3H1BA

Crystal structure of este5, was soaked by isopropyl alcohol
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of EstE5, was soaked by organic solvent
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 103
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1bA00
3WL7A 1CUWA 2WIDA 1H22A 1IZ7A 5D3ZA 3D3NA 4V2IA 4EY8A 3WLAA 2CKMA 4N8DA 1FFDA 1QO9A 4LXIA 3C70A 5EIAA 2FX5A 4W1PA 5D7BA 3T4UA 1YAJA 1U2EA 2ACKA 2H7YA 2VEOA 4EHBA 3D5EA 3AIKA 2J3DA 3G0BA 5SYMA 4MQMA 4FDMA 5ALQA 4CIBA 5AM2A 3PDCA 2BUCA 3ZI7A 4O08A 4A23A 1M33A 2O2GA 3F8SA 3FOBA 2QS9A 5AIBA 1TCAA 2WG0A 1AZWA 5CT5A 3IB3A 5ALVA 2RIPA 1QIKA 1NX9A 5FV4A 1VE7A 1LGYA 1EDEA 3HABA 3OOSA 4DGQA 5T4BA 1I6WA 4A5SA 1IUOA 5BWBA 5AKJA 3AFIA 4BTVA 2QJRA 5BWCA 5IH7A 2ZYRA 3R41A 4QNNA 2WG1A 3DOHA 5E4JA 4BDSA 4KE9A 1XRPA 3H18A 4AXBA 5CT4A 4B6GA 3B12A 1ACLA 4G4JA 4B9AA 3WA7A 3AILA 5T4EA 4L72A 5K3DA 3M83A 2CBGA 4H7EA 3C6BA 2ZYSA 3QMVA 2D5LA 2GBCA 3W05A 3I6YA 2WG2A 4DIUA 3OURA 4C88A 3PICA 3F98A 3CN9A 4OYYA 5EHZA 1XLUA 4K2AA 1C7IA 2WIFA 1VOTA 4L3WA 4H7DA 4WY8A 3BXPA 1O6GA 4FKBA 5H3HA 2AXEA 4AX4A 4JH0A 2CB9A 5ALYA 3VDXA 1MT3A 3FYUA 3GUUA 3HI4A 4B80A 3WK5A 1XZKA 4F0JA 4C4YA 4Y2JA 4Q82A 5HZGA 3QMWA 1K6EA 1THGA 2WU4A 4UBLA 4BRZA 4GHWA 1CUXA 1A8SA 1CUIA 2BGRA 4KRXA 2WKWA 1R9MA 1VLQA 2HU7A 4QDTA 4U2DA 3M82A 1B6GA 3FCYA 1H2ZA 3ESBA 4G8DA 4X85A 4MXDA 5ALIA 5ALMA 5LZ2A 2EDCA 2FUKA 3IUQA 4EY7A 4HZGA 3G0DA 1DTEA 3FSGA 5CURA 4BC0A 1BCSA 5JANA 2AJCA 3O4IA 2J4FA 5DJ5A 1ZD4A 1XQVA 1DINA 2ZSHA 4WCVA 5JALA 2XQJA 1CUDA 4IQ4A 1R4ZA 1GKLA 1W75A 4FTWA 2PBLA 2WHQA 4AO7A 4Y2QA 3BIWA 1U4NA 2HIHA 2XUIA 3ZPXA 4W1SA 5A71A 3R0VA 3FLEA 4FHZA 3LIPA 4OSEA 5JAUA 2E3JA 2WJ6A 4LYDA 4UHFA 1NU6A 2NW6A 4UHEA 1MX5A 1QFSA 5EGNA 2VJCA 4AZ0A 2R11A 4BBZA 3R3UA 3BDIA 1FJ2A 3WK4A 2G4LA 2JEYA 5KWJA 4QDUA 4B9EA 1UXOA 1BROA 3H04A 3B5EA 3C6XA 2DFPA 1EXWA 1WHTA 2I3ZA 1MJ5A 5ALJA 1FFEA 4IH4A 1XLWA 1IUPA 1ZGBA 1TIBA 3IUJA 3WL8A 4W1RA 4QLAA 3BE8A 1UKAA 4UBJA 1XLVA 5ALOA 1QIIA 4P9NA 4C4ZA 3RK4A 4G4IA 5HK9A 2XUFA 2ZYHA 2HA0A 3DCNA 1DT5A 2VA9A 3KOOA 4BB0A 1GPNA 2O2HA 4B85A 4Q05A 3AIMA 5I7UA 3RLIA 3SK0A 1N5MA 5A2GA 3HYSA 5AM0A 4QEKA 4OU5A 5ALDA 1GKKA 2I78A 1QO7A 1JKMA 1Q84A 2GZSA 3QMMA 2PVSA 1XROA 2OXEA 4OPMA 2CZQA 4PQEA 4BAUA 2ONCA 4QZVA 4BVKA 3WWPA 3F97A 4ARAA 5A6VA 1RP1A 3G02A 5JZ9A 1WHSA 3WQHA 1HL7A 4G9GA 4J7AA 4Y2YA 5IVHA 4WDRA 2QOEA 3BDVA 2H7XA 4CFSA 1CUCA 3WK8A 1N1MA 5CH8A 3N0TA 4ARBA 3DLTA 5DNVA 4BYMA 4QDZA 4Y2UA 1S8OA 2QZPA 3FYUB 1A7UA 5AOBA 2Z8ZA 4OU4A 4X95A 4DMKA 1JMYA 2WM2A 2HFKA 5AKHA 1X70A 3ILSA 5AHXA 5ALTA 2PSHA 2YASA 4X3CA 4OB6A 1BE0A 1JT2A 1YA8A 2PSDA 2HA7A 4DSZA 1B41A 5ALEA 2BFNA 3ANSA 5C8VA 1LPSA 2JBWA 1T4MA 4KR0A 4UHBA 3WZMA 2OCGA 3WJ1A 3S8YA 2XUHA 4H7JA 1XQWA 4HVTA 4PSUA 2UZ0A 3ESDA 2DR0A 1GQRA 2RAUA 4CG3A 3TEJA 6YASA 4HAIA 1J06A 3WWEA 1J07A 5ALKA 3H2HA 2WFMA 1XZCA 5AO9A 1OXMA 1RYYA 3BIXA 3VJMA 4QDXA 3C5WP 3IUMA 4LXHA 3W06A 3ESAA 3HC7A 2Z3WA 2JIDA 4K5QA 3DDUA 1EB9A 1JFRA 2VQ6A 2BUBA 3VXKA 3NOXA 4BAGA 3KWJA 4XX1A 1EINA 3H2JA 2XUDA 5KBYA 4JYMA 4X6XA 2YH2A 1UK6A 1A88A 4Y2PA 4LXGA 3OM8A 3WJ2A 1EX9A 2WSLA 4BP8A 4BZZA 5DYYA 2DCMA 2G5TA 4MWTA 2FJPA 2QXTA 3AJAA 3VVLA 3NUZA 2X5XA 3CXUA 3TRDA 5JARA 4H7HA 1QIDA 2GZRA 4UBIA 4ZRDA 2DQZA 4LHEA 4BVLA 3GELA 2VATA 4PSDA 4Z49A 1CUHA 1XZEA 3E3AA 3I2KA 3O4GA 2JEZA 1CUAA 2RONA 4JEIA 4H0CA 3NGMA 2BKLA 3FWHA 4KYVA 4EB0A 4G4GA 5JATA 1TKRA 1DWQA 1W4LA 1WB6A 3HEAA 3V1MA 1SCKA 1Y37A 4HRXA 3D2AA 1KEZA 1MO2A 1CEXA 3C43A 3I2JA 1EA5A 1GT6A 1TRHA 2Y1KA 5AK3A 3WL6A 3AINA 3HLKA 5AKZA 4GWLA 3NWOA 1DX4A 1K5PA 2CUTA 5JZBA 3EIOA 1MX1A 4QA9A 5LZ8A 1HQDA 2I3DA 2XUQA 2OCKA 3BWXA 3WZLA 3STTA 3BF8A 5ALSA 5K3EA 3WL5A 1QIMA 1GGVA 4INZA 3FSGD 3R3ZA 3V1KA 4FFVA 1AMNA 4B0PA 3ANTA 5A7FA 4X97A 2ZSIA 1WPXA 2HL6A 5BOVA 2X76A 2WIKA 3IA2A 1QIEA 2OGSA 4CI9A 1CIJA 3WK7A 1OILA 3RM3A 4X6YA 1BN6A 2WU3A 2PU5A 1R9NA 1XRNA 2XUAA 2H7CA 1E8MA 4MEAA 4U2CA 3I1IA 5AKEA 5FLKA 4IH9A 4NMWA 1CUGA 4TPKA 1SFRA 4DLNA 1UOQA 1LPMA 2Y6VA 1C4XA 3HACA 5ALUA 1A8QA 4G9EA 3QH4A 2QR5A 4BDTA 1THTA 4UBNA 2RI6A 3DL7A 1QONA 4HXEB 2DHEA 4RE6A 5JD4A 5K3CA 1X2EA 2HA3A 3EQ9A 4Q3LA 5AI0A 3WKDA 5FUMA 1H23A 3I1YA 2ECFA 3I6ZA 4X00A 3PF8A 4FBMA 2EEPA 2RHTA 3DQZA 2D0DA 2HADA 2G5PA 5AI8A 4M0EA 1KU0A 4DYHA 3ZLTA 5CH5A 3FYUC 2ZJ7A 4KAAA 4UFOA 4BZWA 2YYSA 1CUSA 1YB6A 1CUUA 4EY5A 4XIIA 5ALPA 3V1LA 3MVEA 3I2HA 4MJ3A 4AMZA 3KDAA 3V1NA 5JAOA 3IBTA 3O95A 1ZI8A 3U0VA 1SCQA 3EQ8A 4Y2VA 3QITA 3C45A 1MTZA 2HA5A 5AM3A 5CH3A 1EI9A 1WM1A 1JI3A 3I2IA 4PNZA 2WFLA 3G9XA 4DMCA 1MAAA 2BJHA 3LIIA 1HKHA 5FPQA 2AJ8A 5EHXA 3W9BA 7YASA 3E0XA 5HKBA 1XZDA 4FLEA 2VSQA 1E8NA 1ZD5A 1QZ3A 2W22A 5I8PA 1TAHA 1XZIA 3UMJA 1ISPA 1ZIXA 3D59A 4C89A 4OCZA 1AQLA 3D0KA 1P0PA 1Q83A 1H2YA 2DHCA 5JAPA 4I3FA 1QE3A 3H2GA 3C87A 5SYNA 2HA2A 1DQYA 4B82A 3G8YA 4G8BA 5AK6A 4RPCA 5HF5A 1MPXA 2VAVA 1JU4A 1SCIA 5BV7A 4DNPA 5D6OA 2HRQA 1PV1A 3DD5A 5JAHA 4NVRA 2QMQA 4I4CA 1DWPA 3VVMA 1ZD2P 1U65A 2QKYA 5CT8A 3PI6A 1IZ8A 2ZVDA 2O2IA 3ED1A 2R8BA 4UUQA 4J03A 1CVLA 5CTAA 5CRIA 4DMFA 3AIOA 2H9YA 1MNAA 2XQKA 3WKEA 2PL5A 1QJ4A 1QTRA 4E14A 2X8BA 4W9RA 3CCCA 3P2MA 2XDWA 5J3JA 4ROTA 5A62A 3N2ZB 2PSEA 2WTMA 2OGTA 2ES4A 1LPOA 1UOPA 4M0MA 3SWWA 3L1JA 3OG9A 1UFOA 4J3JA 2XMBA 4U2BA 1EDBA 4CG1A 3A2NA 5DYWA 3WMRA 3ZLUA 4MYDA 4UFNA 1QGED 1K4YA 1LPPA 3FLAA 3O4JA 4BE4A 5ALLA 3M81A 3Q8WA 3I28A 5ALRA 4D9JA 2WJ3A 3IUNA 2OQVA 4YX9A 4MWSA 4BCDA 1DX6A 1CUFA 3QYJA 1XZGA 5LKRA 4U2GA 1DU4A 3VJKA 5HQ3B 1IUNA 5JYCA 1CQWA 2BUAA 1ZD3A 4IHAA 1ACJA 4K6HA 4X94A 2HU8A 2XUPA 3H19A 4KE7A 1F8UA 4WDQA 2OQIA 5AKGA 1FSSA 1RWQA 1XZBA 1YASA 1XFDA 3MUOA 5K3BA 4DMHA 3H0CA 4KRYA 3KSRA 2QRUA 3EF3A 1XKLA 4XJVA 1BN7A 1H2XA 4HTAA 3G0GA 2WHPB 3O0DA 4PV7A 4LKOA 1AGYA 4ETWA 5DTJA 3FYTA 4CCYA 2IX9A 5LZ7A 5JASA 1H2WA 1BRTA 1BS9A 5AH0A 3IIIA 3MUNA 1KU6A 3ZLVA 1VZ2A 2JGMA 3G7NA 1EK2A 2AJBA 3GZJA 4FNMA 5FOQA 5LKAA 3BJMA 3QPDA 2B61A 3R40A 1IVYA 3DKKA 4GBGA 3RKSA 2WUFA 3O9MA 3DEAA 5DNUA 5DLPA 1QIJA 3JYHA 2WILA 2VTVA 3D4LA 1BCRA 1TCCA 1PJAA 2I03A 1F0NA 4FLMA 1CR6A 4TGLA 4EY4A 1T2NA 2OPHA 4XVCA 1VZ3A 2C0QA 3ZWQA 5EHNA 5AIAA 3TGLA 2VT6A 4DNFA 1JJBA 2ROQA 5AP9A 4OUKX 3DOIA 1ZI6A 1R88A 1E89A 3ICVA 1XZHA 2C4HA 3QZUA 4RE5A 1F6WA 3A6ZA 1XZJA 5HF9A 5IVIA 1L7RA 4GEGA 2VT7A 4AB1A 1CUYA 4AO6A 4N5HX 3E4DA 4X93A 3H2IA 5KWIA 1WCYA 2P8SA 1XQXA 2QXUA 2J4CA 5HKAA 5LP1A 3D2BA 3VISA 3AUKA 3W2TA 4JNCA 1VXRA 3FNBA 2Z8XA 3M3DA 3V9AA 2Z3ZA 1EB8A 5EHQA 4BTLA 3I6MA 3HJUA 2WHPA 5ALZA 2EDAA 2HA6A 5ALXA 5AICA 5IKXA 4QE3A 4J0KA 4B81A 2J3QA 3FAKA 5LIPA 1CUJA 1YB7A 4X92A 4Q1VA 4I19A 2W6CX 1WOMA 4B0OA 1W76A 1N8SA 1ZIYA 2HDWA 5AKLA 5CBKA 5CXUA 4LYEA 4FMPA 1CUZA 5LLSA 2OGZA 3VJLA 4BE9A 4DTCA 1Q0RA 1XZLA 5HCUA 4G8CA 3QPAA 2VJDA 2YXPX 3RARA 1VA4A 4H7FA 3STVA 1ODCA 4HRYA 5FPPA 5T4HA 2Q0XA 5HFNA 3TJMA 1EVQA 1XRQA 1D07A 2QM0A 1F0PA 1QTIA 1GPKA 2PUJA 1XRMA 4YPVA 4PW0A 5LZ4A 1ETHA 3WIBA 1G42A 4GW3A 4AN1A 1MU0A 3LCRA 2C0PA 3IULA 4NS4A 5DNWA 2WUEA 3V48A 4J0IA 2Y2VA 5AJHA 1G4HA 2IITA 1ODSA 4Y9SA 3WWOA 3DJYA 1DWOA 3KWFA 1WB4A 3C5VA 1GQSA 4X7BA 5A7HA 2PSJA 5AI4A 2C5GA 3G9ZA 4F21A 3WK9A 4YK7A 2VJBA 2GBFA 2XMRA 2WFZA 4C6HA 2WJ4A 3WYNA 4HXFB 3C6YA 2PUHA 1LBSA 1LPNA 3ICWA 2XLBA 2G63A 1YCDA 2JGFA 1ZOIA 1CFJA 2B4KA 3O4HA 1TK3A 5AKIA 1FFAA 2VAXA 1MNQA 3T52A 5D3KA 4AMYA 3HXKA 4YASA 1R1DA 5C8ZA 1HDEA 3KD2A 3R3XA 4GLBA 4N8EA 4J0DA 5K3FA 4H35A 2LIPA 4QWWA 5AI6A 4FBLA 3LLCA 5DWDA 3LS2A 1ZJ4A 2JGLA 2XMSA 2JGIA 1O6FA 4K6KA 1J2EA 1W1IA 2ORYA 4E11A 1CUBA 3DKRA 4MYSA 4WY5A 4X91A 1AUOA 4GXNA 2DHDA 2HM7A 3W9UA 3R3VA 2Y2UA 1Y7IA 3STYA 1UK9A 2QUAA 2AJLI 3YASA 1PFQA 5JADA 5E2IA 4ZV7A 4UHHA 2BGNA 1R50A 3BF7A 4UFPA 4EUSA 2XQIA 3SC2A 2OCLA 2DSNA 5K3AA 2WIJA 5LZ9A 4UBKA 4N8SA 5JZSA 2XE4A 1VKHA 3QPCA 3K9BA 2AJDA 3U1TA 2JGKA 5E4TA 5LZ5A 5AM5A 5AK5A 5ALNA 4BRSA 3R3WA 4WFJA 2XMZA 1P0IA 3G9UA 1LNSA 1VE6A 4F5ZA 1CV2A 3OTQA 1G5FA 4C4XA 1GZ7A 4S0XA 3EQ7A 4MQLA 4FLFA 4PO3X 3WKCA 4J0HA 3CN7A 1YS1X 4L9AA 4C01A 1ODTC 1LZLA 4EY6A 3GA7A 2WUDA 4JYPA 3GFFA 4OD0A 4ZXFA 3G9TA 2HU5A 2XMDA 4OB7A 3QVMA 4DNQA 5DTIA 4KAJA 1QIFA 4Y7DA 4RNCA 1A8UA 2Z5GA 2HHAA 1P0QA 2GYWA 2ACEA 2H1IA 1U8EA 2O7RA 2ZJ6A 1WB5A 4CIAA 2JF0A 5AKXA 3C8HA 1UKCA 4PF1A 4H7IA 3IDAA 4H7KA 1AC5A 2OAEA 4ZGBA 4LIPD 3STUA 4E46A 3GBSA 4BVJA 2DQYA 1UWCA 1JMKC 3FCXA 1NU8A 4FNGA 1BEZA 3G0IA 1L7QA 2OLEA 2B20A 3UUEA 3WKAA 1MAHA 5EI5A 1BU8A 4UBMA 3LP5A 2XI4A 2HRRA 2BAGA 4NZZA 1VA5A 5CMLA 1ZJ5A 4K6GA 3A2LA 1G66A 1YS2X 2GYVA 4UBOA 2FJ0A 3STXA 2WLSA 5AI5A 4RGYA 1E5TA 1XZFA 3PE6A 2PPLA 5AOAA 1YR2A 4ITVA 5AKYA 4CCWA 4DM7A 3BL8A 1EHYA 1W52X 2PKYX 4OYLA 1CQZA 3C6ZA 4ZWNA 2RGUA 3QBJA 4BP9A 1X2BA 5KREA 2XB6A 3AZQA 5I9IA 4BATA 4WJLA 1XRRA 1Z68A 1K8QA 3WKBA 5HFAA 2CMFA 1TQHA 3DYIA 4KE6A 2PU7A 3WK6A 4HS9A 2BCEA 2Y6UA 2JGJA 3L1HA 1AX9A 1QIHA 5EFZA 3AZOA 2XT0A 4H18A 5ALHA 1UZAA 5ALFA 5E4YA 2WHRA 2XUGA 4Y2TA 4BCBA 3I2GA 1MX9A 5F4ZA 5AOCA 5AM4A 1CLEA 4PSCA 5FDFA 5A7GA 4A16A 3Q0TA 3F9CA 3KXPA 2WUGA 1XKTA 2ZJFA 5FKJA 2GYUA 2VF2A 2QUBA 3FVRA 1EVEA 3C8DA 5AK4A 3WYDA 3F67A 4AN0A 3ESCA 1LPBB 4DSAA 1AKNA 4MEBA 4FFWA 3S2ZA 1EK1A 1JU3A 4C87A 3WWDA 2B9VA 4Y2RA 3FVTA 4P08A 3WI7A 2PM8A 2CJPA 2VJAA 1JJFA 1R3DA 4WFIA 4BC1A 2QVBA 1MN6A 3DL4A 5ESRA 1P0MA 1XZAA 5FRDA 5AKKA 4AO8A 3PUHA 5C8XA 4U2FA 4OB8A 4TVKA 4N5IX 4EZIA 4M0FA 1LBTA 5T4FA 2XLCA 1J1IA 4BAZA 1IMJA 3B3QA 1CRLA 1ZGCA 3CCBA 4AZ3A 2PX6A 2PSFA 5EIHA 3VKFA 5FXMA 2C5FA 1UK7A 3OPMA 4Q34A 3JW8A 4J0CA 4BCCA 4UHDA 4GECA 2V9ZA 2V96A 4G5XA 4G1FA 2XQFA 1C7JA 5LYYA 3H17A 3DYVA 3IVMA 3HZOA 3X3HA 4IH1A 1QIGA 1CPYA 2OG1A 5CT9A 5CW2A 2XUJA 3AZPA 1AURA 3BJRA 3UUFA 3F96A 5ISMA 1XZMA 2ZYIA 1ORVA 3PFCA 4B7ZA 4UHCA 3D7RA 3PFBA 5IVKA 2XMQA 3H2KA 4WFKA 5ALWA 1JJIA 1LZKA 4KACA 3EBLA 1YA4A 1WPRA 3JWEA 3O9VA 5C81A 5EIEA 2XUOA 3HSSA 4Y2XA 5CXXA 4CG2A 1UK8A 1L7AA 3H1AA 4B83A 3QM1A 3K2IA 2XQGA 2HA4A 4KAFA 3OC0A 1HPLA 3FLBA 2QJWA 4KJXA 1W6RA 1VXOA 1E66A 5K5EA 4QWMA 4GDMA 3W04A 2WIGA 4X71A 3A70A 4KE8A 2WTNA 2XMCA 3MGAA 4W1QA 4GI1A 1HBJA 2V98A 1UKBA 1LPAB 4H77A 1Y7HA 4P92A 2IIVA 2WFLB 5HF6A 5IVDA 1EH5A 4B84A 4HXGA 4FOLA 3G0CA 4J0JA 5JD5A 1LLFA 1QOZA 2C7BA 1FFCA 5AM1A 4EA6A 2OCIA 2O7VA 4Q3OA 4F60A 5HQ3A 3STWA 4UPDA 4J0GA 4FWBA 3H1BA 1CUVA 5HF8A 1Q0ZA 4DNOA 2K2QB 4QDOA 3SX4A 4Q3KA 1SOMA 1EDDA 4P93A 3K6KA 2XUKA 2WQZA 1TCBA 3I2FA 4ZI5A 5YASA 1UOOA 3DS8A 5JD6A 4X6UA 1ZI9A 3GROA 1DQZA 2V97A 1ORWA 1N5RA 1FFBA 1CUEA 2HFJA 3WWCA 1XRLA 1OCEA 4Y2SA 3WA6A 2OAGA 2RHWA 2C58A 1QLWA 1HLGA 4ZV9A 4U2EA 3E1GA 1BEEA 4ZREA 3ZV7A 3IURA 1YAHA 4CCYB 4L0CA 2JGEA 3D2CA 1VJ5A 4E15A 1SC9A 2GBGA 4AQDA 3A2MA 3DNMA 1QFMA 5JIBA 2QT9A 2QTBA 3WIOA 2CEKA 3FBWA 2GBIA 4IO0A 5CT6A 4QLOA 1GPLA 5AI9A 1K63A 1E3QA 1ZICA 1UT6A 3R3YA 1USWA 1DT3A 4EBBA 4X90A 2XMGA 1XQYA 3PUIA 3PF9A 4W63A 5FP0A 3L1IA 4KEAA 5C7YA 4XWGA 4JUIA 1YSCA 1E8DA 5HK8A 5DYTA 1GXSA 5K3FB 3HRHA 5ALGA
chains in the Genus database with same CATH superfamily
2YYAA 3O73A 1I9CA 3IPCA 3EZXA 5DMHA 3VYWA 1BSVA 1T8WA 1IZ7A 1SU8A 3F9IA 3KHSA 4UDXX 5D3ZA 3HUUA 2R5WA 5TF4A 1RHMA 3N86A 4QOHA 3TIGA 4EY8A 1Z16A 3QVGB 4WZAE 4O3MA 4NECA 4IFTA 4IJVA 2FAXA 2H3EA 3N8NA 4KWHA 4WN3A 5AW5A 2N1BA 4QDKA 1NZFA 1S3SA 1BMFA 3BM5A 4BJ6A 3OOWA 1MW8X 1YZNA 1PBTA 4AFNA 3ZY2A 3LDAA 1KS2A 3AIKA 3DLPX 3Q15C 5FJJA 4K86A 1IHYA 3FJOA 1QJCA 3G0BA 2NO7A 3KYJB 1CCWA 3NAQA 2AN5A 2A5LA 2IHZA 3KOWA 4FDMA 2Q2WA 5P21A 4DLZA 2KHZA 3VR1A 1DTWB 3U44A 1F8FA 1NHGA 1F06A 2AK2A 1M1NA 3PDCA 1G60A 2BUCA 2V3WA 4I4LA 4DJEC 5KYWB 1AB5A 2DQKA 3I0ZA 3T7KA 5GV7A 4FMDF 1RWNA 1HKUA 1OFUA 4EO7A 2VDVE 4AJ9A 1REQB 4YRIA 2H4WA 2QTHA 4Y6LA 2EF0A 2R62A 1EGVB 2Z09A 2H2IA 3HVJA 4RPGA 5EWMA 5L7TA 3CX4A 3OWHA 4JLDA 1USIA 3FGZA 3ND6A 4MWOA 5DYIA 2FB9A 2QK4A 4II7A 4ZVVA 1ICEA 1TA9A 1TD1A 3QVJA 1PV4A 2APJA 1ZHFA 2RIPA 3L92A 4M0CA 3WP1B 4E5KA 2MMGA 3KSDO 4TS4A 4ZVSA 3SHWA 3GAZA 2VDQB 2BI4A 3FPAA 5CHYA 4F97A 2VTBB 5FV4A 2VK1A 4FYWA 1KSGA 2XTMA 3D0OA 2VWHA 2W90A 4GUAA 4M6WB 4P4SB 2XZPA 4CMEA 3AKZA 1ZEMA 1KJWA 2OHXA 4PWYA 4QUHA 4R41A 3U3ZA 2H5IA 4YV2A 3OOSA 1WEHA 4R1OA 3H6GA 3MQFA 2IEAA 2Z9CA 3T7RA 4D0RA 6LDHA 4DGQA 5BVHA 1M74A 4YMLA 1AUXA 4M1YA 5T4BA 2G04A 1N25A 1JALA 1I6WA 2GBPA 3OLXA 2Z57A 1AQIA 1IUOA 5BWBA 4FDVA 1YTUA 1N7HA 2AD5A 5AKJA 4N3AA 4MWDA 1U9JA 1UR5A 3LDGA 3H1PA 5T64A 1HI9A 3EJWA 4INOA 5BWCA 5IH7A 1YI8A 4WW0A 1F7VA 4GMFA 3KZXA 4Q37A 3ZQ4A 5ANRB 2VQEB 4P4TA 2C9MA 2I5PO 1L4YA 3TAXA 2E82A 2WA1A 4DV4B 1HX7A 3P71T 2WG1A 1KJNA 2ZB2A 3JQRA 1U2PA 2M32A 1SZJG 2CF5A 2GD6A 3OE4A 1GGMA 3DWEX 4AY6A 3E82A 3JY6A 1H2EA 1Z36A 4B47A 2JFYA 1JHYA 1FX0B 1BHQ1 3JQ7B 2R48A 4N82A 2PNJA 3RBZA 4C0LA 3QLVC 4O4LB 2BSXA 1T2VA 3S99A 5LP6C 1PW7A 3LK6A 2HNBA 2OHFA 4B6GA 5JZMA 1G3UA 4Z1MA 1DV2A 5TMPA 3LHSA 4B9AA 4C04A 1VRCA 2NQ8A 1V71A 1XA4A 5FLEX 4JUCA 5E6SA 3PUKA 5DHQA 3JVUA 2NU7B 3VM6A 2A1IA 1KQ3A 3PSHA 2YN2A 2ZXUA 4IHJB 3BWEA 1T5DX 3H5WA 4AYTA 4F2GA 2D5LA 3HYRA 5KTSA 2QTWB 1QS0B 4G5FA 2CWWA 2UVPB 5FX2A 2DBVO 1P1BA 1LI7A 1GARA 2C20A 5IC6A 4U1RA 1LFDB 3OU2A 3GHYA 5E6RB 4INPA 4QRHA 3HU5A 4X5OA 3EIQA 1V11B 2XBLA 2Q07A 2YY7A 3CN9A 4OYYA 4Q4LA 3IMGA 2Q4BA 4FBGA 4EL0A 5CB4F 3OOHA 4QBHA 5CDGA 1X7XA 1V5GA 2QW8A 3PFGA 4JT9A 4LA4A 3H6KA 1JFFA 1L4GA 1DMSA 1A95A 2FPUA 2P35A 4DLBA 2WIFA 4KQXA 4MAFA 3K73O 4DN6A 1VOTA 3PTZA 5ARBA 1I8TA 2IWRA 1BZYA 1O3YA 3V6MA 5AW9A 4B09A 1NBMD 1O6GA 2AYZA 1PJQA 1PNTA 1TVKB 4RTMA 4GPEA 1R10A 5H3HA 3RK1A 1LS1A 5DU2A 2C5HA 1K4MA 1OROA 2QTVB 3NAMA 3SHTA 4Q4DA 3VVBA 1RQPA 2YMQA 4JT4A 4PSAA 3UK6A 1RKVA 2XA9A 3ST7A 1R9JA 2FFQA 4LHVA 4D42A 4E22A 5IWAB 3I01A 1HZZC 2WWXA 3FA2A 4MKGA 3F7TA 2QUHA 3A27A 3A4NA 1M7HA 4GLOA 2RHLA 4HAOA 3UMSA 2OLJA 1AKVA 4KVAA 3HI4A 4R2WA 2OORC 3PUYA 3MGKA 4FYXA 1DCMA 3NEPX 1XZKA 1HTWA 3N58A 1V48A 3AWDA 3KQYA 4W4TA 4PLHA 4C4YA 4DABA 4EKEA 1P7ZA 1TFRA 2EAUA 2JAXA 1ODKA 2Q50A 3L41A 3L0ZA 3CZ4A 4RMNA 4Y2JA 4Q82A 1ONSA 3BOSA 5EMJA 1DEHA 4RD2A 1L8QA 5FUVA 5HZGA 1THGA 2WT8A 4ECAA 1RJ9B 2BVNA 4COOA 4N65A 4QOIA 5A04A 4ZYLA 3WNQA 4BRZA 1T5SA 5K0NA 5F4BA 1KKLA 1CF2O 4PPYA 4Y6OA 2PGLA 2BGRA 3NGLA 4KRXA 2NUTB 3UB2A 1Z2EA 4C4TA 4XWOA 1FLVA 1VLQA 4EABA 4B3SB 2P4QA 1ZUWA 13PKA 3UB4A 5I01A 4GDFA 1ISGA 3B1YA 2XD4A 2TMYA 3QE3A 4LVOA 4AF6A 1RI4A 1FPMA 4S35A 5G40A 1QV9A 5D5HA 3L79A 3ESBA 2MR6A 1EJBA 4C7JA 2ZB8A 8ATCA 2IYNA 2RJ3A 4MB0A 2WSSD 2FF7A 3PD7A 4REQA 3RSSA 2QTAA 5CFOA 3N2YA 2F2TA 3V4SA 2I7DA 2EHDA 3DZHA 2AXQA 2AH5A 3E3OA 4BB9A 4EY7A 1OXXK 2ATXA 2B3TA 3L7AA 3KTOA 4DSTA 3FSGA 3LY7A 5CURA 1V39A 5HDBB 1G4UR 2IIQA 5JANA 2QMUA 5A6SB 2DERA 3RSQA 3TM4A 4E4YA 5AVKA 3E22A 1CHDA 5DJ5A 2OPBA 3SQXA 5FEMA 3KQNA 4XCXA 1DINA 4WCVA 4G5RA 5IH3A 5C5EA 5K3OA 3VYRB 5I4BA 5FI0B 4YECA 4IQ4A 2AR7A 5BOSB 2SBTA 3M83A 1Q21A 4DJJA 1H4SA 3ENWA 4PC6A 3Q8XB 5GJVC 1W75A 3ER6A 1NW4A 2IYYA 1WZIA 1I2CA 3NTXA 2AQIA 1K0UA 3EOAI 3ZD9A 1R0XA 4X44A 4P0QB 1TAGA 1Q7GA 3G5AA 2ZWOA 3U7RA 4GT1A 4H17A 2P9YA 4MUEA 4PZEA 4A5OA 3KQMA 2ILTA 5BSUA 1I30A 1X7XB 3EIFA 3IEPA 4HI0E 3ZCVA 8LDHA 2ZIXB 4ZQFA 2B25A 4QM6A 1FE8A 4QYIB 1W8DA 1YZKA 4G0QA 1O8BA 4P3PA 5EN4A 5A71A 1JTFA 3WGQA 4D9KA 2F4VB 3LI2A 3V46A 4PG5A 3VU8A 4CF5A 2G08A 3DDWA 1JKFA 4FHZA 4OSEA 3RUDA 1XJQA 2WJ6A 1I2BA 3TTWA 1QKJA 3ON5A 3EX7C 3FD8A 5F51A 4UHFA 1JB1A 2MDTA 3DZDA 4QIHA 3RIEA 4CLOA 1SBIA 1L8LA 2UYHA 4O8CA 4B3RB 4DQVA 4RDCA 3H9CA 1VJGA 4AZ0A 3HJBA 4GMDA 1LDNA 1E2FA 3R3UA 2OILA 2ZJYA 1KFBB 2GB4A 2P62A 2IY8A 1W88B 5JEDA 2JEYA 5JJKA 2F62A 3WLOA 1CB0A 4BVHA 4KMSA 3M7IA 3KAKA 5H8WA 4ZDKA 1EXNA 4B9EA 1ZJYA 1UXOA 2FY8A 3LC7O 2VXOA 4RH3A 1QRSA 2CE7A 3IH5A 5ICEA 2X7JA 1J8FA 1II0A 4XIGS 2R7NA 4GRAA 2EQ5A 5KVAA 3PCXA 3F74A 3ONEA 1TU0A 1FMFA 1GSIA 2ZE7A 4GNKA 2I3ZA 2CBXA 3NHSA 1CY1A 2W6JD 1MJ5A 3DUFB 1V1JA 4Q3EA 4BNGA 3WJ7A 5C0OE 1Y5RA 3LAWA 1XLWA 2Q1SA 2DUNA 4IH4A 3TOZA 4EYKA 3KV1A 5DBFA 4D9MA 4CLEA 2QN3A 1HA3A 1KJZA 1Q20A 2A0XA 1JR3D 2FFAA 1AQ6A 1NURA 2J7KA 3IUJA 2HDNB 1BJKA 5EZQA 5KNDA 3N2IA 1N0IA 3GG2A 2I55A 3QU4A 5KCZA 1TJ3A 2XXAB 3DNPA 3T61A 3OX2A 3A1UA 5DASA 1XJWA 2AIRA 2R8RA 1KAGA 3T1TA 3B1XA 1EESA 5BVHB 3GNQA 4ZI7F 3AVTA 2IS6A 1A9TA 2BGUA 2FW1A 4MI9A 4C4ZA 1XEXB 1K08A 5DI3A 1K75A 4G4IA 3WGLA 4F11A 1O96B 1UBSB 1ZH0A 2HA0A 1FJGB 4N0EA 1E2QA 3UENA 4TMWA 1P2GA 2IU4A 4TQ9A 3KOOA 3AFHA 4GS5A 1QF7A 1A04A 2LWIA 2ZSKA 1OAKA 3TAHA 2E55A 3E27A 5FPYA 4B85A 1G1AA 3T5AA 2Z9DA 3SS8A 5TVKA 4Z9XA 4FHCA 1J00A 4Q3BA 1Z4NA 4W6ZA 4QT0A 1X1RA 4JASB 5G3ZA 1N5MA 1R4NA 1TUEA 3V7UA 5I8PA 1Q22A 1YIOA 5AM0A 1T26A 4J07A 3BGVA 3BH0A 1FP7A 2AOXA 2YMPA 3SJCA 4BO9A 2YXLA 1FB5A 1UBKS 3SHVA 5BV0A 2YWDA 1U0OC 1XROA 2QD2A 3M2TA 1AKQA 5BNFA 2CLMB 1THZA 4JITA 3CBGA 3TR6A 5KB3A 4BAUA 2GXAA 5JJCA 1Q0HA 1V2GA 2G17A 1RI1A 2JI6A 3DAHA 2Y1CA 1OX5A 3KB8A 5K0LA 2PNFA 2OV8A 2VCHA 3E0QA 4M1ZA 4R1PA 1ZOOA 5A6VA 1VIDA 1RP1A 5I5GA 1DRJA 1EWRA 3W90A 4AS1A 3RVSA 3G02A 4HEQA 2PGIA 4DCJA 4CEJB 3G8AA 1HL7A 3MTAA 4G9GA 4C2AA 1WPGA 4ZVNA 3S5JA 2YX1A 3HP7A 4FZRA 3DUWA 1OB5A 3MMPA 3ROTA 4LJLA 1O77A 3LWBA 1Z0IA 4DA7A 1ADFA 3F5FA 3NASA 3R5KA 3H86A 2JCSA 1WDLA 4MITA 1XPUA 4QARA 3ZHUA 3TQRA 3RADC 2QOEA 5EE9A 4EG1A 3N53A 5JECA 3MYYA 3HFJA 1NLMA 4ZVUA 1O94D 1R37A 4IGFA 5KVVA 4U7JA 5CYFA 3CV3A 4UW9A 2R79A 4YV0A 2VG8A 5BW6B 4K26A 5KWSA 3F0TA 1N1MA 1X8JA 3C3YA 1VL6A 3EOBI 3N0TA 3L05A 2XF2A 3MJTA 4DCMA 2DKFA 3DLTA 2C8JA 1KDZA 4QGAA 2Q4RA 4AG3A 3GJQA 3KQPA 1ANKA 4C29A 4WA8A 2A0KA 1NJSA 2HJVA 4FZVA 3WO1A 1T5HX 3L01A 4UVDA 2RAVA 4IS2A 3EY4A 4NQZA 3KXIA 4XM0A 2FCRA 3F3SA 2QZPA 3PC8A 3B2NA 1JDUA 1WKVA 2AFIE 3VAZA 3NVKI 1DAEA 3DKIA 1RXYA 2PK3A 3ID6C 2Z8ZA 2ZKIA 4U02A 5F73A 3EA0A 1JMYA 4XGKA 2O8EA 3GP8A 2WM3A 1ABBA 3DE7X 5D8DA 1PS0A 4DT1A 4M0DA 2QZ4A 4NZMA 1WDTA 1QCDA 2B5OA 3MS2A 2GJKA 4X3CA 4BV3A 4IOMA 5B3AA 3RVRA 1ES9A 3P9KA 1GNTA 2J6BA 1BE0A 3RTDA 1EE1A 2G09A 3AMVA 2QZSA 2X0IA 2JIRA 2DCUA 3WYGA 4DSZA 1D4OA 2BF7A 4W99A 3UA4A 2JJ2A 5ALEA 3V33A 1JB9A 1E69A 2BFNA 2QQGA 1HE1C 2N46A 5C8VA 1T36A 5HKOA 1CSEE 1PZFA 2GN2A 3WZMA 4S04A 3I01M 3ZUGA 1NVMB 3WJ1A 1KYVA 5FULA 3WL4A 1LVHA 3BA1A 1JV2B 3IALA 5HFJA 2CXQA 3GH3A 3W78A 4EECA 2QTVA 1A0OA 2CDAA 1AZLA 3B3AA 3PX3A 1VKJA 1HG1A 4CG3A 1HDOA 3CVYA 3R7AA 2GK7A 3A0UA 1G6KA 3AF5A 2LGJA 2FN4A 3NHFA 6YASA 2D3TA 2QQ0A 3OCJA 2HRDA 3FZNA 4IIJA 1CF9A 3KG2A 4G5GA 2Z2IA 2WFMA 1R0RE 1XZCA 1ZXLA 2J6HA 3KKZA 5KHOC 3OSZA 1S2GA 1F14A 2AG1A 3GK3A 4ZYUA 2BGGA 1GRQA 1KFKB 3EGXA 2VPTA 3BDAA 4IEFB 4EUHA 1K6JA 3DCYA 5ITZB 2HHLA 3BIXA 1P33A 3VJMA 3M49A 1KC3A 2L82A 3DO5A 1O97C 3E6AA 4LXHA 4MI3A 1KZ1A 2ZUSA 3PGKA 3MTIA 3W06A 4LJ9A 3S1SA 1URPA 4LS3A 3CUSA 3R5JA 3ESAA 2JAUA 4GBED 4X41A 5EPEA 1R5JA 2FFRA 2Z3WA 2VDJA 4FYMA 3TW0A 3MWFA 4K7JA 1JWBB 4BYGA 1CY7A 3QXXA 3TXXA 4ZI3A 1JLKA 2FOLA 1XEFA 3WL3A 3HY4A 5GONF 1NW6A 1Y98A 4YCAA 3GZ4A 1OD6A 4WLOA 1RLJA 2QTRA 5JRZA 3VXKA 1NAHA 1LW6E 2ZI3A 1GPAA 2ZJ3A 4JIGA 4Y1RB 5KBYA 3DE4X 2D5CA 3VHRA 1WY5A 1LK7A 1JQAA 1A88A 3L6DA 4J75A 3PNQA 4OHOA 3U7JA 2OMEA 3OM8A 3ET4A 4LXGA 2K7FA 2FEPA 2Q8NA 4WBSA 2R6JA 2VS1A 3KDSE 1EX9A 5BN3B 5H83A 4UDYX 5G1OA 3K8YA 1MMFB 4BZZA 1WXGA 3WLKX 1KETA 2DCMA 4G67A 4XYLA 1E4YA 4M1EA 2PLWA 3H42B 3VVLA 1DXHA 2PD4A 4BMSA 3AXSA 3JD1A 3P5BA 1M1NB 2FFBA 3A1FA 2GF9A 2BTEA 3GCXA 2BTOA 2FMHA 5B12A 5JARA 4MGIR 4A91A 1ULBA 4EMUA 3P0IA 2BP7B 4R8LA 3UFBA 2BGWA 1QIDA 1Z5NA 2GZRA 3INGA 4NBTA 4PR3A 2CLKB 3BCRA 1ZOLA 3T5BA 1M2WA 4BVLA 1NQOA 1QYIA 1WCWA 1SPXA 2B37A 2DQSA 3GELA 3LPAA 3PU6A 3PWZA 4LE0A 2FMUA 3GQBA 4PSDA 3SQLA 3O4GA 4OLAA 3WDSA 1EHCA 2ZJOA 3K70D 2ZUVA 3T54A 1YXMA 1KKMA 1Z82A 3W3AH 4ETIA 1NNSA 1WF3A 4O4HF 2WE8A 1FJHA 3W8EA 4LXUA 2H54A 2AZXA 5D1NA 3V7YA 4CHTA 2XVZA 1C9EA 2OQRA 2QVGA 4DUPA 4DV1B 3ESXA 5JE8A 4FOOA 1WB6A 3KEGA 3KJHA 3RGGA 2QYTA 2QM7A 3VRHA 4HRXA 1BMDA 1BG6A 1MOQA 1K86A 3AUAA 2ZETA 1JVNA 1XMSA 2DBRA 3ZY5A 1NN0A 1QMPA 2FSGA 2W7TA 2XIQA 3BGSA 1Q0PA 1UDAA 3K0AA 4XTCS 4EELA 3ZQ6A 1F20A 2W11A 3SFVA 4EF6A 1U7XA 5FWYA 4O02B 1SBHA 3UWOA 1FNSA 3ZHYA 4XIFA 4M8IA 2GF0A 2NOAA 4EMTA 3F1KA 3DAGA 1KI1A 4B17A 1UQUA 1JG7A 3ZWYA 1TRHA 4TT3D 4WGFA 4HADA 3PENA 1UQTA 3T0FA 4DV7B 2EIXA 1NKSA 3HLKA 1E3TA 3H5AA 5AKZA 2O3RA 4GWLA 3NWOA 5AHRA 1OTYA 3QE4A 3M6UA 1D2AA 2FOIA 2NTVA 5HRUA 1L4EA 2X8JA 5DNDA 3LT4A 3PFIA 1PCXA 1W46A 1TO2E 4QA9A 1JAZA 5IXJA 2YWEA 5LZ8A 3QU2A 4N9QA 4CCSA 5K0GA 4N7MA 4JP2A 4OQZA 4WRRA 2KI5A 5C3MA 3B8HA 2HLDA 2XCTB 1Y4AE 4RA9B 4X63A 2G4VA 1B3RA 1XD2A 3BWXA 5IAAA 5JXGA 5FJIA 5THQA 4Z7NB 5EUMA 1FL9A 4HBGA 5LR6A 4ND6A 2P6RA 3WL5A 3ED5A 1GGVA 1G0OA 3AUYA 4D3FA 1C4WA 2REXB 5EG5A 5EJFA 2FG6C 5EWJA 2ODEA 3EA5A 2O05A 3H87A 3V1KA 1PF7E 4KL8S 2C2KA 3R3SA 1SCAA 5TQ0B 4FFVA 1OTXA 3SU8A 1B1AA 5H4HA 1G6OA 2YCLA 4MIOA 3CZMA 3ANTA 2DWUA 2FKAA 2I6SA 3UJBA 5A7FA 1AO0A 4WNAB 5K0FA 2HPHA 3K4QA 3DBOB 4X97A 3UGTA 3U7IA 2PZFA 3OSUA 4FN5A 4TYWA 3K0FA 3GT0A 4MAAA 1JIKA 3E5RA 4WT7A 2RG1A 4LF4B 2X76A 1KJJA 4CJXA 3CF2A 4FT2A 2OGSA 1SKQA 4TSKA 5CP8A 3GJRA 3KLBA 3FCSB 5CFRA 3T3IA 1MGOA 4ZAWA 5C80A 1CIJA 1S2MA 3SFTA 3RM3A 1ZIOA 5P8WA 4GE0A 4CU2A 2E89A 4A1FA 1KDPA 1XRNA 4P35A 2FLWA 1YVRA 4LNUB 2JH9A 1UBGA 1E8MA 2Q1TA 2J5BA 1Q0QA 1AB6A 5K6TA 5FLKA 3QKWA 4IDGA 3U17A 4IH9A 4NMWA 4J9VA 2F1OA 1E9DA 1SFRA 1XALA 3E8MA 1TRKA 1WMSA 4ALMA 1PWYE 1PR0A 1QRRA 1O0CA 2P41A 5I3CA 1LPMA 2BEUA 2JGNA 3JVDA 1D2MA 3T7TA 2PRKA 4D7AA 1RW4A 1RZUA 1G7SA 4QTYA 1RT9A 2V6JA 1A77A 1SUEA 4F3KA 1QZZA 4RQBA 2P5TB 3MTQA 2WV7A 3ZDFA 2PKQP 3L4SO 1VYUA 3NHUA 2HXSA 1NY6A 3O7WA 3ZXUB 2QD1A 4ALLA 4AVYA 4RTJA 5MHTA 1IOVA 2I65A 5KMGA 3ITEA 3AUFA 3UAXA 3C3EA 4MQUA 3RYHB 5DVZA 2VRCD 3EA4A 4UE6A 1THTA 3CKKA 3N0VA 5AVRA 4C7OB 2OVBA 4ERNA 3O2NA 1KORA 621PA 4JI7B 4NZPA 2UXBB 1A69A 2RGNA 1FU8A 3UWSA 4JK3A 3UT6A 2ZSFA 4IUBS 1NI4B 4EHKA 3PA6A 2ALJA 3B7WA 4OMFG 4CF3A 4ZHSA 1QGYA 5LYJA 2CSUA 4DWJA 1SAYA 4R2KA 4Q3LA 5AI0A 3WKDA 4DC0A 4MR9A 1H23A 5FFMA 1WCXA 2D1QA 5FQNA 1L2TA 3C48A 1XN1A 2XDQA 3TJRA 4KOAA 2OFPA 4AURA 3CF0A 1KZ9A 1W85A 5J58A 1JFSA 1NVGA 1RMQA 1DBRA 2AR0A 4ZKEA 4EG7A 2XTAA 4LHWA 5JOQA 1P6XA 4WN9B 1MG5A 2D0DA 2HADA 5AI8A 4ZCQA 1KI9A 3EFBA 1PI3A 3QOYA 4C20A 2GA9A 2VJLA 4NBUA 1OR8A 3V8QA 5LVAA 3BPSA 3M33A 1NIPA 5M04A 2C8KA 3E05A 2W37A 1IG0A 2RJOA 4MGHA 3VO2A 1E96A 4RHXA 5CA0F 2GAIA 2YYSA 4Q9KA 1KPIA 1QK5A 4FQ5A 4MV3A 2XUZA 3WIDA 4RULA 4EY5A 2SCUA 1M6VA 4WZ6A 2EP5A 4XIIA 2RH9B 2HCTA 3W9SA 1P1FA 5KOJB 5C51B 2OECA 4EJ2A 4FHEA 3E9QA 3ZHVA 2FX2A 1SD5A 4QRIA 3KPVA 1CJSA 1F6BA 3BWBA 3V1LA 1N2ZA 2PRZA 3D6JA 1BC5A 3I2HA 3WQBA 3OOJA 4QOJA 1E3WA 1OJ7A 3ZD7A 5D87A 1PRYA 3UT5A 1YBHA 2QHXA 2CCKA 4HN2A 1UPCA 1IY9A 3AI7A 5JAOA 2ZVJA 3EZYA 3IMEA 1QCCA 2XT9A 5EIXA 1EFUA 1C9YA 4IGAA 4DIFA 3EDMA 3UTCA 5DN6D 2AEFA 2DM6A 1C3VA 4WUVA 3UMMA 1WD5A 5CVJA 2IELA 3J80A 2C9ZA 1ZI8A 4D3DA 4LQ4A 5LQRA 4BGUA 5ELXA 4TS1A 3EQ8A 4LMRA 3SYMA 2D8MA 3UNXA 2WYOA 3DP9A 4PGMA 3VZBA 1A9OA 5AHWA 3ZS9A 5FUYA 5CLJA 1MTZA 2HA5A 1AT1A 1FTNA 2VJOA 4ND8B 5AM3A 1AU9A 1W4AA 5JQWA 2I99A 5DHAA 1PYOA 3DLHA 2CXPA 3AQIA 2RHHA 3TMAA 3NOVA 1E6KA 2AJTA 1MDBA 2HF7A 2FEOA 3PGVA 3W9YA 4DMCA 3AXTA 1MAAA 3TVTA 3TTXA 1F1BA 2Q3BA 1BWRA 1P74A 4PYMA 1N2XA 2Q9CA 3V4RA 2C7QA 4BQRA 3EVZA 5DIZA 5C1PA 1FYEA 5EHXA 2ZZNA 4EW6A 1C7ZA 1T1IA 3QOWA 4DV3B 1AGNA 4ZT3A 3KLOA 2QLBA 3N0XA 4YWHA 2VDUE 4E08A 5KNLA 2CUKA 4A8JC 2PY6A 4WACA 2VSQA 3BIFA 1TM1E 1YOBA 1JJVA 3OTOB 3EPKA 3L4BA 2FQYA 1HOXA 2P30A 1EX1A 3E9DA 5T3YA 1G6Q1 2PKRA 5F2KA 1DV1A 1W0KD 3KXLA 1TZBA 1TZKA 3AFOA 4WERA 1ZIXA 5DLEA 5FWYB 1DO8A 4C89A 4RPLA 2ODTX 3GEHA 3PXGA 3AETB 2Q99A 1FU7A 1ZU4A 1AF4A 5B53A 4N7JA 3A14A 3QVTA 4GVXA 1Q83A 2DHCA 3RPEA 1QVAA 5JAPA 1Y6FA 3SFZA 1WAMA 3H2GA 1YCFA 2OR3A 2VHQA 4YMIA 1IXSB 2HA2A 4W5HA 1DQYA 2AV6A 4B82A 4UNNA 1IOWA 3G8YA 4G8BA 4UM9D 3PLAE 3ONDA 2O2CA 4BEVA 2WD7B 1ZLXA 2JAHA 4Q4CA 5TPZD 2C54A 5CX4A 4HTFB 1G16A 4OV6B 5IXSA 5CK5A 2HMUA 3SQNA 4JBYA 2IBTA 3L0CA 2GFIA 4OJNA 3ZCRA 4LF6B 5KJ1A 3OM0A 1NSFA 2WYVA 1PFUA 1VL0A 3DD5A 3Q6IA 2QPTA 4BNXA 3DXXA 2C29D 1YA6A 4B7XA 6ADHA 4UREA 1SXIA 2HSWA 4YPOA 1KO7A 4EJ0A 2G9RA 1DWPA 1CQIB 1H6AA 1OZFA 5CLQA 1YL6A 2GD2A 4TLMB 4ZC8A 2PFGA 5CNJA 3VVMA 1ZD2P 2P2CA 3ZIAA 1S3IA 4F2HA 3VU0A 1IM5A 2VT3A 2XCOA 4Q6WA 2PWBA 1HC7A 4KDEA 5CAEA 3PHGA 4MQ6A 3W6NA 2HW8A 2R8BA 2H06A 1U5BA 3LLVA 4UUQA 3V55A 1WW3A 3ZBPA 5K05A 4AXXA 2VA8A 3ITDA 2FX3A 4CLHA 1NRIA 3AY0A 5CTAA 3T8YA 1GQOA 4DMFA 1CQPA 4ZI2A 2G7MC 1FS4A 4I2NA 3L49A 5LQJA 1KWKA 3UJPA 3U6BA 1TM7E 3FPHA 2FSUA 3KXKA 4YGXB 2EZUA 3RU2A 2QMZA 1NBAA 3FHCB 1P17A 4MQFA 2JLBA 2O23A 3HWSA 2HF8A 2NUAA 4OMUA 3GAFA 1OGJA 1RU3A 3JQ8A 7GPBA 3CMCO 1BWSA 2JNWA 3LG2A 2VTDA 4JC0A 4K9NA 3U16A 2RD2A 3DJFA 2Y71A 4CQLB 4L6AA 3FTNA 2HCJB 3VOTA 2ATVA 3WIVA 1P4JA 5J3JA 1TZMA 3NBFA 1SIBE 3ROZA 1VL8A 3AKEA 2XGOA 5F1YA 2AF4C 4DQLA 5KWVA 4EPWA 4MUBA 2I4OA 2PSEA 3HJTA 4PS0A 4YUWA 221PA 3ZN2A 3NS7A 5BW4A 5KKCA 3HL4A 2XCIA 3GAAA 5ICGA 3T0GA 1RACA 4EOGA 3ZNNA 1DKMA 1VBKA 2I34A 3DFZA 3I5AA 3OQHA 1XHLA 3O3NB 4NOKA 3O4FA 3X1YA 3RHZA 1K9VF 2C4VA 4HNRA 1UOPA 2PA0A 4XDHA 2YZ7A 3IAM1 3EXFB 2Y1WA 1Q3KA 3GCGA 2IRWA 4E09A 2YOFA 1YRWA 2O8NA 1QV7A 2V54A 2VP5A 1JXQA 3F90A 4OQFA 5BUSA 1M2HA 2FR1A 2WKRA 4XD2A 2DFDA 4X7PA 1Q1GA 4QHSA 4HUQA 3MC1A 1B8UA 4PANA 2P8JA 3JQ6A 4U2BA 4DXHA 1EDBA 2HF9A 2GNOA 1FXSA 1ZRNA 3K0KA 3TVYA 3VGPA 1Y6QA 4M0KA 3CGWA 1NVTA 4UNIA 1NUHA 5DYWA 5HJ2A 3ZLUA 3O94A 4EFNA 9LDTA 5L4LA 1P4AA 2WEKA 4BNMA 4YUAA 1ZSYA 3T1NA 4RELA 3X1WA 5JQGA 1K4YA 5KEIA 2WY2D 1WW2A 4QU9A 2PLAA 5TPWB 3J7TA 3SX0A 3AUXA 3CIOA 3FLAA 3OZXA 1KYYA 1ZK2A 2CDRA 3AKYA 3WWYA 1NMQA 5JS6A 1CS4C 2PH1A 4U7TB 3Q8WA 5KI6A 4GC9A 1M1YA 1C2YA 3HHPA 2XE7A 3SOZA 3ENQA 1VE9A 4HAWA 3HWX1 1NVXQ 4M83A 3AR2A 1XNJA 3UAOA 5J1SB 4L9SA 3S2UA 3T34A 3HCBA 4DM3A 3A6PC 5HKKA 1E98A 3TO5A 3KIPA 4MWSA 2IX3A 1PTJC 5HR5A 4IVNA 2CNBA 1CUFA 1YB5A 1NW9B 4Q1BA 4X1IA 3O4RA 3D8UA 2CDBA 1HNXB 1HE8B 4WINA 3IUSA 3KT6A 3HG7A 3QYJA 5L3QA 4U2GA 4CKWB 1DU4A 4B48A 4BJ5A 1IUNA 1DNPA 4XUGB 3T4EA 1B73A 2BUAA 3KQUA 1Z8FA 4IHAA 2D5AA 4PQGA 3VPHA 3CEMA 4PGFA 5JSHA 4U5QA 3HV2A 3ISJA 2JCVA 4Z0TA 2HU8A 4RDIA 3ZGYA 1VGRA 1QRTA 4RM3A 1JAYA 2P5SA 4RVSA 2QRQA 3TGWA 2GM9A 1TIKA 2XB8A 5K45A 3A6KA 1EG2A 1MVLA 2QSYA 4KE7A 2C61A 4CMJA 3R9XB 3SC3A 5E1MA 3PNYA 5KNCA 1DIHA 1VKOA 2OQIA 3LGSA 1C0LA 3QE9Y 2WWFA 3EB9A 3ZV4A 2OO7A 2CCJA 3FTQA 4RJLA 1XFDA 3DB1A 3MUOA 4H1HA 5DW3A 5FV7A 5K3BA 3RKRA 3CNBA 4J16C 3W4IA 1FNBA 1UOEA 3FUXA 3KZCA 4FGJA 4XYEA 2CNWD 3NIDB 3PYMA 5E9AA 5KDDA 1JILA 1Y33E 2ZRAA 5AMXA 5B6IA 1OFGA 3EF3A 3DAFA 3NV7A 1U7ZA 2CY0A 3A6EA 1IZZA 1EGAA 4D9IA 5CVTA 4XJVA 1EFAA 1BN7A 4F85A 3QGMA 4I66A 2DXIA 3PPIA 1UP7A 3NFRA 4QFDA 3RS5A 4JC4A 4MUFA 1TTTA 4RKFA 3OPXA 3O0DA 4AKTA 1VB3A 4XQCA 4L73A 2HPVA 3U2QA 3VSAA 4LKOA 3CW2A 3ENZA 2QW1A 4JVSB 3Q3VA 5DTJA 4J49A 5LDDC 2IPNA 3ISTA 1YHNA 3FYTA 2P2LA 1ZINA 3EY9A 3P9CA 4MMYB 5EZYB 4QGSA 1G5PA 4CCYA 5JAZA 1I4EB 3LDHA 1Y1LA 4YJ2F 1BS9A 1WDMA 2HX1A 2VTEA 2VJPA 3PQFA 2ARKA 3QBDA 3RBVA 2O0KA 1X7DA 4MZXA 3MUNA 3PR3A 4Q7MB 3JD4A 3TLCA 1M5TA 3NO4A 1MA3A 1U4OA 1T29A 1AKWA 4I4NA 1X74A 3ZU2A 5FOQA 3D54D 2R8ZA 4GP9A 5LKAA 1I3KA 1KEWA 2IDMA 3C98A 3K9HA 1QH1A 3NJ4A 4LJ7A 4MS4A 3CSUA 3IBGA 1IVYA 4H9GA 1K7CA 1O4VA 1U1CA 1I4DD 3EGVA 3IOMA 4GKBA 3ZI0A 1DEOA 3NH9A 2JI9A 1YACA 4FT4A 3RT1A 1KVRA 4NF2A 4U7GA 2OD7A 3THXB 2DJ5A 5LN1A 5CDTA 3RIXA 2C2MA 1ND6A 1R6DA 4WMLA 5JWOA 3DMDA 3UMYA 5BN5A 3C3AA 4DMLA 1DFGA 1OVMA 1PEAA 3IHTA 1ZGAA 3B1VA 3Q5GA 2PLRA 1E5LA 5CB4B 3DT9A 2BFCA 1PT8A 2H9AA 1M5UA 2DPYA 1RQXA 2VTVA 2E7ZA 3D4LA 1F17A 1UJ2A 4OY3A 3TLGB 4PINA 5TPZA 5FL7D 3ODPA 2ADFA 1Z4QA 1T3HA 4JX9A 1BDBA 4J76A 2JJQA 4KLRA 3OIDA 1M6HA 4AJKA 1FUYB 4BLUA 3TZKA 3L6EA 4KH1A 4FLMA 2QTMA 1CR6A 1XD9A 1Z5OA 2PV0A 3LBIA 4O2BF 4YCBA 1ULSA 5CEJA 1M1XB 2J5RA 2J30A 1JQBA 1X7WA 1XDGA 3OBIA 4JXKA 2FPGB 4AMGA 2HSEA 2I8LA 2W98A 2XNDD 3FGOA 3HU3A 4IIEA 1Z34A 2FWNA 4F6RB 1AHIA 3GDFA 4M99A 4OM8A 2ZSEA 4A9AA 4JJIA 2Q3CA 5FPSA 5DXAA 4R84A 3FUUA 1Y6GA 4DLLA 5EVJA 1YQ9A 5ARDA 2HSJA 1MAWA 3ZBQA 3BB1A 5AIAA 3HZHA 1Q7RA 1DPFA 4JJKA 4CKEB 4M22A 1U80A 2BH2A 5FYQA 1W0JA 4XYBA 3UQZA 5IM5A 1ZGJA 3K53A 4Y2HA 1UMKA 2ROQA 5AP9A 1V6AA 1ZI6A 2EBWA 1YKSA 1C30A 1Q7TA 3GGSA 4NJEA 1L7EA 2YV2A 1VQ1A 1GPH1 1E5VA 2QAIA 2XRYA 4IOJA 4BIIA 1CY8A 1JKJB 1F6WA 1G8PA 4QPPA 5CM2Z 3ETHA 2JGRA 1B43A 2RBEA 3L7BA 4FW9A 4QO7A 5IVIA 4DBLC 4OI1A 1U0RA 4K6OA 4GEGA 1JPJA 3IVRA 5TQ0A 4C4AA 1JPVA 2RGDA 4AO6A 3HCOA 4N5HX 1GG8A 5AHKA 3E4DA 1FFSA 1R0SA 2YOHA 4X93A 3Q7TA 4TL8A 1IY0A 1KJIA 5HS6A 1WCYA 2RBGA 2P8SA 2N3ZA 1RRKA 3K9WA 3N39C 4FJ2A 4BV2A 4KFRA 1DO0A 3N0WA 3ZS8A 1AVTA 4QOGA 5LYJB 4MINA 5ITWA 2NWQA 2WSSA 1G41A 5LNK1 3FYSA 3NEYA 1IJFA 3PQ8A 1FC0A 4H6PA 4PXYA 1ZN2A 4ZOLF 3VISA 4UUBA 3ZY6A 4JNCA 4HTFA 2X5JO 1DIOB 3QNUA 4PC7A 3DLBA 2QIPA 1ZL2A 2Z3ZA 4IDBA 3D4BA 3R5TA 4N0QA 4UOZA 5EE0A 5FHQA 4J1TA 2GVZC 4L8WB 2XGJA 3OFKA 1JLRA 3RSOA 4XVUA 2JVIA 4NYJR 1H0SA 3I6MA 4IDAA 4BNNA 5LMZA 4HEJA 1KOFA 2WHPA 5ALZA 3T9BA 2MWMA 1TEHA 3FPJA 4IFEA 1BD3A 3O38A 4OQMA 4DZTA 1N2HA 1VJRA 2HA6A 4Y9DA 3VSCA 2WDPA 2FW7A 3FTCA 5AICA 1QAOA 2GZAA 4GQBA 3OC6A 4E31A 2JZCA 1T0BA 4M0LA 1Q1NA 3ORRA 2I62A 2IYTA 3UA3A 6Q21A 5K8UA 1NF2A 1F3LA 2IYZA 4BKQA 1QF6A 4JDUA 4QXOA 3FAKA 4IEEA 4G36A 3WR5A 1X8LA 2VIIA 1RI2A 1UEIA 3DPIA 1YB7A 3O8BA 2Y1XA 3B89A 3FCEA 3IX7A 5CW1A 5GVSA 1ISFA 4GICA 1ZIYA 2G25A 1AHPA 2YJ5A 3PPWA 4FSXA 4P5DA 3K70B 4ZICA 2BKUA 2W71A 2Z2XA 3GDOA 1Y4ZA 1XCPA 1GYPA 2OAP1 2HBZA 2EZ9A 5LLSA 3VJLA 1TM4E 4JLSA 2I8CA 2JI4A 4Q1DA 4DBVO 4MV8A 4JP1A 3DAOA 5C46F 1UMDA 1ESDA 2AEMA 3ZX4A 2CXRA 2J0UA 2Z30A 5HP4A 3RC9A 5HVNA 2E21A 4QKQA 2BCGY 3WB2A 3HBAA 3ZC3A 1IXKA 4MKIA 1VA4A 3ILXA 1ZJZA 3IQZA 2QIOA 4D3ZA 3SE7A 3PKJA 4IJUA 1DKLA 2SICE 5AQ1A 3U26A 5FPPA 5T4HA 3ILHA 2IHKA 4C4RA 1XDUA 2Q0XA 2YVAA 4V1CB 2I3AA 1EVQA 2CXTA 2AA3A 2QM0A 2IP1A 1Z7GA 2OOSA 2X4LA 4KQ1A 1OYVA 2CHUA 5EHGA 2X9LA 2YYYA 4EGAA 1ZK0A 1F0PA 1SVOA 3ASYA 1CJKC 2QW0X 3CLTD 3MBOA 4MWZA 4GPD1 1W4ZA 4TWRA 4PIMA 3A9VA 4QL3A 1EJ6A 2M6LA 1GZUA 3V2HA 2G9ZA 1HDIA 1V5WA 2Y77A 1Z73A 2BMWA 1XJ5A 3SBEA 1BDJA 3UAGA 4ZEMA 1Y3BE 1G42A 3RUEA 5FNZA 3STHA 1TF5A 16PKA 1RJGA 2C0PA 2CXXA 1XAHA 4I1VA 3CO5A 1M2NA 4WLUA 2JHFA 4GSKA 5CNKA 4BFWA 2WUEA 4RS4A 2AOVA 2A9OA 4HDSB 3FCCA 1P18A 1W0KA 1RABA 1J8DA 2VHXA 5FFFA 4BN0A 4ZYVA 2HEGA 4JOCA 4QNRA 2XVYA 1VMDA 1ODSA 1Y3IA 3KFVA 4MRRA 4Y9SA 2O14A 2VI5A 4ZMBA 4YR9A 1JNXX 1Y3CE 5BQ3A 2NQ2C 1DJQA 4PPQA 4WUTA 5JQGB 4NWIA 3VR4D 3JYPA 1CFZA 1NPTO 3FWYA 5J43A 4X7BA 1QKIA 2ODWA 1B1CA 3PFHA 4HMQA 4J91A 4M21A 2PSJA 3PTLA 1W59A 2BGJA 3USZA 2ZIFA 1C14A 3G9ZA 3PK0A 2YR0A 2E4XA 2P75A 2PT6A 4LGVA 4RVFA 2JJ2D 1LSSA 1G5QA 3WK9A 4F21A 3WGJA 1HY3A 3H9EO 1K8XB 3X44A 2J3IA 2QAJA 3TTTA 2GCOA 3TQSA 5JLAA 2E18A 4G2NA 3EFOB 4HH3C 4UUNA 2J09A 1I4LD 4GP7A 5IAJA 5SY4A 5I9NA 3PRHA 5CHEA 1RAEA 3GGCA 1ZW1A 3C6YA 4HL6A 2PUHA 3UK7A 3OUTA 3Q7IA 4IUYA 1LPNA 3Q3IA 2YVUA 4DADA 2YOGA 1OQAA 2XLBA 3D1JA 3HQ4O 2YWJA 4YI3A 1ZOIA 1EU1A 2R86A 4AY3A 5CBPA 2GPAA 1JZTA 4YAKA 2B4KA 2H29A 3O4HA 4Q1AA 2Z9BA 1I3CA 3AC0A 3B6MA 3FTPA 1D1QA 3QWIA 4RTKA 1NATA 2P3SA 5A9TA 3WLSA 3LH5A 1IY8A 1FFAA 2NZ2A 2YWHA 1YUBA 3CLHA 4RJJA 3D6FA 3GGPA 2PUVA 1MNQA 5A05A 3T52A 4CEHA 2VCYA 1UFVA 2IV3A 2R6CA 4ND3A 4TL7A 3MMXA 4UAGA 4ATNA 1R1DA 1GQ2A 2BT4A 4GM0A 5C8ZA 3M6MD 4YXWA 2FPSA 3KD2A 4GLBA 3A6GA 4N8EA 4HMPA 3MFQA 4J0DA 1MO3A 4NMLA 5DNEA 4EITA 1JF8A 2CKDA 4TV9B 4OFZA 3TINA 1OI7A 2HQSA 3H7AA 1N3YA 4E70A 2RKWA 2B2CA 3RO7A 1QTQA 3CLSC 3LLCA 3VHQA 4EGSA 3F5DA 5DWDA 4GZ3A 1Z47A 4HQFA 1AUQA 2CXSA 1HDGO 5TRTA 3R7LA 1P4RA 4QTUB 3COSA 1JQEA 2HSDA 3DBLA 3K8OE 4I5EA 4ES6A 2RCNA 3C3XA 3HWRA 2HDOA 2HIMA 2ORYA 3AU8A 3GZNA 3E1SA 1D09A 1M54A 2OVFA 3CUVA 3LL4A 1S8AA 1EFPA 1YBFA 4J0QA 3PVCA 4MYSA 5FOSA 3RVDA 4LOLA 3SXPA 3A9SA 3I05A 4RIGA 2ZCJA 2WQ6A 2W8ZA 4ISBA 4BQPA 3AVOA 4HDAA 1TQ8A 3K9FC 1QZXA 2EL7A 2HM7A 3BD9A 1Z4LA 4AL4A 1HDZA 1P39A 1C81A 1UEJA 4EARA 1H93A 3HO8A 1XEWX 1F9EA 5ER6A 1UK9A 5AWFC 2VK8A 3M4XA 4FCTA 1ULTA 5E95A 4OHZA 3CW8X 3H65A 4S1VA 3EC2A 4F84A 2AJLI 1UBUS 3WBFA 2W0SA 5AW1A 4V0LA 3QBVA 3CNQS 1FP6A 3TJZA 3YASA 1RBYA 2ZSJA 3W4KA 1HETA 3IDSA 1ZU5A 5JADA 1UPXA 4XGQA 5LOVA 4E1BA 2G83A 1XCJA 2BFBA 1CVIA 3BF7A 6NULA 4EUSA 1RR6A 2DLNA 2C1EA 3SNKA 5K03A 2XQIA 3CIFA 1GT91 2ZJ4A 4IRUB 1XD2B 4COKA 3E3LA 3BH7A 4C0XA 4EHLA 2PFKA 5GJWC 2XECA 5FA5A 3JQ9A 3FPEA 2BKXA 3KK0A 1II8A 3O74A 4LYYA 4O5AA 4R05A 1OYOA 3RYHA 4JL5A 2I29A 4N8SA 2XE4A 4K6FA 3Q12A 4XQ0A 4FFRA 1Y48E 5IFKA 3A1TA 1T1EA 2VYNA 3K9BA 3P9SA 4C43A 3O4VA 2ILVA 1S7CA 3RYIA 2X58A 2TSYB 2ZYDA 3B1JA 6GPBA 3AM4A 2H1LA 2J9FA 1ICIA 3BQ9A 4X1OA 4HP8A 1Z4OA 3SQOA 2YFHA 3ANXA 3WLEA 3A6HA 2UYQA 1ZMOA 5LNK6 1Y1QA 4BFVA 2LCIA 2O3JA 5AK5A 5ALNA 4ARIA 1PQWA 2ZYTX 3VPGA 2ZWMA 3D3EA 3WQRA 5KNDD 5HRAA 3AK4A 2W93A 2E4UA 2FF5A 4EW1A 1SC1A 2IHTA 3QTBA 1U1EA 4A2PA 3LL7A 3GLGE 3E9EA 3ECAA 2GBLC 1LNSA 2ZZKA 3DUFA 1VE6A 2F3QA 4LNUA 4MR9B 3C4QA 1CV2A 5GGXA 3M8KA 1UZLA 1B0ZA 1Q57A 2V7TA 3DAYA 1M7BA 1TZCA 1GA6A 1BX3A 4I2VA 1FTSA 1T0IA 1T3TA 2VNHA 3W6OA 2BF4A 3I64A 5AXCA 3NX4A 5E8JA 4G56A 3WB0A 2P2DA 2BR4A 4X9XA 4UMFA 4XWAA 3K1YA 4CODB 2CVOA 4ETNA 1E2MA 1X92A 4IICA 1DXOA 3EQ7A 3HWWA 4HMOA 2E0IA 3ELWA 4L8FA 5AJTA 3AQ4A 3CX7A 2ZJZA 1OY1A 2A9PA 2MYTA 1C4OA 1MIHA 1LLUA 2HREA 3TDNA 3L8ZA 4IX9A 1T4CB 4O2BB 2B4QA 3KYCA 5JJLA 3I3OA 3WGGA 4REMA 5DHSA 4EY6A 3G2OA 3GA7A 2QF7A 4DMRA 2VDPB 5AVOA 1PWXA 3GFFA 4NYMR 4OD0A 3FIUA 1GQFA 4C6TA 1FDRA 1R6XA 2RKBA 4EVIA 3ZDZB 4OB7A 3QVMA 4NESA 5EZ6B 4K6CA 4RK4A 3V8MA 3GCWA 2EBUA 4KLNA 1JDZA 3GLFB 2KWIA 1UL1X 3SJ7A 4J29A 1M5RA 2W70A 1PLKA 3L18A 5KTPA 1GNVA 1DBVO 2R66A 2IODA 3KRTA 2VP4A 3PL1A 1Z0AA 4M1QA 1IVSA 2RIRA 5CXSA 1X77A 2XDYA 1H1TA 1JSZA 2C1ZA 3ZBUA 4F3YA 1KDOA 3ELBA 1JU9A 2PX3A 2ESRA 3K96A 3AF0A 3FCAA 4G4SP 1E1RA 1UC4B 1C3LA 3LMKA 1U8EA 3C1OA 3PE4A 1T9KA 1BHSA 2O7RA 2IHUA 3KALA 5C3UA 5KC8A 1E5DA 2ZJ6A 3B52X 4LKRA 2JZOA 3SZOA 2R3SA 3I8OA 1KXJA 2JF0A 1CBUA 2A2ZA 1XHEA 1UKCA 3QEKA 4B6RA 3FPGA 3PC6A 3R9KA 3IDAA 3DOEA 4O4HB 4D80A 3K9QO 4BVBA 2NSHA 3COYA 4X1KA 4XARA 3LUJA 4KYIB 1EAMA 4LRWA 4PCVA 3RVMA 2I2DA 3G88A 4B34A 1M2VA 1UBNA 3GBSA 1ULUA 1T0UA 4XB1A 4ZODA 1NMSA 1MIOB 2XWPA 1Y7TA 5EKXA 3IELA 1KHTA 4OJTA 4CIVA 3EPHA 4N6NA 5I5EA 2IUEA 2UUBB 3KVVA 2FJUA 3LU1A 1XV5A 3SKVA 2IS1A 2VPWA 1L5VA 1SHTX 1IONA 5JD3A 4E2XA 4ZK2A 2CNOA 3OEEA 3L7LA 1R0WA 2VOEA 3KAPA 1E0KA 3BB3A 2B20A 5GM1A 4Z2YA 1JHUA 2G0AA 4K87A 3IDFA 1Z5VA 4GO1A 4WQMA 4DYDA 1MAHA 2KW5A 2TECE 1H9CA 1DUIA 1IDN1 5EI5A 2OXTA 1UBTS 1D7AA 5HKKD 3ZX5A 3WGKA 1A9SA 3AJDA 2DC1A 2Z58A 3EYWA 4MVJF 2IHVA 1P19A 4ZEVA 5ITZA 4O2RA 5C5CA 1CNMA 2F8LA 3QY0A 2W42A 2IXBA 4IJQA 2FV8A 4AMUA 4BMZA 2XVMA 3O2SB 3PXUA 4N6GA 4K6GA 1ZM4A 5IDQA 3SF0A 1ZN9A 4CNBA 1G66A 3SHOA 4E7PA 2V7EA 1J49A 1XF9A 5C7LO 2I4NA 4UBOA 4CGZA 3CYFA 5BSVA 1J8VA 1QHYA 2WD8A 3LFUA 3EIHA 1DX9A 1FYVA 3N5KA 5K0TA 3D3WB 5D3MA 1N2OA 3GAMA 4AF7A 1XZFA 2PPLA 4O4JB 3R6DA 5BUCA 2PMKA 3AR8A 5HIJA 4DLRA 4GOOD 4CMIB 3SJUA 1EHYA 4E07A 1CRWG 2UAGA 3B1FA 1BDMA 4CKYA 1A4RA 3HTXA 4BJHB 1I9GA 1X7HA 2XOKA 3LZCA 3RSHA 3VR3A 2O6LA 1OH8A 2ECPA 3OMWA 3QFFA 1O9HA 4MPDA 3C6ZA 3ZCQA 4H1WA 2M6SA 3QV1A 4JSTA 2GCPA 3GPDG 3ECSA 3QBJA 2H48A 2ZRKA 2WJAA 2J4DA 3LXMA 4HUJA 4IIUA 4BP9A 2QRKA 3T12A 1JSLA 1K68A 4TYYA 4DB4A 3L7OA 4WX2B 1D4AA 1SCJA 1X2BA 2YYZA 2XB6A 3F4LA 1MAUA 2AQKA 3P0HA 1E1CA 3EBPA 1XTUA 5BSWA 1O6BA 1NVKA 4F4IA 1RI3A 1SQGA 1XRRA 4FE3A 4NCBA 2HU2A 4UU7A 5FA8A 4GYYA 3NHLA 4UUOA 3IEUA 5LPNA 1H94A 3NTRA 1J0CA 1JIVA 2QMOA 4S2EA 2XRMA 4F4UA 4B8YA 4W7HA 1K8QA 1I32A 1TJ4A 3JTEA 4O2AF 1MZVA 4HNTA 3AEQB 1K7XB 2O6HA 3LQQA 4MQEB 4D8VA 1MJGA 2H63A 1EE2A 3P9YA 3FUTA 4YXFA 5BT8A 2VF5X 2IYEA 4RL4A 3RU7A 2QRZA 4DDVA 3MJEA 4OH1A 1OHHD 5H0IA 4EM6A 2XZLA 3E1KA 4G0YA 5EFZA 1H2RS 2XT0A 3PC4A 4C30A 4DQUA 1Y8CA 1QHFA 4MTCA 5TX7A 1RLMA 2VK4A 3CH7A 4TS9A 3QG5A 3RTCA 2XB2A 3QVOA 2RBKA 1PT6A 1JJ7A 4DKJA 4UZFA 3BZUA 4BCBA 3M5WA 1QMGA 3GLUA 4TM8A 1M1YB 5J4HA 2OY0A 2X9QA 4OBWA 2J0SA 3UAZA 3ONNA 3FAZA 3JVIA 3Q0TA 3QJGA 1FCJA 2W5UA 3A3OA 3BXHA 4NHOA 3SC6A 3F7NA 4D45A 1TE2A 4Z2AA 4RHYA 5EJEA 1XKTA 5IT0A 1DHTA 3FKSA 1RXIA 2VZ9A 5FKJA 4RCVA 5TNXA 1QFYA 2QGNA 1Z15A 3NTUA 3H84A 1KVTA 1P2TA 5J2UF 4BNDB 1N0WA 5K09A 4WZBE 2UXCB 1H1LA 3AR6A 4XUCA 4V39A 3NBMA 4RIIA 3VUFA 2PZJA 1ZJWA 5JR3A 2C5LA 3LLSA 3VH1A 4H60A 4XW2A 3ET5A 5A1TA 1EVEA 3HGTA 2ZUDA 2J6IA 1WQ1R 4DC9A 3HHEA 3MMZA 3C8DA 3I09A 3WYDA 4MW4A 2A9JA 3KVOA 4MKFA 5CFPA 1YFLA 3HVHA 1JR4A 4MEBA 3OAAA 4TN5A 5LM3A 1GY8A 3MB5A 4FQ8A 1EK1A 5DTQA 1LEHA 1UBJS 3DE1X 4C87A 3I34X 2GAFA 3WWDA 3NHMA 4P08A 4UTRA 2PM8A 3OMLA 4IYJA 2VJAA 4Z7QB 4IMJB 2ZRJA 2X4IA 4OL0A 1GNSA 2OD2A 4B40A 1S2DA 1CETA 3A04A 3NIFB 1EWYA 1P0MA 4CM3A 1QM5A 4HDMA 5FRDA 5H02A 4L7VA 3FI0A 3TQIA 1ONNA 1ZAYA 4OHRA 1KE1A 4UM9B 1KGDA 1CJVC 2M1XA 4PLGA 4UCQA 1N1DA 4JQZA 3KUDA 3PUHA 1JBKA 3B6IA 3NRJA 4RIEA 3HM2A 4U2FA 5HBGA 1DKOA 5EKSA 1E7RA 1KFCB 2CJWA 3WFJA 4EZIA 4CDNA 1KAHA 2X1MA 3UKJA 3SBXA 4G41A 1P75A 4S1TA 1Q17A 5DCUA 4FU0A 1YRBA 2V7GA 4JUFA 1IMJA 2C9BA 1Y0BA 1KK1A 4LDRA 4QUGA 5KYUA 3R7BA 1Y8QB 2D62A 2QX9A 5EIWA 3GJ4A 2HZ7A 1ZGCA 3BKXA 3HR7A 2PX6A 4J8PA 1A4XA 1G6HA 2NIPA 5EJAA 4B75A 4DA8A 4FM9A 3Q5DA 5REQA 4FYYA 3IAS1 5EIHA 5JSFA 3E81A 3AR4A 5FXMA 3CVVA 4W9NC 2PQ0A 1WXEA 2GJ8A 2IEGA 1NQVA 2ZLBA 2ZROA 1OYYA 1Z4MA 3KKLA 2QSUA 3M5DA 5I7HA 1NDHA 1SRQA 2XE8A 3ILVA 1XP8A 4P54A 4Q34A 4Q03A 1MJNA 4TSFA 2I0FA 1N78A 3PGLA 4F5YA 1JHPA 1C0PA 2HPZA 3L7DA 2WP0A 1FDUA 1SOUA 1Z22A 4GI5A 4GECA 1P91A 4I4IA 2Z8YM 4UHDA 4XD7D 1WXWA 1IHPA 2BFMA 1SK8A 1TI7A 1NJ5A 2XQFA 4HNHA 4X3OA 5FF9A 1VP3A 4X0EA 5LYYA 4AUKA 4FFMA 1DDOA 3HZOA 3X3HA 3ASUA 3QQ5A 4U3JB 1ZS9A 2OG2A 1JEEA 2WJPA 4EG8A 2Q2QA 1I51A 3P1JA 4PO9A 4YBRA 5CW2A 2C4TA 2I7VA 1WDKA 2DG2A 4L78A 1H2HA 1RWWA 3AZPA 3OKAA 4DLKA 3UUFA 1U94A 2ZAGA 4KB5A 4ZN6A 4AKHA 3FCUB 3MS7A 4BEBA 4BLSA 4G0UA 3F96A 1C1DA 1E2KA 1UZMA 1E6UA 1WTAA 2DUMA 4GPIB 4TLDA 4Z0PA 3FZGA 1MF7A 2Q49A 2M2IA 4JUAA 3P9ZA 2Q5CA 4YCNA 1SK9A 4MQ5A 3ZDDA 1ISIA 1T9HA 3EASA 2KSQA 1KRXA 3FGPA 3IIJA 1Z28A 3RSFA 1E2UA 2QY9A 4AZTA 5HMLA 2XMQA 5DRYA 4WFKA 4KGZA 4R6XA 5CIQA 4R3WA 1Y4DE 4QSHA 4BEJA 1RKUA 2V5UA 3UHAA 2X0KA 1UBHS 4NLLA 1L5YA 5C81A 3Q41A 2K4MA 3GJ3A 2IJGX 3JWJA 3IBYA 1P7YA 2RK3A 3MLAA 5HE9A 2HDHA 1U6KA 1UK8A 3WLTA 3DVAA 3MCVA 1U99A 2YZKA 3ZZNA 2VHEA 4UDOA 4ZRNA 3B36A 3TBHA 4EA8A 3LQ2A 3DDZX 2BFDB 4ZQIA 3HO1A 2ONJA 2B4AA 1C3OA 5CA1A 4XCQA 5K2MA 3QUQA 3AGQA 3RT7A 2HLHA 4JLKA 1XPOA 4PN7A 4H6VA 2GN1A 1HWYA 4Y0VA 4IV0A 2UUPA 4QUDA 1Y5NA 1U3UA 1OHHA 2LV8A 2JLWA 1VDZA 3WTCA 4EFMA 2C31A 2QJWA 3DL0A 4LGMA 2I2FA 4Y6RA 3DLAA 2ST1A 2PWAA 3G6KA 3NVAA 1VXOA 2IE8A 1GLNA 1TOAA 5T6BA 4CLRB 3SLKA 5AESA 3QVWA 4JLUA 1NGSA 2V5AA 3A70A 2OO3A 4XPIB 1KEPA 2J3LA 5EXDA 1IXRC 3GLGA 1KY4A 3VU3A 1NXQA 3WBJA 3OOYA 3WP0A 3H4IA 3VJRA 2V98A 1N5LA 1X13A 3OA0A 2VH5R 4RYLA 4IG9A 4H59A 3N3BC 2JIMA 4I36A 2YHUA 4Z9AA 4TTQA 2ON6A 4H77A 1Y5MA 2F00A 4P92A 3WRWA 5KSOA 4ON9A 2IIVA 1WRBA 3G1WA 3K2QA 3T35A 4OLFA 3MPOA 4FYHA 1G98A 1ZQ1A 3W0LB 3DXYA 1KS9A 2PX2A 3MCTA 4RTRA 3Q98A 4L8GA 2X22A 2A9VA 4NEQA 2VKTA 2JS7A 4B84A 4F4DA 1MUUA 1TCUA 1R4NB 4HGQA 2AE2A 2W83A 3AH8A 4FFOA 1TJYA 3L06A 4DQDA 1O03A 3G0CA 4J0JA 4HYQA 5KTRA 1GSAA 1LLFA 3HDVA 1QOZA 1S5PA 3NNNA 4QJBA 1UFRA 1QUEA 4ENPA 2ONYA 1FFCA 1T24A 2VPPA 3K1ZA 2CW5A 5SV2A 3WB9A 4TL6A 4B6QA 1EP3B 5I9MA 3R20A 2C97A 4F60A 4PN3A 3GUCA 5AQEA 1EUDB 5JYBA 4UD6A 5KVCA 5HOEA 3MTJA 3QE0A 5J59A 4XLLA 4KQKA 5KTKA 2QLFA 5HXAA 2AFIB 5E6SB 4KRGA 1CUVA 1Z2OX 2G67A 4RA6A 4DNOA 1FSPA 2G9QA 2L17A 1SXJC 3L7IA 1XYVA 4TLLB 3REQB 1VHLA 5EE3A 4Q3KA 1Z0FA 1QWSA 1SOMA 4NIMA 4XX0A 2I6UA 2Q1XA 3NDPA 1MOPA 2F48A 2QSJA 3VPBA 3I5XA 1TCBA 2JPDA 1TAUA 1S3FA 5HIMA 1ZC3A 5FI5A 4ENTA 4GKVA 4JI3B 1G4AE 4UVHA 5JYDA 4PXAA 1ZI9A 1N0UA 4WXYB 2JFBA 4LK2A 1V47A 1IG3A 1DQZA 4OKNA 1ORWA 2WD9A 1EZZA 5FWXA 3FZQA 1EBBA 4MGEA 1U9IA 4L50A 5LDHA 1E3MA 4I08A 1GU7A 1DC4A 4LGCA 4ND2A 5JCXA 2PT9A 4LWOA 2GPWA 1BQ3A 4FQ7A 5CGZA 1CUEA 1JPNA 2ZJ5A 1SCDA 4GMXA 4P7JA 2OC4A 2AC7A 4W7IA 4CQMA 1J22A 3AEQA 4HAVA 4ACAA 3RIHA 3FJ1A 2AMJA 3UZUA 1L9KA 5H5JA 3WWCA 3K6JA 3A1NA 2HGZA 5DOVA 4EK9A 3T7AA 2C4MA 5B36A 4KHZA 1E18A 1NBEA 3KKEA 3GP3A 3G0HA 3ZWOA 1Z5ZA 1QLWA 2HNKA 3KJZA 4XYMA 3D6TB 4Q4HB 1S3GA 4R9UC 4V1CA 1Q74A 2WAOA 4I9UA 2C9DA 3IP3A 4AF8A 4D92A 2CFSA 2XR1A 3ZV7A 3L0BA 4EBFA 1YAHA 1T5OA 2ZRBA 1PK7A 5F2NA 4Q0MA 1R00A 5FLYA 3A3PA 3GB9A 4Z1OA 4PQFA 1U9ZA 2LZ0A 1RQLA 3ZOZA 2ZI5A 4QYXA 1IJEA 3G85A 5MFPA 1P73A 3E23A 1I33A 4ND1A 3NWBA 5B7GA 1WHSB 2ZTUA 2ZIXA 3RVBA 3RROA 3GLIB 2A3NA 2QN1A 2X9VA 2ZYGA 3DNMA 1SG9A 3BE6A 3D81A 1DTSA 4L0DA 3AEYA 1T0HB 1IAVA 3K5IA 4W82A 1SQ5A 2IUSA 2RMKA 4A6DA 1BGXT 1KI8A 2CHFA 2CEKA 3D5TA 1XAIA 2BL4A 2H2WA 3BWMA 4F92B 5LJIA 2NAFA 1UT8A 2UZ4A 3BFJA 4KQHA 3KKPA 4IO0A 2IA5A 4TMVA 4BKRA 3LJKA 3LHIA 2LBPA 5CEFA 5K0JA 2GK6A 2REQA 3R3JA 5ESWA 5K8LA 3AHFA 1GPLA 4OHCA 1SMKA 1XTTA 1DXQA 1ZG3A 2TMKA 3IE2A 4JIMA 3IP7A