3H12A

Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
392
structure length
392
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGMKKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mandelate racemase
publication title Crystal structure of putative mandelate racemase from Bordetella Bronchiseptica RB50
rcsb
source organism Bordetella bronchiseptica
molecule tags Isomerase
total genus 127
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3h12A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3h12A01
2NQLA 2PTYA 4DXKA 3STPA 3ZLGA 3FCPA 3SJNA 3D46A 2OX4A 2AL1A 2GDQA 1YEYA 2QDEA 3IK4A 2PP3A 2PPGA 3NXLA 4ROPA 3BOXA 2P88A 4DHGA 2FKPA 3SN4A 4F4RA 3FV9A 3GY1A 4E8GA 3K1GA 2XH4A 2HZGA 1ECQA 4GMEA 4M6UA 2XH0A 4HCLA 3RCYA 1XPYA 3QPEA 4G8TA 4ZA0A 1EBHA 4GISA 4M0XA 3MQTA 3KUMA 1PDZA 2PU0A 1P48A 3UCCA 3DERA 3OZMA 2QJMA 4H19A 4E6MA 3BJSA 2XH7A 1EBGA 4JN7A 4DYEA 4HCDA 3T8QA 4GGBA 4DN1A 3N6JA 3QLDA 3UXKA 1ONEA 3ZLHA 1SJDA 3MWCA 3EKGA 2I5QA 2PSNA 3R25A 3R1ZA 2AKMA 3I6EA 4GIRA 3P93A 3DFHA 2AKZA 2GL5A 7ENLA 4IHCA 3IJQA 3UCDA 3TCSA 4H2HA 1KKOA 3SQSA 3ENLA 3HPFA 4A3RA 4IT1A 2XGZA 3OPSA 2CHRA 3DEQA 2P8CA 5FJPA 3OZYA 3RITA 3TJIA 1DTNA 3NZGA 3MY9A 3CB3A 3N4FA 3PFRA 4MGGA 2GGGA 2OKTA 3B97A 4Z1YA 1E9IA 4HNLA 2DW7A 3UJ2A 2OVLA 3S47A 3MZNA 1JDFA 2OG9A 2PTZA 3H12A 1WUEA 2POZA 4FP1A 2O56A 3GD6A 3SN1A 2OZ8A 3Q4DA 3QN3A 2FYMA 3THUA 2ZADA 1MDRA 4MKSA 5FJOA 3DESA 1R6WA 4Z17A 3OW1A 2ZC8A 5BOEA 1IYXA 2XH2A 1BKHA 4IL0A 4ZCWA 1F9CA 3H70A 2OPJA 3JW7A 4J3ZA 3CXOA 4MMWA 3UJRA 3DDMA 2GGJA 2GGHA 3DG7A 4H1ZA 3JZUA 1MUCA 2PODA 3DFYA 2P0IA 2OQYA 4DWDA 1MNSA 2QDDA 4E4UA 4KPLA 3RRAA 3VDGA 3R0UA 3VCNA 2PCEA 3SN0A 5FJTA 2GSHA 3PK7A 2RDXA 2PP0A 1RVKA 3R10A 3IJIA 3T4WA 1KKRA 3P3BA 1MRAA 1NELA 1SJBA 1TKKA 2PGWA 3TWBA 4EWJA 3GO2A 3R11A 2MUCA 4IL2A 2OFJA 1R0MA 3VC6A 1SJCA 4J1OA 3RO6A 2GGIA 2PTWA 3V5FA 3SBFA 3N6HA 4HNCA 3V5CA 4JHMA 1TZZA 5IDZA 1XS2A 2HXUA 1KCZA 3UXLA 3EEZA 4JN8A 3MKCA 4KT2A 3ZVHB 1JPMA 3OP2A 3RGTA 3CK5A 2PGEA 1MDLA 3TQPA 1BQGA 3ES8A 3DG3A 4X2PA 3T9PA 2QJJA 4KWSA 1EC8A 2OLAA 3ZVHA 2P8BA 3MUCA 3NO1A 5J04A 1FHVA 2OZTA 3CT2A 4YWSA 3RR1A 4K8GA 5ENLA 3TTEA 5EU9A 4HN8A 3I4KA 3ES7A 2AL2B 3UGVA 1ELSA 2PS2A 3ZLFA 3QTPA 3CAWA 3BSMA 3NFUA 4K2SA 4HPNA 3DG6A 2PP1A 2OQHA 3ZVIA 2HXTA 1KD0A 2QJNA 3VFCA 1WUFA 3UJSA 1OEPA 2HNEA 2AL2A 4GFIA 3U4FA 2ONEA 3PWGA 3SSZA 4A35A 2XSXA 1FHUA 3PWIA 2OO6A 2DW6A 1NU5A 4FI4A 1EC9A 1SJAA 4KEMA 4GGHA 1JCTA 3TJ4A 1L8PA 3OTRA 4H83A 3TWAA 4G7FA 1JPDX 4IP5A 2PTXA 5BOFA 1PDYA 2MNRA 3R0KA 1TE6A 3DGBA 3FYYA 5FJRA 2GGEA 6ENLA 3TOYA 3TW9A 4IP4A 3QKEA 3UJFA 2QVHA 2PU1A 3S5SA 2QGYA 5FJUA 3IJLA 3MSYA 4E5TA 3T6CA 3VC5A 3JVAA 3I6TA 4ENLA 3FVDA 2PA6A 4GYPC 4A6GA 3DIPA 3Q45A 3D47A 4GYPA 1P43A 4K1WA 4E4FA 3U9IA 4HCHA 4HYRA 2PMQA 3CYJA 3FXGA 3H8AA 3FJ4A 1EC7A 3P0WA 4IZGA 3GC2A 3N4EA 2QQ6A 2P3ZA 4DX3A 3UJEA 3V4BA 3H7VA 3VCCA 3VA8A 1W6TA 3V3WA 2OZ3A
chains in the Genus database with same CATH superfamily
3EMZA 1XV8A 4HZ8A 3ECQA 4PBFA 4V15A 3CIVA 3FCPA 4UR7A 2KX9A 1JIBA 3AM9A 3CQJA 4UQAA 3IC9A 3RAOA 3UZ5A 2WWDA 1RY8A 4C7GA 3WLOA 4EIVA 3GNXA 2HBVA 4LV9A 4ROQA 3W81A 1A5AA 4M6PA 4XQ6A 3M6DA 1ZMCA 1HFBA 1Q5MA 4XAFA 4POCA 3N12A 2F2HA 2V3BA 5D33A 1PKLA 2GJXB 3DJGX 4PB3A 1ONXA 4EMJA 1PVNA 2Y5SA 1XFBA 4ZO9A 2WZEA 1ECQA 1UPPA 2HZGA 2R9RA 1Q2SA 4FNQA 3SFWA 3VE9A 2RH9A 3W1QA 1ZNNA 1GETA 3VFLA 1GVRA 1MQPA 4QNWA 1FWEC 2PU0A 3URAA 1IT0A 3VD3A 2NQHA 4UTTC 3VNJA 4EF9A 1N82A 3VUSA 2YDSA 1TCMA 4JEJA 1A50A 2ACQA 2Y7GA 4JTRA 1PZ1A 1IWAA 3LBCA 4DN1A 2Z2BA 1ONRA 1XIBA 4H6QA 1VRDA 1JGIA 3AZSA 1SJDA 3XISA 5BMXA 2AKMA 2P53A 1V93A 3OYZA 4IMCA 2DZAA 3N14A 4DAIA 5I03A 4IHCA 1GVSA 3FSTA 1ZENA 3TCSA 3NEHA 1FFRA 5HA7A 4OJYA 4HA3A 3G77A 1KCXA 2ACUA 4E2OA 3MMWA 3OPSA 4LB3A 1QATA 3HJEA 4IXHA 1QPQA 3VGFA 2VKZG 3PNZA 4IIFA 3D9XA 2FTWA 4XISA 2G50A 2J66A 4LSBA 4WD0A 1H61A 1OVDA 6XIMA 2R1PA 3KXQA 5M03A 3DKJA 4AVNA 1ESWA 1H49A 2DSUA 3WG6A 1UWIA 5JU6A 2GJNA 1PIFA 2ASHA 4UTLA 1LOSA 1QDSA 1NQ6A 1GVYA 2CZ5A 3R13A 4JIIX 4QJ1A 1VHCA 1OB0A 3GNDA 3MKKA 2BOGX 4NYYA 4OZOA 4UCFA 1FXPA 1UWQA 3TN5A 2G4JA 4AF0B 1K7EA 1TV7A 2WSRA 1TREA 1XDJA 5D9PA 2BMBA 3OW1A 2FB2A 4UQBA 1SW3A 5I23A 1UP0A 3L2IA 4US6A 3BC9A 3M6YA 1S5VA 2V69A 4RKAA 1IGWA 1JCNA 1OINA 4MKNA 1X1OA 1KFKA 2YL8A 3HGOA 3TTSA 3S6TA 3O0KA 4RZ4A 2A1YA 3W1MA 2J79A 3KBWA 2E5CA 1QPKA 2GGHA 1XC4A 2CBJA 1V3KA 3NQ8A 4PCNA 4PSPA 5CGQA 3DJJA 1IIGA 1L8NA 2FVLA 1TUFA 3DFYA 4N9BA 5FCZA 4GBUA 4BS0A 1XLCA 2Z6IA 4H6RA 1Q4WA 3MHFA 3M07A 1JEHA 4OE7A 3LHTA 1EP1A 4TVWA 4QG6A 3SN0A 4M5PA 2F38A 2RDXA 2R1LA 2FTYA 3NM1A 1EP3A 3LV6A 4D6CA 1FWIC 2AMXA 4JDYA 4ZXOA 3L5MA 3UR5A 2O7SA 3MBDA 4C1KA 1SSGA 3TWBA 2A3EA 3KRZA 1WZKA 3WF0A 4HMDA 2BBFA 5EPDA 4FIRA 3IIVA 2E7FA 3APGA 3S0CA 1XG3A 3B4UA 3H22A 2BC1A 4DQWA 3H23A 3S5OA 1VJIA 4HNCA 3AS3A 4P8WA 3CLMA 1LP6A 3JS3A 1ICPA 2QHAA 4KBXA 1KCZA 4JQ3A 1ZB5A 2A4AA 1XRSA 3MUIA 1T8XA 3ANYA 4JN8A 3B9EA 4YCPA 1PTAA 3G1XA 3HM7A 3ZT7A 3UETA 4H9ZA 1AZ1A 3QV7A 4UTHA 3E0IA 2C7FA 3M9YA 4GR1A 5KITA 1E55A 3C86A 1DWAM 1HL9A 4KCVA 3BZJA 4ZBCA 3IANA 4OBSA 3T9PA 1M1BA 1UOZA 2XM2A 1M53A 2GUBA 3PZVA 2D20A 2XISA 4YVXA 2VFFA 2OLAA 1AD1A 4PN2A 4DJFC 3ZVHA 1OFRA 2HTMA 2XIIA 2QCDB 1NWUA 4IGHA 1FP9A 2C0HA 4BF9A 1XD1A 4HOWA 3IS4A 1D3CA 4FR1A 1V3LA 2PWHA 3EWWA 5I3IA 2AOSA 1Y0EA 1TVPA 3MDUA 2V38A 3OQEA 1Q65A 3I7QA 1R2RA 2A7PA 2D24A 1GKQA 2PS2A 2QUTA 1BYCA 4GC4A 3KW3A 4CNUA 2E5AA 5CPTA 4AY8A 3A4WA 3CGTA 1XWYA 3RN6A 2Z1VA 4PMUA 2RDTA 4JNMA 3TFXA 1LBMA 2X0YA 5AHFA 2XSXA 1J9YA 3EMCA 2PDHA 2VD9A 3ARRA 5G2IA 4FI4A 4X3ZA 1UD4A 4W89A 3GH5A 1KCLA 4V1YA 1GESA 4B5UA 1PKYA 3GUGA 1IXPA 4H4XA 3A4XA 4AU0A 5H2ZA 4BI5A 3OC4A 1KV8A 1R5YA 2Y63A 4MNKA 1QNVA 3OGVA 1LRQA 1QW9A 1E9YB 3D6NA 2YXOA 3L2LA 3S1UA 3WEMA 5T8GA 4W8BA 4IPJA 1H1ZA 4HB7A 3H55A 1EEXA 1S7MA 4S3AA 3BJTA 1JPIA 4K1WA 3U9IA 3QMTA 2X16A 3W7DA 1V59A 4I9JA 4HYRA 5M1TA 1UHVA 4XZWA 2PMQA 3TLLA 3H2NA 2EG7A 2G0WA 3UVIA 2GZXA 3NQGA 2Z00A 2YIHA 3TYEA 4UTWC 3AWNA 4Y9NA 2PFHA 5D38A 1GTHA 2YJQA 1NWTA 2C6QA 4GPNA 4EK7A 3VDAA 4YTTA 5CBIA 2CC0A 3O9NA 4DXKA 4DWSB 1J0HA 4OFCA 4J56A 1QNOA 1YW1A 1JCJA 1S5WA 1HT6A 2DSKA 2YDQA 3LEPA 1D7FA 1ITXA 4W93A 4BJHA 3SJNA 3PSWA 3FK4A 4CU7A 1X7IA 4BI6A 3WJZA 2REQB 5CZJA 4GI4A 8XIAA 3CPUA 1RPXA 4BCEA 5KINA 3TC6A 1XX1A 2R14A 1T99A 3B8WA 3W22A 4L64A 2VQUA 4GHRA 3HJZA 1FDYA 3HFYA 3AMLA 3MHGA 4EP8C 4LVGA 2J9XA 4EVZA 3PZTA 3VIHA 4FDCB 2XH4A 1HJXA 1M7XA 3CB8A 4RDWA 3IGUA 1GCYA 3NVTA 4UFHA 3FYOA 5BNKA 4ZOBA 1BYDA 2TAAA 4DO4A 4NI8A 4W88A 3LM7A 1CLXA 4W85A 3EOLA 4GUJA 2DUAA 1YRRA 2PLCA 3BJSA 1O5RA 5A8MA 2ZZ7A 5JBEA 4HTYA 5K4XA 4JN7A 4DYEA 3GAYA 3BPWA 1DJZA 2VR2A 4HOXA 2OKOA 4PRWA 4QDPA 2CFYA 3RLGA 1JYVA 1FWDC 5CPSA 2XM1A 1IF2A 4YMZA 1LQ0A 1AJ2A 1RD6A 3DGHA 3KVKA 4PMOA 3SECA 1V5XA 3W1NA 2C71A 5SWUA 2BZNA 1PEZA 3FX4A 1IEXA 1JR1A 4WIWA 5FEZA 3BQ5A 1WDRA 3B4YA 3HPSA 2VEMA 3LDVA 1XKJA 3E2RA 4D1JA 1XRVA 5H8MA 3AIUA 1DJXA 1UD5A 4CGTA 4B4FA 2Q09A 4GA8A 4CVUA 4ZE5A 2YXXA 2Z0IA 1O5QA 1N8FA 4JQAA 5AY7A 5FS9A 2GJLA 2BCPA 2DIJA 2WKGA 3GXPA 3MZNA 4M7SA 3ZWTA 1Q8JA 4IIGA 3WK3A 4Q8QA 2WSPA 1GJPA 2O56A 5HPOA 2FZ9A 2NUXA 4Z2HA 4EPDC 1DE5A 5FJOA 1FWGC 1TA3A 5FJIA 4GX8A 5BOEA 4XBJA 1W1YA 1E3ZA 3LTYA 1ISZA 3TSMA 5AFDA 4AIUA 1WOAA 4NG3A 4C6LA 5DBTA 2J7DA 2IMRA 3TAKA 4FX7A 3U0HA 3W2LA 2BVTA 5DMLA 3FFSA 3NVZB 4CEUC 1E6ZA 1RLCL 2OWWA 5LHFA 5G1YA 2J7GA 1VBJA 1PKNA 2G3MA 3GRTA 2Z1XA 2QDDA 5M17A 3VDGA 2PDUA 3GDLA 1Q13A 1J11A 1Q6DA 2YCEA 4GQ0A 2XN2A 4Q7IA 5C8BB 1WKFA 4DM2A 2PP0A 4ZENA 5I09A 2WJEA 3KLLA 4N6EA 1UR0A 2PGWA 3FJ6A 2PDCA 3CT7A 5M2FX 3B8VA 1JZ5A 1DXLA 3PVFA 4FAMA 1SO6A 2IPWA 3MUZ1 1VIWA 2J74A 3KFTA 3AFBA 2WPBA 3AJXA 2PTWA 4E8CA 3LOTA 2E4TA 3KHDA 4H04A 1RJQA 1OD8A 3APTA 3AMDA 3UYCA 5D03A 3CZEA 1PYFA 3HGSA 4WJXA 1XS2A 1YDNA 1UH2A 4O52A 3N29A 1GOMA 3LGGA 5C2XA 3ZR6A 1S5MA 4MWAD 1KFJA 1PZ2A 1VFOA 1PB0A 3PN8A 1R3WA 4XAZA 3RRXA 3R7MA 3G24A 1GW1A 1Z9AA 1GG0A 1BPLB 3SRHA 3ES8A 3LERA 4WUIA 4EXBA 1U83A 1KM4A 3N4AA 4U4MA 2ISDA 4F9JA 1S1RA 3VIKA 2QAPA 2BGQA 3ZT5A 1VFFA 1EJTC 4NZ5A 4DUOA 2OZTA 2V9DA 1K7XA 4P8UA 4YWOA 4ALDA 3EPOA 3VABA 3NVYB 3GYEA 4K8GA 5I3JA 3KX6A 1IWBA 3UVAA 3W1LA 1CGWA 2WP5A 4PTDA 4TOQA 2ZICA 3NR0A 3NG3A 3BSMA 3CXBA 3CC1A 2XWDA 4FX9A 2ZRXA 4P8XA 4H4WA 3CPRA 1NOWA 3V1PA 1QNQA 3UZJA 1UC4A 1TWWA 3ME3A 3H2CA 3DC0A 2O0TA 3XIMA 4JX5A 5D8WA 1VFTA 4GQQA 2I9UA 2OCZA 1JCTA 2Z29A 4AYGA 3MA8A 3CU2A 3W28A 4CCDA 2YR1A 4ACZA 2BP1A 2PBOA 1WYIA 3TTYA 5DELA 1K6WA 4WSJA 3WH7A 4HNUA 1FA2A 3UEQA 4W4QA 3EF6A 1ADDA 2PU1A 3CWOX 3CMJA 4LUYA 3OLEA 2EO7A 3VIFA 4WQ6A 3AMKA 1PL9A 4JZ5A 4PL1A 2BGSA 4EQRA 3VZZA 2WC4A 4KEUA 5BWFA 3VKDA 1V4YA 1AW1A 5DXYA 1BWLA 2A6LA 4AY7A 2X41A 1KXQA 3WMLA 2IPFA 3GG8A 4NZCA 2J6XA 4YN5A 4HA1A 2X2YA 4YVPA 3V4BA 4PR4A 5E9XA 3LYEA 3QC3A 2V2CA 4MY8A 5DANA 1W6TA 3L65A 1FWWA 2YCIX 3CYVA 3UWUA 3NQVA 5E70A 3GIPA 3AROA 2B7PA 1G7UA 1OFBA 3ITYA 4XB3A 3QGVA 4ZB0A 1NHSA 5C55A 4M7TA 3WNNA 4DXVA 6REQB 1H1YA 1PTDA 4J2PA 4DVOA 4P7QA 1TTJA 2VFGA 4TVYA 4H4VA 4P2VA 3I68A 4IMFA 1C90A 3APYA 1LF1A 2VC5A 1TJ2A 1R9XA 3N19B 4MADA 2GVYA 3LXAA 1YLVA 1NJJA 3KHJA 4ICCX 3EBVA 4LALA 1GVQA 1UD2A 1FP8A 2VX6A 4CQDA 4QJ5B 1W3IA 1VFLA 1U5JA 1GEQA 1C7SA 4D6DA 2VEKA 5DF0A 1W9VA 2FH6A 2QCGA 3GUWA 3U2EA 3H4KA 5LXXA 2DT2A 3INPA 2P76A 4S38A 2BG5A 3WH5A 3KUMA 2PEVA 3DZ1A 2JFEX 1UR4A 3OZMA 3VAVA 1IXQA 2ZTKA 3UG8A 4QAIA 4NJIA 1KXHA 1GZJA 1MO9A 4FF7A 1KRCC 5FESA 4TUFA 4G7EA 4EQXA 3WUGA 1PZ3A 3T2PA 4G5DA 2Z1WA 5E9AA 3T09A 1Y8BA 3LCGA 2WMFA 4UTFA 1YE4A 3EKGA 5DCEA 4DI9A 3PJXA 3PJTA 1VHNA 4TXEA 1MOKA 3N3TA 3RX2A 3T2OA 3P2VA 3EX4A 1A5UA 3PUDA 1HO1A 2J24A 4IT1A 1XLJA 4PMVA 4FPSA 3C61A 5LGXA 1JYWA 3H7RA 2QJIA 3C2YA 3TE9A 3G6MA 3ZM8A 1ZTVA 4WVXA 1ZAHA 1ME9A 2DZUA 2E6FA 1EBDA 1PZ0A 3DFPA 3Q6JA 1SPQA 1KO0A 4ZB2A 4IQEA 1I2PA 1AFSA 2P3EA 4JKLA 1LZOA 1G9HA 4AW7A 1UWAA 3ALFA 2W6RA 2WB5A 3BZGA 1IWPA 3CTTA 2OZ8A 3Q4DA 1RALA 3NVWB 2VRKA 1YXCA 2A3AA 3SR6B 4GNVA 2WOQA 3THUA 4JQ2A 1TWSA 3AHVA 3C2VA 4CN4A 4Z17A 4FXRA 1YDOA 3O7UA 2QIWA 4J9JA 1JZ6A 1E4MM 2Y1HA 4TTGA 1T5AA 4INFA 2A2IA 4DBUA 4P8VA 4D6FA 1B3YA 2R1NA 1JFXA 3THDA 4LEFA 3KTSA 3BVJA 7ODCA 5JCNA 4ACYA 4H1ZA 2VI0A 3GVRA 2V3DA 4N6FA 4H4RA 5A8PA 5TQLA 3W3OA 4DI8A 2NQ5A 4MYXA 4C6IA 5K4ZA 4NZ3A 2YB4A 2AAAA 3LPPA 3MCMA 4IXXA 2GWNA 1KKRA 1XLHA 1VDVA 2PI6A 1QWKA 4JTFA 5D05A 4J1OA 2WMKA 3GX9A 3V5FA 4JX6A 1X6NA 3II1A 5DMNA 4UTUA 1HP4A 4HK6A 3TFCA 5CPOA 1ZQ5A 1DTUA 4Y9OA 2XVLA 4G1KA 3B8DA 4S3EA 1AQFA 3LQGA 2ZUUA 3ITVA 1W3NA 4KT2A 4WKHA 3RGTA 4ZOHB 3TR2A 2H9AB 4MUZA 3TQPA 1ZS2A 5G5IA 2DH2A 3W2UA 1M03A 1DJHA 4G6CA 5E0CA 3KBNA 3N15A 5FD0A 4JFSA 2E09A 4LC8A 5I3DA 3NPVA 2OMAA 3A5VA 3KCOA 4GY0A 3L4VA 3VPLA 3PUGA 3BANA 1W9PA 2F2KA 3UR8A 2ZXAA 3GFZA 4MSSA 4J4KA 4D6IA 2PAJA 3MV11 1ISWA 3OBEA 1IZKA 2F9RA 4DEFA 3RK8A 2YBVA 2OQHA 3BGGA 4I9MA 3P74A 1KR0A 1UIPA 5IBXC 2CYGA 2GSJA 2XVPA 1KFLA 4PBEA 2HS6A 2W66A 1XYCA 5JRBA 1A5LC 2WBGA 3PZIA 3UY7A 1GZ1A 2Y2WA 1V0LA 3N6QA 1ZCCA 4NKCA 5DRIA 3TWAA 2PTXA 3SUSA 3YPIA 2VXNA 1E15A 1XFCA 2OWCA 4J27A 3KVLA 1WXYA 3DGBA 3CTLA 4NJKA 2GPTA 3WEOA 3WD2A 4XO6A 1OCBA 4KERA 4AVOA 1US2A 3DOPA 5IDIA 2C1HA 4DZHA 1BAGA 2QULA 4REQB 4AZ5A 1OGGA 1ECEA 2VC7A 4XG1A 1AJ0A 2OQLA 5DY3A 4WZHA 1A0EA 7PTDA 3FXGA 3NQ7A 1TMLA 3F4WA 3MHUA 2OU4A 4B3ZA 4P5UA 5KETA 1A0CA 3LHUA 2PLMA 1ZJIA 3OHMB 3R8RA 1J0YA 3GIYA 3SFKA 2A6NA 1MUWA 3O6AA 3VO0A 2VCCA 1H62A 4F0SA 4ZEPA 1JULA 3MI6A 4AWTA 5HNUA 4MPQA 2HMCA 5EMLA 3WQOA 3DAQA 5CCZA 3FIGA 3LNPA 4O1FA 3NO3A 4ADWA 1QBAA 4HK7A 1YXYA 2WO5A 4JTTA 3K8KA 1Q6LA 3BOXA 5HJYA 1G0CA 3TW6A 2FFCA 2XSBA 4B5WA 1ZP3A 2WPEA 2CKRA 2E8YA 2VVNA 1E40A 3GY1A 4B5NA 3ANUA 3K1GA 3V0UA 3NA8A 4GMEA 4M6UA 1M7OA 2XH0A 1D7YA 4ZA0A 3A3WA 1EJUC 3EEGA 6A3HA 2FGBA 4Q6JA 1KGWA 2VGBA 4B16A 2D2JA 1ZCOA 1DYSA 4RZ6A 3MMTA 2EQ8A 1SMDA 2J3NA 3K46A 4HNNA 3CZJA 2J47A 4DNAA 1WX0A 1K3UA 1AH0A 1KFWA 3VGDA 2QV5A 3GHSA 5MF5A 1LWJA 1SFTA 3RLHA 3W7PA 4AISA 1ONEA 3MWCA 3LD5A 4L61A 3AXIA 2BXZA 3WQPA 4PMRA 4JIEA 4WXYA 5ER0A 4RXGA 3N2BA 4NAFA 1W1VA 7ENLA 3W2NA 3RCNA 3TKFA 1V02E 3LI0A 2YFNA 3KVMA 4C6NA 1VCVA 4M1RA 3P81A 4A05A 1J6PA 4URIA 3HPFA 4AXKA 4AAJA 3L4UA 2VFHA 2VZUA 5LYRA 3SCTA 1W37A 1W54A 1XL9A 1MW3A 4L4OA 1S2AA 3AXHA 2GR0A 5HAOA 3MSRA 7XIMA 1C8YA 1REQB 3TNBA 4GFSA 3N4FA 2Y8VA 1J93A 2WLYA 4ML4A 3K8LA 1I8JA 1DL3A 3GZ3A 3K5XA 2YYUA 1LJYA 4DELA 3WEZA 1C9WA 4JFVA 3R8GA 2VOMA 1KTBA 3L5LA 2TSYA 2CDUA 3A64A 4JHZA 2DGAA 1W1ZA 4MWAA 1UCWA 3N2XA 4F2BA 3AYVA 1L6GA 3PJWA 3R6IA 3CHFA 4TVDA 1LCOA 3FKKA 3SCUA 3ZSSA 2QUMA 2O7QA 1XG4A 2R91A 3MCNA 2DPEA 4A8NA 2DT0A 4HZ7A 4H8VA 5LA1A 4US5D 4UTJA 2PRHA 3W76A 4NXSA 3VNDA 1KRMA 2OYMA 3MYOA 2PD9A 3GDMA 3QHOA 1TTIA 2CLLA 4O1AA 2V6OA 1NHQA 2OELA 2VZTA 5F1VA 2VRQA 2YB1A 1FUYA 1OFQA 1B30A 4JTKA 5KTLA 3DH9A 4DY1A 1W3HA 1R47A 1TV4A 1P6WA 3RXZA 3L12A 1QRQA 2O9PA 1N5XA 4UNKA 3VCNA 3EKZA 4RZ5A 2L5HA 4PH6A 4RX0A 4GYKA 4S3FA 3M43A 3IJIA 2XGBA 1A5SA 2EQ6A 2QKFA 1OHLA 2XVGA 3BXWA 2PD5A 5K7JA 3WBYA 3R11A 3TMLA 1L0PA 1JRCA 1R0MA 1VENA 5C9UA 3B9DA 1SZEA 3CWNA 4CU8A 5IM51 3EPMA 1P7TA 1FHLA 2BY1A 1O4UA 2OT1A 2R8WA 1X7FA 4JTLA 3NM3A 2WZHA 3BUVA 5DCDA 3N6HA 2QAFA 4XZ9A 3W82A 3HN3A 1FKWA 2DQXA 3IAPA 2Y5EA 1FIQB 4EX4A 2I16A 3L21A 2W5FA 5ABFB 4BZYA 5GJNA 1JCYA 4ZO7A 2DIEA 2XIOA 3AYSA 4LF2A 4EWND 2XTKA 1VIZA 3CHVA 4IF2A 3ERPA 4AZGA 4IM4A 5F2LA 3URQA 1JRPA 1RLDA 3WZ0E 1WV2A 3SUWA 4AEOA 4IGMA 4XZBA 1CT5A 1UZHA 1FX6A 4LYRA 3RO8A 3NO1A 4YWSA 2VGFA 1ZX9A 2E0PA 1JDDA 1RP8A 3LNMA 4DLFA 4LS1A 3TTEA 1T96A 1XUZA 3CQ0A 1OFAA 3PY2A 1MVYA 3T07A 2BXVA 4NY2A 4WDUA 2AMGA 1QAPA 2X50A 1HXJA 2X40A 4M82A 1DNCA 3MSGA 3UG4A 4C5ZA 4K2SA 2NPXA 4AF0A 1A3WA 2Y4SA 1H1NA 1GYLA 2OB3A 1OEPA 2VCBA 2CPUA 5EFFA 3U4FA 2GK1A 2YBUA 3V36A 1EA0A 3H2FA 1SZNA 2ACRA 2G97A 2YL5A 4QQ3A 2XWEA 3QSTA 1W56A 4XZLX 1R3QA 1EC9A 3UWYA 5ABHA 2YPIA 1LOQA 4D6JA 4DXXA 1R46A 4M29A 2YVJA 1Q7MA 1D8CA 4IG2A 1PDYA 2Y0FA 5CGTA 1KWGA 2HEJA 2EPKX 2ZDSA 5AZ1A 2QVHA 3S5SA 4AC7C 3HGJA 2VTFA 4F48A 4JTQA 4B15A 4E5TA 3ARWA 1I0BA 4AIBA 3C8NA 2V5BA 1TVNA 4MB4A 4L4MA 3B8SA 1JGMA 3GFXA 4HMCA 1JPKA 3FXYA 2HV5A 1AVAA 4O12A 4HCHA 1LWHA 1Z48A 3P7YA 1J6OA 1FH8A 4YNGA 3PUOA 3CV6A 3QC0A 3OZPA 4C6JA 2P3ZA 2XYLA 1TMHA 2VR4A 5EB8A 4PBGA 1HL8A 4C7DA 3VA8A 3LXCA 1X97A 4FNUA 1OIFA 4C6MA 2ZZBA 4QEEA 1PO9A 3CL7A 1YMYA 3C2FA 4RLIA 1F74A 3K4DA 3P0XA 3OBAA 3LCIA 4M24A 2BWGA 1QOXA 3W38A 3VE7A 3BK0A 1XW8A 1G4PA 3VOFA 1C8QA 4HHLA 1V3MA 3W7LA 2Y85A 1HVXA 5EKYA 2ZXBA 3SY8A 1VGAA 5HUOA 2QPUA 1KQYA 3T55A 1R9YA 4TMBA 1UROA 1EA9C 2WNZA 3SN4A 2WYSA 4KW2A 2C16A 1VYRA 3WUFA 2IXVA 2VENA 3EWCA 3SUVA 3GU9A 2VZVA 4OTKA 3ZMRA 4UB9A 1LRTA 1OFOA 3LA4A 7A3HA 2CWNA 2QZRA 4RDVA 4LVDA 3MYPA 4M0XA 4HMNA 2PDXA 3MU7A 3WH9A 3GVVA 3VDHA 2GDUA 3UCCA 1XLBA 3QFAA 3TYBA 3QQWA 1GREA 4XKYB 2Y24A 1CGVA 3ZJKA 1US0A 4E6MA 2NQ9A 2CHOA 4NU7A 1DWHM 4PGLA 1THFD 4QDWA 4LC6A 2FTPA 2EGZA 2QUNA 5EA9A 3CH0A 3V18A 3C56A 1XC6A 3IJ6A 3TSDA 2NWSA 4C6PA 2E68A 3C0QA 5GNYA 1UJQA 3WN6A 1LPFA 3EUB3 2CZVA 4YCOA 1LM1A 2BY2A 1NF7A 3MS8A 3WYZA 2DFAA 1QPRA 3TIMA 2ZA3A 3N25A 3UW6A 1E1CB 1BSIA 1J2WA 3WD0A 3GBDA 3VXGA 3WH6A 1UWSA 2ZA2A 3IJQA 5BZAA 4J2MA 1GV4A 4I5RA 1OADA 1EXPA 1UR9A 3FEMA 4H4TA 3W83A 1H3GA 5ABEA 3LMZA 1TWZA 4JYDA 4OIFA 2EPOA 2I5GA 3SCWA 2QMJA 1M5WA 2BGNE 4JKMA 3VGHA 1G01A 3M0KA 1QCWA 4RR4A 4U3AA 4HNLA 3NEVA 4DWSA 3UJ2A 1XDMA 1NTHA 3LPGA 2ZZ2A 4ZFMA 5GNZA 1BTCA 1GOIA 4ZQMA 1ODUA 3NL6A 4DJFA 3BJFA 3HMJG 2IUZA 3HFTA 1VS1A 3C52A 2QCLA 1TPH1 3RJYA 4HKPA 3VDCA 2WZIA 3CUZA 3KOWA 4KWWA 3QW3A 2A0NA 1N62C 4J3XA 3ARTA 4IL0A 1C93A 4HIBA 5CAKA 3QY6A 4Z2IA 3CQKA 4KETA 3NYDA 2OXNA 4S23A 5DCBA 3DDMA 3TTOA 2E9LA 4R34A 1CXLA 2YL6A 1ZZMA 4JIHA 3CLWA 3UG5A 1MQRA 4E2BA 5TD4A 3OA3A 4NI3A 4E4UA 3PZ9A 1W1PA 1LL6A 3WDIA 1I75A 2PUZA 3WFZA 3DH7A 1J96A 3L0KA 3QW4B 1M3UA 4JY9A 4JTUA 4KESA 4FLQA 3BL3A 2RABA 5C9WA 3IGSA 3CO8A 5L9FA 1Q4NX 3BLKA 3ZSTA 3U48A 3OVQA 5I06A 4OU1A 1F6KA 1CXHA 1N2VA 3RX4A 4AX7A 3P80A 2WMGA 1TJ0A 1IR1A 1I2RA 1JJKA 4D71A 3V5OA 1TZZA 2Q01A 5IDZA 4APNA 4ZOAA 1PX4A 3KOYA 1HIZA 1XIMA 1FWBC 2VO5A 4IP7A 4H4YA 1BG4A 2PGFA 5A6BA 3LHYA 5TNVA 3URHA 5E1QA 1QK0A 3KE0A 2ALRA 3GK0A 4ZQNA 3CGCA 3R0DA 3AIBA 2Y70A 2VR5A 4ZFCA 2H8XA 1FWRA 1MQQA 4CNSA 3C4UA 2WJZA 3GW3A 1M41A 3ARXA 2UY3A 2D3LA 1C7TA 2G41A 1P0NA 4G56A 3UXIA 1XQLA 3EDKA 1ADSA 3PTQA 4UXDA 5U4NA 3EZ4A 5DN1A 3SO7A 2OEMA 1VAHA 3LXDA 2W91A 1X1ZA 3MSDA 4H00A 4H9MA 2C1GA 4UQ9A 4H41A 1AMYA 1HJSA 3CZKA 4JQ4A 3DN5A 5JBDA 4UTMA 1E3XA 4LV4A 2NLYA 5AECA 2W55A 1VLIA 2OR2A 3HO8A 3WUBA 3TH6A 1GUVA 4L7ZA 1H11A 5CQ1A 1DPMA 2HNEA 4IJBA 3W71A 1U30A 1VBGA 1C8XA 4LTSA 4H4IA 1XKYA 1Z8AA 1ZFJA 4H2CA 4RNHA 2DW6A 3RX3A 3V75A 2HNHA 1CGUA 4Q8UA 5DXXA 1JD7A 2WJFA 2YCLB 1GZGA 2HQAA 4N02A 4XKMA 4QX4A 1XLIA 2QF8A 4GZJA 3KM8A 7TIMA 1SZGA 3WK2A 3WBAA 3UR2A 2BX7A 5JUVA 2QDHA 3MB9A 5FJRA 5DBUA 3FOKA 1AJZA 4GQRA 3P14A 3A3HA 2XDFA 2YA0A 5EBKA 3MSYA 1A4MA 1NF0A 2TRSA 2GDVA 3GDKA 3I6TA 3SGUA 1HL2A 5HMSA 4UMAA 3F2CA 2C1IA 4AHQA 3OA5A 2RDWA 3A47A 2X1TA 4GBDA 1QPOA 1DORA 2CESA 3WX7A 3U57A 3CYJA 1RM6B 1XSJA 1F3EA 1OABA 4E3VA 4PMQA 3GC2A 4J3UA 1L6WA 1XLDA 3KDNA 3VDBA 5LZLA 2QQ6A 1EQCA 3G22A 2PBGA 3VCCA 4LWWA 1YHTA 3AIEA 1KM6A 1LQAA 4GOAA 3V3WA 2CBVA 3S5YA 1FXQA 1P4CA 4M6QA 3ZLGA 3VD7A 2XZ7A 4NNBA 3LI1A 1DQUA 3LRMA 3EWZA 4H6KA 1BVWA 3I65A 4F0RA 1R9ZA 3QFBA 4GE8A 4PTWA 1FEBA 2HK0A 2PDMA 3M44A 2W27A 2Z1KA 1GRTA 2QEZA 1J4EA 2HVNA 2C8NA 3KLKA 1LUCA 1Q63A 2FVKA 4PEKA 2UY2A 2R1MA 3H4GA 3HMCA 1ZSXA 3GW0A 1P1XA 1U22A 5B80A 5LNSA 4I9TA 3ZWSA 5AHMA 4A3UA 5HK4A 1PS9A 4RK8A 3LLDA 1U2YA 3T0BA 2R6OA 3OJGA 4C6QA 3VKCA 3SGZA 3DERA 3EDDA 2PWUA 1Z41A 1GPFA 3WLRA 3PZNA 3HG5A 3B9JB 3S1WA 2LLEA 2J8FA 4L9XA 4C6DA 5KVHA 5EMYA 2BY3A 2QF7A 5EYWA 2ZE0A 3UCQA 4US5A 2RKXA 1VFSA 1OC5A 3NQFA 3G1AA 1T8QA 3PBYA 2R82A 2F7FA 1V02A 2G3NA 3I6EA 4TV5A 2HROA 2GL5A 1AQ0A 3IV3A 4N9EA 1P1MA 1V7YA 4JTJA 3CUFA 3U3HA 3AIRA 1BZLA 4LAUA 4LT9A 2HVOA 3VKAA 4GZ7A 4JOMA 3L23A 4B5TA 1MEIA 1XBXA 1BRLB 3CUXA 2CHRA 1SW0A 3SSJA 1R8LA 5C6MA 3VK5A 3TVAA 1VPXA 6TIMA 4KRUA 5HJXA 2NQJA 1U33A 1VBUA 1SVDA 3U6WA 1ZBCA 2QS8A 3GFYA 4B91A 3REQB 4Q4OA 1ENUA 2ODOA 2FGLA 1VFUA 5EMMA 3T1GA 3WQWA 4DF2A 4Y96A 3HV9A 4WGHA 3CIWA 1C3FA 4L4PA 1QBBA 2XN1A 3GD6A 4Q8NA 4XSLA 3WQVA 1M9HA 1LRNA 1QO5A 4JFTA 3H54A 4LVAA 5FACA 1A4LA 4XVDA 2HBXA 5JXQA 4XUGA 4C1NA 3V16A 3RHGA 4UTKA 3ITXA 1WOBA 3BLPX 4Y2WA 4NL1A 3V0TA 1EDQA 3BAYA 3QRHA 4AVFA 1NM9A 1FRBA 5CSSA 2CETA 3THAA 4H9UA 1WO2A 5MKGB 4JDRA 1O95A 5A6SA 3AYRA 3TYUA 2ADAA 3ZIZA 4YIWA 4MDPA 5AB3A 1OYCA 2X7VA 4L6DA 3IACA 3DK9A 3FJNA 2WSYA 4AWSA 3RRAA 4LNCA 5D04C 2DUXA 3LX9A 4OUIA 2HE5A 1A0DA 2PCEA 2V3FA 1ISXA 3VKKA 4LNYA 3PK7A 3FN9A 4IMEA 4W5ZA 3M7WA 3QZAA 4X2RA 5D2TA 3NUKA 5CEWA 2DJLA 3EWUA 5H91A 3MTWA 4BKNA 3N9RA 5CXPA 1TKKA 3UPWA 1UUMA 3TV8A 4LJ3A 4LAKA 2OFJA 3TN4A 5FS8A 4X22A 1SJCA 3O2LA 3QVQA 5KZMA 1XBZA 3HQOA 4LUSB 1UUOA 4Q8MA 2I5IA 3W7JA 3QV9A 5A94A 4A22A 8RUCA 3BCJA 1H5VA 2GJRA 4DJDC 2PZNA 2OZ0A 2E25A 1W2PA 5EGRA 4IH3A 5E6YA 2EBNA 1EJ7L 1XSIA 4ADSA 3PBWA 4JTGA 4MDOA 5E5CA 3FGCB 1MDLA 3FVMA 4AZHA 3HQNA 3W53A 3VKJA 3NQAA 4KWSA 3KTCA 4MJ4A 3W0KA 1XGEA 3EDEA 1T0OA 4KF1A 4N9CA 3W74A 4LVBA 1KLZA 2H3BA 4GXMA 1SFJA 2DIKA 2FQIA 5AYBA 1NEYA 4V28A 4LS2A 2EQ9A 3QMSA 2ZTJA 4MHBA 4BQ4A 4F2TA 1XJBA 2ALDA 2WSQA 3GRIA 2A85A 1FDJA 2NXGA 4EACA 2RUSA 3WQCA 3QQ1A 5CPLA 3SCPA 4YTQA 4BF5A 3GG7A 1HQTA 4LUJA 2CEQA 1XLMA 1W0MA 1JAKA 2ZVIA 3LV5A 2F5ZA 3CV2A 4F8XA 3OVRA 1XIGA 3MI2A 4K39A 3RPMA 4F9DA 2Y61A 1UWUA 5AHLA 1AQMA 2ISFA 1FHUA 1KTNA 2FHBA 4XD4A 4LX4A 2V3EA 4B9ZA 3W26A 2CLKA 1K8ZA 2DT3A 2G96A 4H83A 2A3BA 5BW6A 4N42A 1JPDX 4IP5A 2EPNA 2PDQA 4GO8A 3PPFA 4GVFA 3PS7A 4ATWA 1E0TA 2MNRA 3MZ2A 1H7XA 2TPRA 5LSMA 5HWNA 1AD4A 4DJEC 4FALA 1JCLA 3K30A 3UJFA 5JMUA 4NRSA 2YDAA 4FOJA 3B40A 5FJUA 4H7CA 1A5CA 1ZLPA 1TV2A 3O05A 3T2QA 4JL2A 1UH4A 1XHGA 1RAKA 4HN4A 3N13A 1I6NA 4GUGA 1FVPA 3EX6A 2EG8A 1HKMA 3GD3A 1G4SA 1AA1B 2XIMA 4QLKA 3AHTA 4X0NA 4A3HA 2VGIA 2PDBA 5FAGA 1H50A 4DX3A 4JIPA 3FY1A 1ZBWA 2DZVA 1F6YA 4CQBA 4O57A 3GBEA 4S39A 4O1CA 3PZOA 1SO4A 3CNYA 1ZAJA 1KXVA 3VX0A 2IW0A 3UZZA 4CD5A 4G9PA 5LNRA 2A3HA 4AX6A 1C29A 4JDBA 1W32A 1SO5A 2GOKA 2AGTA 2IKJA 1T3QC 2WZTA 3OU8A 4U2YA 2PP3A 5F7UA 1HGWA 4ZXLA 4ROPA 1MMFA 5JVLA 4H8HA 1V8EA 1DE6A 3W6YA 3AMZA 3VNKA 4GYJA 4A2RA 3SM0A 2PDIA 4HU0A 1A5OC 3PBMA 1B5TA 1HX0A 3WSUA 4QLLA 1VPQA 2PC4A 2TMDA 4G8TA 4AH7A 2X8CA 4L1GA 5JCMA 3KCLA 1J79A 1UBPC 2ZX9A 2CITA 3BTNA 1FWCC 3BARA 3T0DA 5CJNA 4E0CA 1FQ0A 1GVOA 5LIUX 5DX7A 3G1DA 2WM0A 4XIMA 3BAXA 1NAL1 3GQYA 4O53A 2PB1A 2H6RA 3GXTA 4OBRA 1I60A 5AVHA 3EWYA 1UH3A 1YBQA 1CI1A 1H6VA 4C5YA 4UMCA 3C6CA 3EOEA 1WDWA 1VP5A 4OQVA 2VT0A 4PMZA 3M0YA 1EOKA 4QFUA 3HF3A 4NXKA 4RL3A 4UNIA 1M7JA 3BSGA 1LLOA 1BKSA 1OK4A 4RJEA 4F2UA 2I5QA 3VMOA 5FF3A 1XISA 3R1ZA 2NUWA 2VZSA 3DECA 1TV3A 3AZRA 4GJJA 1L9WA 4WSHA 4OV9A 1PHWA 1EJVC 4ZQPA 1VLWA 1DQWA 4DUXA 4ZMGA 1FOBA 2CXEA 1TJ1A 2ZKMX 2UV8G 1XYAA 3ARYA 4WRHA 3KEHA 4GZEA 3ENLA 2DZXA 3D0CA 4JY8A 2W3RA 3DEQA 3G8RA 2NT1A 3OZYA 1OC7A 1UR3M 5C0QA 1FWNA 1KC7A 4M56A 1RJPA 1VFHA 2X0SA 1POKA 3VKBA 1EX1A 2J13A 3LUTA 1TX2A 3K2GA 4MGGA 5FEXA 1NP0A 1EEPA 3P60A 4L80A 4PMJA 5F2IA 1ZK7A 3UPMA 4RW5A 1U1HA 2ZYFA 3BE7A 2ZXDA 5AYYA 2C91A 4K8HA 4GI9A 1JDFA 1KRAC 3LCHA 2AQWA 3GDTA 1R3RA 4JTHA 4K7VA 1SMAA 4JCMA 3G1RA 5FJJA 2EKCA 1DXIA 4CNPA 1AMKA 4X63A 4IPLA 4R9OA 2FYMA 3PULA 1BQCA 2ZADA 3GVGA 3BG5A 4GCXA 3CGBA 3G1VA 4YYCA 1GRFA 2BHUA 4JHOA 3IUDA 4P7NA 1F9CA 4J3ZA 1WA3A 3RM8A 2WVVA 3G18A 4ZSTA 1IZJA 2NVAA 2C13A 3ABSA 6XIAA 1W3JA 3FSUA 5IBXA 3TMQA 1QVBA 4AZ7A 2XN0A 1FECA 3KL3A 3R8HA 1RBOB 3Q37A 1XXXA 1I4NA 4X61A 1A5KC 4K6AA 3PBVA 4UFMA 3NL5A 3SCQA 3M0VA 4Y7EA 3VIOA 5FJTA 3QZ6A 4MTVA 4X60A 3RNMA 1AZ2A 5DO8A 1ZY9A 4Q7NA 3W87A 3N3MA 2CZFA 3OLDA 6TAAA 3SIZA 3MUAA 3CUHA 1E72M 2GGIA 1ZJAA 2D0FA 3WF1A 4AMAA 1TO3A 4HD5A 2NV9A 5D9MA 3CEPA 5D9OA 1HNYA 2BASA 1M65A 1F8WA 3NIYA 1WAWA 3UXLA 3G0SA 1H5YA 3VM7A 4YS1A 3C2RA 4A8IA 3DHUA 1LLWA 3B0VC 3ZVHB 3OP2A 3SRFA 3ZT6A 4JEQA 4Y9PA 2QJGA 1VEOA 4IISA 2ZZ4A 5CZ0A 4NNAA 2R94A 6CGTA 4RZBA 4X2PA 3PPGA 1WXZA 2XINA 4L4LA 1F2JA 4AZCA 4FIQA 1B4EA 4MF4A 4ZQOA 1RK5A 4S3JA 2IS7A 1F8IA 3QZEA 1R2SA 4KMQA 2BVWA 3SCOA 1XBYA 1WDDA 1RJRA 2GVEA 3GTHA 4RPPA 2V5JA 4RNIA 3SUUA 4RV8A 1KWKA 1ML1A 3GE7A 2E6AA 2E1DA 4H7ZA 3VNLA 4ZGYA 1H7RA 3CAWA 5I79A 1D2KA 2ZZ0A 3NFUA 3VZYA 3FLUA 3AXXA 2HXTA 3O06A 4H01A 1K9DA 3S46A 2IKHA 2AL2A 1XIFA 4GNKB 2CWXA 1XGDA 4O4VA 1BXBA 5LNVA 3WNMA 3PWGA 3NS1B 2GQ9A 4NSBA 3ZXWA 1EJRC 5D2WA 2OOGA 1J10A 1QT1A 3WFLA 3TYZA 4D8LA 1V77A 1W8GA 5BOFA 1RD5A 2PWEA 4IMGA 3RLVA 1TE6A 4HTBA 2WBKA 3VNMA 1W5NA 4KFPA 3QKEA 4XBKA 5JQ9A 3ETRB 2WMJA 2V82A 5HR7A 1WB0A 4CU6A 2FB3A 3JVAA 2VX5A 1GEUA 1MO0A 2CBUA 3J7HA 1J01A 1QMLA 4E4FA 3RG6A 3ITTA 4IFOA 4MNJA 3G1HA 1GKRA 3AWOA 2WMIA 3RIKA 5G1TA 3S1XA 4KGJA 4EMWA 5CLWA 3GDRA 3POHA 3UGRA 2DZPA 3IEBA 4IFKA 3HRDC 2YFOA 1IV8A 2VX7A 2Y7EA 3WQDA 2VHLA 1B31A 4IUOA 5JH1A 4LGXA 4GH3A 2NQLA 1HJWA 4DUWA 2PTYA 2GQWA 3WBEA 3WH8A 3DBPA 1QOPA 2OX4A 3W1PA 2VZOA 4FK9A 3P6LA 4FO4A 4L9ZA 4IPPA 3TC7A 3AO0A 1H2IA 2FZNA 4BR1A 1NP2A 3D3FA 1NFBA 3COTA 1BEUA 2YBTA 4V2XA 3WNKA 3EPNA 5MHBA 1TX0A 1XPYA 1EWEA 1EBHA 4BURA 1VC4A 2WVSA 4QM1A 2QUVA 4CD4A 3O63A 3L5AA 2D0HA 1PHQA 4NYUA 2XIJA 4TX8A 5GVJA 2DORA 3SB0A 3WJYA 4QLJA 3OOQA 1YNYA 1OJXA 2HVMA 3G5EA 2OLSA 1BVZA 1B9BA 2DEPA 8XIMA 4LBUA 3VI2A 1Z32X 1TPB1 4JX4A 4GGBA 3ONBA 3N6JA 1K03A 2DV0A 2PSNA 1ZY8A 1ISVA 1NOFA 3E9AA 4AUBA 1LTDA 4L5ZA 1XDLA 5CAHA 3OGRA 2ZQ0A 2HJPA 2VQTA 4YHEA 1J0JA 1GYMA 1OGSA 4GACA 2QAEA 3VGBA 2XGZA 2B4GA 4CCCA 3DHDA 3RITA 1S3HA 1PE1A 3UG3A 3JR2A 1TWIA 4PMDA 5K9XA 3I6RA 1VYPX 3PG6A 4IIEA 4M3PA 2PWVA 2QMKA 1GVEA 2E3TA 3WQFA 1WZMA 4J3SA 4DWSC 1B57A 1EQPA 4OT7A 4AIEA 1TA3B 3IUIA 3IRSA 2O4QA 1PV8A 4H4PA 3RJXA 3WK0A 1G94A 1ZP4A 2Z24A 4A2SA 2POZA 3SN1A 2VFDA 1H41A 2WNQA 2V0TA 5HXMA 2WQDA 3GWQA 3LK6A 1K9TA 2ZZ6A 3KCJA 1CZ1A 3DYMA 1OZMA 1R3TA 1LL4A 1W31A 2BHYA 5LKYA 2I1OA 1JXJA 1EPXA 1GRHA 4PRTA 3SZ8A 3S4TA 1O68A 4AZ6A 4MMWA 1FH9A 3GU2A 2GH5A 3O0FA 2A79A 8A3HA 2GGJA 1D3GA 5FSDC 4UQDA 5E09A 4OVXA 2XHYA 3S9IA 2UBPC 4GJ1A 1TQXA 2PODA 4C6EA 1DJYA 2ZUTA 2VUNA 3ICJA 4JKKA 3SURA 1JF5A 1DEDA 3LMYA 3T05A 1YTEA 1F07A 1R2TA 3MI3A 4GUHA 3PF3A 4OV4A 4QAWA 1GVIA 2ZOXA 1V3JA 3B9OA 3T4WA 4DO5A 4C6CA 4XKYA 1P6CA 1H63A 1TQJA 3JRKA 3OIXA 4PFHA 4UWMA 4DJDD 4DF1A 1LBFA 3NRZB 4AD2A 5CZTA 4TU1A 4IL2A 2VURA 4I7WA 3BMWA 3KWXA 2WMHA 5EMKA 4NIRA 4U10A 5FMHA 3VZXA 1W1B1 3BV4A 3KZSA 4U2ZA 4QSFA 2ACSA 5HNTA 1CGXA 3SEPA 2JGYA 3KRBA 5FKYA 5I5RA 1EXBA 2NXIA 5F1UA 3NCOA 4QROA 3W27A 1UA3A 3WD3A 3EEZA 1Q66A 1PJ9A 1UR8A 1OF8A 1STZA 4IIDA 1BWCA 1K6AA 1MZHA 3B04A 4HU8A 4UR8A 1KB3A 2YL9A 3L66A 1W17A 3LBMA 3NQBA 2QCMA 1F73A 9RUBA 3NYZA 2QJJA 2OYKA 3WMSA 4Q4SA 4N2YA 4O54A 3DUGA 3DHFA 4HHPA 5ENLA 3QY7A 3VGGA 1CGTA 3F4DA 2F8QA 5EU9A 3CQHA 3B8TA 4U5IA 1OM0A 3H21A 3PUEA 4NX5A 3MUXA 1N60C 3QTPA 2QYGA 3MWAA 3WLHA 2WCAA 1SZFA 3K1DA 3P8JA 1QW7A 5HR6A 4CNTA 1TMQA 3EXSA 5JIWA 1MXGA 1H0IA 4ACZB 5F4XA 2I14A 3A9BA 1DKWA 2FPTA 2GVGA 1AG1O 1WCGA 3P61A 1PSCA 4DJED 4U28A 4I9AA 4F3HA 4YVVA 1FCBA 5A6AA 4ZODA 1ISYA 1OX4A 1V03A 4XO7A 1Y5XA 4C65A 1M7PA 4RE0A 3LGEA 2PWGA 3T42A 3GC5A 4NAEA 2GR3A 3JUGA 2ZRWA 1KFEA 1IT7A 5HMEA 3KS6A 3CJPA 4FEZA 3ABXA 2WJDA 2HQMA 1X1NA 5JH2A 4A8LA 4UOZA 3ARQA 2KAUC 3TLQA 4ATLA 3Q2DA 1B3VA 1EIBA 2VP8A 2W3SA 1HGYA 2QIIA 3GXNA 1XSKA 3EOOA 3D47A 1Q1RA 3UPBA 5FAJA 1R85A 2NLIA 5D30A 4P7RA 3R4IA 1AL7A 1Q6GA 4W7UA 1OCJA 1K02A 3CQIA 3BO9A 5I78A 2Z1SA 1OFDA 3PG8A 1SSDA 4HSOA 3CV1A 2CZDA 4XX6A 4LCQA 3UNTA 4J3TA 4GABA 4XAPA 1UIOA 3EDFA 1WP6A 3O6CA 1BWVA 5I3GA 1QI0A 1SFSA 3CMGA 5FF7A 4KH2A 4L6HA 2P50A 1XYLA 1BHGA 3E12A 4PL2A 3CMFA 1AOGA 1FBAA 4TO8A 4O8AA 2EQ7A 5H6HA 1ZHAA 4GIAA 1XCXA 4LW7A 2BY0A 2QDEA 4OOZA 3R94A 7REQA 1PAMA 2PPGA 3WKZA 4DUVA 4GXWA 4ZSUA 5LIXX 2WKLA 3P67A 1ZKQA 1WBJA 3MP5A 5IFPA 2CW6A 3WK1A 4A29A 3HG2A 4G1NA 3WENA 3GVWA 3AAMA 2WQPA 3CWHA 5FF0A 5AC5A 3RLUA 3STCA 4M81A 1UZ1A 4M8UA 4O8RA 1LVLA 3WNLA 4ATDA 3EAUA 2D0GA 2JF6A 3EX1A 1MFVA 4G7EB 4Q4QA 4IX2A 3F2DA 3L5OA 2NX1A 1PDZA 4NASA 2WOWA 1ZU8A 3NXFA 2OODA 2J7HA 4GYFA 4IOTA 1QK2A 4IGSA 3MUY1 2YVFA 3ARPA 3HB9A 3N34A 1E4IA 2XH7A 3NNTA 4IJRA 1KGXA 3T8QA 3WJXA 4U5KA 2FPYA 4RNFA 3IIOA 3UWVA 2ZUMA 5HQMA 2CLFA 1RXOB 1E71M 3CV7A 4L1XA 3LTSA 3AUOA 3GG0A 1V51A 4ERAA 5AHEA 1CXIA 1SUXA 2CLIA 3QFWA 4PUJA 3TYCA 4LYQA 3QJAA 3GVQA 1TR9A 3N9SA 4ADUA 1FCVA 4O1BA 1R86A 3UWEA 3GTFA 1E6NA 4C90A 3CUIA 4OKDA 3GLCA 4H8NA 2VGGA 2VJXA 3MY9A 2Z4GA 3IIXA 4R53A 4JNYA 1OG0A 1SU5A 3HOJA 4AG0A 4FLOA 3IIPA 3GNOA 3QGKC 4DAFA 2ZUVA 4A4AA 1YPFA 1P6BA 1JI1A 5EL1A 2IKIA 1RP9A 1ZALA 8TIMA 1MDRA 1QTWA 3DESA 3E6EA 4GLEA 1MXDA 2D2OA 3TSBA 3H26A 3OG2A 4RPQA 2B7NA 1XRFA 5I07A 4GUFA 5HWMA 3S2CA 4HPXA 2QUUA 3AOFA 3URBA 4ZCWA 4L6OA 4QQUA 3HG4A 3GTXA 3QLLA 3QY8A 3A6OA 1MYRA 4CCZA 3SY1A 1POJA 1EFZA 1UZ4A 4D6HA 3BW3A 3S9YA 1XIDA 5I3FA 3QYSA 4NJHA 2P0IA 1OFEA 4DWDA 4XWUA 1DOSA 1LROA 2PCQA 3WL0A 4YJ5A 2INFA 4PUKA 2E6DA 2ZRZA 3CL6A 3IVTA 3L9CA 4M51A 2VD8A 2W61A 3PTKA 4GQBA 2J9ZA 3A24A 4AYSA 1RVKA 3R10A 1DWGM 1Q6FA 3WLPA 2ISVA 1NELA 1SJBA 4W84A 4MB1A 3A5FA 4F0HA 3VM5A 1O5XA 5CBBA 2G95A 4GCAA 1TIWA 2Z2AA 2VDIA 1CNVA 3I7RA 5AOUA 2QV4A 1VBHA 3Q58A 1F3WA 2W62A 2DT1A 4UFLA 2DVTA 3NOEA 3EA1A 1UR2A 1EX5A 1V3HA 3T08A 3H2AA 4XBSA 1V6TA 4GRSA 1NWRA 1VCGA 1ME8A 2XG9A 1AQHA 2ZZ1A 1E4LA 1VEMA 4UQCA 4L9YA 4QE4A 1F61A 2FFIA 3N11A 3DG3A 1C92A 4LAOA 1R3YA 4MVAA 1AH4A 1GYNA 4TQTA 2PTDA 1EH9A 1ONWA 4DO7A 1W3TA 4FXFA 4GC3A 5CJMA 3MUCA 4HNVA 1EO5A 3UNDA 5G2WA 2YA2A 5AKQA 2Z7KA 3TK7A 3VOHA 1FCQA 4YXGA 3S5NA 1O12A 1O66A 1KA9F 4O0ZA 3E96A 3BAWA 4GUIA 3G6LA 4K37A 1V0NA 3GNPA 4KS0A 4KIRA 2GQ8A 2D22A 2CNCA 2PP1A 3F5LA 3D3AA 4UIOA 1YTKA 4GD0A 4BWLC 4PEEA 1XF0A 3ANVA 3RM9A 4UR9A 3P62A 2A8XA 1BF2A 2PRLA 2OO6A 5U1OA 4LYPA 4BI7A 4H6EA 2XZ9A 1RSCA 3TJ4A 3WNOA 3T7VA 1ZMDA 3O3RA 2NW0A 5AZ0A 4NEWA 4XD6A 4F40A 3VIJA 3N2MA 3ISIX 2YAUA 1DIEA 1HKWA 4W86A 1BVNP 1PXGA 1MW1A 4TV6A 1VJSA 3EANA 1LT8A 1YNPA 3WD4A 1EJSC 4Y8FA 2XSAA 2OSXA 4TIMA 4ENLA 1ICQA 4WHBA 2V30A 4CN1A 1J18A 3CHDA 1U5VA 2J62A 1W3LA 2G3IA 3ZYZA 4MFEA 3GKFA 2VRJA 1V79A 1W91A 4E2VA 2FDSA 1ME7A 1R38A 2KZHA 4G2DA 3NSXA 1XBVA 3MJMA 4HT3A 4UMBA 3WLLA 4O1DA 1UG6A 3NL3A 2CFFA 4RE2A 3W29A 4NUWA 2Y5JA 5JBFA 4H4ZA 5D9NA 2GQ3A 1WDPA 2YX0A 5REQA 1IXOA 1I1XA 3CZGA 3RNDA 3S8HA 2AL1A 2ISWA 3B0UX 4UZSA 1FFQA 1GGOA 5D2VA 3PTMA 5A6TC 1OIMA 3OVPA 4UFIA 1O60A 3FAWA 3BSHA 2PF8A 1K70A 4H9VA 3GDBA 1QI3A 2CKSA 4F4RA 1FFUC 3FV9A 3RR4A 3R5EA 2WOVA 2C14A 4JYEA 5G1MA 4XZIA 2Q8LA 1B3XA 4AEFA 3RYSA 4WLCA 4DYJA 2WWCA 5C9ZA 3VGEA 3M0XA 5IHSA 3N2TA 3ZOAA 2HPMA 4GVIA 4H50A 4WKFA 4QRNA 4PULA 3NDYA 3GC4A 8CGTA 4ZZ9A 2O92A 2PWDA 2QJMA 4P7OA 2WANA 1TWDA 4ZOCA 2XPKA 2NVCA 1VH7A 1XUUA 2O9OA 5C7VA 4NAFB 1JZ8A 4YL2A 4HGXA 4ZL1A 3ARSA 4JICA 1XANA 3NOYA 1ITQA 1JNDA 4WOZA 1AW2A 1CPUA 1DXFA 1F76A 5FA5A 5G5HB 2ZZCA 4AD4A 2IXUA 1PIIA 5HUPA 5JCKA 4O19A 4NILA 2Y8KA 5AHNA 3QQ0A 5LIWX 1EIXA 3L4ZA 2BC0A 3VTRA 4DWSD 4MY1A 3LCFA 4FNTA 1X8FA 3WLJA 5FJPA 3S2LA 1BYAA 4DJDA 2E6YA 4DJFD 3MCOA 1PX8A 3TNOA 4IIHA 3TJLA 3CAQA 3BV7A 4OBTA 1I1WA 3GKAA 1EZWA 2V68A 4MWAB 4CKQA 2OKTA 1UWTA 4QDMA 3FA4A 1N63C 2PDGA 1BF6A 1UKSA 3S47A 2JK2A 4H7VA 2DVXA 4JTSA 3NTYA 3SY5A 5T9BG 1TUXA 3N17A 5CG7A 5KVIA 1WKDA 3NJ3A 3W75A 1O5KA 4RXFA 4UNLA 4PUMA 4HU4A 1V0MA 5TAOA 4HA0A 9XIMA 1WAUA 2NSOA 1ZDLA 2ZC8A 1GONA 4LUTA 4JD4A 3IVSA 4FXSA 1XYZA 4IQDA 1J0ZA 2VFIA 1QHPA 2VOTA 4LRTA 2PLKA 1N55A 5GJMA 1JQXA 4NF7A 3WMCA 4EPBC 2FLIA 1FHDA 1MUCA 5CC3A 4EM4A 2J4GA 1E6RA 2BXYA 2PDYA 1W9UA 4PFMA 2NV2A 1YDVA 5FIPA 3PZUA 4JS3A 3MMDA 3ZR4A 1EHAA 3U2ZA 3ALGA 5G4HC 4LY8A 1KGUA 1VCFA 1OYBA 2DSZA 2BLEA 1P7TB 3USZA 4JPGA 5EBUA 4Z42C 3GXIA 5CC6A 2V2DA 1W9XA 5A6BD 4DJEA 3AIVA 3K4WA 1TFVA 1KW1A 4I6KA 1UKTA 3SBFA 3W84A 1S1PA 4Q4PA 4RNJA 3W37A 5EBAA 4Q33A 4F0LA 2GFTA 1WZAA 2HXUA 3OHIA 1UP2A 1H60A 5I7GA 1RPKA 4HPJA 1LG2A 3MKCA 1R87A 1HJVA 2V81A 3QKZA 1E0XA 1GRAA 3CK5A 2FIQA 2P10A 4QG9A 1XGZA 3S5ZA 5I6SA 4BHYA 3WQGA 2VEFA 2ZX5A 1KBLA 4CEXC 3VIPA 1G7VA 4Q8WA 1MW0A 2WSKA 4KWOA 1GQLA 3FA3A 4IICA 4PCSA 1GKPA 2B31A 1P0KA 4UOQA 2J7EA 4B90A 1GHSA 3OLIA 4AXNA 1ZJBA 1FHVA 1GJUA 4FX8A 1JCXA 4P61A 2X30A 4QGCA 3UBPC 3W7RA 3LSBA 1KTCA 2X1SA 4MY9A 4HN8A 2IQ0A 3FNDA 2WKJA 4LA1A 3H4XA 3LADA 2GK1B 3ZLFA 2WC7A 1W1IE 1XHCA 2CLOA 2ZZ5A 5AC7A 4HPNA 3DKLA 3MC5A 4XUYA 1KD0A 4WY0A 1SW7A 3WDPP 4IG2B 5M3WA 5BYWA 1NSJA 1MI3A 3ITGA 3FW6A 3W9ZA 3BLLA 4GO9A 1SJAA 2AQOA 4LF1A 1UD8A 4CQAA 3B3DA 5B7YA 3EDJA 4G7FA 1CXEA 3DFTA 5TBOA 1CCWB 1JDCA 5CH9A 4R7JA 1GT8A 1WDQA 3PM6A 4IX0A 3C2OA 1OT2A 3WLTA 4AC1X 1JUBA 3TOYA 3UZWA 3AIWA 2TYSA 2O9RA 3LLFA 4MB3A 2VNCA 4E38A 2ON3A 1ZBVA 4EAMA 4WXZA 4L56A 3KBVA 5JCIA 3GAKA 2NX9A 3VUPA 1P43A 1EJXC 1K8YA 3ITCA 1AH3A 4MM1A 1SM9A 1FKXA 1RUSA 3FJ4A 2J7FA 4IZGA 2WM1A 3KWSA 3EWXA 4U3CA 2VFEA 2Q3RA 3QR1A 4NRRA 4PUWA 3H7VA 3WMBA 4MOZA 3DI0A 3NGFA 3KBJA 2ZRUA 1A3XA 1JPHA 3BLFA 1G4TA 1EUNA 2V5LA 3P5ZA 2ZUWA 1QI2A 1JYXA 4AZBA 2Q02A 3KZPA 4KCUA 2DSWA 1TCDA 2NUYA 3KRSA 3H2MA 3PR2A 1UD6A 4KQNA 1P0DA 2EPMX 5E0FA 4N4PA 1EKOA 3PB0A 3SR7A 1WXJA 1X2HA 3SDOA 3BDKA 3JZEA 3IK4A 4XV0A 1MW2A 3GU1A 4QNEA 1B3OA 1W5OA 1XYBA 1XPGA 2WPCA 3M0IA 3S2NA 5C9RA 2CBIA 1QI4A 4UFJA 1CB7B 1X96A 4FOKA 4QBXA 3UY8A 1G1YA 1HJQA 2IQDA 4R7WA 3O6YX 1US3A 4JQ9A 1XH0A 4ORIA 4H3DA 1ONFA 4EPEC 1MEHA 1IZCA 2WAGA 3MQTA 1Q85A 2YCKX 2GJXA 3VX1A 1QHOA 1WZLA 4KWVA 4B5SA 3FS2A 2V5KA 1XLFA 2D3NA 1KBJA 1YXDA 3VIGA 1QR7A 5J8LA 5F2GA 4CVWA 2QGHA 3ZO9A 4AQLA 1SR9A 4Z08A 4CUCA 1MUMA 1ZPTA 5KZDA 3UXKA 3ZR5A 4X9YA 4QHRA 4GINA 3R25A 1YKWA 1BD0A 2YCJA 4FOUA 1KCKA 2X0HA 1IGSA 4R33A 4Q3MA 2G3JA 3W00A 4ERGA 4IMDA 2GR2A 1YPIA 2OEJA 4IJCA 4Z1DA 4DBEA 5GNXA 1SO3A 1QWGA 1M6IA 4C91A 2P8CA 5I24A 4LYKA 2JKEA 3GHRA 1Q6QA 1QHZA 1DTNA 1XM3A 3RMJA 3WQ4A 1DXEA 1GQJA 3EWDA 3F4CA 3MO7A 3W1XA 3TOPA 1W5QA 2DSVA 2E3ZA 3UQNA 4S1FA 3EKLA 5XINA 1LYXA 3WLIA 3W7NA 3NQDA 2Y7FA 4D72A 1YX1A 1X98A 1GOXA 2YGYA 1OYAA 4GVHA 2ISSA 4PRRA 5K3VA 5ABGA 4ERIA 5HQEA 4TR9A 2ATSA 1E0VA 4Z1BA 1NY1A 5HDRA 3T78A 1XLAA 1ZAIA 4HJWA 4NZ1A 1XIJA 1F4HA 3NO5A 5A8OA 3AZTA 4Q8VA 4IGNA 1IHIA 2PURA 2EXOA 4AWUA 3TYAA 4PYSA 1JDEA 4A3QA 3M46A 3L2MA 1BKHA 5HOSA 5BXSA 4AZIA 3VILA 3LXBA 1L2QA 1GORA 3TC3A 4EQSA 3HPXA 4Q8PA 4E4PA 5BXTA 1L6YA 3JU2A 3I3BA 3S2MA 2C3ZA 3K13A 1NARA 3JZUA 4UBPC 3PG9A 2XVKA 3I3EA 1V97A 3BLIA 3W07A 1MEWA 3EX2A 4QCEA 2ABBA 3WDHA 1HW6A 3IWPA 1QO2A 1PCWA 1IXNA 5GJPA 2GSHA 3ATYA 1KNWA 4ZQRA 3UZXA 1MRAA 4W5UA 3PNUA 4ZO8A 5GPRA 1JFHA 5A2AA 4H4QA 4LCRA 3QFEA 2D23A 5I02A 3W2MA 1QPNA 3VC6A 4S3BA 1V3IA 2DZSA 3UXDA 2O4MA 2QJHA 2WHMA 1Q3NA 3MO4A 2G4FA 2A3LA 2VUYA 3VNIA 4JHMA 5AC6A 3CL8A 3S42A 4ZO6A 2YLLA 2VCAA 2WP6A 4DNHA 1NIUA 2BFGA 5T9CE 4ZTXA 4HOZA 3MVTA 1B4KA 5HATA 1JPMA 3GYCA 2HWGA 4GWEA 4R7OA 4IPNB 1VB9A 3QTGA 1U1UA 2VX4A 3LZ3A 1B3ZA 1BFNA 4WDWA 3CPGA 2XIBA 1D8WA 2OTDA 3W7EA 5I77A 3M5YA 4IPIA 1OBAA 5CPNA 3W70A 4C7FA 2EHHA 2H8ZA 5I3HA 5C9XA 1MWOA 4GXPA 4MZ1A 3L8KA 4MJZA 1KQZA 2EPLX 1S5NA 1PPIA 1YNQA 5HNRA 4D6GA 1KBBA 3M0JA 4MWAE 3DGRA 3TZFA 2ZX7A 2QXWA 2QCDA 1K9EA 1SZRA 2GVLA 4PTVA 1HKJA 4QSHA 4H4SA 1WKYA 2CXGA 3ZVIA 1TZ7A 4LPCA 1EUAA 3F7JA 3UJSA 1A3HA 3BLDA 3CH9A 5LIKX 3ITOA 2ONEA 3GR4A 4EQWA 1CX9A 3SSZA 5I2UA 2D2GA 1MNZA 2Z7GA 1F5ZA 5DMMA 2YQUA 3MP3A 3L4XA 4EF8A 2J78A 5DEZA 4B5XA 1SB3B 4AMCA 4Q8TA 3HZ3A 1VKFA 3ONCA 3T40A 5D2YA 2HDJA 3A7RA 4I3GA 1RV8A 1U5HA 2FVMA 3LGDA 1HUVA 4Z2JA 4FNSA 2QGYA 4KCWA 4CCEA 1BGAA 3VMPA 3K8MA 4BF7A 3G0XA 2MANA 2FZBA 4FZIA 3KBMA 4XAGA 1LDCA 1RZMA 3Q45A 1MXSA 3BG9A 5HQLA 1GRBA 1NDVA 3P0WA 5G2HA 2JKAA 2DQWA 3GH7A 2J8GA 2JIWA 1L6FA 4ES4A 3W02A 2Z27A 2NX3A 4ZB5A 2W79A 2DZBA 1K4QA 3WNPA 4JTIA 2PZ0A 3DK8A 3AS2A 3ZQ9A 3E2SA 2ZCGA 2JALA 2OZ3A 5BRPA 3LLXA 4BQ2A 1RK6A 5K2ZA 1XYFA 1OFPA 1DWJM 1AW5A 1K8XA 2GJPA 4IQLA 2BDQA 3VOJA 1JDAA 3G3DA 1HTIA 1LUCB 1OK6A 2VEPA 3NZ1A 4FMVA 1GW9A 4AWEA 2HSAA 4QEHA 3A12A 4DHGA 1EGMA 3KOFA 3M4HA 1W2VA 3PAJA 3GD4A 1N8IA 1XLGA 4FHAA 3WLKX 1E0WA 4YWIA 2REQA 1G67A 3QMRA 2DU2A 3IIZA 3AS1A 2JKPA 2Z1BA 3E38A 3UA4A 1JD9A 3Q65A 4GY1A 3BAIA 7CGTA 3W72A 4J57A 1Q6RA 2WVTA 4KRZA 1P48A 2QDGA 2TPSA 3KOXA 3DFQA 3DBNA 3TTQA 4H19A 4HJFA 4O15A 2ZA1A 3O1NA 1X6LA 4D6EA 3VIMA 3PC0A 1UW9A 2RFGA 1XLLA 5CZKA 1EBGA 1EF3A 5E0KA 4L1WA 3Q67A 5FOOA 4WKAA 4HMEA 4S2BA 3IUHA 4M52A 1JZ7A 4E8DA 4HK5A 4JN6A 2R9ZA 4I90A 4WR3A 2GUYA 2AKZA 1GERA 1NFPA 3H6OA 3ELFA 4MAVA 3VNZA 3IJ9A 2I9EA 3UCDA 3STFA 1YTDA 3HU7A 2UZ9A 1I45A 2CHNA 1KKOA 5H1WA 2EEXA 3DFOA 2OEKA 1EGZA 4DO6A 1K77A 2F6UA 4K36A 4BV6A 5CPQA 1VYSX 2Q3OA 2WPFA 4NQ1A 4V33A 3QXBA 1NDYA 1EZ2A 3E74A 4FB7A 4PC8A 2I56A 1EDGA 4LANA 3DX5A 3AUJA 2HISA 1UUQA 3TCEA 2E67A 2GGGA 5G4EA 5C7HA 4GIEA 3IVUA 1AL8A 3T0CA 1B9ZA 4AIOA 1J5SA 3E2QA 1PKMA 1TRDA 3ZZ1A 3TN6A 5L6UA 3BLEA 1ZL1A 2PWFA 4DNMA 3A7AA 3H12A 2VC6A 5HMDA 4C1NB 4B3KA 1V0KA 3QSRA 1M68A 1TTPA 3DXIA 4MB5A 1OX6A 1YQ2A 4HYVA 3QGAC 2BS9A 3S9ZA 1D7KA 5K9DA 3V0SA 1R6WA 3F2BA 3IV8A 3KVJA 1IYXA 1KM0A 4CN6A 4GJIA 1JZ3A 1J12A 3WL1A 3O15A 4Z2LA 2FJUB 3H70A 5A6JA 5GRTA 3V7PA 3UJRA 1S39A 3GR7A 3AQUA 3MMUA 3DG7A 1UZDA 3GR8A 3GXDA 1NHRA 4EPKA 3E0VA 1MNSA 1O7AA 3HQ1A 3ARUA 1HO4A 3Q94A 4GKLA 2GUUA 5C54A 3FEQA 5BROA 1GOKA 1I9CB 4P7LA 3U7BA 1JQVA 3CZLA 2DH3A 2JBMA 1RCXB 4O28A 5BRBA 1CLKA 4C6OA 1X6UA 2I17A 2X2GA 3C5QA 5CGMA 3BCFA 4WX2A 3O8AA 3P3BA 2ZE3A 1DHKA 2WXDM 1W5PA 2PLJA 1LL7A 2MUCA 4IQJA 5CJ5A 4Z1CA 3V35A 1VPYA 4QITA 3TUUA 1A5NC 1ZUAX 5D37A 4NP7A 4OUEA 5I00A 3SCVA 4LVFA 2ZDRA 3F4NA 3NSNA 4DRSA 4XD3A 2JEPA 3CAVA 1ZXIC 2NXHA 1UQYA 3NQEA 2Y89A 1WYGA 2YLAA 2G5WA 1VRXA 5KSWA 2W63A 3WLNA 2PGEA 3USBA 2PDNA 3OG3A 2H3DA 4DZAA 5CKSA 5U25A 4RE4A 1XH1A 2XU2A 3KLJA 3F03K 4CQCA 1IT8A 3CAKA 1FO4A 3F5JA 1B2YA 4WGXA 1R30A 1E6SM 1EF2A 2W92A 3DYPA 4O11A 3DFSA 1UC5A 2WW5A 3CO4A 3CASA 3BOLA 5KZEA 4QS6A 1XIIA 4B9YA 2ANUA 3LENA 3AU6A 4GI6A 3M47A 1V6XA 5A1AA 3I10A 5DT7A 4D1IA 4C6FA 5LGZA 3WY1A 4HSNA 1E70M 3GNRA 4HHMA 3CHCA 3I4KA 3M5ZA 4BA0A 1IQ8A 1WE5A 2GVJA 2E5BA 2ZX6A 3AMCA 4XZNX 1JUKA 5KZ6A 2I57A 2CLEA 1W9DM 1Z69A 4U31A 2PDFA 3AXMA 1L6SA 3KAOA 3B0YA 4CQ9A 5AVNA 3UESA 4JIRA 4MAZA 3P5YA 3AYTA 1XRTA 3SIMA 2Q8ZA 4O1EA 3W2KA 4GNJA 2V67A 3PSVA 2F61A 3W1RA 1E6XM 4EXAA 3PWIA 4KRTA 5C71A 5C2GA 3AC0A 2JK6A 3TZNA 3UWQA 5FI8A 3HGRA 3SUTA 1L8PA 3F5KA 4O13A 2BTMA 4HA4A 3QHNA 2W3ZA 1TRIA 4HBKA 2WLZA 2V3GA 5I0DA 1F6PA 4W7VA 4EAYA 1EPVA 1UP3A 4TMCA 1T6MA 4JIQA 4PCPA 1Q6EA 3W7KA 1FWFC 1V08A 3T6CA 3M16A 1RA0A 3W7QA 3R43A 3RMEA 3SJ3A 3FVDA 3RDKA 4A6GA 1Q6CA 4KEVA 4CNOA 4GYPA 1W1A1 3N9KA 2C79A 4GH1A 3W1TA 4JQ1A 1NH6A 4XTIA 5D4YA 3AXKA 4DM1A 2QCFA 3AALA 1CECA 3KP0A 5J5DA 1RY0A 5BOOA 1Q7ZA 1F3XA 3VYLA 4NX0A 3EB3A 1F8MA 4H9XA 1M04A 1KFBA 5HNNA 1S38A 3QOMA 3WBWA 4MLRA 5TF0A 2AAQA 4FNRA 2X05A 3FYPA 5A69A 3BWWA 3H4WA 1OJTA 2J88A 4JCLA 3ABOA 4YHGA 5CLTA 4HZ6A 4HVXA 3STPA 2ATMA 1QFEA 2E1WA 4J3VA 3D46A 4NJJA 3EA2A 5HBFA 3C0LA 5JIPA 5BWAA 1Q7QA 1JROA 1C8VA 4MFDA 1EWDA 4DPPA 3TP4A 1G4EA 3HPZA 1SR0A 3ATZA 3NXLA 2CLMA 5C70A 2PDPA 4OHQA 3O07A 2P88A 1JI2A 3WDQA 4YTSA 1LG1A 3WQ5A 4XD5A 4TVCA 6REQA 4HPGA 1A49A 1CYGA 5AC8A 2R1KA 4LY4A 3NWRA 2F6KA 1UKOA 3TXZA 1TG7A 3EX3A 2DVUA 4M80A 3ABZA 4U33A 3LHWA 3W23A 1UD3A 2RJGA 3NURA 1YBQB 4A3YA 2X09A 5BXRA 3BMVA 4GISA 3GB6A 3OEXA 3WCZA 3LS9A 1A53A 3C3NA 1HF6A 4H9TA 5B7ZA 4EM3A 3GRSA 3ZJ6A 1HP5A 4JFUA 2VWTA 1KR1A 1XIHA 4NZFA 2J8TA 3GNNA 1DIKA 1QASA 2QT3A 4O50A 1TE1A 2ZVRA 1E73M 3W1UA 4O4WA 3PB2A 2EJAA 4YLWA 4D2JA 5H8PA 4NZ4A 1ZRQA 3NPUA 1UB3A 3M0MA 1GOWA 2EQDA 5CZSA 1NWSA 2CCRA 1FWJC 2YW4A 1R3VA 4CD8A 1UJPA 3C8FA 1S5TA 1IIHA 3SQPA 1Q6OA 4WEVX 2Z25A 3IGXA 4E3TA 1XLEA 4S3CA 4QR6A 4EANA 2VDHA 4K1GA 2V6AA 3WIJA 3STEA 3TQ0A 4M19A 3SCSA 2C3CA 3KBSA 2CIPA 4MNMA 3N1AA 3WLMA 1TPEA 3T44A 2A3CA 3WF4A 1TYGA 2C19A 3EB4A 3CUGA 1Z89A 3H2EA 3GH4A 4QCFA 1HKVA 4CD7A 4ONVA 3B97A 4QISA 3D5HA 2OVLA 2ABAA 3TROA 1J0KA 1LORA 3QHMA 3WQEA 1XP3A 1A5BA 4J28A 3W88A 2F84A 4NVTA 2VYOA 5K9CA 3FDGA 3UD6A 4ICNA 3EAOA 4DIAA 3ZJ7A 4J40A 4BK9A 4MKSA 2WVVB 3KL5A 1RQBA 4J7RA 1DJIA 1XCWA 5CG0A 2EKGA 1P5BA 5BXPA 1HG3A 1E43A 3E02A 3NDZA 4C6BA 4RDYA 1J8VA 3MKVA 3NVDA 1K4HA 1X38A 2BVDA 5DRCA 3TYDA 5CC5A 2OPJA 3M41A 3TA9A 5F2MA 4BQ3A 4F0KA 3BW2A 3EXRA 3WDJA 3TU9A 2IPGA 3L68A 4BWLA 3DK4A 3WD1A 4A21A 1I2OA 1VF8A 2OJPA 5E6ZA 2OQYA 4CLMA 1OT1A 3BAJA 3V1HA 1Y7VA 4KPLA 4ZTYA 5A2CA 3S6OA 2WNWA 2P5NA 4W87A 1AODA 3S83A 2WHKA 5LA2A 3CEUA 3GG1A 1OX5A 3DCPA 1ODZA 1IEVA 1CIUA 4FS9A 1TELA 4PSRA 2QPXA 3HIJA 2X1UA 2F6XA 3W24A 2ZRVA 3A7UA 5F4SA 1FY6A 1D9EA 3PZQA 1HKKA 3LCLA 2GYIA 3V5CA 4OWGA 4QE1A 1DJNA 2WPGA 5RUBA 4E2DA 3RFAA 3A4JA 1KBKA 2W4XA 3EMQA 3LY0A 3U4AA 5LIYX 1K7FA 4AZCB 1X8CA 4YU1A 1OQFA 3MBFA 2A5HA 2ZWYA 3SAZA 4N9DA 1BYBA 4K8DA 1UR1A 2XIQA 1RQHA 3S6DA 3PTDA 5D2XA 4AHOA 1S46A 5FL0A 3C3UA 3P82A 3ARZA 4I6VA 3DFNA 3AN1A 1NHPA 2A21A 4MPKA 3UFYA 1H51A 3RU8X 3AU2A 3A4AA 5IOBA 4XZMX 1KV5A 3CT2A 2H9AA 4AY1A 1BSLA 3B9AA 1JL8A 1S2WA 1DJWA 4PCFA 3WLQA 4GK8A 2HK1A 1PWMA 2AL2B 2ZZ3A 3GHUA 3OZOA 1TPDA 2VEGA 4HZMA 3BICA 1GOQA 3PANA 3WDRA 5A3HA 5AYIA 1E9LA 1XDIA 6PTDA 3LM3A 1QNRA 3NAVA 3RM4A 4ZOEA 4B2DD 1YYAA 1WUFA 3AMGA 1KXTA 3OYXA 3KL0A 2XGIA 1TIMA 3P84A 1RBAA 4A35A 3ZJ8A 2PRMA 3T81A 4PUUA 4JL1A 1W8SA 4O10A 2PGRA 4Q32A 3R89A 1UOKA 1TPC1 4KPRA 3H2OA 4ZVJA 1KM5A 4HNTA 4QP0A 1VFMA 1TPWA 1ICSA 1DQXA 3W01A 4BY3A 3FYYA 4B5VA 4A8RA 6ENLA 2PC8A 3HQPA 2DJXA 2X8GA 1BXCA 3VOGA 2E40A 3TONA 2WCGA 1NFGA 5LHEA 2VELA 2WMIB 3VC5A 3W73A 1S2CA 3HA1A 1FCUA 4KFNA 1B0IA 4R3UA 4IFKB 1EHNA 4PB4A 3RF9A 1JG9A 2ZBTA 1EB3A 1NVMA 4JBRA 2XFRA 3WF2A 3HTWA 2GRTA 3E5PA 4REQA 5FEWA 1K8CA 1GQKA 5H8UA 2OGJA 2OSYA 1MSSA 3NQMA 4O14A 2Y8UA 3QOKA 5CSUA 1RCQA 2J7CA 4PZVA 3OODA 5DFAA 1FEAA 2YVGA 3W25A 3AIQA 1GWJA 3L67A 2Q8XA 1UKPA 1J2BA 3W7OA 3VOCA 5AHIA 1F3PA 4O16A 1JZ4A 1MRQA 2GOUA 3IPWA 3FKRA 3QM3A 2EAWA 2ZUNA 5I3KA 4JTDA 4LFYA 3W4RA 3IARA 3ORWA 3E0LA 4RE3A 5A6KA 4GVGA 1AK5A 3L0GA 3B0XA 1ZBKA 2CLHA 2QCCA 1LWIA 5EMJA 2W54A 3M0HA 4FLSA 3SRKA 2RHGA 4E8GA 3AHYA 4TTUA 4KWUA 5DMYA 3CUJA 4HCLA 3QPEA 3RPDA 3TA6A 3CHEA 4Z2KA 2DP3A 1IEWA 2NQZA 4FLRA 4HQVA 1JCMP 1EYWA 2YDRA 2O55A 4DLMA 2NWRA 2NT0A 1WKEA 3TQVA 4UTTA 4JFWA 1Y5VA 4ZQCA 5A5WA 2PDLA 4GZIA 4R9XA 4UZUA 5DLCA 1WPCA 3AJ7A 3URNA 1Q2RA 2YOCA 4YYFA 1UYQA 3ZLHA 2JGQA 3E49A 4AB4A 3A3XA 1RR2A 4GIRA 1JRBA 3DFHA 2X1IA 4Y90A 2NVKX 3N04A 1TSIA 2IKGA 4JTEA 1ITUA 3IJ8A 1CENA 1JVNA 1F7BA 2CLPA 1OSEA 4A3RA 3RUBL 3KDOA 3UF9A 4K7ZA 1VD6A 3ITLA 1VZWA 3TJIA 3QV8A 2VDGA 3BH4A 2BHZA 3UWZA 1RH9A 3NQ6A 9CGTA 5BRQA 2V63A 2X1RA 3PBGA 1Z6KA 1GK8A 1E9IA 2Z2UA 3FHAA 1B54A 4ZR8A 5XIMA 2OG9A 2GLKA 4Q4MA 4D8AA 1CWYA 1SYTA 1REQA 1CXKA 1PIGA 3DI1A 3MANA 4MUPA 5AYXA 4D8ZA 1TZ9A 1JEZA 2XFYA 4W7WA 2V5DA 3HG3A 4TX9A 1ZJHA 3M1ZA 3S2JA 3M5XA 1P0BA 2I7GA 1XH2A 4QE5A 1GEHA 5IXEA 4DBSA 3W7HA 1W3KA 4JGDA 4NHVA 3CXOA 2YA1A 1DHPA 1XIEA 3VCRA 4Q22A 3PZGA 3W7GA</