 4A8NA 1UKPA 3VE7A 3WFZA 1HO4A 1F8IA 2OX1A 2G3NA 3MKKA 3RX2A 4DWSB 5FSDC 3RJXA 5AB3A 4J3UA 1TA3B 2YB1A 1DVJA 3AOFA 2A0NA 3EANA 1F8WA 4QFUA 4O52A 2Y61A 3OVQA 3HB9A 1KQZA 3GNPA 3ETRB 4B91A 4N7QA 1AQ0A 1SZNA 2H8ZA 5LZLA 4DWSD 4KRUA 3PPCA 2UWFA 1QPOA 3RR4A 1ADDA 3PZQA 3M44A 1Y5WA 4E6MA 5AHFA 1K9EA 4J5NA 3LHUA 1ONXA 1TPH1 5I23A 4NX5A 4RNFA 3LHZA 4IJRA 4O18A 4NNAA 3KS6A 4HA0A 1Q63A 2FGLA 3SURA 5IFTA 1RAKA 4ZTXA 2NX9A 5CPSA 2QCHA 5FJUA 1JIBA 1OYAA 5CPOA 1NFGA 1K9DA 1OGSA 4TV5A 3W7HA 1NVMA 2J75A 3HQ1A 3WL0A 2DJXA 1T5AA 1P1XA 3CHCA 3WK0A 1V79A 2RH9A 3JUGA 3WO8A 3U5UA 3CL8A 2EKCA 2AGTA 2PBOA 5CLWA 4WXYA 5HJXA 2YL9A 2E5CA 1HJVA 4KWVA 4JHOA 2Y7DA 1QHPA 3UZYA 2VFIA 2ZZ2A 4BWLC 1W9XA 1F6YA 1QOQA 4H50A 4TQTA 3TV8A 1DWAM 2BB0A 3AS3A 4F4RA 2YIHA 2V8ZA 2XDFA 1BXBA 4DZHA 2A7RA 1JD9A 2BVYA 4M6VA 3GRSA 3CO4A 3IARA 4H6RA 2DQWA 1HG3A 3E12A 4IGHA 3UR8A 1LM1A 1QMLA 3FVMA 3ARUA 3VOHA 3MP5A 3L4ZA 2OQHA 1QUMA 2VGBA 1RXOB 1MUWA 2OO0A 3EEGA 2XZ9A 4IF2A 2VGGA 1E55A 4PRTA 1KLYA 4MZ8A 3P74A 4KFNA 4YVVA 4L4PA 3KFTA 4PBGA 3EX6A 3T1GA 2HTMA 4GNVA 4DB7A 1WB0A 2E0PA 3ZT6A 3GRTA 4EWND 2J88A 4YMZA 1XUZA 3CV2A 3O63A 2PU0A 1DWGM 1KBJA 2OG9A 4GJIA 1LPFA 2FZBA 1GQKA 3L5OA 4N2YA 4HHHA 7ODCA 4XKYB 1GRFA 1JI1A 3OA5A 1KC7A 3LSBA 3DEQA 3C0LA 4AH7A 1YNPA 3BW3A 1O5QA 2V5BA 5JMUA 1I2QA 5LXXA 2NLYA 3RDKA 1V6WA 3K4AA 1WDQA 4UOQA 2Z28A 9CGTA 4PBFA 5LIYX 4FOKA 3QZEA 3NQ8A 5HJYA 3MWCA 3DK4A 4DZ5A 3R07C 3EYPA 4O11A 2Z27A 3CLMA 4QJ3B 2JK2A 3BVJA 1OSEA 1K7FA 3H2NA 2CESA 1G94A 4P61A 1OCBA 1LL7A 2QAEA 1B0IA 4CKQA 1MO9A 5JCLA 4IT1A 3UVAA 2IKIA 1ITXA 1FHDA 1SUXA 2DUXA 1S5MA 4Z2IA 4DO4A 2FYMA 4GNJA 4Q8TA 3Q45A 3ZVHB 3DERA 4ROQA 2DGAA 1YHTA 2PA6A 3PZUA 1XPGA 1LDCA 1RVKA 4JAWA 2E8YA 3S5SA 4H9XA 3L8KA 1W0MA 1SW7A 2Y85A 1JCNA 4F66A 2VCAA 1MDLA 2DSUA 3UQNA 3UNTA 3HOJA 3M1ZA 3E6EA 1AW5A 1CBGA 4JL2A 5CSSA 2JGYA 4BR1A 2EG8A 1TG7A 2PDKA 3LRLA 4QDPA 4AFYA 1GRBA 2GSJA 5DT7A 4TMBA 1O7AA 4MMWA 3TFCA 5CQ1A 3UCDA 1ADOA 3EX3A 3HG4A 1ODUA 3WLMA 3G22A 1JDAA 2WLZA 1RZMA 1GKPA 2J74A 5GJNA 2ZX7A 4MNKA 4Q4PA 3TEVA 4DM2A 3GXNA 2OODA 3GKFA 2V67A 4C6JA 4LYKA 2CZEA 2B4GA 5IBXA 3QPYA 1K4HA 3GNRA 4I8YA 2CLPA 4L6OA 2O4QA 1O66A 4HD5A 4IP5A 4AIUA 3VTRA 5D04C 3N2BA 3V7PA 1D3GA 1JZ6A 5LKYA 1OFRA 5JBFA 1N8WA 1XGEA 3S9ZA 3CH9A 3PZVA 1X2GA 4B5VA 3LV6A 5D05A 4XISA 1P48A 2DDXA 3BJTA 4LVBA 4MUPA 4B5XA 3KZSA 1VCVA 2HZGA 1BEUA 1V03A 3N4EA 3RXZA 3QTPA 2YL5A 2EQ7A 3THUA 5CBIA 4PULA 5KZEA 4ERIA 1DWFM 2VM8A 3ZOAA 1RLDA 2DW7A 2CFFA 1H0IA 2WW5A 2D1ZA 3ABZA 4IG2A 3ZQ9A 3IVTA 4QEEA 3NOYA 4BQ4A 2NXGA 4R7WA 4LC6A 1UA7A 5TIMA 2HCVA 2DIKA 3W7IA 3L4XA 4REQB 2QXWA 3NZ1A 4GVHA 2ZZCA 2Y7GA 5JRBA 5A6TC 3BAKA 3WNNA 1A5SA 1M7PA 2HE8A 4GC3A 3A7RA 1KXQA 3O1NA 3N3MA 4US5D 3W29A 2OLAA 1GZJA 1ADSA 4C6FA 4DZIA 1ZY8A 2ZRYA 4GRSA 4KPLA 2YDQA 3PR2A 4A3UA 4NIRA 1VKFA 1PX8A 1QNQA 4F0MA 5BOOA 1H7OA 2HS6A 3AHZA 3PZGA 4Z2KA 3A21A 1FDJA 1MQQA 4ADWA 2FB2A 3ANVA 2VYOA 1Z41A 4CU8A 4KW2A 1CEOA 1KRMA 1GEUA 4MM1A 4O53A 1PJ9A 4IMFA 3QN3A 2VWSA 3AISA 4WUIA 4RNHA 3TYBA 4D6GA 1KM1A 4UIOA 1UUOA 4WY0B 3EAUA 3TUUA 1FWGC 4JY9A 1NDYA 2D23A 3W1AA 4EX4A 5L9FA 2VRKA 4QSFA 2O9TA 2EQ6A 1REQA 2VCCA 2WANA 3Q65A 3QVQA 1E1CA 3OEXA 4B15A 2X0YA 4Q22A 4UTMA 4KPRA 5DCDA 1TPEA 2BX7A 3WCZA 3EOEA 4IMGA 3AXIA 2BG5A 5D8ZA 4KGLA 1H1ZA 1W3TA 4GY0A 4AEEA 4M19A 4R34A 3WH9A 4B2DA 1KW1A 6A3HA 4LEQA 1EHAA 3OZYA 4U33A 3W7LA 1NHPA 2VVNA 2H9AB 2YCIX 1PZ2A 2R1KA 4DY1A 3B0VC 4Z17A 4JDRA 3M5YA 3AS0A 3H4WA 3RAOA 3C6CA 4XD5A 2RFGA 5F2GA 4DJDC 1TZZA 4Q4OA 1QW9A 4HMCA 1IT8A 2GDVA 1RJPA 3CIWA 2GPTA 5E0KA 3WUEA 4DLFA 2BHYA 1W3IA 1XFCA 1DPMA 4JIIX 1KLZA 1T3QC 4EMJA 2XM1A 1F4HA 3RILA 1ZCCA 3WKZA 2PDXA 4C60A 2GJLA 3DZ1A 1O94A 1B4KA 2DZSA 4LNCA 4GUJA 3OVGA 3WG6A 1S39A 1OGBA 3BLDA 4L4OA 1GEQA 1UZHA 4IXHA 5BXRA 1FECA 1R3YA 4K6AA 2TAAA 4QBXA 3EWWA 4QCEA 3BAIA 2VFEA 2WKJA 4XUYA 3AIVA 1JCTA 1PCWA 3W71A 2ISFA 3TYZA 3SUUA 3E49A 4LRSA 3CUXA 3LN3A 1P43A 1FX6A 1WAUA 1MEWA 4PSRA 1XIJA 4Z1DA 5CG0A 2XUCA 3QYSA 4WGHA 1EO5A 3PVFA 1S7MA 3UWZA 1Y5VA 2MNRA 3D0CA 1CCWB 3W6YA 2QAFA 2HXTA 3GYCA 1ZDLA 5FF4A 3LG3A 2J7EA 4KEMA 3HMCA 1JPHA 2VC6A 1W9UA 4GKTA 4CGTA 3ITOA 4ZO6A 5M5DA 3MB9A 3QKEA 1O5RA 1H1NA 2WCSA 1BSLA 2AQVA 2FH8A 1FFRA 4XAFA 1HFBA 2WPEA 3IK4A 1LJYA 1E6QM 1TTIA 2F9RA 3QLDA 3QFBA 3TMLA 2NUWA 1EIXA 4LVFA 1GZGA 1PO9A 1YNYA 5F1UA 3W37A 4NHVA 4DF0A 3DK8A 2IKGA 2AKZA 2I17A 5BRQA 4NXSA 2E4TA 3PG9A 1B31A 2F7FA 3SCPA 3I6TA 2V81A 1SU5A 3W7PA 5J04A 2Z1VA 4GZJA 4WCJA 4HSHA 2WHKA 4BFAA 1UJPA 1TWZA 4FA3A 4H04A 1FOBA 1FHUA 4GGBA 4LNYA 4GNKB 2WNQA 4GQBA 2F84A 4C6PA 2R82A 1O6IA 3U48A 1XLBA 3DFOA 1GCYA 2VCBA 3F5JA 4AWUA 3ZT7A 3ARZA 3RMEA 3QZ6A 4GI8A 3WLOA 1EX5A 2CBJA 3KOWA 5JUVA 1GV4A 3V4BA 4GIYA 4XSMA 4PC8A 4HOXA 3URBA 4HPXA 1TYPA 5FESA 2DH3A 5FKYA 3ARPA 4KIEA 2X2YA 3VC5A 4TXEA 1A5UA 4GUFA 3MJMA 4GFIA 3PJWA 3F2CA 5FD0A 1E6SM 3TSDA 3A23A 1XLFA 1UC4A 2XH2A 2WQDA 1Q7QA 2WMJA 5DANA 1IEWA 4EXBA 1ZSXA 3GR4A 3FNDA 3B40A 4PMUA 1BSIA 1EP1A 1R9ZA 4GY1A 1OVDA 5L6UA 1DBTA 4V33A 3GR8A 1JZ4A 3W1UA 5BXSA 3W7GA 4JN7A 1Q6CA 7TAAA 4JTIA 5AC6A 4ZE5A 2NQHA 2QDEA 4BF7A 3WF0A 2Z2BA 3LZ3A 3BAYA 4GUHA 1DJZA 3KCLA 2ZZ7A 1GRHA 2TSYA 4H8HA 1CYGA 3AROA 4PA8A 1R87A 3AFBA 1TUFA 1ICSA 4CQ8A 5H8PA 1TPWA 1MRQA 1UWRA 4ML9A 3C0SA 4H4TA 1S2TA 1QASA 1WE5A 3UCCA 4UTWA 4F2UA 5HQLA 3LA4A 3MSDA 1IIHA 3STEA 3FAXA 3EMZA 1YBQA 3UG3A 2F2HA 4B92A 1O5KA 1AL7A 1VBRA 3ALGA 3NVYB 1XPYA 2H6RA 1WKYA 5ECUA 1KRCC 3J7HA 4IPLA 5FJPA 3H2CA 4LUTB 4DJED 2CBIA 1UD5A 1UR1A 1S5TA 2A85A 4I9AA 4O8AA 3PBVA 3W22A 5T8GA 1W32A 2XSXA 2QJHA 5D33A 2D69A 5A69A 4ROPA 5TR3A 5AHEA 1LZOA 5F4XA 4U3CA 3TCEA 4H9MA 4QHRA 2TODA 3FDGA 3FDKA 2CYGA 3A12A 3O0HA 1FH9A 2REQA 1C29A 1FWSA 1DJHA 3BOXA 1ZS2A 5TBOA 3CB8A 2PGEA 3B9OA 2DSZA 4DJFA 4KWSA 1UBSA 1O1HA 3AJ7A 3C2OA 4JTSA 1E71M 2FMOA 1XD0A 1D3HA 3LZ5A 3BV4A 2VP8A 2Z2UA 2FGBA 3G1YA 4GIRA 2I5QA 4XAPA 1S1PA 3NL3A 1QNOA 3MPGA 2WVUA 4M0XA 3OO2A 4LWWA 2DJLA 3PWGA 3VIMA 4KKXA 3LHYA 1EJ7L 5GNXA 4F9JA 4W9TA 1UZDA 3EOUA 4N9BA 1RBOB 3MP4A 3M6YA 1YTEA 2PP1A 4K39A 2WM1A 1LWHA 3T0BA 3CK5A 4UQAA 5BU9A 3HQPA 1UOZA 3CAKA 3UETA 5HPOA 2EQ9A 5I3GA 3WLPA 2D3NA 3CQIA 1XISA 4M1BA 1C9WA 3MMUA 4UC5A 1FWHC 1VS1A 1FFUC 3IJDA 4IFKB 5JVLA 3ONCA 1B3ZA 4ZVJA 4RKAA 3RLVA 1OZMA 2V3FA 3W1LA 2E5BA 4IPNB 2CDUA 5EPDA 3P67A 1J9YA 4AZBA 2QJGA 4MFEA 1UBPC 4L9XA 5I09A 4CN1A 1YPFA 4GXPA 4O1DA 1PBGA 2HK1A 5F2LA 3W24A 1WKFA 1ENUA 1VBHA 4HK6A 4UMCA 4DUXA 2VEIA 2WK2A 2NVDA 1US0A 3UP8A 3O2LA 4CCZA 3LSCA 2X0SA 1SQ7A 1A4MA 2OSYA 3ZLGA 1PKLA 3N3TA 3CGDA 5LNRA 2JGQA 3N04A 3H21A 4JYFA 2XVLA 3VIOA 4ZXLA 3S2MA 4C1KA 3TKFA 3ICJA 2XISA 1QI3A 3F2BA 2BHZA 1UOKA 1W9VA 3GHRA 4H7ZA 3KBMA 4DXVA 4HZ6A 3IUDA 1VFSA 1QHZA 4H8VA 3PWAA 2HWGA 1H63A 2EF9A 1RCXB 1XYFA 4DAFA 4UQEA 3MCOA 3CEPA 1R3QA 3EBVA 4AD5A 4GINA 4I7UA 4A4AA 4H2CA 4QAWA 3S1GA 1MEHA 4JFUA 4GBDA 3SGZA 5JBDA 1PAMA 4YN5A 3BLEA 2PDPA 4MB5A 3Q37A 1UD6A 4F0RA 4S3EA 2PUZA 3PG8A 3MI3A 1AJ0A 3NM1A 3T09A 1EXPA 3AMLA 2YFOA 4DYEA 2OPJA 3OVPA 2YVJA 3NR0A 1J0ZA 1GQNA 2GDQA 4J4KA 1UJQA 1JRPA 1Q4WA 3GDLA 3QR0A 3VCNA 4QJ4B 4XIAA 1RA0A 1VFTA 1XH0A 3DG3A 8XIMA 3EF6A 1W5NA 3CYVA 2I7GA 3AMZA 1CENA 2NQJA 4JFTA 1TZ7A 3OG3A 2FQIA 3GK0A 3RNMA 3MSGA 1E15A 3QMRA 4OHQA 2BSLA 1QI0A 3XIMA 2V3GA 4UR9A 3VM5A 4B5TA 1HO1A 5C7VA 2A6NA 4W89A 1TTPA 4FLRA 3VABA 3G1SA 3DG7A 4HOWA 3VD9A 1CI1A 1X8FA 1ZALA 4ZTYA 4FHAA 5FS6A 2JKEA 4NU7A 1Z42A 3F1QA 3H4XA 5F2IA 1C8QA 1ZJHA 4UTFA 3WELA 5JH1A 4LBUA 2GH5A 2VFHA 2UY2A 1E43A 4QX4A 3B97A 4F3HA 5D9PA 1XSKA 2V3DA 5G4EA 4LANA 4J27A 3SQSA 1OJTA 1ZJAA 3DI1A 3R1ZA 2J47A 3N29A 2R24A 2HVOA 1KFCA 5AYZA 5H91A 4YS1A 3S42A 3RPTA 1BQGA 4AEOA 3D3FA 1NWUA 3BW4A 2QIWA 3GC4A 5FJIA 4E8GA 2EQ8A 4X60A 4ACYA 5LIWX 2X8CA 1LLZA 1FHVA 4CEUC 1YE4A 1GTHA 4UZUA 4ZR8A 4K8HA 2ZRVA 3GAKA 2FPTA 4AX7A 3FGCA 4DBEA 1TR9A 1XYCA 2V5KA 5DY2A 3NPUA 1EJWC 3AMKA 3MKCA 4F2BA 4GBUA 5A2CA 1JD7A 4MTVA 2J7DA 1ESWA 4B4FA 2Z26A 1YMYA 4PMXA 2V5JA 1RBAA 2PMQA 3B0XA 1BWLA 4OU1A 1UH3A 2WZIA 1ZLPA 4WSJA 1GG0A 4YWSA 2CKRA 3WD0A 3CASA 3UR7A 2QCLA 3KM8A 1BWVA 4BQ5A 3Q67A 1X6UA 4NJIA 3HPAA 4ATDA 3QTGA 1C93A 2DZUA 5JH2A 2DZXA 3NQEA 1AL8A 4M7SA 1FWAC 1UKQA 1LOLA 3SUSA 3RNDA 3IJ9A 1Z69A 2UBPC 1H1YA 1QU4A 3SCUA 1TJ0A 2ASHA 2VFGA 1FIQB 3LUTA 2PGFA 2A3BA 1DJQA 1FQ0A 2A3CA 2CXEA 5T9BG 4Q8VA 1VR6A 2INZA 2WP6A 2IQ0A 2ZZ3A 3PUEA 3URHA 2NT0A 4JHZA 4HNVA 2YX0A 3URNA 1QOPA 3OQ8A 3R2GA 3HPFA 1US2A 2BTMA 4HU3A 3TX9A 3CQHA 2IQDA 4G7EB 2FIQA 3GZ3A 3OC4A 4MY9A 3G0SA 3L0GA 2JK6A 2VEFA 1UH4A 3EXRA 1H7PA 4EK7A 4W7VA 1FXPA 4XTIA 1O12A 1TPFA 5CZSA 4AXNA 3A7AA 4H4QA 1HKIA 3MMTA 1P6CA 5LGZA 4PCTA 4ICMA 5D9MA 2EEXA 3AM9A 1BKSA 4NYUA 2OSWA 3TLQA 4DI9A 5C9XA 1KTNA 4H7VA 5EMLA 3C86A 4UNKA 3CMJA 1SYTA 3V75A 4LY8A 4J35A 4EMWA 1ICPA 3SUTA 3O07A 1HL9A 3NZPA 2O0TA 1DXIA 1K3UA 3GU9A 3MUZ1 4OT7A 2IW0A 4DRSA 1KGUA 4OECA 3UWUA 1SM9A 3LS9A 1CXIA 5C5YA 4MWAB 3FCPA 3NQMA 3ARTA 3SCSA 1PYFA 4V28A 3ARYA 3DK9A 1U83A 2WBAA 5EA9A 3LBCA 1PS9A 3LEPA 3TYDA 1PUDA 3AYSA 4GVFA 8CGTA 4E38A 3WENA 3V0TA 4AD3A 4NAEB 1XLEA 1SFSA 2VT0A 2WVSA 4EQXA 4AIBA 4MWAD 2GUBA 2OKOA 1NWTA 2NV9A 3FV9A 3USZA 5AHNA 3QEZA 2YDSA 2OFJA 3CXBA 3ZVIA 1EWEA 3TZNA 1GNXA 1SR9A 3FJ4A 2FDMA 2WC3A 2R14A 3W1NA 4U10A 1IZCA 3UVIA 1PZ3A 2W61A 3HIJA 1V3JA 3DOPA 3E96A 3LHWA 4DHGA 1R2SA 1TV5A 5K4XA 2WMHA 3BZJA 2UY5A 1JF6A 3R11A 1JCJA 1JPDX 3VIIA 2YA2A 3FKRA 4AC1X 4FF7A 5E93A 4JTUA 4C6OA 1TE6A 4FEZA 2EO7A 4N6FA 1KKRA 4MZ1A 4IMEA 2IMRA 2C6QA 1H62A 2PE4A 2ZC1A 5CGQA 3APYA 3QR1A 3VYLA 4XV0A 1HKWA 3U9IA 1PIGA 3L23A 1V7YA 4HYRA 4S3BA 4LALA 3N11A 3DYOA 4DF2A 4ZFCA 3MMDA 1FY6A 1QCWA 1I1XA 3TZFA 5EFDA 2BGQA 4GY7A 2XIOA 2XIBA 4FX8A 5HQEA 3NL2A 1OF6A 4HB7A 3BG9A 2PWUA 1AK5A 1XV8A 5ABHA 3HU7A 4X61A 3M16A 5F1VA 4JEQA 3PTMA 1AW2A 4QGCA 3RHGA 2WV8A 4S3JA 4BI6A 4UFLA 1YDNA 4JGDA 3SUWA 3FYOA 1HTIA 3DESA 4GH3A 1N5XA 3GVVA 1LBMA 3HW2A 3QGVA 2V6AA 1FCQA 3GDRA 5IDIA 1MDRA 3QSTA 4UQDA 4Y9MA 4NZJA 4Y8FA 1F61A 3AJXA 5KETA 4CD4A 1MW3A 1FDZA 4P2VA 3UW6A 1F3EA 3VU2A 4DNMA 4D6EA 1NEYA 2ZUUA 2PWHA 4FNRA 4W86A 1I0DA 1XS2A 2YJQA 3MMWA 1O60A 3FSTA 3QFAA 3NQCA 4RZ6A 5HOSA 2X1TA 3KOZA 2PCQA 2J6VA 1BVWA 3VZXA 4F0SA 4AC7C 3FKKA 1I8JA 4MIMA 2G0WA 3OBKA 3VNZA 4RXGA 4ZEPA 1S5WA 3NVVB 1BVNP 2AL2B 1P5BA 4QR6A 4TX8A 3W2JA 1RLCL 4RLIA 1E9LA 4KMQA 3NL5A 3WY1A 2OZ8A 2FZNA 3O15A 5GRTA 1SZRA 1V02E 1TA3A 1GHSA 2P88A 3IUHA 4GKLA 5DQPA 5FL0A 4P8UA 4HNCA 1P7TA 3TQPA 5C9ZA 3MTWA 2XGIA 2QULA 5LA2A 2BBFA 2QJMA 1FWIC 4D9PA 1I6NA 3PWIA 1ME9A 3NQDA 1DIDA 5A8NA 3N15A 4Z2HA 3THCA 5C71A 1H6VA 3E5PA 5FMHA 2ZX8A 3WK3A 4NT0A 3VDHA 2ZC8A 2F6UA 2HK0A 1TELA 1PTGA 2JF6A 4FP1A 2PC8A 3RO6A 4DX3A 4KEVA 1B54A 4PL2A 3ZS4A 4F2TA 3UA3A 4F0KA 1K7XA 2VRQA 3L66A 3H23A 3DC0A 2X8HA 1NDWA 1U1JA 3G1RA 1DYSA 2XFRA 3S3GA 1RJQA 4A3HA 1MSSA 2G3IA 4FX9A 4ZL1A 4CVUA 2C1GA 2GL5A 2HE5A 1QWKA 3PC0A 4AZIA 1TYGA 3G3MA 3WH8A 1H7RA 1ZP4A 1L9WA 4A35A 3CV6A 3O8AA 2AMGA 2CBUA 1NF7A 4C7GA 2YXXA 1IT0A 4UWMA 1Y8BA 1EC9A 4GHRA 4M51A 2R1PA 3CZKA 3EKLA 4J2PA 1PHQA 4ZE4A 3WEZA 1ECEA 1G4SA 3BAXA 4D72A 5CSYA 2NUYA 3UWEA 2DT3A 3CWNA 4XVDA 1DJXA 2OZTA 4AHPA 3W25A 1RY8A 4AYSA 4XTDA 3GFZA 3DI0A 2D0HA 5JU6A 4QE4A 3IJ8A 2Y8UA 2QV5A 3KCJA 1HL8A 2YDRA 2HXUA 4GIAA 3SB0A 4EM4A 1HW6A 2ZUSA 4PEKA 1UUMA 3W23A 1JPMA 1EJVC 1ZBKA 4LX4A 3PNZA 4DYJA 1S2WA 1UWTA 1MQPA 3ZMRA 3WEOA 1TQXA 1KWGA 1W3HA 2JALA 3NCOA 3R8HA 3RK8A 2WSQA 1DIEA 3M6DA 4DAIA 3BG5A 3QY6A 3W70A 3WMBA 4W93A 4TR9A 5HNRA 1YX1A 1KO0A 1YXDA 2O92A 3KHJA 3GBDA 1UA3A 1JR1A 1NU5A 3NO3A 2GWGA 3OTRA 2C13A 1TR1A 4L64A 3HM7A 1WDDA 2AOSA 4NAFA 3H2EA 3N1AA 4K8DA 1S2AA 1AMYA 5F7UA 4I9JA 3REQA 4I3GA 1NTHA 3KLJA 3MC5A 1J01A 1UD4A 3CZGA 3HG2A 2FKPA 1KM5A 2DZWA 5CKSA 4MDPA 3SZ8A 2DIEA 1ZBVA 4UCFA 2CITA 3T6CA 4HHLA 3G1XA 3DIPA 5ABTA 5U7SA 1ISVA 3WMLA 1JCLA 1VJSA 2FJUB 5I3DA 2NT1A 1RK6A 3GIQA 3PZMA 4UFHA 3MS8A 5FA5A 2YGYA 1IQ8A 3GTFA 4JPGA 4AHOA 1VFLA 4Z2GA 3MT1A 2ZYFA 3H26A 3OG2A 5I3KA 1HT6A 4FO4A 3GD4A 1FO4A 4UTWC 1EA0A 2R9RA 3ZVHA 1QBAA 1R0MA 4UTLA 3NVWB 5D02A 4OFCA 5A2BA 1UP3A 4NI3A 2B7OA 2OYMA 2XIMA 1XC6A 4O0KA 4R7JA 1KCXA 1NM9A 3VZYA 1U33A 3TTOA 1LWJA 4JN6A 3UJEA 3AAMA 5E70A 5MF5A 5HNUA 5AYYA 1Q1WA 3UWYA 3WF4A 2DQXA 2AAQA 3PHAA 3GHTA 4GYPC 1E3XA 1BWCA 3E74A 5HUOA 2A7NA 5CXPA 2HEJA 5XIAA 2EG7A 3W7OA 3VI2A 2QNEA 1TPUA 1I45A 1BVZA 2WSPA 2YKKA 4MUZA 3PBWA 2EGZA 4WDXA 3DGHA 4G6CA 3RF9A 4V15A 2IPJA 2G4JA 5LIKX 4DF1A 3KL0A 2ISDA 2YCLB 1VYPX 1OFEA 2NVAA 3ATZA 3NYDA 2VUNA 1N55A 4GQRA 2JFEX 2RABA 1EA9C 4GZIA 1UMLA 3KOYA 5GQBA 1ME8A 4HOZA 4H9VA 3QQ1A 4HGXA 3WFAA 3THDA 1ONEA 4UTKA 4L1GA 4P8WA 2X16A 2OYLA 3NXLA 1W8SA 1KXVA 1PCKA 1TMQA 1M7JA 2CETA 4M3PA 1GYMA 3EX4A 3QGKC 5CPMA 1B3VA 4QJ5B 3BW2A 1LG1A 1X6NA 4A2RA 3E1F1 1I4NA 4D1IA 1DQUA 1VRXA 5JCMA 1SFJA 5ECVA 1DJIA 1W2PA 3TQKA 1W6TA 1S3HA 4US5A 1H2IA 2PD9A 3CUFA 3GBEA 5BOFA 2DP3A 1YXYA 3G1VA 1XJBA 4PGLA 4HIBA 1BKHA 5FACA 4AB4A 1P0NA 4GUGA 3EPMA 2PFHA 1B5TA 1LROA 4IIDA 2QCDB 3W1RA 4C6MA 4D1JA 1LBFA 3VFLA 2XN0A 4X22A 3NRZB 3CUIA 1NOWA 1LL6A 5FEWA 4QP0A 2CWNA 2VX5A 2KZHA 3BWWA 1N7KA 3IIVA 3IACA 3K4WA 4Z1BA 4C1NA 3TMQA 2ZFAA 1NARA 4OQVA 4EIVA 1CGTA 2ZXAA 3H24A 2WHJA 4BF5A 4ML4A 4APNA 1LOQA 1PX3A 5F2MA 1OFQA 3S0CA 1AD4A 1WYIA 4PB4A 4JQ1A 1UZ4A 5FIPA 4DNAA 2PTYA 4ZO9A 1MMFA 5HNNA 3P61A 3WQOA 4ZO8A 1R6WA 2PRLA 1I0BA 5I79A 4AWEA 1XC4A 3A4AA 4WY0A 1VHNA 1X8CA 1QVBA 4EPEC 5BOEA 3PB0A 2QVNA 4HQVA 1EF3A 1F9CA 4P8VA 3L9CA 1MNSA 4PB3A 3W7KA 3PANA 4WJXA 2IPGA 1W1VA 5DRCA 1ITCA 4OWGA 3R0DA 3LRKA 4LF2A 2NXIA 4QJ1A 4LPCA 5HR6A 4CD5A 4DJDD 2QF8A 1TV7A 3T2QA 4GA8A 2FHCA 4K8GA 1D3CA 1VDVA 4H41A 4CLMA 3P2VA 1DE6A 1IXNA 3KOXA 2GSHA 1UR2A 3G0UA 3G77A 1MW0A 3GG0A 6XIAA 2J3NA 1GJWA 2A6LA 1PE1A 1VPQA 2IS7A 3QQ0A 5HNTA 1MRAA 3U2EA 4GC4A 4PMOA 3GIYA 4HT3A 2J8TA 3VGDA 5I06A 4L1XA 3D47A 1UIOA 4H8UA 3MANA 5DO8A 2O55A 2QR6A 4TVCA 1Z32X 2XVGA 4FNTA 4G7FA 1T99A 2L5HA 2WJEA 1VQTA 4NQ1A 3EUB3 4F9DA 3AXHA 1WKEA 1I2OA 1EH9A 3H6OA 2ZTKA 3C2RA 1V6VA 3TE9A 6CGTA 3E5BA 4B5SA 4O15A 3WJSA 3A4JA 1ZJBA 2GWNA 1FUYA 3LCGA 4R5EA 2YXOA 4DPQA 3HRDC 4H4UA 1HVQA 1QDSA 1YDVA 3KTCA 1SSGA 3N18A 4CCDA 1H51A 1M6JA 4H4IA 3UPBA 3K1DA 4XZBA 3OBAA 3T8QA 3IS4A 3U4AA 4D6HA 2VL4A 1EOKA 2ZWYA 1KFEA 1DJYA 5FF3A 5A8QA 1XWYA 3UG5A 3TQ0A 3V3WA 3ID7A 4DO6A 2QCGA 3VIHA 3GVGA 4NEVA 3OODA 3FN9A 4O0QA 4N9DA 1HJSA 4EF8A 2O9OA 5BXTA 2DT2A 4C65A 3C2FA 3QLLA 2R8WA 3VNYA 3WL1A 5B80A 4K7ZA 4FDCB 3DJGX 1JFHA 2PURA 3MVTA 1X7IA 2OX4A 2WZMA 3V36A 1J4EA 4YYCA 4OBRA 3MDUA 1ZPTA 1RPXA 4Q6XA 1NHSA 5AHLA 4D6IA 1CXEA 3I10A 1JPIA 3QOKA 3R8GA 3WLRA 2E28A 5K9XA 4LB3A 3WQWA 3W3OA 1E9YB 3EZ4A 2KAUC 4NVTA 2QF7A 4ACZB 2D0GA 3DGBA 7REQB 2QMJA 5DEZA 3CGBA 3VDCA 3ARXA 1GRAA 1VFMA 4M81A 4R53A 3WH7A 3LGEA 4PUWA 1XXXA 1F3XA 4JQ9A 3GE7A 1WBHA 2ISWA 2NW0A 3FOKA 4PMNA 4TIMA 3GU1A 3UESA 3QV9A 2BHUA 2HBXA 1ZJIA 3U2ZA 1M7OA 1N5WC 4L61A 1AMKA 1TV3A 2J9YA 4XG1A 4K68A 1B3WA 2ZTJA 4OBSA 3IPWA 3L4TA 3P84A 1YXCA 4E3VA 3MZ2A 2WMGA 4MSSA 1IGWA 1V08A 3N34A 2OWWA 1L6YA 1XH1A 3GIPA 3CPUA 4O1CA 4AIOA 2HMCA 1BWKA 1YE6A 3ZR6A 3PZ9A 2VDIA 2ZX5A 3LCXA 2RGLA 1FEBA 3PTDA 5I3HA 3DBPA 5FJRA 4MGGA 3UPWA 2P53A 1AUSL 1RD5A 4O1FA 3B8DA 1EEPA 1PX4A 1NIUA 1K6AA 4LA1A 4KRZA 2WKLA 3NDZA 3KL3A 2YOCA 5IXEA 1QT1A 3MV11 1AJZA 3VOJA 3VAVA 5A8GA 4OUIA 1VLWA 3QGAC 4PUNA 2X40A 5D2WA 1UG6A 3NEVA 5CPQA 1SW3A 4IJCA 2RJHA 2V2HA 1R7AA 2X1UA 1DP0A 4JTLA 6ALDA 2YDAA 1BZLA 2GZXA 4ICCX 4GZEA 1R3SA 2KX9A 4WVXA 1K7EA 2QCCA 3EXTA 3I4EA 3K8MA 1Q6RA 4GK8A 3QBUA 2Z1SA 2E40A 3UXLA 5I07A 1UYQA 1P0EA 1ZQ5A 3U3HA 1JZ7A 4FK9A 4ZQNA 4H9UA 3AXKA 3A9IA 3C8FA 2G3MA 2LLEA 4OUEA 4ZB0A 3NSXA 3PPGA 5RUBA 1XANA 3WQ8A 4DJEA 3GG7A 1IEIA 4TTGA 3HPSA 2OEJA 1XBVA 3MWAA 1NAL1 5JXQA 1JULA 2WZHA 4W84A 3ONBA 1A5NC 4K1GA 2A79A 3B8WA 1HKMA 5DELA 4H4XA 3KP1A 3N25A 3B9NA 1RHCA 3VD3A 4DZAA 3B0PA 1JOAA 4PTVA 4EE9A 2PGRA 3KEHA 3CAWA 3UT0A 3OBEA 3ITCA 2TRSA 2TPSA 4Z2JA 1GQIA 1IXPA 3W73A 2IPFA 3EEZA 1XYZA 1L6GA 4CVWA 9XIAA 2GR2A 1BAGA 4AU0A 1RSCA 4DO5A 3N2MA 4LW7A 1E9ZB 3HQOA 4H9ZA 1UROA 1OC7A 1G4EA 3LLDA 3LV5A 2H3BA 3QYQA 1CT5A 3VNDA 2RDWA 4H01A 4ZFMA 3B8VA 3GU2A 3KHDA 1CECA 3C61A 1K8ZA 3LOTA 1SFLA 2J4GA 3M0ZA 4UMAA 5E1QA 1YIXA 3WLJA 1CGVA 3LXBA 2BVWA 4EAMA 1GVEA 3CJPA 1KQYA 7XIMA 6ENLA 2Z00A 1A3WA 4JIEA 1Q3NA 3AIBA 1PL9A 3FLUA 5TD4A 5EMUA 2WPCA 2WVTA 3SFKA 4N02A 5D03A 3G8RA 4FPSA 1LQ2A 1V6YA 2C79A 3ARVA 1QBBA 3DAQA 1GK8A 4K3ZA 1HP4A 2PDLA 1FXQA 4IFKA 1VFOA 2NPXA 3WF3A 4ZQMA 1EUAA 4WZHA 3UJFA 4HPGA 4C7DA 2Q09A 2J7FA 4NZFA 1V3KA 3WN6A 2GUUA 3H2MA 4BQ2A 3G6MA 3N17A 2XH4A 2W3SA 3NZRA 5KMYA 1UWQA 3URAA 1M53A 3AICA 2Q3OA 2PWEA 3WLLA 2FZMA 1PKMA 4B16A 3R8RA 3PUDA 2XN1A 3OLEA 3HG5A 2QUNA 3CL7A 1C8YA 5DY3A 4L5ZA 1JRBA 1Z6KA 3PY2A 3BO9A 3ENLA 3COTA 2J77A 1CGUA 4IPPA 1XRTA 5FOOA 1GERA 1JGIA 2P1FA 5MHBA 2JF7A 1KCKA 3LXCA 3DUGA 4RZBA 3SI9A 2BASA 3OLIA 3W02A 3THAA 2C91A 2Z2AA 1D8CA 3LLXA 3AS1A 4LY4A 4E3TA 4D8AA 3DU0A 1IWBA 4W4QA 3R5EA 3WJWA 3SR7A 3TJIA 3DHDA 5LNVA 2W3RA 3PAOA 1WOBA 3L4VA 4IMAA 1IF2A 5CBBA 5B7YA 2GQAA 1SJCA 4UB9A 1WZLA 2WSYA 3EX2A 4NZ1A 5CLTA 4IGSA 3GC2A 4MB1A 2EPLX 2OOFA 1U5VA 3UWWA 3OJGA 4XO6A 3UERA 5A2AA 3W72A 1E0UA 1U5JA 5G4HC 1E0TA 3PZIA 3OPSA 1TIMA 2Z7KA 4PUMA 3QW4B 4PCFA 3AUOA 4AY7A 3TOYA 3AZSA 4Z1YA 5LIUX 1LLWA 4OOUA 1N61C 4ZO7A 1OWQA 2CKSA 4NY2A 3W0KA 1A49A 5I7GA 4KFOA 2EPOA 3PBYA 1DJGA 3H4GA 3H2FA 3NZQA 1XBYA 3WBAA 1UB3A 1GEHA 3GD3A 1PXGA 3PTKA 1Q7ZA 4DBUA 2YAUA 4WJEA 3W81A 1NFBA 1PIFA 4P7RA 2QKFA 3BSMA 3O3RA 5E9AA 5E6ZA 5T9CE 3N2CA 2CLOA 1P1MA 2PDIA 2OTDA 2WNWA 3KTSA 4PFMA 4O19A 4I5UA 1TPDA 1UPMB 3HN3A 5IOBA 4PUKA 3II1A 5HINA 4ZOHB 3G3DA 4I90A 3F4NA 3CO8A 4DNHA 4H83A 3CT7A 2NVCA 1JRCA 1I2PA 2VVSA 4R27A 1EX1A 3ZO9A 3VE9A 3WDJA 1XCWA 1QPQA 1K6WA 3TN5A 2QS8A 4AAJA 1HKJA 1E9IA 5G2IA 4ZOEA 4FLOA 3MP3A 2W67A 3MYPA 3EDFA 3RLGA 4MY8A 1OZQA 2YXGA 5FCZA 2XTKA 1GW1A 3CB3A 1ZMCA 5HBFA 3YPIA 3CAQA 3GW3A 4IWWA 3L2MA 5HAOA 1XRSA 5FF7A 2FH6A 2QPSA 1R86A 3FXGA 1DORA 1IIGA 3WIJA 3IV8A 3GSMA 1PV8A 5G4WA 4K38A 3HV9A 4MLJA 3GVRA 1FH8A 5GNYA 1WOAA 2JE8A 1Q8JA 2VQUA 3F03K 1GHRA 3B8UA 3R94A 3F4DA 2A3LA 3QXBA 3FW6A 1VEMA 4Q32A 5CG7A 1NWSA 3DCPA 5I03A 1I60A 4N4PA 4O54A 3UJ2A 1R3WA 4H4SA 4FALA 1DXEA 2UV8G 1SZFA 4XZWA 6REQA 2G8ZA 4LCRA 3BLOA 4TVWA 5LGXA 1BG4A 2FTWA 4W5ZA 3SFWA 1ZFJA 1V8EA 2PWFA 4RNJA 2C0AA 2JIEA 4S38A 3VK5A 1WZKA 2QYGA 1V97A 5A5WA 3BURA 1LYXA 1WP6A 2CU0A 3T4WA 4EKJA 1EJSC 4IG2B 4RL3A 5C55A 1I9CB 1KFKA 2V2CA 2YZRA 3QQWA 1G4TA 3AIUA 3HV8A 1GWJA 2GGHA 3RCYA 2E09A 3OVRA 2V3EA 4XZIA 3K1GA 2CFYA 3UGRA 5FF2A 1TVNA 1EC8A 3L4YA 2UZ9A 3TNOA 1FP9A 2BC1A 1MWOA 1V0LA 2VC9A 1UC5A 1A5BA 2JKAA 3W88A 2E5AA 4GCXA 1B30A 4B3LA 1XSJA 4POCA 1R85A 2YBTA 4GYJA 2VZVA 4MWAA 1JVNA 2ZZ1A 2NV1A 2NSXA 2Y5JA 3SAZA 3S9IA 2GGIA 2PDQA 3LK6A 3S1XA 2XVPA 1VQZA 2WLYA 4GFSA 1ELSA 1K02A 3GNXA 3O0KA 2P76A 2HQMA 1NDAA 3BG3A 2ZUNA 3S6OA 3M0JA 3QC3A 2DVTA 1S5NA 1WDWA 4P7LA 2JIWA 4I7WA 3T0TA 1EBHA 3UFYA 2F8QA 2OZ0A 3TVAA 1CLKA 2FB3A 3CNYA 1R8LA 1WQ5A 1NOFA 3MUY1 1W2VA 4U28A 2DFAA 1L8NA 4AVOA 2XGBA 5CGMA 1REQB 4AHQA 5G5HB 4NP7A 1E1CB 3O05A 3OLGA 4WKHA 3M0MA 2PI6A 2BGSA 5EMKA 1M04A 4QSHA 4QNWA 5FJJA 3A4WA 1ONFA 4PL1A 3WDIA 5M03A 1JZ2A 4JY8A 5A6SA 4GX8A 3KDOA 3QY8A 4KETA 1F6KA 4ADUA 3GLCA 5HPCA 4JQAA 4H9TA 3UYCA 3GVWA 1V3LA 4CNTA 3WH6A 5A95A 3M0IA 4B9YA 4YHGA 1GT8A 1RY0A 3B3DA 4B2DD 1WUEA 1D7KA 2ZVRA 1WO2A 4RJEA 5M1TA 1AH3A 3AU2A 2X41A 1K8YA 2J66A 4K36A 1SO5A 1J0IA 3M0KA 4QAIA 9RUBA 3JZUA 4D6CA 4UTUA 3MBFA 1J5TA 3QOMA 1XRVA 1JAKA 2XZ7A 3WQPA 3MA8A 1YTDA 2GVGA 1Q6EA 2CLFA 5EBUA 3D5HA 3STGA 5LHEA 1OK4A 3A3WA 3RN6A 4CCEA 2E68A 3VIGA 1GXFA 1L2QA 2PTWA 4JX4A 3VXGA 3ITLA 4PRWA 3WBXA 1HJQA 1PPIA 1TMLA 1UD2A 1GETA 4AVNA 1QW8A 2E67A 4ZQRA 3VMOA 1TWIA 2FPVA 1GYLA 3VGFA 2X09A 5F4WA 3B05A 4UR8A 2BY0A 4S2BA 3D6NA 4PMYA 1F8MA 1STZA 4K7YA 3VPLA 2ACRA 4O57A 4RDZA 1KTBA 3BC9A 3RIKA 1JXJA 2G97A 4YLWA 1Q66A 2POTA 4CNOA 3SRFA 3NQ6A 2Y5SA 1GJUA 4NRRA 3IGHX 3A47A 2QPXA 3VOFA 2POZA 1OD0A 4LUSA 3TC3A 3M7WA 2BGNE 1KGWA 5ER0A 1ZXIC 1HQTA 1XCFA 3DFQA 3VD7A 3GNNA 1JF5A 4LBSA 5CPTA 1ODZA 3P5ZA 2ZRZA 3W84A 3BOFA 3SBFA 1TIWA 3TWAA 1ZY9A 2OKTA 1MQRA 2CW6A 3LXAA 4DVOA 3ANYA 3VX1A 2WOWA 1XP3A 1QPRA 3KLKA 3GNDA 1P0DA 3VGBA 4FMVA 1E51A 2C0HA 4BWLA 4XKMA 1SO6A 2PDCA 2PZNA 2Z6JA 3RYSA 1UQZA 1XF0A 3ITTA 5JIPA 2VZSA 3KDNA 3ZJKA 4N0RA 3EWCA 1PDYA 1QI4A 1X7FA 4UNLA 4YJ5A 2Q8ZA 3MO7A 1PKNA 4FS9A 2ZA3A 3F4WA 5LXEA 4NZCA 3ANUA 2ZRXA 3B4UA 1OG0A 1UP0A 2QCEA 1W5PA 3PSWA 4E2BA 4XD3A 4Q4MA 1PKYA 1W1A1 3V5CA 4RR4A 3DENA 3W87A 3NDYA 3B8IA 3NUKA 2D20A 1K8XA 1NF0A 1NP2A 2WQPA 2CHOA 1FWDC 3S6TA 4KH2A 4M56A 5LHFA 3ZWTA 4CUCA 2I14A 2W6RA 3WNOA 2J78A 3GH4A 3K30A 2XHYA 1UR9A 4EVZA 1OFPA 4NF7A 4TX9A 1XLKA 1JZ8A 1F3PA 3O6AA 3FA4A 2CNCA 3GXFA 3Q6JA 1IGSA 4PB5A 2GJXA 1FWWA 3T08A 2WB5A 5AZ1A 1G69A 1AJ2A 3UXDA 2WP5A 1B90A 3LCIA 2E9LA 4XD6A 1E6PA 4MY1A 5ABGA 1A5CA 4JX5A 2ZXDA 1DXFA 3R58A 1I75A 1V0NA 1KV8A 4PUEA 1BGGA 4GUIA 1KCZA 1DL3A 1QATA 4M1RA 4EAYA 1E3ZA 2R94A 1G7VA 2WYSA 3JZEA 3CZJA 1ZU8A 2QIIA 3L5AA 2GR1A 2VX6A 5D4YA 1OBAA 3O9NA 4IP4A 2OLSA 3JU2A 1JCMP 3ZJ6A 3B8TA 4CU6A 3BMXA 2NQ9A 1EUNA 2HDJA 2J9XA 2R1LA 1UUQA 1XIMA 3IJQA 3CXOA 3TJXA 1TX2A 5FSEC 7A3HA 5A6MA 1UWAA 1D7YA 3ES8A 1NDVA 4HK5A 3EOSA 4F79A 3LRMA 4Q4SA 4Y9PA 4QITA 3I3BA 4AF0A 4O4VA 3IUIA 1W5MA 3U2OA 4W7WA 1YDYA 1VAHA 3IIOA 3CHFA 1ML1A 4QIUA 2X42A 2ZZBA 4IIEA 4H7CA 2EPKX 1CXHA 4HN8A 2C1HA 2GOKA 3VOIA 1OC6A 1LUCA 4AG0A 1LORA 3DECA 1CTNA 2IKHA 1YPXA 4O1BA 4FR1A 3VD4A 3TU9A 1SB3B 3AHXA 3DFYA 1UKTA 2PZ0A 3HPZA 1EJUC 1FWCC 1LLOA 3QM3A 4FF5A 3R13A 4O1EA 3SCRA 1A5MC 2EHHA 1GOXA 3N12A 5DX7A 2EG6A 2FZ8A 4JHMA 5C9RA 1NPXA 3MV01 3WQDA 3IRSA 3B0YA 4QE5A 3S9YA 4IP7A 1RK5A 2J7CA 4HJFA 2NWSA 1QNSA 3VIKA 4PZVA 3S6DA 2RDTA 3D3AA 3LNPA 1F2JA 3PZTA 1V3IA 3WUFA 2X99A 1AW1A 3S83A 4S23A 2HVNA 4A05A 4XBKA 4C6BA 1EF2A 5EMJA 3BGGA 1W56A 3ERPA 3C3NA 4QQ3A 2EXOA 3W1QA 3ZZ1A 3T9PA 2REQB 3VFCA 4H8NA 4MPKA 4I5RA 1RBLA 4F8XA 1XIGA 3TJLA 2Y7EA 5G5GB 3DDMA 4JKLA 4M82A 3HMJG 4WDUA 2P3EA 5HJLA 3CWHA 1GOKA 3WK2A 2PDFA 2D2OA 1UD3A 4H00A 2OLHA 4GMEA 1TX0A 2ZRUA 2CCRA 4B4HA 4I5XA 4BA0A 1BF2A 3QZAA 3RRXA 1K8CA 3WDQA 2YA0A 5EGRA 2V5CA 1XIIA 1KB3A 2MUCA 1XLGA 3D9XA 4ENLA 4YYFA 2VENA 3OGSA 2J25A 4A8IA 1V51A 1Q13A 2OWXA 3DFSA 3OW1A 3QW3A 5HDRA 3CQ0A 3S5YA 2P3ZA 1K9TA 1C9DA 4UFJA 3OYZA 3N73A 2A8XA 3I7SA 1A50A 3LERA 3GB6A 3NQBA 3TIMA 4UXDA 5C8BB 5JCNA 4B90A 4JNYA 4H1ZA 3T0DA 4P8XA 1CXLA 2F38A 1E6RA 1IWPA 5D9NA 3W85A 3HQNA 3S2LA 3TTQA 3NOEA 4EOUA 3V1PA 2J7HA 1OX4B 3MY9A 1TJ1A 3OZMA 2YCLA 3RITA 4KEUA 1TVLA 1HKKA 1LRQA 4H3DA 3SSJA 2B7NA 3TA6A 1XDJA 3EB4A 1IZJA 2OSXA 4JBRA 2WHLA 1B4EA 1AQMA 1JQXA 2CIPA 5H2ZA 1VBJA 3GRIA 6XIMA 1VFHA 3VKDA 4PCNA 1H61A 3S5OA 2ZWZA 3LGDA 3WJZA 1TFVA 2AKMA 4PCPA 4KFPA 2PDUA 1IWAA 4BEUA 3ZFHA 1FWRA 4QRNA 4DPPA 4KCVA 1VCFA 3AALA 3LQLA 1UKOA 4MVAA 2WMIB 5DMNA 3TTSA 5G1TA 3R0KA 2DSWA 3W82A 2EKGA 1QFEA 1VBUA 3E2VA 4ZB2A 3RX3A 4Z1AA 1D8WA 2ISSA 1VYRA 1W9PA 3BL3A 3IVSA 4B3ZA 1RD6A 1EPVA 2BOEX 1S3TC 4JFSA 3MUCA 3G18A 1GRGA 1E4MM 3PFRA 4JCMA 3EB2A 2YSWA 1CW2A 1UZ1A 4IPJA 4B9ZA 2G96A 1KFWA 3T42A 2ZE3A 4N42A 5TQLA 1FTXA 4FOUA 2Y0FA 1HUVA 1TTJA 1DEDA 2F6KA 1JFXA 4FX6M 5GJPA 3W2KA 1A5OC 3ITYA 2C1IA 4UTTC 1JI2A 5FAJA 3BAWA 2VOMA 4GOAA 4ZOCA 1GVRA 1W3KA 1XYAA 2W62A 1GKRA 4INFA 1W54A 2ACSA 3OIHA 3TYUA 1SMDA 4OBTA 4YHEA 2CC0A 3TYAA 5KZMA 1KTCA 1BG9A 3R6IA 3EKZA 1CX9A 5E9XA 1MXSA 4OTKA 2J13A 1R5YA 2QT3A 3SADA 1WAWA 5HMFA 2BWGA 1DIOA 5BMXA 1KV5A 2GGGA 2F5ZA 4XAGA 2CERA 1XLCA 2DH2A 4CNUA 1H09A 1R9YA 2OMAA 4JTDA 1XG3A 4OGZA 2DU2A 2INFA 3L67A 5E6YA 2VELA 3WQFA 1TPC1 2RHGA 3ABRA 3MQTA 4RX0A 3QPZA 3I7RA 3R43A 1F5ZA 2ODOA 4EXAA 2R6OA 5DXYA 4MWAE 3AC0A 3AS2A 3SCNA 1DIKA 1SVDA 3KTXA 3L21A 1EGMA 1MZRA 2Z25A 1RJRA 3WDHA 3BJFA 3W7MA 1VB9A 1OB0A 4JN8A 3AMCA 2XPKA 3CZLA 1W3LA 4CN6A 1QO5A 3LXDA 3ARQA 4Q8PA 2GQ8A 1SPQA 3PBMA 5DT5A 1FA2A 2WVVB 1OADA 3ZYZA 2OQYA 3RM8A 3G6LA 2PPGA 5E0FA 1BXCA 1V02A 2AMXA 1SO3A 4M80A 3W75A 1DHPA 1EYWA 5A6AA 3WDRA 3GC5A 3HPXA 2ONEA 3RM4A 4MPQA 2F6XA 1ZAIA 5BXPA 1DKWA 2A1YA 3H12A 1JPKA 2QLYA 3U7VA 2QJJA 4Q8NA 3MO4A 1SZEA 2R91A 2YCKX 3N2OA 4PE8A 2QAPA 3F2DA 4CQCA 3EWZA 2PDBA 4X3ZA 2VZUA 3UWQA 3IJ6A 1B1YA 3NQ2A 1L6FA 2QHAA 3LPFA 2I9UA 4XZLX 4E2OA 1OGGA 1LQ0A 4LQ1A 3W26A 3KWXA 4ZSUA 5C70A 1E6NA 3IC9A 1XQLA 4WGXA 2A3AA 3KVLA 4KRTA 4L9YA 3W9ZA 3WJYA 4AD2A 4QLLA 4KCUA 1KNWA 4EF9A 2PS2A 3VDAA 1D7FA 3I7QA 2PF0A 3UPMA 3NSMA 2OYKA 1UCWA 3M7SA 5FJTA 1QW7A 3H7VA 3BICA 4EMIA 3KBWA 4ZMGA 5LIXX 2OB3A 4WQ6A 1GGOA 2XIIA 3A3XA 4IJBA 5CPLA 4MB3A 1RQHA 1EJRC 4DBWA 4TOQA 7CGTA 3HFTA 3ITXA 4RDYA 3N4AA 2W79A 4W8AA 3L12A 2PRMA 1QNRA 4NL1A 4ACZA 7REQA 1ITUA 2QV4A 4FZIA 5K2ZA 3O0FA 4MKVA 2TMDA 2VDGA 2OQLA 2A3HA 1TRDA 4IICA 4L6HA 3WMCA 3C0JA 1LVLA 3GG8A 2EPNA 3LI1A 2BY1A 3CPGA 3UZXA 3VX0A 2V5DA 5EMYA 3OLDA 2I16A 2YW4A 4LAZA 1XICA 2GR0A 1AQHA 5JCKA 1RALA 1P0KA 4IQJA 5EMMA 3T78A 1M41A 2WHMA 3LPGA 2E9BA 3K8KA 5GNZA 4PTXA 4JR5A 3ZLHA 4O1AA 4LAMA 5D32A 1J6PA 5REQA 3LQGA 3VNKA 3WLHA 2PDNA 1PSCA 3EGJA 1VPXA 4QQUA 3CQJA 4QS6A 4Z1CA 1JYXA 5FJOA 3GKAA 4GRTA 3RG6A 2GFTA 4IQLA 4H9YA 4YTUA 4P7QA 1R47A 3P5YA 2JKPA 2WCGA 3TW7A 4UR7A 4RE2A 5MKGA 4LOCA 4JQ3A 4XB3A 3BH4A 2PD5A 1HP5A 1OY0A 4GI4A 4JTEA 3BTNA 3TSMA 4XZ9A 4Q3MA 3TTYA 1XBXA 1S2UA 2V68A 2Z1XA 2B31A 1XLMA 1KCLA 1Q8AA 4I8DA 2E77A 1E72M 3L0KA 2NQ5A 1C92A 3AHYA 4B5WA 1QPKA 2V3BA 4JX6A 3EXSA 1E1FA 1S2VA 5DXXA 4WSKA 3LGGA 4XBSA 5HWNA 5D37A 1CGXA 1JL8A 2GJNA 1BF6A 2D0FA 3PZOA 3R79A 3UD6A 1VJZA 5FEZA 2A21A 4BY3A 2PTZA 1X2HA 2YL6A 2QJIA 2ESCA 3WDPP 2EPHA 3VKKA 2GDUA 3O16A 2XFFA 1Y0EA 1L6WA 5EU9A 1WXZA 2W9MA 2O9RA 3PJUA 3FG2P 2WZTA 2ZKMX 4XZHA 2CXGA 1UWUA 2ZUMA 2XM2A 1FH7A 3VIPA 1BYCA 4LCSA 3NZGA 3SJ3A 1M68A 3AXXA 3C3UA 3QV8A 4JNZA 5I00A 4HTYA 1DWJM 4HP5A 3ABSA 1A47A 1T8XA 3GXIA 3LPPA 5KVIA 4XUGA 1X1OA 3A64A 1EYEA 3UXAA 3FHQA 1UP2A 2GK1A 2X2GA 1NH6A 2G41A 3CGCA 2PDHA 5J5RA 3C8NA 3OIXA 3WX7A 5AYXA 4HPHA 4ZZ9A 1EP2A 5BMWA 1Q4NX 4YXGA 3U2CA 4O28A 4DO7A 2D22A 5HANA 1FWBC 2ZVIA 3EAOA 4NZ5A 4M52A 3GTIA 1VJIA 1LRTA 4LIIA 3PP7A 2PLKA 4YTSA 2DY3A 1M5WA 1B3YA 5J8LA 4PMVA 2OO6A 3E02A 4X9SA 3ZSSA 3VNIA 2X1RA 3ABOA 4S39A 4AEFA 3PBGA 3ZR5A 2C3DA 3SQPA 1B3OA 3W86A 8A3HA 3W6LA 1NDZA 4H6EA 1BXNA 2Y62A 4LVDA 4DBDA 5CZKA 4IPIA 1IYXA 1P7TB 3CU2A 1X39A 4P7OA 4JEJA 1JUBA 1XDLA 1DWHM 4N6EA 1O68A 3PJTA 1S38A 4LRTA 1U30A 3WLIA 1FWFC 1KN0A 1K70A 2DT0A 1GZ1A 3GXDA 3DGZA 1BTMA 1O95A 2ACUA 4DI8A 4A3RA 1IR1A 3H54A 2WPFA 3M5XA 3TDFA 2VUYA 4HNTA 3QMSA 4GIEA 1LQAA 1M6IA 4ZOAA 3EB3A 1XINA 1QK0A 3MCNA 3F5LA 2C71A 3W7RA 1UWSA 1VRDA 2CEQA 4O13A 1S2CA 2FVKA 4YVXA 4NYYA 3UXIA 1PEZA 2QDHA 2ZBTA 5HMSA 3E2QA 3CGTA 3DC8A 3HZ3A 1R9XA 3MJYA 5FL1A 1QHOA 3NVTA 4NSBA 3WLSA 2JEQA 4AD1A 4AZGA 2HPIA 5E0CA 2W5FA 4EANA 3A7UA 4L80A 3TSBA 3DYMA 3A22A 1N82A 4HMNA 4ERAA 1R2RA 3N13A 5K7JA 1TSIA 4HNUA 4R9XA 1XIBA 3TXVA 1F74A 1RV8A 2VFFA 3GW0A 1FWNA 2GR3A 5F4SA 4PEEA 1VIZA 1H11A 5U1OA 4E4PA 1VYSX 2J27A 3V1HA 5KINA 4X2PA 3O7UA 3E0FA 4BZYA 2YCEA 3LU2A 1KD0A 1EZ2A 4IXXA 1EDQA 4WKAA 4HA4A 1BYBA 4HJWA 4M6UA 2YVFA 3CIXA 1AFSA 4ZXOA 4AZ5A 3JS3A 4D8ZA 3MW7A 2W91A 2ACQA 2PDMA 1HGYA 2OGJA 1J0YA 3WQVA 2IUZA 4Z0SA 3PB2A 2ZCGA 1BQCA 5EY5A 2HJPA 4C6DA 2OOGA 1KR0A 3TQVA 4JYEA 3D46A 3NQGA 3DH7A 3GO2A 5IBXC 3KCOA 4WK9A 2PGWA 3CBWA 2WZEA 3K5XA 4E0CA 2MANA 2J8GA 3P0XA 3EDEA 1K1DA 4NAFB 1XSIA 4W5UA 3QH2A 2R9ZA 4M6QA 1XM3A 1NQ6A 2Y1HA 4GPNA 3REQB 4FNPA 3CEUA 2FDSA 1CPUA 2Z1WA 4BURA 1FFQA 3GZAA 2E6DA 4JIRA 4H4YA 1CIUA 3G5EA 3G8EA 4D6FA 1GTEA 1BYAA 4Y9NA 1TJPA 3C2YA 2OELA 3DFTA 1BTCA 3QV6A 1L0PA 3M41A 2WJFA 1TV4A 2RJGA 3LBMA 3BMVA 3FIGA 4XZNX 3T0AA 3NA8A 4GISA 1HIZA 3S47A 2NQLA 2NZLA 2OVLA 3MYOA 2VD8A 1BLIA 5EKYA 1ALDA 5G1MA 5AVHA 3ZJ7A 2H3DA 1H3GA 1TZ9A 4NRSA 5JQ9A 1N62C 3BOLA 1EKOA 4UUIA 4F0LA 4UNIA 1J12A 4O0ZA 2ANUA 1MEIA 2CZVA 1XKJA 2X1IA 3QMTA 1SSDA 3CTLA 3NVZB 3HFYA 3T0CA 4RV3A 1J8VA 4ZB5A 4JTFA 3EA1A 4UFMA 4URIA 4U2ZA 3IIZA 4L56A 2W3ZA 5CC5A 2V5LA 4TX6A 2WWCA 4GR1A 2YQUA 3W4RA 4AZ6A 4Q8OA 2WSRA 3FJLA 2HQAA 2ZZ0A 2E3TA 3I6EA 3N2XA 5HUPA 1QWGA 4R33A 3IAPA 3MU7A 2VGFA 2AAAA 1G0CA 2A3EA 3TYCA 2ZA2A 1EFZA 1WNOA 2X8RA 5C9WA 2BCPA 4GE8A 4JOMA 4S3KA 2UY3A 1N8FA 2NVKX 3KL5A 2JQXA 4Z42C 3P8IA 3PULA 1OINA 1GVOA 2FPYA 3QR3A 3WNMA 5D8WA 4NEWA 4HU0A 4CD8A 4Q4QA 5ABFA 2HNEA 1K4GA 3M46A 3NNTA 4C91A 1ZMDA 4GJJA 3QV7A 5LNWA 3JR2A 1TPB1 4I9TA 4DIAA 2QPUA 3KAOA 3CUHA 4PFHA 1QNPA 1V3MA 4YCPA 3VC6A 2JBMA 1EC7A 4C6NA 1WV2A 4NJKA 3TR9A 4JS3A 1MW2A 1Z3NA 1OFAA 1V5XA 1RCOB 1IEXA 1UMYA 1DJWA 1LT8A 3AIEA 4JKMA 5CPNA 3WMSA 4A22A 2AGKA 4HU4A 5FEXA 4JFVA 4M24A 3UNDA 3C5QA 4HBKA 2HROA 3EA2A 2Y4SA 3QPEA 5BRPA 1NY1A 1JZ3A 1JYNA 1FWJC 2JEPA 1E0WA 1GOWA 3G24A 3BLPX 3FSUA 4JIHA 3W7DA 1UPPA 1XDMA 5D38A 4LB4A 4YVPA 1Q65A 2BXYA 2RUSA 2WC7A 3ZLFA 4E2VA 4X2RA 1EBGA 4A3YA 1RVGA 3EWXA 3LCFA 4LH8A 2J6XA 4C6CA 1CGWA 2G3FA 3RU6A 2YW3A 3NG3A 4XO7A 3NO5A 3W1MA 5HATA 1TJ2A 1H49A 3GQYA 3PK7A 4MB4A 1XHGA 3HGRA 2GJRA 2P0OA 2B81A 2ZZ5A 1UQYA 1Y65A 4ZGYA 1F05A 2FHBA 1JDFA 1EQCA 4JDYA 4X9YA 4DWSA 3AHTA 4KWOA 4C1NB 3TN6A 5AYBA 1E40A 3CHDA 1BYDA 3BAJA 4TVUA 3OQEA 4Q7BA 3LHVA 2NUXA 3EWDA 2DORA 1OF8A 2PTXA 2PEVA 1TREA 3FEMA 1QTWA 3KRBA 2V6OA 1FCUA 2QJNA 4MDOA 3M0VA 4GWEA 3KW3A 5CZTA 3T81A 4N4QA 4A8LA 1H41A 5CJNA 1C8XA 4C7FA 2ZZ4A 2XFWA 3BQ5A 5PTDA 4QS5A 4HA3A 1G4PA 4S3AA 4JFWA 3HO8A 4UMBA 3EOLA 2I9EA 2XH7A 4HN4A 2CZ5A 1AA1B 2QW5A 2CLIA 2FTYA 4LSBA 3S46A 2Y6ZA 4L4LA 1J2WA 5I5RA 5FS9A 2RDXA 3FS2A 2E6AA 1GUVA 1E0VA 3UXKA 5BYWA 4WD0A 3G0XA 4Z2LA 4O17A 4AY8A 4RPQA 3POCA 2Z24A 5AFDA 2YBVA 3WQGA 2FLIA 4IMDA 2DZTA 2NXHA 1QPNA 5KITA 1G7UA 3R0UA 1E1EA 1C7SA 3HTWA 3T40A 4US6A 1TPVA 2PTDA 2GOUA 2TPRA 4WX2A 1CWYA 3MHGA 4WEVX 3MUIA 4J3XA 2I5IA 1F76A 2Y7FA 4L65A 3DGRA 3S2JA 4UFKA 2ZQ0A 3VO0A 1WCGA 1ICQA 2GQ9A 1Q7MA 1XLIA 1XL9A 1ISYA 2ZA1A 1ZBWA 1Q6FA 4ECLA 3DBNA 3AYTA 2Z0IA 1B9BA 1VH7A 3WD2A 2V69A 2QUUA 3GDKA 3NEHA 1RA5A 3G2GA 1VEOA 4KF1A 1AH0A 2IXUA 4GX9A 1OCNA 5KTLA 3LMYA 4K8EA 2BDQA 5EBAA 3VKJA 1WZAA 1OG6A 1V0KA 4QG8A 4K37A 1GVIA 2DIJA 2NV2A 4DXXA 3AWOA 2D2GA 2WPBA 3F5KA 3U6WA 1B2YA 3ARWA 4CQAA 3EPNA 1XRFA 2BC0A 3CV7A 3H7RA 3RLHA 4TMCA 3LY0A 4C5ZA 1M65A 3DG6A 1MFVA 2TYSA 2XG9A 2Z7GA 2Y88A 1JEZA 1POKA 2F61A 5T26A 4AVFA 1NOUA 4AUBA 3WFLA 3R89A 2CZDA 2PDYA 2OEMA 4P7NA 4AISA 4XKYA 1TE1A 4JDBA</