3H1BA

Crystal structure of este5, was soaked by isopropyl alcohol
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
b'MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
total genus 103
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1bA00
1EHYA 3RLIA 3VVMA 5CW2A 4UHBA 2O2IA 1Q83A 2QZPA 5SYMA 2VQ6A 3H18A 2B4KA 1XZKA 4OUKX 4ZRDA 1CUYA 5AM0A 3OC0A 3H1BA 2WIJA 4Y2PA 3I6ZA 3PDCA 3WJ1A 2OGTA 1GT6A 5LKAA 1BS9A 2PM8A 4EY4A 2C0QA 4PSDA 4H0CA 1XRRA 2CZQA 5EHQA 3PF9A 1E8NA 5CURA 2XE4A 3DKRA 4MEAA 2BFNA 3R3XA 5AKZA 5LZ9A 2ZSIA 1JKMA 4ETWA 5E4YA 4M0MA 5AJHA 4W1QA 1KU0A 1G5FA 4QEKA 3ICWA 1UXOA 2CMFA 1U2EA 3DD5A 1QIMA 4WY8A 2ES4A 1ZD4A 4Q3OA 4LKOA 4QNNA 1FSSA 1YA8A 3MGAA 3DL7A 4QWMA 4HXEB 3WWCA 4X94A 2GZRA 4BCCA 4CCWA 2PL5A 3IVMA 5JALA 1XFDA 1L7QA 3I2FA 5A7FA 5AKGA 1A7UA 3UUEA 5ALQA 1YR2A 4YASA 1K6EA 3A6ZA 5HF6A 4FMPA 1T2NA 5ALEA 5AO9A 2QJWA 1GZ7A 1QGED 2HIHA 4K5QA 2Z5GA 2XMDA 1TAHA 1UT6A 2G63A 5ALMA 2J4FA 4QE3A 3STWA 1TQHA 1BROA 1NU8A 3C8HA 5A7GA 3WIOA 2BJHA 1DX4A 1WPXA 2XUFA 2J3QA 4KRXA 3G02A 4LXIA 3CXUA 4KYVA 2C0PA 3K9BA 4UFPA 1P0QA 3WK6A 5FKJA 1H2ZA 3HEAA 1UOOA 3QH4A 5EFZA 1M33A 1EX9A 4FBLA 4AO8A 5C7YA 4Z49A 1DX6A 4UBNA 1MAAA 1CUIA 3CCBA 5ALHA 4DM7A 4J3JA 2VJBA 1R4ZA 1ACLA 5LIPA 2X5XA 4EUSA 1O6GA 5K3FA 4GLBA 3QZUA 4KJXA 2ACKA 2QXUA 4GEGA 1U4NA 4X92A 3PUHA 1R1DA 4PO3X 1LPNA 3H2JA 3I2IA 1X2EA 1F6WA 3Q8WA 3D0KA 3ZPXA 4KAJA 5I8PA 2QJRA 3AZOA 4FBMA 1CUBA 4UHHA 1ZGCA 1A8SA 1XKTA 1DT3A 1UWCA 2C58A 2OCKA 5DYTA 2O7VA 2HDWA 3VKFA 4KR0A 1XKLA 4N8DA 5LZ7A 2Y6VA 4EY5A 1ZOIA 3QVMA 2PSHA 1YS2X 1WOMA 1QIHA 4AO6A 4B7ZA 2NW6A 1JT2A 2WIGA 5T4BA 5DNUA 4KRYA 1GPKA 2DHCA 3L1IA 2BAGA 5JANA 2ZYIA 3R3ZA 2XUPA 1CLEA 3AIKA 4RPCA 3RKSA 5JADA 4GBGA 4Q3LA 1YA4A 4C6HA 5AIBA 1MAHA 4OB6A 3WJ2A 3P2MA 5C8ZA 1OCEA 2OGZA 5LLSA 2WG2A 5EGNA 3IUMA 1F8UA 2GBFA 3B3QA 4ZI5A 1MNAA 3I2KA 1R50A 3O4IA 1KU6A 4E11A 3ZV7A 3ESDA 3L1HA 1L7RA 1AKNA 3QM1A 3STVA 3GROA 5T4HA 4UPDA 1CUZA 5BOVA 2HM7A 1XRPA 4RE6A 1LPMA 4BVLA 3IB3A 1E8DA 4B6GA 5SYNA 4X00A 2K2QB 3CN7A 3FSGD 4EY7A 4G9GA 2AXEA 4PQEA 4BTVA 5D3KA 5LZ8A 2VF2A 3GFFA 5DWDA 3V48A 3E0XA 1Q84A 3R3YA 2V96A 4GWLA 4F5ZA 1UOQA 3N0TA 5HK9A 4FDMA 3C5VA 2CKMA 3O0DA 1H22A 3BDVA 1DWQA 1TCAA 2GYVA 5AK3A 2XUIA 4BZZA 4J7AA 2HRRA 1LPPA 5K3DA 1N5MA 2XMQA 2ZJFA 1QTIA 3WIBA 4WFJA 3K2IA 4BZWA 1C4XA 1F0NA 4X90A 4LXGA 1EB8A 4B9AA 3H19A 1UK7A 5DNWA 4QLOA 2Y1KA 2C4HA 4ROTA 2W6CX 4G1FA 2FJPA 4DLNA 1CUEA 1H2XA 1R9NA 3FNBA 3I6YA 5KWJA 2B9VA 5AKHA 3VJMA 2O7RA 5FPPA 7YASA 2ECFA 1XRMA 4BCDA 5JAOA 1DQZA 4ZV9A 3WL6A 1MTZA 3IULA 2WG0A 1ZJ5A 5CH3A 3FYUA 1AZWA 1EK2A 1AMNA 1ZI8A 5ALNA 1ZIXA 2JGLA 5C8VA 3WKBA 4M0FA 4EZIA 3C45A 3PFBA 1UKBA 1ZD2P 4EY8A 3H04A 4PF1A 5A62A 3H0CA 2ZSHA 4V2IA 3S8YA 5HFNA 2G4LA 2I78A 2PX6A 2R8BA 3WL8A 4F0JA 3HI4A 2OCIA 4PNZA 3BJRA 4S0XA 1Z68A 1BEZA 1QONA 1RYYA 4RGYA 4GECA 4XJVA 2XUAA 2XQGA 5IVIA 2WUGA 2XUDA 4X91A 2R11A 2EEPA 1EVQA 2J3DA 3O4GA 4H7DA 4CG1A 4WDQA 1XQVA 3B12A 2QXTA 1K5PA 4NS4A 1K63A 3DOIA 2ZYSA 4Y2XA 4E15A 2BUAA 4J0HA 3DL4A 4L3WA 1VOTA 4Q1VA 1VLQA 3AILA 5EIAA 5FV4A 4O08A 4DGQA 1U8EA 5FUMA 2V9ZA 4FLEA 3LP5A 4OYLA 4TVKA 4J0JA 2XLCA 3QPCA 4UHFA 1U65A 5IVKA 1J06A 1ORWA 1VKHA 2XUHA 2D0DA 1QZ3A 5CH8A 2QS9A 4G4JA 1UK9A 2AJBA 3M81A 2OXEA 4HS9A 4UBIA 4G5XA 4AMZA 3DDUA 4CIBA 3D3NA 2DQYA 2DFPA 1E3QA 4FLMA 4QZVA 3WQHA 4J03A 1XROA 4UHEA 4ARBA 2XLBA 3CCCA 2C5FA 2ZYRA 2C7BA 2GBGA 2HU5A 4JEIA 5DYYA 4Y2SA 2ONCA 4Y7DA 3ILSA 4D9JA 4CG2A 2RONA 4X97A 3RARA 4FKBA 5ESRA 1A8QA 1EH5A 4Q82A 1BN6A 2BGNA 4Y2JA 1TK3A 3M83A 2HU8A 2FJ0A 3D5EA 1WHSA 1USWA 1WB4A 5FXMA 4GDMA 4MXDA 2OLEA 2ACEA 4X85A 4IH9A 2I03A 4KE6A 4BC0A 3WKEA 3DS8A 3G9ZA 5ALUA 1N1MA 1PV1A 4M0EA 4ZV7A 2WFMA 1A88A 4F60A 5D7BA 3ESCA 2UZ0A 2O2HA 4WDRA 1VZ2A 3KDAA 1CVLA 4DTCA 5AM2A 1UKCA 4LYDA 4GHWA 4AZ3A 4MQLA 3UUFA 5D3ZA 5BWBA 3E4DA 4JH0A 2OAGA 1K8QA 4PSCA 1EXWA 4DSAA 5E2IA 4QDZA 3EQ8A 2ZVDA 3G8YA 4XVCA 5K3EA 2LIPA 2PUHA 1XRLA 1TIBA 3H2GA 4QDTA 3GA7A 4WY5A 5AKIA 2XUOA 3F96A 3F67A 4OYYA 2JIDA 1AC5A 2XMRA 5ALGA 4DNOA 2JGKA 2B20A 1E5TA 1H2WA 5CRIA 1XQXA 1UK6A 4BVJA 2Y6UA 3OTQA 3H2HA 3BXPA 1MO2A 1GXSA 3STUA 1UOPA 4ZWNA 5HF8A 3WA6A 5JZSA 2JGJA 2YASA 2EDCA 1ZI6A 5AI8A 1J07A 5FP0A 3ZI7A 3WA7A 3KOOA 4UHCA 5CXUA 1XZFA 4I19A 1CUDA 1ZI9A 3M82A 2B61A 3HJUA 3BDIA 3ED1A 4OPMA 1CV2A 1ZGBA 3DYVA 1DWOA 4P9NA 1VE6A 5AOCA 4C4XA 5ALVA 1ODCA 4XX1A 5JD5A 5E4JA 2VJDA 4P08A 2WFLA 4JYPA 2DHEA 3KSRA 3G0DA 1E66A 3FCYA 1VJ5A 4HRYA 4JNCA 5DNVA 1PJAA 3F98A 4LYEA 1QIGA 1LLFA 4C87A 2AJCA 4LHEA 1Q0RA 3FLBA 3JWEA 4FNMA 4HRXA 3PI6A 1AX9A 1GQRA 2WM2A 1QIIA 2WQZA 2DCMA 2HL6A 1ACJA 4GI1A 2C5GA 4Y2QA 5K3BA 1UFOA 1QE3A 2BUBA 1ETHA 5JARA 5ALDA 2OPHA 2WHQA 3WK5A 3FYTA 5ALOA 4A23A 3EQ7A 2G5TA 3FYUB 1ZD5A 5HFAA 2WTMA 3KXPA 2CJPA 4H35A 3IA2A 5AI4A 5EHNA 2WLSA 1CUJA 1YCDA 3F9CA 1IMJA 5AKKA 2JEYA 4B80A 3W04A 4TGLA 2WHPB 3O4JA 1BCSA 5AM4A 4XIIA 4H18A 1MT3A 2VJCA 3H17A 1CUGA 1SCIA 3FSGA 2PSEA 3KWFA 4MYDA 4DMCA 3FCXA 4Y2UA 1YSCA 1QFSA 4BBZA 3KWJA 4HZGA 2OCGA 2GYUA 1CUVA 3WK4A 2VTVA 4AO7A 5HQ3A 3JYHA 1ODSA 1E8MA 3BIXA 4LIPD 4INZA 3O9VA 4OCZA 5EHXA 5JAHA 3VXKA 2W22A 5T4FA 3K6KA 1AURA 4L72A 1BN7A 2WHPA 3RK4A 3EQ9A 3I1YA 3AIMA 5EIHA 5AKYA 1A8UA 3WYDA 2HFKA 2D5LA 2OCLA 1BCRA 5I9IA 3WK8A 2P8SA 4FLFA 2PVSA 2DSNA 2PBLA 3I2HA 3WYNA 2ZJ6A 1CFJA 1AQLA 1Y7IA 1EI9A 1EA5A 1VA5A 2XI4A 1P0PA 1MPXA 1MX1A 1OXMA 3A2LA 3BL8A 5FOQA 3DOHA 3EBLA 1N8SA 4BATA 4G8BA 5IVDA 2OGSA 1YB6A 1Y7HA 2HA2A 3D7RA 3ESAA 1XZHA 4CI9A 2CUTA 4Y2YA 2E3JA 4B9EA 1JU3A 4Q34A 1F0PA 3WWDA 2QOEA 1ZJ4A 3AUKA 2WFLB 1TKRA 1ODTC 5AK4A 1FFCA 3C87A 3STTA 5ALSA 4JUIA 5DTIA 3QITA 2PSJA 3C70A 4B81A 2HA7A 1J1IA 1JJBA 1C7IA 1BEEA 4B0PA 1G66A 4HTAA 2XMSA 3G9XA 2CB9A 4U2EA 5KWIA 3OURA 1HBJA 1QIFA 1CR6A 2PSFA 1EVEA 2XQFA 5ISMA 2HA5A 2WU3A 1QLWA 5CMLA 3W06A 1EDBA 1CUWA 5HKAA 4IHAA 1QIKA 3OOSA 4B85A 2XQKA 3SC2A 3C6XA 2ORYA 5CXXA 2JGFA 1W1IA 2YH2A 4ZXFA 3VJLA 5AOBA 1XQWA 2WU4A 3I6MA 5AM1A 5LZ4A 5ALZA 5DTJA 1VE7A 3C5WP 3C43A 5ALFA 4H7FA 4BVKA 5H3HA 4KE7A 4I4CA 2CBGA 4X71A 3X3HA 4BRSA 1VZ3A 1CIJA 3WZMA 3ZWQA 4BAGA 1CUUA 3FVRA 3GUUA 2XT0A 2WFZA 3D2BA 3SX4A 3G0CA 1XRQA 4EHBA 4X7BA 3TJMA 1XRNA 5EHZA 2QRUA 2CEKA 2QKYA 3F8SA 5E4TA 4BAUA 4P92A 1JMKC 4Q05A 1HQDA 4X93A 4C4ZA 4K6GA 3V1KA 3QMVA 2VT6A 3G7NA 5AK6A 5A71A 2Z3ZA 1CUHA 2XUJA 2IX9A 1LPSA 3D59A 1IZ7A 1TCBA 1HPLA 2WIDA 4U2DA 1CQWA 3FAKA 1C7JA 3GELA 1GGVA 4X95A 3A70A 3NWOA 4ITVA 1GPLA 4KEAA 2V98A 4BYMA 3V1LA 5A7HA 2HA4A 2WHRA 4EA6A 1W52X 1JJFA 3NUZA 2RHWA 5CBKA 4K2AA 4N5HX 5DLPA 2WJ4A 3WKAA 3AZQA 3V9AA 2JEZA 1XLUA 4WFIA 5JIBA 3H2IA 3GBSA 5ALYA 3DCNA 3PE6A 5JATA 3WI7A 4C4YA 3DLTA 2H7YA 4FTWA 5JD6A 3IURA 4QA9A 4AMYA 4J0DA 3BF8A 1GKKA 1W75A 1LZKA 3HABA 5K3AA 2WIKA 2HHAA 2WKWA 4BCBA 2XUGA 2ZYHA 1P0IA 1DINA 3HRHA 4K6KA 1TRHA 1XZDA 4DSZA 1CUXA 1FFBA 1SFRA 5D6OA 4IQ4A 4AN0A 5KBYA 1XZLA 2BGRA 3BWXA 5CH5A 5YASA 2OQIA 4DYHA 1O6FA 3AFIA 5LZ5A 1CRLA 5LKRA 1XZGA 4Y2VA 1FFDA 2RIPA 4Y9SA 4G8CA 5ALIA 5CT9A 4DNQA 4EBBA 5I7UA 1XZMA 4YPVA 2JGEA 3ANSA 3A2MA 3PUIA 1THGA 4AXBA 1XQYA 2Z8ZA 4ZREA 2XQIA 1RP1A 2PSDA 3I2GA 3QMMA 4J0GA 1MX5A 3I2JA 3W9UA 4H77A 4UBJA 4B82A 1IUPA 1XZIA 5JZBA 4BP8A 1QO9A 1G42A 2VAXA 3ZLVA 5C81A 4WCVA 5AIAA 4AB1A 1H2YA 4JYMA 3AINA 5HQ3B 4BTLA 4E46A 2VEOA 3DYIA 3ANTA 4G4IA 3R3UA 2HFJA 3MVEA 4CCYA 2VATA 1R9MA 1JJIA 1YS1X 4PV7A 1LPBB 1R3DA 4CIAA 3HC7A 3O4HA 3WWEA 4A5SA 4UUQA 3G0BA 3IUJA 1FFEA 1E89A 3N2ZB 2XUQA 3G9UA 4NMWA 4A16A 4FOLA 3HZOA 4I3FA 1EDEA 1UKAA 2WJ6A 4QDUA 1LNSA 1B41A 5AM5A 3LLCA 3IUQA 4B84A 2QUAA 1GPNA 3RM3A 3O9MA 4UBOA 5AKLA 4BRZA 5BWCA 4WFKA 3S2ZA 5HZGA 1GQSA 2WG1A 4H7EA 5AKXA 4XWGA 4K6HA 4BC1A 1PFQA 3C6BA 1X2BA 3IBTA 5CT4A 5CT8A 3WZLA 3R41A 5ALTA 4KACA 3IDAA 4AQDA 5T4EA 2HADA 3WKDA 4NVRA 3OPMA 4U2CA 2HA0A 3D2CA 4H7JA 3F97A 1XLVA 5K3FB 1LPOA 4OB7A 2YXPX 1UZAA 3SWWA 4YK7A 4WJLA 3UMJA 1T4MA 5KREA 4DMHA 2EDAA 3EF3A 4UBKA 1DQYA 1CUAA 2V97A 3DNMA 2BUCA 4UFOA 2HU7A 5ALXA 2XMBA 2X76A 2AJDA 5ALPA 3ZLUA 4DNPA 3FVTA 4Y2TA 3R3VA 2AJ8A 1Q0ZA 3FLAA 4J0KA 5CT6A 4MJ3A 3PFCA 2WJ3A 4QDOA 4H7HA 1BRTA 1NX9A 2XMGA 1R88A 3ESBA 5AKJA 2FX5A 3FWHA 1P0MA 2X8BA 3VDXA 3E1GA 2Z8XA 1IUOA 2G5PA 2VA9A 2WIFA 3DQZA 5LYYA 3SK0A 3MUNA 2PU5A 2I3ZA 3CN9A 4KE8A 4TPKA 3LCRA 2WUDA 5JAUA 4HVTA 1L7AA 2Z3WA 4H7IA 1OILA 2QTBA 5AOAA 3R0VA 4FFWA 3W9BA 3W05A 1HDEA 2IIVA 4CFSA 3D4LA 4G4GA 4KAAA 5LP1A 4BE4A 4EB0A 1AUOA 5FRDA 1K4YA 1WM1A 1MJ5A 3U0VA 4OB8A 2JGIA 5CTAA 3V1NA 4X6XA 4IH4A 4MWTA 1S8OA 1KEZA 1EDDA 5AICA 4DMKA 3QPAA 1J2EA 3LS2A 1QO7A 5DYWA 1XZEA 1JFRA 1SCKA 2RHTA 1FFAA 2WSLA 3HXKA 4E14A 1ORVA 1QIDA 2PU7A 5K5EA 4Y2RA 3H2KA 5AH0A 5F4ZA 1AGYA 2WTNA 5AI5A 4W1RA 1G4HA 2HA3A 2Q0XA 4G8DA 3DKKA 3U1TA 4KAFA 4X6UA 3FLEA 4BP9A 2IITA 4ZGBA 1CUFA 4OD0A 1MN6A 2H7XA 2DQZA 3FBWA 5AKEA 2YYSA 5HK8A 5EIEA 1H23A 3L1JA 3Q0TA 2Y2UA 4N8EA 5AI9A 4C88A 3FYUC 3FOBA 1W76A 3VJKA 1B6GA 1ISPA 1YAJA 3PF8A 1LZLA 4OU4A 3H1AA 3NGMA 3GZJA 1RWQA 3QBJA 3D2AA 5AI0A 4C01A 4BE9A 2QT9A 4FHZA 4GW3A 1XZAA 1WB6A 4UBLA 4W1SA 5HF9A 2XDWA 1JI3A 4HAIA 4KE9A 3QYJA 4B0OA 1ZIYA 3KD2A 5ALRA 3AZPA 4GXNA 4PSUA 1X70A 4N5IX 1WB5A 1VXRA 1W4LA 2QUBA 5A6VA 2XB6A 4NZZA 4QDXA 5EI5A 4H7KA 2ZJ7A 3I28A 4W9RA 1FJ2A 3YASA 4X3CA 4EY6A 4IO0A 3WLAA 3WL5A 2OAEA 4MYSA 3C6ZA 1BE0A 3LIPA 4AN1A 3TGLA 1EK1A 2HA6A 5ALWA 5C8XA 2QMQA 1UK8A 2PPLA 1N5RA 4ARAA 2Y2VA 1QJ4A 2BCEA 1W6RA 2RGUA 3WKCA 1QTRA 3BIWA 5A2GA 2WUEA 3VVLA 1IZ8A 5CT5A 3HSSA 1LGYA 2VAVA 3BF7A 3HACA 3E3AA 2VSQA 1YASA 1DU4A 1EINA 3IUNA 5JAPA 6YASA 5FLKA 1BU8A 3EIOA 4U2FA 5AM3A 4RNCA 1QIEA 2GYWA 1LPAB 1CUCA 3WWOA 5JYCA 3T52A 2JGMA 1CQZA 3WMRA 3NOXA 4OSEA 4PW0A 1MU0A 4CG3A 4P93A 1Y37A 1ZICA 3TEJA 5K3CA 4BB0A 3STYA 4QLAA 1ZD3A 4L0CA 2HRQA 4UBMA 2PUJA 3QMWA 4DMFA 5DJ5A 2VJAA 3AJAA 2ROQA 5IH7A 1HL7A 3STXA 4F21A 3HYSA 1VXOA 1QOZA 3LIIA 3M3DA 5JZ9A 3OM8A 5BV7A 2H7CA 2QM0A 2JBWA 1I6WA 1JMYA 4QWWA 1WHTA 1SCQA 1CUSA 2GZSA 3JW8A 1DTEA 3MUOA 1LBSA 1QFMA 3OG9A 1IVYA 4AX4A 4B83A 1HKHA 1GKLA 1THTA 3T4UA 4BDTA 5FDFA 2XMCA 1DWPA 5ALKA 1XZJA 2H9YA 3HLKA 3I1IA 3WK7A 2XUKA 3W2TA 2DHDA 4FWBA 2WILA 2QR5A 3WWPA 5AK5A 4CCYB 4MQMA 4OU5A 1NU6A 5IVHA 3PICA 5LZ2A 2J4CA 3TRDA 2RAUA 4BDSA 3C6YA 4W63A 1XLWA 4HXGA 1D07A 2VT7A 3BE8A 3O95A 3A2NA 3G0GA 4LXHA 4G9EA 4RE5A 5HCUA 1EB9A 1MX9A 4U2GA 4AZ0A 1QIJA 4J0IA 4DNFA 5JASA 1SOMA 4FNGA 2GBCA 2PKYX 1CEXA 1CPYA 1DT5A 4N8SA 2AJLI 2FUKA 1YB7A 4YX9A 3BJMA 3DJYA 4HXFB 3V1MA 1IUNA 4W1PA 1HLGA 4U2BA 5HF5A 3ICVA 4C89A 2BKLA 1VA4A 1TCCA 4L9AA 1WCYA 4UHDA 2OG1A 3B5EA 3AIOA 3VISA 5AI6A 2I3DA 1WPRA 1XZCA 2XMZA 4BAZA 2QVBA 2DR0A 5ALLA 4MEBA 4Q3KA 2JF0A 4FFVA 2RI6A 3R3WA 1JU4A 3R40A 3C8DA 1YAHA 2XQJA 2GBIA 5J3JA 5HKBA 5FPQA 4DIUA 3DEAA 4MWSA 5AP9A 2H1IA 2OQVA 5ALJA 5IKXA 3WK9A 5JD4A 2WUFA 3ZLTA 3G9TA 1XZBA 3IIIA 3WL7A 4X6YA 5AHXA 3G0IA 4J0CA 3QPDA 1LBTA 4UFNA 1MNQA 4IH1A 2O2GA 1SC9A
chains in the Genus database with same CATH superfamily
3WAGA 3LCVB 4MVWA 1QFZA 4X1KB 3DOFA 3RK1A 3VVMA 2ABWA 1J39A 3DVAA 2C78A 4DW8A 4C3OB 4QT0A 3PKZA 1T9GS 3CEHA 2GLTA 5BMOA 3WLJA 3PQ7A 5SYMA 5JWHA 4PFJA 1MVOA 4KOEC 1R0ZA 2VQ6A 3H18A 3U7IA 1U9JA 2B4KA 4JX9A 3HWRA 1G59A 1BQEA 2ASEA 3LLVA 4C14A 4RIGA 3N7TA 2FN8A 2OVFA 4F11A 2FK7A 5BRNA 4B7UA 3B6MA 5A03A 1T6BY 1U2SA 3WJ1A 3PDCA 2SECE 1UIMA 1UMDB 3N2YA 4HGRA 2Z95A 3PLAE 2OGTA 2NX2A 2WUVA 3IMGA 1KH2A 4WNIA 1YQGA 3Q7EA 3O90A 5IAEA 4DQKA 2BM9A 1JLLB 1YU6A 4WOCA 5J23A 2C5AA 4AURA 4K8RB 2VSNA 4IF4A 1M1YB 2GN4A 1X7XB 1YL5A 3MSXA 3P94A 3RSZA 3SAJA 3FPJA 5LC1A 4ARVA 3E9RA 1VJRA 4D42A 4GDFA 1LU9A 3C7AA 2IZOA 3QKIA 3MW8A 5BPHA 1H9CA 2G08A 5CURA 2VH1A 1NSYA 4N9QA 1Z0ZA 2XE4A 4MEAA 3OQMA 3MWJA 2J5KA 3V4SA 3P9NA 4OREX 4RPKA 1EFDN 1BGXT 1I51A 1RSZA 5E4YA 4B75A 4II7A 5AJHA 4LAFA 1F1BA 2HMSA 4UZFA 5FFNA 2ZR8A 4HADA 3VZQA 1Z5VA 5IWCA 1I4DD 3KO8A 4FFLA 1YS9A 1E2HA 4OLJA 2E0IA 2CMFA 2E6KA 2AFHA 5JXIA 1QIMA 1UINA 4NE9A 2C4VA 1UL1X 4B6PA 1JIQA 3MGGA 4ZCSA 5KC9A 1IOLA 1IY0A 3OWXA 4KQJA 5C0OE 1FSSA 1B2RA 1YA8A 2C0CA 1D2MA 1UP7A 2BBSA 4LISA 4BJ1A 2VXBA 5JW6A 3MUEA 3E22A 1S8NA 4MI1A 3S2UA 1ELOA 2AOVA 1NN0A 4DQVA 1Z4MA 3WWCA 3EZ2A 2HB6A 4M0UA 5EIBD 3TS1A 3UGKA 8ABPA 4N82A 3WB9A 3FSEA 4X3PA 5JALA 1L7QA 1KVTA 4XUDA 3OZUA 1EKXA 2I2BA 2TMGA 3JR7A 3SQMA 3FVVA 4LJKA 1YQUA 1RAIA 2HREA 1BW9B 1WF6A 3F9IA 2ZB7A 3KT3A 3P2EA 2ATEA 1YZHA 3IJEB 4JIMA 3NBMA 4YASA 4JI7B 1MB9A 2E87A 1HFEL 3AP1A 2PGDA 2VF5X 1J8MF 1NE2A 1WA5A 3DAGA 1NV9A 2IZ1A 4NJMB 5A6SA 4G84A 2FW0A 2FEPA 3NATA 1II0A 1JQJC 1QQ6A 4ALJA 2RE8A 3EMVA 4MINA 4MSUA 2B1RA 4QUKA 4E5KA 2X0JA 1PGOA 4IIFA 4BU1A 3UHOA 1TEXA 5F64A 2WWYA 4LV6A 2GO1A 4BQOA 4EJ2A 1UQRA 1QHHB 4TYYA 3HWSA 1J09A 2L82A 4FGSA 4FZRA 1JFSA 2A9OA 1HQYE 5ALMA 1V7PC 4XQEA 4E70A 3ZZUA 3PNQA 2XCQA 1L1QA 3TVDA 4NWIA 4RELA 4I8IA 2P9QA 1TAQA 3EPRA 5H7XA 4LN1A 4GLJA 1K4MA 5TC4A 1EJ0A 4LRWA 3KUDA 1G2QA 3VC1A 1S3IA 1UBRS 3R7BA 1SQ5A 4LS3A 3EWSA 1QANA 5BR4A 2EKPA 5AW2A 3N3AC 4NYMQ 4QGSA 2OM6A 1GNTA 1XXLA 2PBRA 3KCQA 3QV1A 5CCEA 3UJNA 4AKIA 1PUJA 3H9BA 3GYBA 5FJIA 2P9HA 4J7CA 2H8KA 5A9SA 2POCA 5FADA 1ONPA 3H8VA 3ONFA 2O5CA 2VUIB 1F2VA 1CJVC 3EZ7A 4GNKA 2D2VA 2R6FA 4DCJA 1QRSA 3KSZO 3NKVA 1Y7LA 2ADOA 1FMTA 3HEAA 4WJKB 2C4WA 2D1QA 1UOOA 1TNDA 2EGUA 4F3NA 4HQFA 1DRJA 2FWBA 3WRXA 3ER8A 4WEQA 3KZCA 1M33A 1TT5A 2Z5VA 1NUSA 2PUEA 3L9WA 3C1TA 3DMYA 4GYKA 1E4OA 3PDUA 4HAUA 1Z28A 3NJ4A 4X9XA 3KVYA 3LVBA 1R5OA 3L7JA 3EXAA 2FWIA 1G5QA 1EUDB 4UBNA 1N34B 1C1XA 4L7VA 1S8AA 3M4XA 3FGPA 3CCBA 1N0VC 1O95A 3OFND 4EG3A 1JR4A 5BWOA 3K5PA 1SQ0A 3VZRA 4ENWA 1FJHA 3GA5A 4FFPA 3AKYA 3K35A 4J3JA 4DIEA 3PFIA 2OHIA 2UXBB 5ENDA 4EIWA 1C7EA 3AR3A 4LSMA 3PNOA 4GPBA 1FYFA 2X5XA 1GPDG 4AT1A 4OQFA 1ESEA 1O6GA 2QI9C 3BQNB 4GLBA 4YJ3B 2PT5A 3QZUA 1L8QA 1D09A 4A8JC 5I7EA 2I4IA 1K98A 1RPAA 2WTEA 2WE8A 4FJ1A 4JGBA 2IEYA 4ZC8A 5JDCC 4XUEA 5TPWA 3RH0A 4OK5A 4DV2B 2IOQA 1JEQA 3CT4A 3JX9A 1H5UA 2BHSA 3MXTA 3COJA 2BDEA 3VHXA 3PUHA 5IEBA 2Q4TA 3P4YA 3JD0A 3GJ7A 3PFWO 4PO3X 3TSOA 3K31A 4BP3A 2P7IA 3I2IA 1DDOA 2BJVA 5ENZA 3KCNA 1KVRA 1PWYE 2CWWA 1TYZA 2K4MA 3WB1A 3R24A 4KAJA 5KYYA 4FBMA 1CUBA 4JXXA 4UHHA 3WLOA 5C5IA 3JQ9A 1KI8A 1KMHB 3M9LA 4M38A 2DGDA 2BMAA 1EP3B 3CLHA 1A4IA 5KYKA 2FP3A 1HZJA 1X14A 3H3XA 3H9QA 3P20A 4A9AA 1G6HA 3O8CA 5GZ6A 4PY2A 4TRNA 5DIFA 3QE4A 3WFIA 5I5GA 4H4DA 3W6ZA 3ULKA 2O7VA 5CM9C 1I7NA 3OE5A 1P44A 5K3OA 3R6DA 2D3WA 4H0NA 1N6LA 2XWJI 4MQ6A 5TGZA 3HKDB 1AXEA 3PEWA 2O3UA 2Q7OE 2N3ZA 3HXLA 3B7WA 1PFKA 4ENQA 3G2IA 4YJ3A 4CIVA 3TUIC 1ADGA 1J33A 1S2MA 4P58A 3UJDA 5AVWA 1WZNA 3L1KA 3LYUA 4N8DA 4AROA 4CF3A 2YIMA 4JJIA 4AZ0B 4GI3A 2IYRA 2FGJA 4RCZA 3TD9A 1JFFA 1QIHA 4DJAA 3KLMX 1NM5A 1N0UA 2PWYA 5EPUA 2CXXA 4TXMA 4O2BA 1F9AA 3MTJA 3IVRA 4G1VA 4K9NA 4NENB 1X1BA 1ENPA 4YRDA 4S04A 2E5LB 2ATVA 2WIGA 4K0RA 2C5LA 3DZJA 1ZK4A 4Y1EA 5T4BA 3WBBA 5HMMA 3C6KA 3WS7A 1YZGA 4B76A 3O26A 1NVXQ 4JK3A 4LUCA 3TL2A 3LXMA 4IHJA 2BSQA 2V7GA 2I4TA 4IJ5A 4HGQA 5DNUA 2PUBA 2A3RA 2WBLC 1L3CA 4KRYA 2DHCA 4W8OA 2FR0A 3ADPA 2X3UA 2Q5FA 3OJLA 1W34A 4QOEA 5I6DA 2BEKA 4HKTA 3KM0A 2WV9A 4RK6A 4E08A 4HOYA 1DP4A 4DCPA 3ZE7A 4YT4A 4GOXA 1JN0A 1LC3A 2GEDA 2Q46A 3N76A 2ZI5A 3TH5A 2EOAA 1E60A 2XUPA 5HBGA 2QMOA 2GTHA 1E9BA 2HQRA 4CLOA 5IT4A 3S8EA 3IC5A 1KFKB 1R12A 1ZVMA 1K7FB 2ZIXA 4ZJYA 2R6ZA 2JBHA 2ILVA 1AOXA 3L0DA 3L79A 3Q15C 4DL9A 1Z33A 1HE8B 1XKXA 3OLQA 2X0KA 1YA4A 4GBGA 2VNJA 4C30A 5KVCA 4AKHA 3N2NA 1EQAA 1G1AA 1NLFA 2XXAB 3W90A 2HQOA 4HYQA 1HDCA 1RWPA 1EFCA 2IFTA 2PUFA 4JT9A 2NUTA 4M36A 1NFFA 1EPUA 2HTEA 3B1XA 3F2VA 3GRRA 4MJ7A 4W7IA 5AJZA 5FNVB 4CKBB 4UNPA 1FX1A 1ATZA 1MIOB 1JQ5A 2OK7A 1CNMA 1LRJA 2UZ4A 2J0SA 1NBMD 1GGKA 2O2ZA 3GBPA 3V34A 1DADA 4JI8B 4HX5A 4XUCA 3WWZA 3DTTA 3RIMA 1PT5A 3EDCA 3NPAA 3MS2A 2A33A 2RDMA 3OEEA 1RAHA 2BVNA 3ISJA 3NT2A 2NU8B 3WG9A 3I2KA 5BSKA 4P7BA 3SEQA 1KDPA 3U7GA 2JHFA 3QVWA 3O4IA 3SDBA 3DLPX 1ORTA 3OP4A 1KU6A 1HG0A 3P5SA 3U5TA 4E11A 2AB0A 4PVCA 1CQJB 1OMOA 5JDCA 3N53A 4TWAA 2D3TA 2OCAA 3P27A 4GX2A 2WYVA 5K0TA 4RE6A 3SYNA 3LQ4A 4BZPA 1DNPA 3Q1LA 3GJ0A 1X7ZA 3UHPA 1KO1A 4DQLA 3DMTA 4HEHA 3M4ZA 1SXHA 1PT6A 1EP9A 4DZTA 2HIAA 4LZPA 2PGLA 1DBQA 4G9GA 2ZANA 4I5EA 1ZMXA 3DV9A 5IDQA 1NW6A 3JD1A 1RKUA 4PQEA 3S1AB 2H16A 3MWEB 2DTEA 2A88A 4M1SA 1CY4A 2C2OA 4A4DA 1JG3A 2AVDA 5JXJA 3BIFA 2XCSB 1GILA 1GA4A 3VTAA 1BGWA 1R8SA 4B6QA 3CO5A 3E0XA 3AEXA 2E5FA 5G4LA 4PZYA 3FDJA 5KYTA 3R3YA 2D7DA 1OLXA 2ZZMA 2RHJA 4GWLA 1GGHA 1R4MA 1ICEA 1NIPA 3ZS9A 4OBWA 1S01A 4MVJF 3TWOA 3R9XA 2I7DA 4EYQA 1AZSC 2PGJA 1YCHA 2ZREA 5HK9A 1L5YA 2DYKA 3Q2OA 2NU8A 1GZ5A 5L9AA 5LQUA 4KN5A 4JEUA 1NKVA 5F4BA 1PLLA 5KSPA 2QNIA 1MW9X 4A36A 3DMDA 1F3LA 2I7VA 4FKZA 4GVLA 4C78A 4Y2GA 4Q9JA 4EPYA 3BDVA 4U7DA 1W8IA 2N42A 3HXOA 1DWQA 5LP6C 3OPXA 1Y33E 2OBMA 2XUIA 5IDWA 5FNZA 3SZRA 2O5RA 4RESA 4J7AA 4NYIQ 2HRRA 1UC4B 1LPPA 2RIRA 3DV0B 5HKLA 2EF1A 5H59A 2C29D 4NPHA 3VTFA 3C3DA 2HWUA 1QTIA 4A8JB 2IJGX 3WRXC 1ZD1A 1Y1LA 1U8TA 2BKEA 2EFHB 2PZMA 1D1TA 3SI7A 4PC3A 3OIWA 1E1CA 1TTPB 5JPIA 2P4EA 4LJYA 1XWIA 1EMDA 1UODA 5CBPB 3A3OA 2QU7A 3BFJA 3HUTA 1EB8A 4LJ9A 5J2TF 4B9AA 3CX7A 3QY9A 3LQRA 4CQMA 4G25A 2W2MA 2FWNA 1A9OA 4IIGA 5L7TA 1QOPB 1ZBDA 3G5AA 2Y1KA 3MS7A 5TS2A 2OXIA 3VYUB 4ZXPA 1MFPA 4Q6BA 1P9OA 4KN9S 1TT7A 4IVPA 1RKQA 3Q9NA 5EYPB 5CFQA 2PPVA 3UMRA 3A6GA 4MW1A 2R751 4PCLA 4QUEA 2IX3A 1D0VA 1BYIA 2JAQA 4MQFA 2G1PA 3LX5A 2X2FA 3FNBA 3O8OA 2B9VA 5AKHA 1M75A 3VJMA 2ERCA 4JLNA 4DKJA 1F20A 4YO7A 4GT1A 3EG9A 1KRXA 2H51A 2O7RA 5FPPA 1E5QA 2BEWA 5C4IA 3EMKA 5KTOA 1YRBA 2IE8A 4KBFA 5CPFA 3EVZA 5JAOA 2O0HA 2WJVA 3BHNA 4PPYA 3GMSA 2YHBA 1Y8CA 1UFVA 4QGFA 4JLWA 1HT0A 3EVAA 5CH3A 5HRCA 2F1HA 3FYUA 3KJXA 2RBKA 2Z9CA 1U0JA 4R1UA 3HA3A 3ZGNA 5KJCA 1P1IA 1WSWA 2ID7A 3M5PA 2PWAA 5EKXA 2H92A 4GI2A 1AMNA 3HCPA 4YTEA 1M9NA 2CXUA 3X1KA 2MSLA 4EY3A 1R4MB 2PTGA 3I83A 4HFJA 1MO6A 1V8DA 3OFKA 4YJHA 3BG5A 2AKYA 1FZQA 2OHOA 3T35A 4LTMA 3OP1A 3ZCPA 1M2OA 1PNQA 1O94C 2WWRA 1VPVA 1I3MA 4PF1A 1FXUA 1HSOA 1U2PA 2BFFB 3V8EA 3PWKA 1DAIA 3UENA 3P2OA 1GLNA 1E0AA 1CZNA 2PX6A 2H52A 3MBKA 5EXTA 2UUCB 2R8BA 3WL8A 1TECE 2V3VA 3RHZA 4PZEA 1ZH8A 3LPDA 3W8FA 2H8GA 4IILA 3PHBE 3WADA 2OCIA 4TMZA 4PNZA 3EEYA 1MOSA 4RZIA 5D84A 1YRWA 2QX6A 3O4VA 4B47A 4DT1A 1QB7A 1Z68A 2RHGB 2HCFA 4YUVA 3MJCA 4R68A 1USIA 4UAJA 2O50A 4GECA 2PLAA 5A3JA 4U3JB 3IAAA 1HFKA 1RD4A 1T6ZA 4QATA 2XUAA 3U1BA 3PC2A 2WUGA 4MVJD 1EVIA 4RF2A 3EIQA 2ZRNA 3S55A 3HSKA 2FWJA 1PR4A 3EXIA 3TW8B 2VWGA 4PGGA 2VJMB 5KHLB 4J7UA 2B2CA 1E92A 1W4AA 2VPYA 4CG1A 3OPYI 2AEMA 5U4QA 1ZMOA 2XYQA 3GZNA 1XQVA 2IYZA 3QLUC 4WXMA 5FI3A 1WZ2A 1MDBA 3B12A 2AV6A 4NS4A 1PEAA 5TMEA 3CZAA 3HKBA 3J81A 1OH8A 3BKWA 2ZYSA 4BVHA 1WUJS 221PA 3MNFA 4GE3A 3L4BA 3UPUA 1E3MA 2VYCA 2BUAA 2PNFA 3DL4A 3ED5A 1MUUA 3G8BA 4L3WA 4Q1VA 5B3KA 1WR8A 1E2IA 4RMJA 3PXDA 4XYGA 3AILA 3PFNA 1Z4KA 4O08A 5EEGA 3WV4A 4M0DA 2HT1A 5PNTA 2X6QA 7MDHA 2OBLA 1DO8A 1OAKA 1OI7A 1YRLA 1F2DA 2H00A 3L7MA 4J1TC 3THXA 2LUOA 1NW5A 2NUPA 5B4UA 5FUMA 4FLEA 1XQ6A 2VPZA 2R25B 3BGVA 4B3CA 1DELA 1M0WA 4J0JA 4NESA 1NMQA 1M2WA 2QMYA 2X14A 3BH0A 3QPCA 1MGOA 1P6QA 3DBHA 4DA6A 3BIOA 3GC6A 1MO5A 4UHFA 2CNLA 3FNHA 4ARCA 3ACBA 2RJNA 4DTIA 4W4TA 2DOKA 1NZJA 3DZBA 3GEHA 2XUHA 4PZ9A 1GA1A 2GCGA 2QDXA 3C24A 3UK6A 1QZ3A 4YUXA 3RVBA 2B35A 2MSEB 2QS9A 5IBQA 4HGPA 1H42A 3UV3A 1GV0A 3TW8A 3UXHA 1K66A 1TM1E 3FDIA 1YQDA 4QOSA 4U8HA 1HE4A 3RSCA 3H42B 5LVAA 3E7FA 1J8YF 3B6ZA 1LDYA 2X0EA 3LGSA 4HQRA 1TZMA 4JU9A 4UE3S 1MOZA 2JAPA 1C8BA 3KBOA 4K9OA 1YC2A 2HEIA 1QKKA 2B1IA 4YRCA 5F7JA 4II2A 2ZUBA 3BHMA 1N6IA 1RAFA 3VR2A 1MO4A 2FFHA 1W25A 3RRJA 1RC1A 1YL6A 4LXUA 2DQYA 3V3TA 2PJZA 2XNKA 2QVGA 3CRNA 5I7VA 3FDFA 5AVJA 5JSQA 3RV3A 4R2KA 4G1MB 1VL1A 1QBGA 5AHWA 4A73A 3HCWA 4QZVA 3BJZA 4J03A 3G5LA 1GYPA 3T6KA 5JJBA 2E4VA 3O6VA 2H9IA 3PC8C 1NUAA 3PT5A 4UTVA 1A76A 1O96A 2VPXA 2YL2A 3RI3A 3DSRA 3SJ7A 5C46F 2C7PA 2GK3A 1BE6A 3IBCA 3M1IA 2B7LA 2QB5A 4FFOA 3U4QA 4MPRA 2YINC 2OEPA 4KCGA 2C5FA 1BTOA 2ZYRA 2C7BA 1XAJA 5DYYA 3I42A 2VJMA 1REQB 1BHJA 3IQEA 4Y7DA 1FP1D 3QMPA 2JLQA 1XWWA 1NQUA 4IIYA 2YJ3A 1RE1A 1GN9A 3IPYA 5I7RA 5LMUB 1PJ4A 3B89A 4K9PA 4X97A 3BTVA 3IPRA 3OZWA 3G2OA 5IRCD 4KXVA 2WQ6A 4FKBA 4FMDF 3U1VA 3LT5A 4PLFA 4Q82A 5CB8A 3TX6A 2X9GA 2ZUUA 2F48A 3IP5A 4UEOA 4Y2JA 1PLKA 5DTRA 5LU9A 3M83A 3MTGA 3I8OA 3T9DA 2HU8A 3SKXA 4IGFA 3I4FA 2BE7A 4E51A 1NJ1A 4BEBA 2AYZA 2GXSA 1FMJA 2QVLA 3EGOA 4MW2A 3CNNA 5ULLA 4TXNA 5I7FA 2I80A 4WA7A 4X85A 7REQB 1O89A 1PIWA 2G06A 3OZDA 2I03A 2F8LA 2FSGA 4PZ0A 5TGTA 5I7WA 5KYNA 1XPUA 1ZEMA 1KBQA 2CT8A 1FQJA 3I61A 2IEZA 4Q3CA 5E7IA 2H0RA 2HH9A 4DB2A 4WQMA 1N1MA 3R4CA 4XR4A 3E5HA 1PV1A 4M0EA 1Z56C 3TBFA 4U1RA 1YRYE 5KDOA 2I1WA 2W6QA 3R5JA 5DIZA 3UAYA 2CNWD 3MCUA 4HWRA 4HDCA 1PWHA 2WY2D 4CEJA 3PIRA 3JAKB 1X9HA 4FCTA 1R37A 2C7VA 1RIFA 1LTHR 3L92A 4HDOB 1CVLA 3EVNA 1G8GA 1UEJA 1GZVA 3G2KA 1MB2A 3LPLA 4V0NA 4WKNA 4DMMA 3V4PB 5L3SA 2I9PA 1QHGA 3F1KA 3W2HA 5IUNC 3GCWA 4HVCA 1YDEA 2WVHA 3KPUA 1SK9A 4XVQA 1D8AA 4P4SA 5FR1A 4YGXB 2EQ5A 4MVJP 4OFBA 5D3ZA 1Q2XA 5JCOA 2XIQA 1E99A 3ZDYB 5EJ9A 1B6RA 1P2SA 4EFKA 4LRXA 1HLDA 1L1FA 2HJHA 4BJHB 3IJ5A 3K0BA 1Y8QA 3N2GB 1BXGA 1UPCA 4FZVA 1PR0A 1HORA 1EXWA 3AI7A 4FOOA 3ZE8A 2G9RA 5JZOA 2VFAA 4CTOA 4CLRB 1L7MA 5LB2A 3EQ8A 1L5VA 1AKVA 1W49A 1QGUA 2W42A 2D4HA 2PAAA 3ZBPA 5LQMA 4YRTA 4RF4A 3HNPA 2E55A 2VHJA 3PV0A 1C0KA 1SUWA 5J4LA 2YMPA 2V0GA 3KX2A 4QDTA 1HK7A 3I32A 1TM4E 5AKIA 2QTLA 5H02A 1N6PA 1ODFA 1X77A 2ECOA 2I4RA 2GAAA 3RKUA 3ND9A 3VR5D 3WDLA 3MSCA 4ZI2A 1GAJA 2GRUA 5BUZA 4O6VA 1KIAA 3LKDA 3X1YA 5ALGA 2ORIA 4WE3A 3P9SA 1YQWA 3O8LA 5BRJA 2XGMA 4HWPA 4RV4A 4N3CA 4QGBA 5EJ4A 1L4LA 1E5TA 1H2WA 2MINB 5HPYB 5JHHB 1CLUA 1XQXA 4L1KA 5GADl 3OTQA 3OCVA 4Q3EA 4DWVA 4MCAA 1H2FA 5TDHA 3W5HA 2FQ1A 1XRSB 4HYTA 4R5MA 5EJGA 1GXSA 3STUA 2J5RA 4RVSA 1A9RA 5HF8A 1V7ZA 3LZ6A 3K09C 4IDNA 4XRGA 1AA9A 1V5GA 4O2AA 2AWNA 2PGNA 3L8DA 4JB2A 4B3IA 1MEJA 1AHHA 1PKXA 3QVKA 2GZ1A 2QZSA 3RG8A 4R1TA 5FP0A 1LDGA 1L4HA 2JI4A 3H6KA 4TTTS 4HGOA 4AUMA 2L17A 2GF0A 3ESZA 5KX5F 1JDSA 2Z43A 3BIJA 1XJ5A 3ZK9A 2Q62A 3O8QA 5D85A 5GJCA 2VUTA 4ZQCB 3DF9A 1U98A 3KYBA 2VRNA 2PD3A 4L5JA 2BZGA 2V3CC 3NHJA 1PD1A 4ZYYA 2MR6A 4R1QA 1SQ6A 1GPAA 1SC6A 4OPMA 2GAIA 4Z9YA 3DDSA 4CPDA 2BFWA 3CJRA 1RQ2A 1XMXA 2Q6KA 1Z6PA 1UMKA 4OGWA 4P9NA 4A92A 3UWPA 1HTBA 1EIWA 1ONBA 1PZNA 3AUFA 1V4VA 1Z2NX 1QHFA 3QF4A 3RS9A 1SHKA 1ZD8A 4YIHA 3KYJB 1YVPA 5FQNA 1WX1A 1J1ZA 4JI6B 3GPCA 5F3RA 3GLFB 1G55A 1E66A 3FCYA 1H8EA 3K5IA 4ANFA 4AULA 1HDXA 5BVHB 1HC7A 3FRHA 5KDDA 3L7DA 5DSZA 1A4UA 4S1TA 1D2CA 3CUTA 3F2IA 3EA4A 4QRHA 4FI3C 5CK5A 4JI4B 5JFOA 3F3YA 1YD7A 3HUUA 1QAOA 4Q7MB 1OC2A 4QJBA 3QE2A 2HUPA 3TCXB 3SBDA 4E2FA 4D8VA 4TL6A 4C87A 4FXOA 4DAOA 2VKTA 3QXCA 3COPA 4TWIA 1Q0RA 2VF8A 3FLBA 4HSEA 4BBPA 4B73A 4IRUB 1YKGA 1Z4JA 3ZIAD 2BHNA 2GK6A 4P4TA 4BMCA 1V9LA 1D4ZA 3PI6A 4E33A 1E9DA 2J3MA 2PO7A 2V58A 3Q11A 1IYZA 1L8XA 2ZIXB 3K2QA 5E6SB 4R8KA 5HZMA 1RZRD 4PO9A 4PLPA 1I2AA 4MP8A 1ZZEA 3FFXA 3WLSA 2H5JA 2WJHA 4UEWA 2HL6A 4BNXA 4O33A 4GI1A 2C5GA 3L2OB 4Y2QA 1U3GA 4OGGA 5K3BA 1GQFA 4JBNA 3R0JA 4EQ6B 1PZHA 5K20A 2PUDA 4WTOA 5AVVA 4KDCA 5DNYB 3ZWNA 1I4LD 4RD6A 4XYMA 4WHMA 4AS1A 2BUBA 3VR6A 5J47A 3GJXC 2ZUFA 4P3YA 2FUCA 5JARA 3E6AA 3EW9A 2OPHA 2WHQA 2YYZA 3GPBA 3UXEA 5LNK1 5HSGA 1JEQB 3FYTA 1SBQA 5ALOA 2WA2A 4O1IA 1FFYA 4U7GA 3EHDA 4KNWA 4LQ4A 4HT3B 1FB5A 1QCDA 1U0TA 4A0RA 2VYVD 5KC8A 4KUHA 2YRFA 2ZRGA 3HFRA 4KO3S 3LK6A 4JI0B 1QR6A 1ULZA 4ZOLB 1WRBA 3NC0C 4KXFB 1VGQA 2ZB8A 2BY4A 1I1NA 3REOA 4GYWA 4LKRA 4QBGB 1GQ2A 3A6KA 5JAUA 1RLJA 2ZWAA 1AV6A 2O1EA 1CU1A 1P33A 3GD5A 4DUYB 5K0EA 1A71A 1G5IA 1KYZA 3QE9Y 3SM9A 1YJBA 3DUFB 1C9DB 1RBQA 5F1OA 4PSVA 2JEYA 2GBPA 4EB8A 3WMFA 4NBUA 3AONB 3W04A 4B80A 2WHPB 1OFTA 1RYZA 4LJ8A 4O1HA 1EX7A 5AM4A 3QELA 3UJCA 2GSDA 4H18A 4QBIA 3ZHZA 3H1TA 2BIFA 3OMLA 5DXFA 4EQ6A 2CC2A 3FSGA 5AR1A 3S29A 1XMPA 4HXYA 4TKZA 2CLLB 4B4KA 4EVIA 2NNLD 3A58B 3EXHA 1MJNA 2BKXA 4RAOA 1VPEA 4UTZA 3SDSA 1YJ8A 4DMCA 3FCXA 1Q0SA 2WTUA 3RIYA 4W9NC 4BBZA 4YI5A 5GP1A 1KETA 3PFGA 3E3NA 1JR6A 1D0SA 2YVLA 3DAHA 5LA6F 2OCGA 4RMGA 3TSYA 5EE3A 3L6BA 1M2NA 4NENA 1GAXA 2O2YA 4PYRA 4AO7A 3OA0A 1U3CA 3GQBB 4Q9DA 1KZ9A 5AW4A 2P4UA 5HQ3A 1E8MA 4MR9A 1IQPA 5FWDA 3R7FA 3JD4A 3ZE1B 4INZA 3UUWA 3C3MA 4WGFA 3O9VA 3DVLA 4XLTA 3KKKA 3P0HA 5K0JA 5JAHA 4JEHA 4WV3A 4PZLA 1MRNA 2N0SA 5JS2A 4NTZA 3DBRA 5AHKA 4OEHA 3K6KA 1V48A 5IDXA 4L72A 5EZSA 1V35A 4CMEA 5LD2C 1WQ3A 2EX4A 2WHPA 3CW9A 1KY2A 3GARA 3ZV5A 4B32A 5FPKA 3GCDA 3C3JA 3ILYA 4CUJA 1NJ5A 4W8GA 4R01A 2CF5A 5EIHA 1C81A 2JIZA 3PGVA 1UJ4A 2OA0A 3HWWA 1J6UA 3K0AB 2OCLA 5BXYA 4H3SA 1GNVA 3FKSD 4JGIA 4G07A 3ZY2A 5IAAA 3WNQA 2J32A 3Q7QA 3VU9A 1H8ED 3IV9A 4BNIA 5CLGA 4A82A 1DC4A 1E5VA 3BXHA 4OJMX 2BFCB 3U7EB 1S0UA 5A9TA 3IX7A 5JRJA 3ESYA 4Z4GA 1J56A 2XADA 2YHAA 2P8SA 4K9QA 4MS1A 2PVSA 3I2HA 3OCWA 5EPEA 3UGTA 5KU7A 1B15A 1MIOA 5D87A 4WIAA 5FOXA 4EHFA 1ZLXA 4RGVA 2NU7A 4PPGA 4KGVA 2ZJ6A 3THYA 3LWDA 4UM9D 3F47A 1VSVA 4ICIA 3VPAA 3GJ6A 3OCZA 4GP6A 3TXAA 4C3VA 5EE1A 2Z9DA 5C1PA 1CFJA 1D2AA 4H4CA 4D0SA 1ID8A 2P3QA 2OHVA 1J5PA 5BYBA 3TNJA 3LHDA 4YUZA 1MPXA 2P3LA 1OA1A 1HE1C 1UDWA 1Y3CE 2Q6LA 4FB5A 5E1DA 4IIBA 4HRVA 1RYMA 1JECA 2IT1A 2JIOA 3FCUB 2ZQZA 4IG4A 1N8SA 5TF0A 5G40A 3GMIA 4BATA 2VK8A 1LS1A 4UEJA 2I6FA 1NRXA 1RYHA 1U9ZA 1OKKD 1KVUA 2YBDA 3WVNA 3SQDA 4Q4LA 4A2CA 5I9SA 4MA5A 3ESAA 1B2LA 4UZSA 5IU6A 3PHLA 3LY5A 4AS3A 2OOKA 5BNIA 2FQXA 2TRSB 4ND8B 4CMIA 2P2YA 4WGGA 1D1PA 3M8KA 3W3AD 5FH9A 4V3BA 4B9EA 5IM5A 2CLIB 2OP0A 3KQVA 2XNSA 4DPMA 1F0PA 3MWEA 1ADFA 4X54A 4Q37A 4AJ1A 4EPVA 1C30B 1E64A 2IKSA 3EFHA 4D82A 5IX8A 2FKNA 3AUKA 1P1HA 2P7HA 3EGWA 3NEAA 4JKYA 5D8DA 5A3SA 1GOTA 4BN4A 5AVZA 3K72B 3DZIA 1DAEA 1ZSYA 5JO0A 3KQMA 3U61B 5AK4A 3UAZA 1FFCA 1OXXK 1M8PA 2HQ1A 2KS6A 1KJIA 5ALSA 4AJPA 5EKSA 2VYQA 4HRAA 4JUIA 2Y27A 4IWXA 4HUJA 4FHCA 1RI3A 4IHJF 4CMEC 4YC7A 2VC2B 4XZ3A 2D5CA 1Y3AA 1F51E 1E1RA 3H6HA 3K1JA 3LBNA 3MWGA 4HEA6 3KEFA 5CVEA 3I9LA 3SD7A 3NHZA 3AMVA 3S81A 4DC9A 1C7IA 1N2CB 3GLVA 4JBHA 4KFUA 2YRXA 4MV6A 4RF3A 4E7PA 1Y9ZA 3AHFA 4PNPA 2PX5A 1SRQA 4KXMA 1LUAA 4MDYA 4HB3A 1TZJA 3ZUPA 1HBJA 3LHSA 5EIFA 5KNCH 2Z8YA 3VO9A 2H2GA 1P72A 1EVEA 1BFKA 1Z37A 1TMGE 3GEGA 4MVJE 4OY3A 2HKIA 3SP1A 4YRBA 4FJ0A 2L69A 4WKGA 3RVOA 4PR3A 1QLWA 1PD0A 3E53A 4OXKA 3W8EA 2GHQA 3DVRX 5C32A 1V3TA 4LRQA 2YVUA 1V16B 4S24A 1JTFA 2XYRA 2A5JA 4E2WA 4B85A 1YR8A 1RRKA 2I29A 5SZIA 3THYB 2AXQA 3IE2A 1U3WA 2FH5B 1RWWA 2B4RO 5ILGA 3KUCA 1ILWA 2YH2A 1X15A 2OWDA 1NP6A 3CF2A 3R6WA 2JLVA 4HGNA 3BORA 5KZMB 1UJ2A 2DJIA 2K7FA 1JILA 4ER5A 5KOHA 2VHUA 4YCJA 3S4YA 2DFLA 1H8HD 3FX2A 4GEKA 4TXJA 3HDHA 5AM1A 3OTIA 3TNFA 1D6JA 1DLJA 4B7AA 5GINE 1DQSA 3C43A 3C5WP 1NJSA 3KPVA 4ARZA 4NCBA 1JTVA 1I24A 3MPUA 1G8KA 5EHGA 3RFCA 2O52A 3DE4X 5BV2P 2IWRA 4KP7A 4L8WB 3D6MA 1IRXA 3IELA 3B51X 1Y9JA 2H06A 4KE7A 1WVIA 2ZI9A 3G2PA 4TLCA 4D4MA 3U6KA 4GBMA 2CBGA 4RPIA 4YRKA 3X3HA 5K6TA 2Z1MA 4NYIR 2OV2A 1ISIA 3TZLA 1D5CA 1XDUA 2IYVA 1VZ3A 4BAGA 4BRSA 2RB5A 3AB3A 3GEDA 2PZKA 1QFYA 3VVBA 2Y76A 5LLDA 1C30A 2P27A 1VPLA 2WFZA 4J2OA 3UJHA 1I4WA 4YRIA 4JXJA 2Z5LA 1TLTA 1Z2EA 3NVDA 5LSAA 5IYZA 4JJ7A 4KG7A 1VTKA 2DTXA 3C97A 1XRQA 4F4DA 2QW8A 2P0YA 3GPDG 4X7BA 4BX8A 5C53B 3IXLA 2PH7A 4JP2A 2ICAA 2NUAA 5EWJB 3OLZA 1T3ZA 1YHZA 1K3TA 1RM0A 1AF4A 2WF7A 2X9QA 5TPZD 5G1PA 4P92A 5KJ1A 5JSUA 4QKQA 2SCUA 4FONA 2OKGA 2VNAA 1YV9A 4C4ZA 5MGBA 4EUEA 3C3PA 2UYGA 2IP4A 3ENQA 2DKOA 3Q4GA 1YR6A 5THKA 2VF4X 2GZMA 3H2YA 5AK6A 3UCEA 4G5RA 3S2SA 1LVUA 3P2KA 3PSHA 1P29A 5IC6A 4HQLA 2X41A 4C76A 1CF4A 1RMTA 2C31A 2Z3ZA 2ZJ4A 4BQPA 3T3NA 3DC7A 3QVJA 3FOWA 2EVWX 2X22A 3NVMB 2G1KA 2ZM5A 2P41A 3D59A 1QHEA 5GAJA 4BBJA 2QBYB 1TCBA 4CV3A 1ZG3A 2FJUA 3KFLA 1YA6A 3D7SA 3NU1A 3L0YA 4MV5A 1NKSA 3LKBA 3R0XA 2NO4A 1C7JA 1GTJ1 4IV8A 5BSEA 5ERYA 5K0BA 4E2ZA 3U4DA 2AN1A 2YCLA 1X1SA 2BR4A 3A70A 2JVIA 3R7AA 2BW0A 1YJXA 4P3KA 5EQTA 2PMBA 1PE0A 4BO8A 4EKNB 1ZCFA 4EWLA 4DR3B 1Z0DA 4C0XA 4CMCA 5BSHA 2QVXX 3IUEA 2AHRA 2RH5A 1F7VA 1BWRA 1AS3A 3JALA 1WKCA 5IT5A 2X86A 3EZFA 2HF7A 4RV5A 4NDNE 3KQYA 1UXHA 3K5WA 5NULA 4PX5A 3LO8A 2QU8A 1GO2A 1C9YA 2PFKA 4EA6A 2EYQA 1TIPA 3QQPA 1VDZA 1XA4A 1SEPA 2Y0EA 2Z0MA 1PG0A 1SKBA 1KIFA 4GG1A 4BNJA 1T8PA 1E5LA 3VR3D 1XELA 3BB4A 2PX2A 4FFRA 2B8TA 2W0SA 2G40A 3LQQA 3REQB 4YJ2A 4DGSA 4EHKA 2FMUA 4K2AA 5D5QA 5FUWA 5CHEA 5DLPA 5E95A 1VHWA 2ZIWB 3AZQA 1ZOOA 3BS4A 4J4HA 4MI3A 5CGQB 4ZVUA 2CLDX 2GHTA 2P5TB 3TKYA 1GGNA 4PQYA 3V2IA 2JEZA 1RXSA 1XLUA 2RGCA 3KT8A 3BBPA 3V9AA 1B26A 4P6VF 4Z51A 3DDZX 4OMDA 1G291 2J9XB 4WBXC 4YN3A 4A3SA 5DWVA 3D3JA 2D06A 3L07A 4JUDX 3BXGA 2DPHA 3S1LA 3OE1A 1Z4QA 3B2QA 1PAUA 3PE6A 3OQBA 2IHTA 3DXXA 4RQTA 3L0PA 2VP6A 4R51A 1DJOA 1U1CA 2FZEA 3QA9A 3MIZA 1FTQA 2DT5A 2ZI3A 5BT8A 3K0EA 4E5DA 2JDID 2PJUA 1XMOB 4QULA 3RWBA 3UQZA 2D0IA 3U6BA 5HYVA 2AYXA 4JUCA 2H7YA 1FTNA 3LTEA 4FTWA 3RIGA 3O8BA 3QFFA 3FNRA 5HM6A 4I1SA 5K09A 3LHIA 2E4ZA 2IDMA 3NDJA 5GJBA 1STOA 2R1VA 4AMYA 2GN1A 3FZQA 1MABB 3UCFA 3IIKA 1LZKA 4J76A 1FSFA 3LVRE 1KI1A 1GL6A 5JCPA 3SKVA 4C0HA 2IU6A 1JDVA 1S8FA 2VYND 1RP7A 2XAAA 3MB5A 4LV5B 4RVNA 1RXUA 4W5JA 3HVIA 1QP7A 1QFJA 2CMDA 5JVDF 2V5VA 3ZXXA 1L4NA 2GKSA 3E7WA 3LV8A 1A27A 1DUVG 2QSJA 2ZK7A 3DXYA 4RM3A 5DX0A 5LOVA 1UOEA 2B4QA 1P2TA 3FTDA 2B1GA 3HRHA 4LGVA 2OILA 2O7QA 3RBAA 1M7HA 3UPDA 1BQ3A 3AI3A 3NDPA 4L27A 2FMHA 4YROA 4D41A 1CUXA 1NG9A 2IY9A 3SNHA 1ZM7A 1QQBA 4PZUA 1YUNA 5KYWB 1BDBA 2BONA 5D6OA 4LYJA 1X1DA 2ZTLA 1YTUA 3B70A 2E85A 4TQGA 1A9ZA 3FPKA 3LJKA 4RVFA 4RBNA 4Y6PA 1TA4A 1M0SA 3U4CA 3BWXA 3QU7A 1KMCA 3CF0A 2OQIA 4DYHA 3AHHA 3AFIA 3GT4A 5JU6A 1HFJA 3OY2A 5KVVA 1JSXA 1DVRA 4BB9A 4O4HA 4BPBA 1NI3A 3CG4A 3ICCA 4EKGA 3CR7A 3AF6A 1EUCB 1XC7A 1C2YA 2BHLA 3CURA 1JXMA 3BGWA 1E1QA 4XKJA 3VPCA 2QJOA 2Z8YM 4BNDB 1W29A 2W6ID 1GRNA 4LGCA 2ZRMA 3P2JA 5LQDA 4LJSA 5KTPA 3FETA 4DNQA 4WK6A 2PRKA 1SKMA 2UV8A 4UDNA 2ZJYA 1UJNA 3UHJA 2JGEA 4GLOA 1SBZA 1B93A 1YE8A 1Y98A 3A2MA 1TI7A 2KB0A 3H65A 1Q6ZA 1B3RA 1BFUA 1P2FA 2QMEA 3P2YA 4QD3A 3BQMB 3ER9A 3REQA 5KMGA 3Q12A 4ZV4A 4QYIA 3TLGB 5BMVA 4DSUA 3ZR4B 2I5PO 2PSDA 3D3WB 4MYRA 4P35A 3ZGYA 4J07A 3QMMA 3LBHA 5A06A 4UNIA 5AD1A 3FSJX 4H60A 5DT9A 3VZCA 1FC0A 2EF0A 2VHQA 3TZKA 4LFAB 3W9UA 4LOJA 4JNKA 4L6IA 5ERGB 4B82A 4OI0A 3WGTA 5JZBA 2J6IA 1G42A 2VAXA 3ZLVA 4E12A 4WCVA 3V80A 4AB1A 4C4RA 3CRMA 3WLTA 3EYWA 2P9YA 2R6JA 3QFTA 4X44A 2PL1A 4KPEC 1P3Y1 2R6R1 4JYMA 3AINA 4M2LA 2F8SA 4WK4B 1NDUA 2BSAA 1IQUA 4GOND 2YV1A 3K96A 1NQVA 3HB7A 1OTHA 1RM3A 5H9VA 2EJVA 1A98A 2XWQA 3MA0A 4B3HA 1N4DA 1FYEA 2IELA 3DYIA 3Q40A 1B0ZA 3ANTA 3HJFA 1ISJA 2YHUA 2OPBA 1IBCA 3RBXA 3A1UA 2X9LA 1CJMA 1PSWA 3KC2A 2QRVB 3G85A 4KFSA 2CDBA 3WNZA 3GLGA 1JJIA 2IYOA 4TUYA 1KQPA 1OXBB 4BEVA 1HL3A 1LPBB 3GN2A 5CLHA 1ZLYA 1R3DA 3OM0A 3R7DA 1LVGA 2A30A 2VRCD 3P4UA 2ZT5A 4MUKA 3WWEA 4ZJUA 4CIAA 3COWA 4PGFA 3G0BA 4M55A 3C3KA 3LY9A 3AVYA 1E2NA 3D0RA 1Z07A 3N2ZB 2EFJA 1U28A 4FYIA 2JHAA 1OT5A 4KU4A 3IP8A 1NZFA 4MVCA 4NG5A 4R05A 4NMWA 4IDFA 4RMHA 2O8EA 5F9FA 4K9MA 1QPGA 5DM60 1N6RA 1EDEA 5DASA 5J2UA 3VOSA 1YBAA 2WJ6A 1CEYA 3JS5A 4YFVA 2PBZA 1KDYA 1V11B 2VPWA 2ZXEA 3ABRB 4N41A 4F38A 3IUQA 2B30A 4PYJA 1VG8A 3RUAA 5BVGA 1XT6A 2AC4A 2Q2WA 3DHNA 1ZX1A 2FSVC 4OL0A 1BKYA 1GPNA 3I0NA 2OV3A 4QREA 2FPWA 5EMKA 5JCJA 5LQJA 2O8FA 3UWKA 3AR9A 4PHHA 5HQTA 3TQSA 1DUIA 5DCWA 4F72A 4CL2A 5K0ZA 3LTNC 2R7KA 2VZ9A 1NF9A 3DMTC 3SDZA 2PZEA 4QYMA 1JLRA 3KPJA 3TQRA 5FA5A 3S2ZA 2QRVA 5HIAA 3ZGXA 3H1PA 4PR0A 4AMVA 4IQ8A 3EXG2 1CVIA 3S2EA 4K6HA 7ADHA 1EWRA 1S6YA 3AXTA 1VB5A 3C6BA 4O25A 2FE4A 2W7TA 3JYQA 3IBTA 3N59A 3QNMA 3TGWA 3UB2A 4EMBA 5I3ZA 1U5BB 3VSCA 5E8JA 421PA 3JPYA 4G0XA 3WZLA 3R8FA 2P65A 1A77A 2KBEA 5K6AA 4ER0A 4ZRNA 4TXHA 5TMBA 2F17A 2OO7A 4AF7A 4BL5A 2XVMA 4HV4A 2HADA 3UA3A 1QK5A 3ZU6A 4LCJA 1M6VB 2P67A 2EAUA 1M2EA 2EKBA 3H9GA 3A1CA 3OPMA 1NNLA 3P19A 1N5OX 4P7FA 5B64A 1P6UA 2BZ0A 5EMMA 3E18A 3W8RA 2HA0A 3D2CA 3D7LA 1JA0A 2BGMA 2NQ8A 3ITEA 4HVLA 2IUYA 3O8DA 4BJ5A 1PQUA 3A4MA 4FOSA 3IT0A 1JAHA 2EJWA 3H16A 3HS3A 2G5CA 2EEZA 1LPOA 4ZEXA 1EFPB 3N8NA 3BSSA 3DDNA 5EXXA 1RJ9A 1U7WA 2O59A 3D6VA 1OE0A 2M6LA 4EGJA 4R7GA 3KR0A 3K1AA 3ND6A 1Y8RA 1CY6A 1PS8A 3KB1A 1XHEA 3ZY3A 1SXQA 5UKDA 3OHPA 3L7YA 2PKEA 2WZBA 3QVTA 4N40A 4O2LA 3I4LA 1RBMA 3JWIA 4URZR 4WJLA 5IMSA 2PG3A 3DLBA 2OY0A 4YXWD 2NXCA 3I5MA 3JARB 1T4MA 2JK0A 2PXCA 3OEHD 1XD8A 5KREA 1DIGA 4B6RA 4NOLA 2IF0A 3TZEA 2F55A 1Q1NA 2Z1DA 3EF3A 3NANA 3HDTA 3VR6D 3JZAA 3HA5A 4P5PA 2QPTA 4DMRA 1DV2A 4MI6A 3ZE9A 1T0JB 4YP6A 3VPFA 5I45A 2OZVA 2QTCA 3DHWC 1DBWA 1NXPA 1VKRA 4YECA 2KYRA 4HN4B 2GAFA 4Y0VA 2JGAA 3A8TA 1HDZA 3HP4A 4UFOA 5E4FA 4X65B 2P79A 5KAPA 1T5TA 1WL8A 2PH5A 4B33A 2X76A 2UZAA 2AJDA 3VH3A 2F9MA 3TZBA 4PBRA 3ZHVA 3IVAA 3ZCRA 5COQA 4Q9LA 3FVTA 3O94A 1JG1A 5D7NA 4C43A 1GSOA 2FLWA 1FTGA 2OTCA 5HWSA 3CEJA 3PDJA 4J7XA 1IWPB 4IDPA 5KDLA 4E5UA 2ACVA 5IDYA 3TQQA 2H2WA 1E6EA 1PR9A 2HD4A 5GGXA 4RM2A 3HZRA 3N6XA 4A8HA 1G8HA 1ESMA 2AFIE 1ECLA 2NU7B 4TWRA 3ITDA 2P4QA 4XDYA 3VNBA 3RWMB 4IRXA 1NHGA 4U6NA 2BTEA 1CQIA 1DJLA 3HN7A 5HZKA 1EEXB 1S9DA 2GN8A 4NDAA 3AG5A 3T15A 3UCXA 1YR9A 1A9XB 3OT1A 3WLHA 5JXWA 1NX9A 3H2ZA 2P6PA 3W2IA 3ESBA 3AKEA 5EXPA 1QF7A 3FD8A 4PC1A 5JCXA 3MT0A 2FX5A 3FCEA 1K5GA 3PHHA 3HUEA 1AS0A 1IOWA 1DIRA 4XVUA 1WW3A 3RS7A 3SS9X 4BMYA 5JDIA 3E1GA 1SIBE 5B1IA 2Z8XA 1G9TA 2VA9A 4BMVA 2C2GA 1ZW6A 2WKRA 2ARKA 4LNHA 1KERA 3DQZA 1Z0IA 4KLRA 1EK6A 2EGGA 5FTNA 2P6RA 4FGKA 2BGKA 4NABA 4UUMA 5ESWA 2KBFA 5T8KC 4DIBA 2IGBA 3T9EA 2I22A 3GGGA 1KORA 1U2GC 1Y63A 4FUQA 4TMYA 3WP0A 4BFXA 1EFPA 4HNAA 5FJJA 1W2WB 1RJ9B 1AHIA 1T3GA 1AKWA 1DPGA 4JASB 4DANA 4B34A 1G20B 1T9BA 1LI5A 1L7AA 1YULA 5I7AA 3UF0A 1KOJA 4DLBA 2A9KA 4LY9A 4WZBA 4G5HA 4FE4A 4ETIA 2CXNA 2QTBA 1DSSG 1RDFA 1V1RA 3DB1A 3DM9B 4H1UA 5AOAA 1RPNA 3ESRA 2I91A 2FW6A 2ZUVA 4JR2A 4MV8A 4X20B 2XZOA 4H3KB 3GUVA 4N0PA 1DWUA 3W05A 4OHKA 4MUJA 2IHUA 5CX1B 4RD3A 1PHPA 3WJAA 4CUZA 5AFSA 5K8TA 4AICA 3BA1A 2LXNA 1DJQA 3HBAA 2E49A 1BQ4A 1FU4A 1L7EA 1U8UA 2QRGA 3N39C 2XNHA 1IIBA 3GDFA 2FG5A 4X1IA 2JIZD 2OOSA 3GDHA 4C2BA 1ZUWA 2RB4A 3AEZA 4JELA 1NNEA 4YMTA 4EVRA 3TPFA 1XP5A 3THSA 4NL4H 2FWAA 1K4YA 2HCBA 1WM1A 3H1GA 4OQYA 4EYOA 1MJ5A 1RQNA 1V7QA 1VCIA 3E9YA 1CHNA 1DAGA 2C4MA 2GBLC 4IFEA 4LOIA 4MQBA 1NUUA 2I3AA 2UVPB 1XDGA 3LW7A 4OB8A 1ETUA 2J0EA 1R64A 3D5QA 4P3NA 3V1NA 3VAYA 2EKZA 1QRAA 4MWTA 5FB3A 3DLHA 4N5MA 4XGRA 3HV0A 1KEZA 1NQTA 4DMKA 4RW0A 4HC4A 2C92A 2G9VA 2YMLA 4I2VA 3FNQA 5WRFA 1KAQA 3CX6A 4YRSA 1R18A 1HURA 3LOQA 3JYPA 1KGSA 3SC4A 4HNVA 4NAUA 3A04A 3I9JA 4TYPA 5DFAA 4AKEA 4CV0A 3M89A 4IOJA 1ZGGA 1R15A 4KMOA 2A9JA 2WJGA 3PSAA 3QU9A 3PVCA 1GGEA 3T4XA 4XCXA 5IJXA 3D0QA 2DQKA 2HGSA 4B6FA 1OROA 3G5TA 3RSQA 1A72A 1QIDA 5KQMA 3D6HA 5KNBD 3V97A 1T91A 4O4LB 1AKRA 1PR5A 2I87A 1B74A 2X9NA 4N49A 5AH0A 2A57A 2VP5A 2WTNA 5AI5A 4KLNA 5A04A 4OJYA 5CU7A 4EFMA 3R1IA 1CF9A 3DE0X 4D81A 1FYWA 2B5VA 1JWLA 1QYDA 4TLEA 3H5VA 2H5LA 2JFFA 3DKKA 4G0OA 4GUAA 2BMJA 2OXRA 4CKWA 4A8JA 4X6UA 3EVCA 3FLEA 4X5OA 3NKLA 2PMWB 4C21A 4YAOA 5F78A 3SN6A 2ZWMA 1T2DA 4MS1B 2C9CA 5EP1A 1RVDA 4PC7A 3NAGA 1Y9EA 5DLDA 1MN6A 2H7XA 3BMQB 1SR8A 5FI5A 5AKEA 4P31A 5EKTA 2CLOB 1Z36A 4MAMA 2P6NA 2Q4OA 4XLZA 5F2KA 3L1JA 4MQUA 4UW9A 2NVOA 5IHPA 1Z9BA 3B1YA 2D1SA 2UUAB 3K30A 1HNNA 1D7OA 5LDGA 4F1JA 2JGDA 1CDZA 4WZAB 2V55B 1IU9A 1W76A 2PD4A 2QORA 5IUKC 3ROXA 5I9LA 2J6BA 2NYUA 4E3ZA 2BD0A 3ZEIA 3C3WA 1JYFA 3PF8A 1U2DC 4L4RA 1LZLA 1SHUX 4MVXA 4OU4A 5ITWA 3H1AA 2AQHA 2JA2A 2X3YA 6LDHA 2PKXA 2JVKA 3QEKA 4C01A 3WSTA 1JQKA 1TADA 2W2PA 3C3BA 4NMLA 5K4AA 3RU2A 4KGXA 1QG6A 1L7NA 5KNDA 1U0HC 5IZCA 4ISCA 1KI2A 4I2NA 3ZE2B 4CMIB 2QT9A 4WN9A 4Y67A 1XZAA 3BCUA 4JMPA 3DMGA 4I4LA 1EWKA 1K6XA 1OREA 1Y3BE 2XDWA 3L93A 1P6XA 1PR3A 4GPTA 1QCZA 4MDHA 4IKEA 3B53X 5AW5A 3UEOA 1OH5A 2B9EA 4KE9A 1HT1E 4ZN6A 4A2PA 4BO1A 3TMAA 1WXWA 3O92A 4Z1MD 1LK7A 3DD1A 3ASZA 4CT5A 2CY0A 2GLUA 1J0BA 3FZGA 4ZPJA 2P75A 2JVJA 1I3NA 5ALRA 3NXSA 3WLKX 4CQMD 2C4NA 3QHAA 2H2FA 4P0TA 4W5NA 1KOLA 2CK3D 2QUIA 4PSUA 1PRYA 2CSXA 1EFTA 1JH9A 2DLDA 2WB2A 1ESDA 1Q1BA 4PFSA 2ZW9A 1K6MA 1JEOA 4V1CA 4L6CA 3SM3A 2I4NA 3GGDA 4QDXA 1E2UA 1XQ1A 2P9GA 5KYUB 5B53A 1VBFA 4JB3A 1UDXA 4W9RA 2J48A 1VMEA 2CL5A 1C8VB 3V7WA 3ZHCA 5HW0A 2GWHA 3Q88A 1KTIA 1F2TB 2BGIA 5J4VA 4U02A 1B8OA 2CDCA 2OP1A 1CY8A 1QOQB 2CXTA 3CX4A 1QKIA 3R6GA 4QPZA 4RC9A 1TZCA 2IYLD 2J9FB 3BJIC 4Z7QB 1YE5A 4GMKA 5CDFA 1JDBC 3U3RA 2H6EA 3WO0A 1QWSA 4AL4A 1SVOA 4WN9B 2Y3IA 3ROPA 4RSRA 3Q87B 1SVKA 2YWJA 3QE3A 2TECE 1BE0A 3EIWA 3MTDA 3LIPA 3PE3A 4Q12A 5TMPA 4FYJA 3EIFA 4C0WA 3TGLA 3B3GA 2OZLA 1KHTA 5C8XA 4GM0A 1UK8A 3BERA 4HDQB 5JYDA 2PPLA 2GPAA 1FP2A 1GSHA 5LBTA 1G38A 3D7KA 1N5RA 4ARAA 4OATA 1W0KD 3OJEA 5T7BA 1TA0A 1E2EA 1SVNA 1W6RA 3OM9A 1PV2A 1T1JA 4QJIA 3V8RA 3BRWD 2RGUA 4KAXA 1PV4A 5IM4A 2D62A 3TAHA 3EA5A 5J2TA 1EG7A 3T4PA 3PJGA 3HSSA 4M9ZA 5I9NA 4KBGA 4P4LA 2VAVA 3NKFA 5ES3A 4H4EA 1T29A 1U31A 4BB6A 2PAFA 2VSQA 4XEHA 2ZB2A 5CYGA 4Q4DA 2BDTA 5AT1A 1W5EA 1EINA 2L19A 2PS0A 3PNMA 3LC7O 4UEKA 5HJ2A 3ZX5A 2FSUA 1WBJB 6YASA 1BU8A 1MOQA 3EIOA 4PGAA 1GU1A 4RNCA 1YI1A 2W4QA 3K8OE 1EVYA 4M49A 4OLHA 4W6QA 2J0QA 4AJNA 3KVRA 2O57A 2QN2A 4AJOA 1N2OA 1KJNA 5KTTA 3FUUA 1CUCA 4R9RA 2PZAA 4RUKA 3PNKA 4WXPA 1TU0A 5HG0A 2XKBA 1FOEB 1X1QA 4M9UA 4XB1A 4L2IA 3ZHXA 5CCXA 3WHKA 2MSKA 5JXHA 2XZPA 1Z34A 1YZUA 5JYCA 3H9UA 4IHKA 4JOCA 2F3TA 1AUVA 1ZUHA 2NAFA 3A27A 3I09A 5BUQA 4ND3A 1DEAA 4X7MA 2J9RA 1AVTA 1S7CA 4BV2A 1UFRA 3CJQA 4PPNA 4P93A 2I2WA 1Y37A 1Z7YA 4I3GA 4OKIA 2AX4A 2VXYA 2ADFA 3CUWA 3KLBA 4TQAA 4XQCA 4FD2A 2R4UA 4ZOCA 5K3CA 1W47A 3STYA 1M74A 2C4TA 4L0CA 2QX9A 5CB6A 4AJJA 1H85A 2UUBB 2HRQA 3KD3A 3HJBA 4CL3A 4UBMA 2CNBA 2PT6A 1E3JA 2W6OA 4OGLA 3USZA 1NF3A 5IZ4A 2HZ7A 2YC2C 5JNUA 1YUMA 1TYAE 1AKEA 3FWNA 3NALA 1TMOA 1A04A 3R4VA 3QEBZ 4AMUA 2F4NA 1OXKB 1NBWB 1K2VN 4PPFA 3LWNA 4FZ5A 4Q3AA 1T15A 1Y4SA 5C2JB 1K7YA 3LQ2A 1NR5A 1U9IC 1CETA 1F2UB 2AR9A 4C0BA 2AC2A 4A10A 5CG1A 5KMGB 2C7OA 3HYSA 2C3MA 1OLSB 3LP8A 3EMDA 5D6NA 1SKUA 1KFBB 4LWPA 2QV7A 3N2LA 4OYHA 4S2EA 3LIIA 3E5NA 2FAXA 2ZROA 4YALA 2ZG6A 1GADO 2EBHX 3ELUA 1YMUA 5KYVA 3OD5A 4FE7A 1PWEA 3LX4A 4DR6B 2XJ9A 1SCQA 1NOKA 2HNKA 2KJQA 3RFUA 3AVUA 5DCYA 4HYYA 1ZESA 4PLCA 1QFMA 2NXNA 5AXDA 1KAMA 2YTZA 1TF7A 3O93A 4QUAA 3CLSD 3V4LA 5I51A 5J2UF 1N2IA 2EZ9A 3L8MA 3BXEA 4OH7A 10MHA 1QNFA 5FDFA 4D57A 4BWGA 2AOXA 3AETA 2NMVA 1KA9H 1XZJA 3B6IA 3UJ6A 4Y18A 4RK0A 1GRQA 1EE2A 2HLHA 2AFVA 1TU4A 2PZ8A 2BE9A 2XTNA 4MGIR 3OQ6A 4WRRA 3SE0A 1TL7C 2OAQ1 4AY3A 4EGSA 4M76B 1S4QA 1JBKA 1EQ2A 1KZGB 3EZXA 3L8FA 1R8QA 3G8DA 3K1YA 1VE5A 3PGMA 1TU3A 4G67A 4PS0A 4V3CA 3M70A 2BMVA 3HDQA 4FWBA 3WWPA 1CYEA 2EJTA 4ID9A 4RANA 2AFHB 1GUAA 4YH1A 3GMDA 2TSYB 4NMMA 3P97A 4MUFA 1O8CA 1L4BA 1MMFB 1ZD9A 1SC4A 3KKZA 2F1IA 1AE1A 4O8ZA 3UAGA 4N39A 3R44A 3TBKA 2WUWE 2LNDA 5F33A 3TSCA 1HE2A 1M2KA 1IEWA 4KR3A 3BK1A 4DCSA 4ZVTA 4EG4A 3TEMA 1JR3E 4MROA 5LZ2A 1OW3B 2ISSD 1ZMBA 3CVVA 1JI0A 4OLBA 2NP7A 3OAAD 1AKTA 4ZT2A 2QAJA 4EPXA 4OXXA 1CB7A 1NXWA 2J3EA 3MT8A 2RAUA 3O7MA 3Q5DA 1PTJC 3C6YA 5CNJA 5K2MA 4L74A 4GL2A 5JMTA 3MWDB 3KE8A 4EBFA 5L3SB 5F5LA 1MVNA 1L5QA 2LDBA 3JZDA 2O1XA 3E1KA 1Z6YA 3EBOA 3N0VA 4GZ3A 4LXHA 4QPJC 1EM8A 1O97C 1K8RA 1OFGA 2ZIVB 4IOMA 3JD3A 5J4YA 1Z7EA 2IDZA 1XFAA 1E2QA 2AWOA 1ZH0A 4U2GA 2VQSA 1U0LA 1BWSA 2PRIA 1T10A 1QIJA 2XOXA 4C1BA 2QE7A 4XM1A 4DNFA 4JZKA 5D1HA 5JAZA 2P1ZA 4FNGA 3RS2A 4J0FA 1XNHA 1HG1A 2QRHA 2HN9A 1KQFA 1PJ2A 2AJLI 4H0FA 3KZXA 1TRKA 4AP6A 1CZKA 2QTMA 3OPNA 2ZS8A 2FUKA 1YB7A 3PB3A 4BXOA 1ORHA 4IUDS 4OHOA 1EUYA 1TGYA 5CIQA 4AJ4A 1OBFO 1Y8ZA 3V7FA 4REQB 3V1MA 1A50B 1TUEA 3TGPA 3IESA 2WAMA 1FDVA 1VFPA 1F5SA 2UKDA 1Y81A 2JA1A 1NJ6A 2HQSA 3AHGA 5JISA 4C89A 1R0KA 2BKLA 2HHHB 4MVJM 4PYQA 4DCVA 3SEZA 5IBRA 1ULAA 2FMFA 4TYQA 3H5AA 4GKVA 3TTWA 2EWMA 2ISCA 5KIAA 2CZCA 4UU8A 2HSDA 4OBEA 4YDRA 1HZZC 1IL0A 3V7YA 5B6IA 5AW0A 4AU1A 3VISA 3L6UA 2Q1XA 1MHTA 2I3DA 1C0PA 2FP4A 2R8OA 4PSAA 4XCQA 2FRDA 1KF0A 4FS8A 1DOAA 1YACA 4EFNA 1WPRA 5BN4A 1D04A 2FR8A 4NJEA 2XMZA 4BVEA 2VR1A 5CXQA 5J58A 3DVQX 4F2WA 4IWYA 2ZT6A 1XVAA 2QZ4A 5ALLA 5TQ0A 3T5DA 4MEBA 2JF0A 4FFVA 2RI6A 2BGLA 1XMSA 2LE0A 1JU4A 5IARA 1PWZA 3DMHA 3HB4X 5IAKA 1AIPA 2GRJA 1CVRA 1UZLA 3KQWA 4I4TB 1Y6ZA 1WU8A 2YNMD 3U60B 3HCDA 4P0PB 2QVZX 4NNOA 4F4IA 5LBUA 5EEHA 4B3DA 4EJ6A 3VX4A 4RHYA 2A9QA 3GDOA 5HJEA 5FFFA 4D4LA 1XHFA 4HAOA 1L4FA 3A3KA 5J3JA 1CBUA 2JLAA 2ZUTA 3TAUA 3DZGA 3SSNA 2HK7A 1DBRA 2VDRB 1P2BA 3UWMA 2C61A 4ZQHA 4BX3A 1OZGA 1UIRA 5FPQA 4OIMA 4MWSA 1OZAA 2JAOA 1SMKA 4XQ0A 1V96A 5F35A 1VMAA 1NMXA 1MFZA 2QJTA 2WJWA 4K6CA 4HNGA 5FFMA 4C7MA 5A1JA 3CB2A 5CB4B 2FPUA 2RC5A 2QXYA 5ALJA 1YB5A 4Z54A 3PHJA 4UTRA 1ZONA 2QAGB 3ABOB 2QVCA 2V9PA 4JHXA 3EGVA 3P71T 2XVAA 2XOKA 3U9TA 4JT2A 4ZU6X 3ZLTA 5KYXB 2DEUA 3IIIA 3SICE 3UJAA 3WL7A 1OPR