3H1GA

Crystal structure of chey mutant t84a of helicobacter pylori
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITAEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY homolog
total genus 48
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1gA00
1SXIA 2A9OA 2PLNA 1Z2EA 4IILA 4JASB 4WXEA 3OMWA 2LBPA 1Z16A 5TPZD 2FMIA 3RQIA 2W42A 4W5QA 1KGSA 3O1IC 3OMXA 4LRQA 1Z2DA 1ZGZA 3E61A 3HDGA 4RS3A 1P2FA 5KI6A 1H9CA 1BDHA 3CNBA 3G85A 2QZJA 1MB0A 3QEMA 4B09A 3G1WA 1DJMA 1Z17A 4OG2A 1EWKA 1ZY2A 4YGXB 3C97A 3KG2A 2L2QA 2H0AA 1R8JA 2NZUG 2NT4A 3KCNA 3LTEA 3M6MD 4GNRA 4IF4A 5IULC 4KVFA 4F3TA 5IEBA 2LUOA 3RVSA 2PJUA 1QP7A 3A10A 2MYTA 3F7NA 4KZKA 4RK0A 4RXUA 1KRXA 4KV7A 4MLDA 4S04A 2FMFA 4FB4A 1PNRA 4RK4A 3SG0A 1LJLA 1D2AA 3D8UA 1LJUA 2WY2D 1PEYA 4RWEA 4MS4A 2WJWA 3M9WA 4PE5B 1ZAYA 2O20A 2GBPA 1D1QA 3QEKA 1QQBA 1DCFA 3OLYA 4YO7A 3T38A 5IUKC 5JNWA 1BAPA 3CHYA 2R48A 5E3JA 2JBAA 3JPYA 4NCBA 1DBQA 5ED4A 3QK7A 1YK0A 4H3HB 1A04A 1TMYA 1DCMA 4JOQA 1CEYA 1M2FA 1QP0A 3H5WA 1QPZA 4OTZA 4F06A 1QKKA 2RJNA 3H75A 3Q9SA 4MS3A 3N6VA 5JS2A 3HSYA 1YK1A 3LUJA 3RVKA 2HPHA 4YV7A 1JL3A 3O1JC 5FWXA 2JVKA 3M9XA 3UK0A 1GUDA 3JY6A 3SY8A 1ZH4A 5GOTA 1E6KA 5HM6A 5JNVA 3LMKA 1NXOA 3ILYA 2PUCA 1EWVA 5JS1A 3H5VA 2Q5CA 1FFSA 4Q6WA 5DCLA 2J48A 2CD7A 4MR7B 2PMCA 2BGGA 3RH0A 3H5LA 5C5EA 1P6UA 2IPLA 1DCKA 3HK2A 1DC7A 1D4ZA 2FEWB 1JLKA 3K9CA 4S05A 3OM0A 3H5OA 3OLXA 2MYPA 1RZRD 3HJFA 5B3JC 4ETNA 4Z4IA 1EHCA 1JBEA 1OXKB 4RDCA 1URPA 3GV0A 3BRSA 5D2CA 5TPWB 1DRKA 5CHYA 5EWMA 3VNBA 4WT7A 5IUJC 2PUDA 3KSMA 3EQZA 2JVIA 3LUCA 6ABPA 1JFTA 1NY5A 2PUGA 3SAJA 3IP9A 2JB9A 4QICA 4Z99A 2PUAA 4QYWA 1L5ZA 3RVPA 1M2EA 1USGA 1ZITA 2WMYA 3GYBA 2E4VA 4EYGA 4MPTA 5JNSA 4EVRA 3GL9A 5HKOA 2QVCA 3EJWA 1YIOA 1NTRA 3TB6A 1F51E 3HXMA 3GBPA 3O74A 1A0OA 4TLMB 5TQ2B 5KWSA 3OQNA 3HDVA 2WB4A 4E7PA 5HSGA 5EWJB 2PUBA 1DZ3A 2R47A 4KFCA 3JVDA 5CNJA 4NCAA 1W9HA 4YWHA 4W5NA 3DBIA 3I42A 3C3MA 3F6PA 3NHMA 5KQGA 3LKBA 4WXMA 2LIVA 4G0OA 5FWYB 3LKVA 1MB3A 3D02A 3QX8A 1F4VA 4JA2A 3DGEC 3MA0A 4KRFA 2X7XA 1D1PA 2AYXA 3N0RA 2KYRA 4MQFB 4N47A 1ZGGA 2ZAYA 4PYRA 5FBKA 5F64A 4XFKA 1YMVA 1NXSA 1YS6A 2OENG 2WRZA 4Q6BA 1YS7A 4MR8B 4MR9B 4D6YA 3OQOA 1U04A 4NQRA 3IP6A 1GUBA 4WWHA 1ZDMA 4YLEA 1JFVA 2B4AA 2P4UA 1JHZA 3BBLA 3Q7TA 5T3YA 4YCSA 3MF4A 3HVRA 3BRQA 2R25B 3N53A 4XARA 4XLTA 4E7OA 1SXGA 4KK3A 4PZ0A 4F11A 2QV0A 2VUIB 3QLVA 4KK4A 3RVMA 1JF8A 2E4WA 3RVOA 3EQ2A 1ZH2A 3HZHA 4G97A 2YHBA 3BILA 4MS1A 3TO5A 1GCGA 3Q7RA 3P9YA 1JX6A 1SD5A 4MRMB 3W9SA 3JTEA 5FWXB 4LE1A 4CBVA 3T95A 2QR3A 3C6QA 3GRCA 5DTEA 2XDYA 4RV5A 4TMYA 5EWJA 2PE5A 2FVYA 2F8SA 4LDAA 2L18A 3L6UA 3DGFC 5FWYA 4HYEA 5C5CA 2QSJA 1U0SY 3EDCA 1ZESA 2HQRA 3Q15C 2PUEA 4ETMA 2MYNA 3JPWA 4MGEA 3HEBA 4L85A 4MAAA 4RKRA 3N0WA 3TD9A 4OLAA 4RK6A 2FSPA 1NXXA 3NHZA 3CS3A 4D74A 4RK1A 3OM1A 4LX8A 2A9PA 1Z18A 2V0NA 1USKA 1DG9A 3TMYA 3BREA 1Z12A 1BDIA 9ABPA 1ISRA 4W5TA 3H1FA 4N0PA 4IGAA 2MSKA 1ABEA 4RY9A 2CHFA 1ZN2A 3LUGA 5CNIA 2FLKA 1KRWA 2WWVD 1LBHA 3QLUA 4P98A 1J56A 1KMIY 3GT7A 7ABPA 1CYEA 1TM2A 3EGCA 3O2QB 3HCWA 4EUKA 4KMRA 3KHTA 4TLLB 3I09A 4YS6A 1BA2A 3NBMA 3SNKA 3CZ5A 3MM4A 3QLUC 3HV2A 5BRJA 1XWWA 2GI4A 3O21A 4OLBA 2ID9A 2OQRA 1TVMA 4WZZA 4LE2A 2QVGA 4QPJC 5TPWA 1T34A 5TQJA 1YTUA 1DP4A 3QELB 3LUDA 2FEKA 1I3CA 2IDMA 4H3KB 3KYIB 4N0QA 4UHJA 1IIBA 2LPMA 4OBBA 5TQ0A 2VK2A 1VKRA 4LDZA 3LUHA 4ML3A 1QMPA 4KQCA 2MYUA 3OQMA 2E4UA 4RK7A 4OATA 4MR7A 4IMJB 4KNYA 1UDRA 2TMYA 4Z9BA 5BR1A 3H6GA 3HS3A 2FLWA 4ZMRA 3CZCA 1SXHA 4RU1A 3QELA 1FFWA 2FMHA 2DRIA 3CFYA 3KLNA 4ZMSA 4Z4GA 1PEAA 1RXEA 4W5RA 3CKMA 3NNDA 5CNMA 3H5TA 1Z13A 3OO1A 3H1GA 3TX6A 1P6QA 2FEPA 4FE7A 4MR9A 2CHEA 3FMVA 5B3JA 4LZLA 6CHYA 4RSMA 1ZHHA 3JS5A 5IX8A 4LE0A 1JFSA 1K68A 1L5YA 3LOPA 3LFTA 2GWRA 4EYQA 1E2BA 3F6CA 4Z0NA 1W25A 1XHEA 2E4ZA 4W5OA 1P8AA 2FQYA 2M98A 5ABPA 2F8TA 1RXIA 3I5AA 5IBQA 5KC9A 5DKFA 1FQWA 5IEJA 5IUNC 2NUBA 1EAYA 4G0XA 2E4XA 2PKXA 4HNQA 4TN5A 3NNSA 3DZDA 4YP9A 4EY3A 3OO0A 3EAFA 4MRMA 1TJYA 1MVOA 3A3KA 5IC5A 2HSGA 4QYMA 1U8TA 4EYOA 1BVHA 1TLFA 3MYYA 2L17A 2A9RA 3H6HA 4JAVC 1AB6A 1EFAA 1U2QA 2PUFA 3GBVA 2MSLA 3N75A 4O1HA 2RDMA 1APBA 4JB0A 2QU7A 3K4HA 2H3HA 1USIA 1DBWA 3N8IA 1VRVA 2ZWMA 3QLTA 4G0YA 4HNRA 5BQ3A 1NXPA 4ZJPA 1DRJA 2JK1A 1JWLA 5GQSA 1A2OA 2A9QA 4KPYA 3R0JA 3GA5A 4P1ZA 4MS4B 4N76A 3UUGA 2WJAA 3L49A 4ZPJA 3LUKA 1VPWA 1B00A 1K66A 1JDPA 1OXBB 3FGZA 2HJ9A 5JNUA 1DC8A 3A0UA 1GLGA 2VUHB 3Q7SA 4MS3B 3EODA 1YVUA 4MYRA 1YMUA 2IKSA 1NATA 4MQFA 3IPCA 1M5UA 1SRRA 4GPAA 2IYNA 1C4WA 1RZRA 2CWDA 3CRNA 1MIHA 3IP5A 1Z15A 1JH9A 3A0RB 3FFTA 1E6LA 2IPNA 3QX9A 4N03A 2FTKE 2JRLA 2QW1A 4G0QA 2FN8A 4G0MA 1C0EA 2FW0A 4HNSA 5KQMA 3N0XA 2E4YA 2QXYA 3UKJA 3URMA 1GCAA 1MAVA 3KKEA 2AYZA 1E6MA 4IRXA 4PICA 2PL1A 2IOYA 4EGSA 3EULA 3O75A 2GKGA 4RK5A 2I6FA 2N9UA 3QEMB 5T7BA 5EWLA 2L19A 4L4UA 3VNAA 4N41A 2PL9A 2GX6A 2HQBA 4H60A 3F73A 3O1HB 1QP4A 3OLVA 1ISSA 4Z4FA 5FBHA 4XXHA 4RZSA 3RVJA 4M88A 3S99A 1LK0A 3JVIA 3MIZA 4O1IA 2IPAB 2R4QA 4ZYLA 1Z26A 3H5IA 2YHAA 1JDNA 4FE4A 2M1ZA 3OLWA 4YRZA 3IDOA 4Z4HA 3HUTA 3KJXA 2HQOA 5HQJA 3MQ4A 4Y9TA 3ROFA 1DBPA 4EYKA 4IMIB 5TPZA 3ROTA 1PHRA 1CHNA 4G0ZA 3FDFA 4Z4CA 3NNNA 1FFGA 4NICA 2IPMA 3RVQA 3LUFA 4D6XA 4Z4EA 1NXTA 5DLEA 4DN6A 1U2PA 1ZVVA 4UHKA 3RVRA 3CLKA 4XAQA 3RVNA 1QO0A 1BDJA 1AB5A 2FKAA 4PEVA 3IPAA 1ABFA 5TE9A 4MS1B 5JNRA 2LP4Y 4JB2A 1FSPA 5CNKA 5KQLA 2FQXA 4JP1A 4RXTA 1NXVA 1M5TA 3RVLA 3O2SB 1VLZA 1RPJA 2JVJA 4F12A 5EWMB 3DLBA 2FQWA 3O2JA 3QLVC 3CG0A 4KQ9A 3CG4A 4RXMA 4Z9AA 4DQDA 3C3KA 4KREA 3HM9A 3CU5A 1JYFA 2FXIA 2RJOA 3MMNA 5KQPA 3DLHA 3HO1A 1LBIA 3SM9A 2VYCA 4ETIA 1EWTA 3HUUA 4YR7A 1JYEA 1QNLA 5DGCA 1S8NA 4MQEA 3FFXA 2P9HA 5TQ2A 1NXWA 2JBAB 3H1EA 5BRAA 3LUAA 4RY0A 4WUTA 5PNTA 3Q41A 4Q7EA 3IP7A 4XASA 1RNLA 1QO0D 1Z25A 3C3WA 3I45A 3GWGA 3OLZA 2RGYA 1D5WA 4EVSA 5JNTA 1HEYA 2B1JA 4RKQA 2NT3A 4G0PA 2MSWA 3KLOA 4F8JA 4MLCA 4DADA 2JCGA 3CTPA 1Y1LA 3B2NA 3KS9A 2FN9A 4G86A 4RY8A 5KC8A 2ID7A 1XHFA 3E3MA 4O5AA 5TQ0B 3FFWA 2FMKA 4MQEB 2PAFA 3SQNA 1QQAA 5EWLB 8ABPA 1PUXA 1PNTA 4NV3A 3KYJB 2NZVG 3T6KA 3T8YA 4EVQA 1WETA 3ILHA 5I4CA 4MR8A 3KTOA
chains in the Genus database with same CATH superfamily
3W1EA 4V02A 2WSLA 3EYWA 1A27A 1SR8A 4KLRA 2N42A 4OUDA 3RODA 2CL5A 1OFHA 5BVHB 3CEPB 4F9FA 4OP2A 4J6FA 4TKZA 2BGWA 4GMHA 5BYBA 5TPZD 3HGMA 2W42A 1ZSNA 3FROA 4W1PA 3K94A 1PK7A 4KTVE 1X15A 2ILTA 4NSNA 2WTXA 1Y7PA 3HNOA 3L5KA 4ZT2A 1QF7A 1J9ZA 3H8SA 1DEKA 1I2CA 2QLBA 3DBLB 1YJCA 3F7MA 1LSOA 2ZT5A 3UUWA 3G1WA 3DV0A 4B09A 3CXRA 4QDKA 1YGPA 5H9WA 1NSFA 1SU7A 2IYLD 3JQPA 3ND6A 2GAAA 4PLZA 4D6PA 1F6DA 3CB4A 3JQFC 4NV1A 4R05A 2PZJA 5CW2A 2B8WA 3FOAA 4WJLA 2Y6UA 4KVFA 5L3VA 4I55B 1EM8B 2DJIA 5KTMA 1T4CB 3F3SA 1FC0A 1HA3A 3NANA 3WP0A 3BEDA 4W8OA 4ZO4A 5A5FA 5I7WA 1NFRA 2VUSA 5C9ZA 4X1KB 2IP4A 4FQ7A 3VU1A 1XJWA 2I03A 4CL0A 3MT9A 3D7KA 4U3JA 5DGTA 1ONNA 1R8QA 2PS9A 1KRXA 2QR2A 1KSHA 4FYHA 4OGFA 1AD2A 4MMXB 1C3LA 5A9RA 3HDYA 4QJ4A 2GJ4A 1YQTA 3EEFA 3SFTA 4J1TC 3UW3A 4TT3A 2YCBA 5SYMA 3NHWA 1X7WA 3I9MA 2YYZA 3VZQA 2JIPA 3TIGA 2I33A 4PE5B 3MD0A 2D8AA 4C4ZA 4JT4A 2ZTVA 4BZPA 3PKJA 1DCFA 8LDHA 5KYXA 2FPKA 3BA6A 1UOQA 3KQVA 4HPWA 2ZB3A 3EZ9A 1PZMA 1JIUA 3PE6A 3M49A 1BMDA 3I39X 3QG5A 3W7BA 4D9HA 2P41A 4FDVA 2R8EA 4KLCA 1JI0A 2A5FA 4PNEA 3JQ6A 3VDRA 4XWGA 1LTHR 3RUCA 4C0AC 1QDEA 1YZFA 4L5JA 5FPYA 4D7AA 1AXEA 3OX3A 1T3TA 5F98A 4QT4A 2YN4A 1NLUA 3B85A 1QPZA 1JTEA 4UUBA 1A4IA 4BAZA 2OCPA 4YJFB 2ZJ1A 3ZXSA 2PXAA 3ZZ1A 1Z4IA 1U1FA 2OHXA 4M3NA 4D92A 1XNGA 3DP7A 3FYCA 4WIAA 1ZH8A 5ECGC 4EG0A 4LCBA 3TZCA 1JLMA 3DE6X 3OZUA 4TSFD 3PPIA 4B48A 1JIKA 1FYXA 1FNCA 2OCXA 4NZYA 5C34B 4EB8A 1S2MA 3VR1A 4MQUA 5DRYA 4HDAA 4I1RA 5DEIA 1GDTA 1Q1EA 2O8CA 5AJVB 3QFCA 4IJMA 1CS4C 1CUVA 1VFPA 2Y3IA 4YYZA 3R41A 3KTAA 4HDSA 5G4KB 5LPNA 1XV5A 2R4UA 3N2KA 4J2OA 3T1NA 4GUDA 4YMTA 2MYPA 1WDKA 4M8NE 6ADHA 1W19A 2XYRA 1AQUA 5IT5A 1CZUA 2J3JA 1CJSA 1LZKA 1AGNA 4NPAA 4BTEA 5AI9A 1Q57A 3NBYC 3PHHA 2JD2A 5K0FA 3RBAA 3UH0A 5KYWB 3OIFA 3U56A 3MWYW 2PUGA 1PR5A 4IBOA 4EA6A 2GEFA 5CXQA 1TW2A 4FOOA 1XLWA 1FMTA 2A3RA 2Y4NA 4XJTA 1SCIA 1Y1QA 2QTFA 3VZBA 1KU6A 4EHKA 3F8WA 1XXLA 3DVSX 1BG6A 2HIAA 3FBWA 3ZK7A 1X1TA 3J7TA 1ID8A 4QXAA 2JJ2A 4G5YA 2QVLA 4L3VA 5K09A 2PGLA 3WLSA 4LHZA 3WADA 1DFIA 2EZ8A 4NFLA 1CX9B 2WJGA 5TGZA 5AFSA 1TA0A 2I67A 3PEWA 2AC2A 2BVNA 3VSAA 3OZFA 1GQQA 3PFBA 1VJGA 5EWJB 4YUYA 5JSHA 1KEPA 2FX5A 3INRA 4LYGA 4RGBA 3RK4A 2ZI4A 5CNJA 3TL3A 1W9HA 3OBIA 4NCAA 4REQA 4UE6A 2XB8A 1IDOA 2EL9A 1HDOA 2IE8A 2LIVA 3L7OA 4WXMA 2Y0CA 3BXZA 4M8SA 2DP4E 4J3FA 4NV0A 4QOIA 2ACWA 1X7GA 4YRJA 4AZ0A 5K3EA 1T24A 5EKUA 3ZHVA 1WIWA 3P45A 4BB0A 3C7CB 4KV9A 2IUEA 3ED1A 4C0KA 1JECA 2WI8A 3S2YA 1QGDA 4OD0A 2I6QA 3WYNA 3T5CA 4UU8A 3PVZA 4MCAA 1YS7A 4EOGA 3ESZA 1MAWA 4M8IA 3IP6A 1HZZA 3K7EA 4FHGA 2Z9BA 4L4SA 5YASA 1VSBA 1XCGB 3BWDD 3PXBA 4MW2A 4OBXA 3JQAA 5EXDA 5B7GA 2P4UA 1SHKA 2X41A 3DB2A 4K9DA 4RMNA 4I99A 2FY8A 4NFYA 4ZVLA 2V5AA 5T3YA 4D5EA 3U4QB 1NNEA 3E7FA 2W2VA 2HBQA 2HPZA 2JI7A 3N2ZB 4P92A 1GRQA 3D6UA 3GRPA 2IWHA 1JLLB 4Y30A 3ROZA 3PHBE 1NP3A 4AP6A 5ALYA 4YI3A 4BEJA 4GNKA 3WIDA 3ZE1B 1OCEA 5JH7F 1LBQA 3MILA 1J0EA 4F4HA 1GLVA 1FYFA 1E1NA 1T5SA 4HUQB 4O2AA 2VDMB 4RJ2A 1U7PA 5CCDA 2XUJA 2KB0A 3EVTA 3ZLTA 2P2ZA 2XDAA 1NW8A 1N57A 2AXNA 4PRKA 1E3DA 3K92A 1ECPA 3HUFA 4MQ4A 4B5KA 3OPYI 2PE5A 3EXAA 3VI4B 1H2FA 3DXFA 3GCGA 5J9FA 2A1TS 3CURA 4H7HA 5ELLA 3EBLA 2PFGA 4B3FX 5NLLA 2XEXA 4CHTA 3DKVA 3J7AC 3DONA 1U0JA 5B7NA 2VTKA 1XCMA 1V95A 1XE3A 2PRSA 1E98A 2BTOA 2OOSA 4X1KA 2FN4A 3CSSA 4XA8A 4CKYA 4KYUA 4MAAA 1AKUA 3T61A 2XXAA 1GR1A 5FUVA 3P4UA 1G2PA 3AZPA 1PQPA 1JG1A 4IIFA 2QUBA 4U2GA 3SYMA 2UUBB 4HCJA 3E70C 4ZCLA 1ISRA 2J9FB 3WLQA 1M74A 2Y8EA 4R1MA 4A2WA 2H3EA 4GKJB 1CBUA 1XD9A 4IKPA 3BXOA 2EARA 2O0MA 1FUIA 1XVVA 3BM5A 2HC9A 1M7GA 2GPBA 4S1WA 4ZYTA 1QHYA 4LXQA 3RJMA 4O08A 1OLSA 3IJPA 1A2BA 1VIMA 2D5LA 1CRZA 1Y3DE 3GT7A 4WZBA 4BBZA 1TYBE 2HLNA 2JGFA 4DQ0A 4I2NA 5E7QA 4HXFB 3CH5A 4L5BA 1BEUB 3ESAA 5HBGA 3TLZA 2ODBA 5G0TA 3A9UA 4TKUB 2ZJ4A 3DE7X 4S0XA 3ZDEA 4D3ZA 2IOQA 3JQBC 3O21A 1YB7A 1YL7A 1W52X 4MI9A 1EEXB 1DG3A 1XMXA 3FI0A 2OQRA 1LW6E 1T8YA 4DCMA 5TPWA 1GZDA 1T34A 1O97D 4ALLA 2YJ3A 1J0XO 4OQYA 1QH1A 1JILA 3HSKA 4QDTA 3L0BA 2R2GA 3TOZA 3Q8KA 3KYIB 2EWVA 1W2WB 3TR5A 1R15A 3VV3A 1QGED 1NPTO 1G8AA 1TDJA 2C9BA 1NWCA 3EFOB 3JWIA 3K2QA 3OZCA 4TMXA 3O84A 5ALIA 1GN8A 5SYNA 3BZBA 4TKMA 4IDDA 3MTQA 2NV6A 4ZEOA 5GJBA 2JHFA 3CH7A 4AKEA 4WBSA 3G9XA 2PH1A 1PFQA 1V2GA 3OKPA 4BO6A 2RGUA 3NFYA 4WOCA 2XUOA 1RR6A 2ZPTX 3NWOA 1PTJC 2ZSKA 3OWHA 3THYA 3CFYA 3IURA 2E4AA 4JJEA 1N2XA 5LZ8A 4EECA 5JDIA 3EPLA 5FOWA 3STHA 1AY0A 4B3DA 5I7AA 2WP0A 3GZ4A 1I6WA 1EEHA 3OI7A 2P91A 4QFDA 1RYYA 3EFOA 1FLAA 4RIIA 3ROMA 1O6CA 3PBKA 4D9GA 4FDTA 3JYLA 4R1NA 5E4TA 4XIYA 2VXYA 3JQGB 1G5QA 3IUBA 3M1LA 5B3JA 3FMVA 4DM3A 1PWYE 3BMCB 3JS5A 1RWWA 2EAUA 5CVTA 3GYGA 3DBLA 3SSNA 3EQ7A 1GKLA 3MSXA 2D8MA 1XP5A 1G2OA 3OETA 1QH8B 1YUBA 2BLNA 2J3IA 5FBLB 4HYQA 1P8AA 2IU0A 5BR4A 1WG8A 3A2LA 1UBFA 1IHXA 3PJEA 1TD9A 2H48A 4C0LA 1GQFA 3KEMA 4DWWA 4H0CA 2Y1LA 2NXNA 3DVQX 3PV0A 3VFDA 1WKCA 1BFUA 4O0MA 3ENKA 4WJZA 1S6YA 2XJ9A 2X3FA 3BXXA 4K2AA 2J9GA 421PA 3GJSA 4MRMA 2MSEB 1MVOA 3B7PA 1YE8A 4OKNA 4ZMBA 5G0WA 5C8YF 2FWMX 3IBFA 4NYJQ 1R4MA 4TV9A 3TIFA 4DCOA 3ZW8A 4PSDA 1ANKA 1VA4A 2DFPA 2DQZA 2F48A 4GVLA 3R7SA 1TQHA 3RT9A 4C4YA 4K8RB 1NX6A 4JP8A 1KE1A 2GAFA 4AJKA 3QUTA 4ZEWA 5C8YA 3HRKA 3QTTA 3WK8A 2PX3A 3MMPA 5AVWA 2HT6A 3NYQA 3C8ZA 5I4IA 5A5VA 1NP6A 1YDMA 3EYAA 2Q50A 1B0AA 2VSYA 4HNRA 1NXPA 2GVZC 4NU5A 2AR0A 3H42B 5KSYA 3P94A 4Q9NA 3SDBA 1A2OA 4KPYA 4P7KA 4QUDA 3ZWMA 5CBPA 3NVDA 7ADHA 2OCBA 1IY1A 3I52A 4KO4S 5E2AA 1DEOA 3ZHCA 2WJAA 3IAAA 2YYAA 4AJ9A 4NCKA 4AL4A 1HE2A 4DR4B 3EISA 2HADA 2LD4A 3ROPA 2QTVB 2AT1A 4IHQA 1KORA 4U2DA 4C0HA 5TSDA 5CCEA 2WWXA 3U3KA 2Z8XA 4M9XA 1HNZB 3RTGA 2CBXA 1JQJC 4RVNA 1A5TA 4N7RA 4OXRA 2I55A 4MYRA 5ALFA 2JIBA 3UVEA 3GWZA 2C61A 4FUQA 1ZC3A 4NDZA 4UARA 1XMPA 4Q3AA 4HNGA 1LGYA 1A9QA 4RUKA 2AL7A 1RMQA 2DTEA 4M49A 2K2WA 4RZ3A 5F4ZA 4YXFA 2GB4A 1W0KD 4N82A 5EPOA 5FBZA 4HS4A 4A2PA 2ZJFA 2YV2A 1G3RA 4FFPA 3FFTA 5A7HA 4HLQB 3RSFA 4FILA 1AH2A 1C3XA 3S7TA 2OHOA 1NHGA 4NMHA 3HDQA 1OB5A 1OYOA 3L8EA 3S70A 2QMYA 2QAIA 1UC9A 5CAEA 5LOVB 2CT8A 1C7RA 3FOBA 4Q37A 3CZRA 2HMAA 4MX8A 4BIIA 3A31A 1IWBB 1VLJA 2E85A 3EULA 4HQKA 2EFDB 1V35A 1GPDG 3N5CA 4G8BA 5G0UA 5EMLA 2ZDQA 2CFCA 4TMZA 3SVTA 3ZU3A 3KYDB 2PL9A 5DH9A 1J24A 3EEBA 4ZU1X 4ZCSA 4EG1A 4ND8A 1U2GC 1KYIA 1Y89A 4IDFA 4EW2A 5DNDA 1YBMA 1DRUA 1TGYA 2E6KA 3GEIA 2KMLA 4BX3A 4DNPA 3LSTA 5JI3E 3ZVNA 4ZN6A 1GNLA 3QU2A 5L95A 4IIJA 3WRVA 3AT1A 5JAPA 4DZZA 1N5JA 3O8QB 3O7WA 1UBJS 1UOPA 3U4IA 5JSKA 1PGOA 4Y1FA 2IFTA 4H7PA 4R8KA 3PC6A 3PD7A 1KXZA 1Z74A 1B8VA 1J4AA 4GI3A 5IVPA 3LWZA 5REQB 1Y9ZA 2ZJ7A 1U63A 2JEZA 2OHFA 4HMQA 1YZHA 2B3TA 4WI1A 4Z4CA 4FEEA 3SKYA 5CLGA 3WLEA 4AZTA 3F71A 3LM8A 4K6CA 1ZW1A 1NT4A 2P7HA 1I6MA 2E5FA 3A1TA 4MGZR 4BXOB 4X7BA 1EA7A 4KXFB 2BISA 4OAPA 5IG2A 5F3DA 1TQ4A 1DFHA 1A5ZA 2P62A 4NEGA 2FDCA 2BZSA 2F9MA 1VLZA 2YWDA 1XN4A 1ZK1A 1BMFD 1ETHA 1Q19A 3GVCA 3TZLA 4C20A 2V5VA 3IAFA 1FVHA 1ZIXA 4DQDA 2PX0A 2YWEA 5BWNA 3IPXA 5FLEX 4NAUA 1K6IA 2A6PA 3KOXA 3N05A 2H8KA 3F7OA 4WFIA 3CUYA 3IXMA 1BMFA 1XKQA 4NJOA 4BDSA 5FAKA 1JEYB 4G4GA 4PAGA 1TZKA 4PYNA 1BXRA 3ETJA 3EA0A 4HB4A 1FVFA 5HYVA 4XEUA 3D31A 3L6CA 1G20B 1KEVA 1MO3A 4UM5A 5L4LA 3KZOA 4BFVA 3T4PA 4W5WA 3SQWA 3BZUA 2CZQA 3T1QA 1UBOS 1ONBA 1EZZA 4WUVA 1T6ZA 3MFYA 4R1LA 4QDJA 4RV4A 3CVUA 4C0BA 3LY9A 4G1FA 5LD2B 3U3XA 2XOKA 1OBOA 2ZB4A 3EUWA 4N5LA 4R2LA 2ORIA 3ISJA 2WDZA 4KVGA 3Q8LA 1QFSA 4CT5A 1Y37A 4OLHA 3O9VA 2ZBRA 1VRWA 5SZJA 3GUHA 3WMWA 2EXXA 3KS9A 4L9SA 1E4EA 1WUKS 2ID7A 1XHFA 2Y99A 4YJFA 2C0PA 4YRBA 5IXYA 1XDDA 1FB5A 2MHCA 2ZR0A 3EXG2 5HCNA 1BJKA 2Y76A 2AEMA 2D5CA 2BE9A 2HDNB 1V4VA 1ZD5A 2D5AA 2Z6VA 4JLKA 5SY4A 3ZUPA 4CM9A 4AQDA 5FH9A 3OUUA 3RS4A 3KV1A 1I94B 2XQFA 3T6KA 1E7SA 1YOBA 3RTCA 1EGMB 1EBBA 1RJGA 2ZE6A 4MI3A 4AQYB 2X13A 1O6FA 4RCZA 1SU8A 5ANRB 5JD3A 2XITA 3F5FA 1Z2EA 1VE5A 3I5XA 2J9YB 2PWBA 5ALMA 2HOQA 1MV8A 1VLMA 1WNFA 4EUSA 2OXCA 4IJ5A 1ECLA 1JV2B 3AILA 3DWEX 3P5SA 3CEMA 4PLYA 4ZQHA 3W7AA 2QGFA 4AJNA 4DDWA 1OZAA 2HHCA 1GT6A 3Q7PA 4QX6A 2XNDD 3FCXA 2J3EA 2OC9A 1F2VA 1P2FA 2IW3A 1BD3A 4TLEA 1BVUA 1T91A 2UZ3A 1H2WA 5DHRA 4DIEA 1OLSB 1TAQA 5LZ4A 2XAUA 5FUYA 4CM7A 2BTQB 2KHZA 4EYSA 1P6XA 3NXKA 3IQEA 4EX7A 5K3FB 1UFOA 4E46A 3NUQA 3NAQA 4FFBA 1GU0A 1HL3A 2RI1A 1RYDA 4KYVA 2XMBA 3KG2A 4GHWA 1R8JA 3P9IA 1TK2A 1B2LA 4IVPA 2GXUA 4PX2A 3V4ZA 4JEMA 1I4OA 1L7DA 2FFAA 2LUOA 4IXDA 3RHTA 4GS5A 3RVSA 2YKGA 5C32A 3BMQB 2IE0A 1DAHA 1PSWA 1ZRMA 4HEQA 3CRQA 5J2UB 4HBZA 4K9OA 1Z6YA 5BN5A 3LHSA 5IJXA 4M9SA 1CQWA 4GOND 1HT0A 2QTMA 4AW9A 1IK6A 4YGYA 4XX0A 4BVLA 1FOEB 1SBHA 1CUXA 3BCUA 1NI5A 3KR9A 3MJSA 4GE0A 4RWEA 5IM4F 1TF7A 4QQNA 2CDAA 2DWOA 3KFVA 4TXJA 4R1TA 2QV7A 2V74B 3R3HA 4UM8B 3BE4A 4UEWA 2GYYA 3WB0A 1MXFA 3E4CA 3IKMB 4G6ZA 4B9EA 5JSQA 4D8YA 2DPYA 4GC9A 5A5EA 4UTZA 4XH9B 3GIWA 3BH7A 5LBTA 3ZHOA 3MJFA 3IYLW 1UPXA 4UNRA 4B3RB 5CYOA 2A78A 4OI4A 1GG8A 1PUJA 4M76B 1XTUA 4BNYA 2IUSA 5CJ2A 4ENQA 4R83A 5A4DA 3R6TA 3ZKWB 5COQA 2QYSA 1EDBA 1V9CA 2NVUA 2W48A 4OQDA 4D4MA 2RJNA 1K4KA 3KTAB 5G4KA 4D4IA 4Q7QA 1FXUA 5TF4A 1HG0A 4BLWA 5EQTA 4E88A 4Y2PA 4YV7A 3DT6A 1C0IA 3FWZA 5ALDA 4DRZA 3C5HA 1CZRA 5CPFA 1NJGA 4CLRB 4UDNA 2WF5A 1CRWG 4LKRA 4OQEA 3VR5D 1P7WA 2AF4C 2WOJA 4HN4B 4J4HA 5DCLA 2A0XA 4MR7B 3ZZTA 3LHFA 1M6EX 1XHLA 4MGKR 2XTAA 3U7QB 4UOQA 1PI3A 2DMRA 2C3UA 4I0WB 3EY9A 3C5WP 3DNPA 4GU5A 5GJCA 1RAIA 5JYEA 2NO4A 2V7QA 3NJ8A 3H5OA 3FDXA 2XRMA 2AFVA 1GVHA 4LNUA 5JQGA 1PZNA 1NDUA 3E9EA 1DHTA 3HADA 4OHPA 4RSGA 2IYPA 3GV0A 5CW1A 5IBPA 3K30A 3QEAZ 1E63A 3TZ6A 2FNAA 2YHUA 3O3OB 3RYCA 1GRRA 3LOQA 1GDHA 1IFXA 3RYHA 6Q21A 4HQRA 2MDTA 1F2TB 3QMMA 4C03A 4QICA 4RVFA 3A1WA 2V7BA 4AMVA 3UO8B 2WA2A 2DXIA 3AQIA 1RRGA 1R6AA 4OQQA 4S24A 4XB2A 2YHSA 1NUUA 3QPAA 4GLOA 1FIUA 3C1OA 2EGHA 5D3QA 1CRLA 3G23A 3PI7A 5FAXA 1FFEA 2AW3A 3WHPA 1LRLA 4RZ2A 4F2WA 4V0QA 5AVKA 1YONA 4WBNF 5EJ6A 1M7HA 3DHYA 4KIFA 2VYFA 2I34A 4LQLA 4AUNA 1PWHA 3BULA 4X20B 5I7VA 2R47A 3D2CA 3KD3A 4S1PA 1MH1A 4IHJF 3LPDA 4G0UA 4D02A 5HFJA 2VJKA 5CEEA 4D98A 5A6VA 3W6PA 1FLVA 1T43A 1MB3A 1Z6PA 3O82A 4FX2A 4WXYB 4EL0A 1FYEA 1T29A 3OZRA 3CLTC 1YXMA 2OFXA 3UB3A 1OD6A 4BEVA 2J1LA 2B36A 4ATNA 3CNLA 4LEIA 4WADA 2CNOA 1UWKA 4CRWB 1IUKA 2OA0A 3STWA 4PPYA 3JRNA 1JG4A 3MOIA 1TU3A 5KVQA 3PJGA 2H7VA 2GEUA 4HTFB 3KXDA 3WWCA 1YHZA 4ZCIA 1S2LA 3B52X 1JI3A 4Q9DA 2JLQA 2W2MA 3ETCA 1VA5A 2EFGA 4UBOA 2Q5IA 2V8BA 4F6RB 1B0UA 2PO7A 4F11A 1PFVA 3IOBA 5FA8A 5B64A 4HQLA 3JTMA 3WB1A 4AKIA 4GQAA 4DBLC 3SEQA 1KH3A 4KQWA 1QQ5A 2OO7A 3HJCA 1SD5A 4J91A 1FFCA 4O4JB 3SF8B 3VHXA 6YASA 1OBHA 2XXAB 3ZH9B 2X3YA 4XPIA 2QR3A 4BO9A 1NI3A 1D6SA 1Y34E 1G5HA 4MVJH 2RGWA 1IOZA 1V16A 1PW5A 2VO1A 2WNIA 3NOVA 3AJAA 4LHYA 5DOZA 4FB5A 4L28A 3GJ6A 3JQGA 2J4FA 4WD3A 4BFZA 1XI2A 3UZUA 1I3OA 4WLFA 3RARA 3EDCA 3DAYA 1I36A 4NATA 2PUEA 4X7PA 3OJFA 1G9SA 4U4AA 4WA8A 4Z2YA 4NLLA 4JGBA 5T8KA 3RSOA 2IU3A 2P75A 1M1XB 4P4UA 4RKRA 5FJJA 3TD9A 1SM4A 3FOFC 2G6TA 3AF3A 4EGFA 2O5EA 2AWNA 1WMBA 1PF7E 3OC6A 1T0UA 3I2IA 4K0RA 1XQ9A 2G82A 2UZ0A 5P21A 4B82A 2A9PA 5AHKA 4BFXA 1GG2A 4E5KA 2C84A 4DV4B 3RTEA 1SHUX 1M2HA 4KN5A 2WG1A 2W2QA 2HNKA 2JAPA 2JD1A 3OSUA 4WEQA 1H1LA 4KOEC 2B8NA 2RHRA 5IN5A 3H86A 4LG1A 4N5HX 3LS2A 5FUWA 4OMDA 4IEEA 2OT3B 5AW7A 5DNCA 2QPOA 4GE3A 2QRHA 1NIPA 2Q5QA 2TSYB 3I8OA 3F9CA 4RY2A 4UNPA 3BD7A 4UZSA 4XIJA 3M4YA 2VT6A 4JBIA 2CMDA 4MDYA 4OIMA 4D3XA 5A03A 3W9UA 2NADA 3OCUA 3A3OA 1J56A 4ARBA 2BFEB 4FBGA 1O6GA 2Q9AA 4DQUA 1T36A 3MWEA 2P2DA 2MJLA 1LCIA 1TM2A 2IYVA 2QAJA 2FZVA 3TRDA 4ZCMA 2JEOA 1MQSA 6LDHA 1RYBA 1UXOA 3A4LA 3C6YA 1NF2A 4OMUA 2EHDA 3OVMA 2F64A 4M54A 4QBGB 1JQAA 1GEEA 1UFKA 3HV2A 5D1NA 1UPBA 1T0JB 5G41A 1YA8A 2GK6A 1RJFA 2C20A 3TLYA 2WSBA 3K0FA 2HV8A 1HMPA 3V6LA 1VG1A 3QNUA 1QE0A 4HZIA 2VYND 1U9YA 5HF8A 4YPVA 2D0OB 4TZTA 5LP6C 3ZDFA 4CDNA 4YP0A 2VWQA 4UTNA 1GZ3A 1XELA 3GVIA 4O4IF 3MWEB 3SS8A 3MJEA 1GAXA 1X13A 3OCJA 5HUJA 1CF9A 1DPFA 4YRLA 5KOHB 4ERNA 2IYSA 1PV1A 2HSWA 4JVOA 1Z7GA 5KNLA 2IPOA 2IZZA 3EVNA 1QHHB 1OH5A 1SXHA 4UREA 3QX7A 2DUNA 3IOEA 3SZMA 1OIXA 2EFHB 4DWJA 1KHTA 1QC5B 2ADOA 1GM5A 3RAEC 4MULA 3D4NA 1MP0A 1WEKA 2Q5OA 4GR5A 1J2EA 1USWA 4AIIA 1YQUA 5T4EA 4HB3A 2O9JA 3TWOA 4JV5B 1VKOA 1I13A 1Q11A 1FFXB 1TKBA 3CRMA 3FYDA 1XZQA 4JLBA 2IUTA 4MIKA 4PG6A 5A3VA 1YKFA 3LBYA 4XCQA 1F8UA 1Y9EA 3VPAA 1RSZA 4F93B 2WIBA 1JLRA 2OZVA 1EFKA 2WHRA 4ZYUA 2JGLA 1JFFB 1JXMA 4D97A 2O1EA 3O4IA 1YNSA 2MMGA 4C7JA 1ZU4A 5LLTA 3QKUA 2FQYA 4KIUA 2ZRQA 3RSQA 3TRHA 3TXAA 2PU5A 1CRQA 1OX6A 2H5EA 4HNQA 1Z7EA 2OBBA 2RG1A 3MUNA 3NKFA 2H18A 4G0XA 4RJKA 4HG2A 3IPLA 3E15A 3RHZA 4KMSA 1G8JA 1H2ZA 1WSDA 2IY9A 5KCZA 3O8CA 3SR3A 3AVYA 4G0WA 1PNOA 1SQSA 3FSEA 3TM4A 1MOZA 3M6IA 4GOKA 2P0EA 4X3OA 5TT0A 3ZYCA 4LNAA 4EYOA 3BMOA 4FK8A 3A9RA 3NTOA 5A9SB 1J49A 2Y27A 1PV2A 3NB0A 3QU4A 2ZPUA 3RWBA 1DTWB 3U4HA 4ARIA 2VC2B 4JLSA 3D0QA 3I01A 1JWBB 2C5SA 2H1OA 1D6JA 4GWGA 4BQPA 1VRVA 2XTNA 4OJQA 2AR7A 5BMOA 4JNCA 5BQ3A 5JVDB 3K9LA 4CUZA 4A16A 4M7RA 4K1XA 2GN1A 1P81A 1BMTA 2A9QA 3ESRA 2R0QC 1TU0A 3V3TA 3DXZA 4OEHA 4MS4B 2PMWB 2W4QA 2CDBA 1SWWA 2H5IA 2B78A 1N2IA 4LOIA 1KI1A 4AIRA 2EV9A 4A0RA 3BSYA 1DLJA 1TKRA 2R87A 4XCXA 1KJQA 2HCTA 4C22A 5FTJA 2DKOA 1C7FA 3PFCA 3U31A 1O58A 4IZIA 5B4TA 3O9ZA 1UKYA 3ODPA 5ALJA 3ADPA 4M1YA 4PZCA 4X44A 1N2CB 3ZY3A 4YAGA 2BGKA 4BCBA 3HHPA 2VYVD 4ER6A 3KUDA 5AW1A 3HCFA 2ZJ0A 4KE6A 3AI2A 4UATA 4DSUA 1DAEA 2F00A 3EZ6A 5DNWA 4N18A 1MAHA 3FJYA 1EPUA 4GGOA 3DO5A 2PM8A 2YC2C 2AJ8A 3KTFA 1RVV1 3I1YA 4CWAA 1F7VA 1ULUA 2JRLA 2GPYA 4URWR 1ZXBA 3Q6IA 1O54A 2NACA 3AUSA 3MWLA 2YY5A 2LCIA 3PGVA 4IIVA 5ULLA 5EHQA 2PLFA 2YMPA 1AV7A 4Y6OA 2OHIA 4XDZA 3L6BA 3LLMA 2ENWA 2PL1A 3VR0A 1VLLA 2XI4A 2NZXA 3EZFA 3G6KA 1LQTA 1QBKC 2VDOB 4MWGA 4NAVA 4BN5A 1XYGA 3E9CA 3C0KA 4GXNA 5TR9A 5JRJA 3KC2A 4BN4A 3O1HB 1SH7A 2FR8C 4J07A 3WLIA 3E81A 3JSAA 1GPAA 2AA3A 1P7YA 1KYVA 2VJMA 4YDRA 4RZSA 9GPBA 1ZJWA 4ZAGA 4IL5A 4YCBA 1GNPA 1W44A 3HBFA 3IP8A 5GGXA 3ADDA 1EP3B 3L7YA 4HGNA 1RZVA 3DZJA 2OM2A 2Y66A 2CXXA 3QSGA 2JJQA 1EQUA 4QVGA 5E7MA 3TUJC 3E2IA 4J0JA 5LP1A 3R9IA 1XNQB 1DMSA 1KQOA 3AR5A 3IT2A 1TZMA 5EZYF 3S2GA 1E20A 4KIGA 2FUEA 2HQOA 4PU0A 5A62A 3KOYA 2JANA 4FLEA 3UA4A 1C8KA 1N1MA 1M0EA 4DR6B 1KYTA 2V6GA 5FQNA 1SQ0A 3I92A 2ORVA 3OIYA 2EW1A 1KDOA 3NC1C 5K0ZA 1EWQA 4AU1A 4I1IA 3W5JA 4M60A 2OFOA 4EPTA 4D6XA 4BC0A 5KTKA 4JUAA 1DBSA 1R27A 1Z38A 4A73A 1MIOA 1ZN7A 3RVNA 4C5AA 2ONCA 1NNI1 1UR5A 4D0NA 2I0FA 2OZLB 3W1WA 5TE9A 4CV2A 1UAAA 2IXFA 2LP4Y 3CB2A 3HEAA 3T35A 2X22A 4EG6A 4OYYA 4H3SA 5DT2A 3CZ4A 1MV5A 4GM4A 3OHSX 4HDKB 2UU9B 4CM1A 4A10A 3LRPA 3W8EA 4JJGA 1F60A 4G1CA 3N07A 4REMA 2HZ7A 2I4OA 2GK3A 1XTZA 4LYYA 1QGAA 3EDQA 4TL6A 3W7VA 3SBDA 5AJZA 1U2SA 4ETIA 4I5IA 4WY2A 4IV5A 1C7IA 4F91B 3EPHA 1VJRA 5L4SA 1Z9BA 2Q3FA 3FFXA 4GOXA 5ADVA 4DSAA 1CETA 3E27A 4WBNA 3TRJA 2ZK7A 2JI4A 3LBNA 4EI7A 3AHJA 1YA4A 4LCEA 4TYMA 4CI0B 1IM5A 4P7GA 2PGXA 4RPJA 2RHHA 2D7JA 3LO8A 5G3ZA 4P0TA 5HIIA 3RKRA 1SU6A 2XA1A 4DMUB 3ZDQA 4CEIA 3G1TA 4F8JA 2GILA 2Q46A 4DLUA 3ZS8A 3AVVA 4O5AA 4NNOA 3C8HA 2J0UA 5C80A 3W6ZA 4AJJA 4F4JA 4AO7A 1RAGA 4RQAA 1UJNA 1MJFA 2GH1A 3DE0X 5JZ9A 4FN5A 3ZYZA 4O2LA 1ZO8A 2C5LA 2HA0A 3OT1A 3LFHA 2JGJA 2O19A 1V5GA 3C1TA 4QGAA 4X5OA 5FCDA 3K4PA 3LD9A 2I4LA 3STXA 3VQTA 5FBQB 2AI2A 1NBME 1KP2A 1KP9A 1SXIA 1WCIB 3G17A 5IXSA 4KR3A 4H1TA 4WXEA 1DPGA 4IOKA 3NCHA 3OMWA 2C5HA 3RUFA 3V2GA 2H9YA 1DTWA 4PYMA 2YJZA 1DQZA 4EBBA 1X6VA 1RM5A 3LXXA 3NATA 5DLPA 5DK4A 5EI5A 2CF6A 5HM8A 3L7MA 3NOQA 1QOZA 1L5MA 3DUWA 3FPAA 3VAAA 1KNXA 5HQ3A 4DV0B 2O8BB 2X5JO 2Y0DA 4TTIA 1Z2DA 3UAZA 4QELA 3DO8A 4KACA 1GWNA 1WJGA 5DXAA 5LA6F 3F6RA 2ZREA 1KEUA 2IW1A 3TOXA 3CVOA 5CUQA 5CFPA 2WWHA 2RHTA 2V8OA 4J9UE 3QHQA 4P33A 1E9RA 3AGQA 3MCZA 4O59O 3ZI7A 3GLFA 5IULC 4O2RA 2YCLA 3DFIA 1KEEB 4LXIA 1BEZA 2AC4A 1WUJS 1M7BA 4JC0A 3H84A 3PHLA 4I3FA 3Q5EA 5TJ9A 4BLQA 3F7NA 4A8JC 1ND6A 4DSOA 3ESXA 2ZVQX 3SNHA 3FDJA 3ZWQA 3WYBA 3AKZA 1KYWA 1N3YA 1PEKE 4U7JA 1PZXA 4K40A 4RIHA 1FJXA 2WPDA 3M4XA 4RK4A 3B20A 5BYJA 5I7SA 2OPBA 4MGHA 3WYDA 2YFYA 4JH0A 3TQOA 5A3JA 4D9MA 5CFQA 1AQ6A 3T0IA 2VXOA 3BTSA 3T4EA 3QVLA 4QJBA 4FYJA 5IRCD 1DFGA 3HC7A 3ICWA 3JD2A 4EM6A 1FS4A 2IXEA 2HYIC 4O4JA 3R0QA 4FCVA 3Q5DA 5AVVA 5LBIA 4J0HA 4Q34A 3FDZA 1KIAA 2C4MA 3HXKA 3CO5A 5DN9A 3D2AA 4URZR 3SGLA 1GZSA 1FTSA 1DKNA 1O7JA 4A2CA 2X19A 3IBYA 1YK0A 2OOKA 3JZDA 2CLKB 4QLAA 4RULA 1CEYA 1ZCFA 4BNDA 1JBQA 2R1VA 4OKSA 2FUNB 3AL3A 4FDAA 1SJ9A 3MJRA 3ONFA 3JYNA 4UCQA 4FFBB 2ZBPA 1DQRA 3V7WA 3ZWKA 4CXMA 3DHEA 3MWKA 3ERCA 3WIEA 1HSOA 1NMZA 4JLMA 1YK1A 2XVMA 3RUDA 4HAIA 1QFMA 2F55A 3INYA 1ZG3A 1K88A 2JD0A 4OHYA 1RFGE 1JL3A 1O5IA 2HIGA 3CQ9A 4FT4A 3QWHA 3HYSA 1Y81A 1GUDA 2G0TA 1RXVA 5GOTA 1Z29A 4ER3A 1D8AA 2JFHA 4BRZA 1F14A 1ZCAA 1H1LB 2PR7A 4G0VA 3HLTA 1UJCA 2JH3A 5E38A 5JISA 1US8B 3EVAA 2FW8A 4LI3X 4WMLA 4MTLA 3RTDA 3VNVA 3OE4A 1U1DA 3F7TA 5JPDA 1RWBA 2IGTA 3V5NA 4P0QB 4KC0A 2IPLA 4GVPA 2VJBA 3OEWA 2FEWB 4X84A 5D7BA 1ZJ6A 4S12A 3D4PA 1XZFA 2DY1A 4JJ6A 4MGIR 3DWGA 4YJ3F 3WE7A 3HXQA 3HJFA 1E3LA 2FZEA 4QM6A 2C1ZA 3PUIA 3L07A 2ZBUA 3Q7EA 4C0JA 1YAHA 2PGNA 3FN4A 3KHKA 5G53C 3S5UA 4HDKA 5CHYA 5LYJB 2UXDB 1UP6A 5KTTA 1IVSA 2WICA 1SBCA 2F1KA 3F46A 4TVSA 1VDZA 3LUCA 3SI7A 1YR7A 2FP4B 3QBEA 1ESZA 3EXFB 3SJCA 1U2ZA 3VHRA 1C4XA 3PQEA 4EZEA 1NQVA 4ODIA 3UJ7A 1CUFA 1L8LA 3A32A 3EAQA 1M2NA 2C8KA 3JD1A 4EPYA 5LU9A 1SOWA 3EK2A 2GCNA 5HKOA 5HDBB 1UP7A 4JLPA 5F23A 2EJUA 1KJWA 1F5SA 5DULA 1QLJA 1YZLA 4OQZA 3E9NA 3KDSE 3N58A 3TYXA 3AR9A 1LFAA 1UBMS 1AUPA 3VC3A 3M6FA 1D09A 4BJ3A 1YI1A 3IA7A 4F1WA 1KI6A 1VG8A 4B35A 5K3AA 5BT8A 1ZK4A 4HTFA 2CFRA 4II7A 4G0OA 3ZGZA 3OAAA 4XJXA 2ZRJA 1MC5A 2XRYA 3B1YA 3DKPA 2CLLB 3KOMA 1OFUX 1Z45A 2PPLA 1B41A 3AFNA 4KRFA 2A0UA 2ZS8A 3PF9A 4PG5A 5JYBA 3TF5A 2PU7A 121PA 4KN6A 4LSWA 3ZE2B 2Z1NA 1ZNQO 3WGGA 1IBRA 3LP5A 1DXYA 3W2HA 2H0RA 5KNCA 2F3RA 1TIBA 3TW8A 4LVOA 2JPDA 3V34A 3V80A 2QRVA 4RFSA 2W2TA 4HB0A 4LTNA 3K05A 1Z6QA 1GA6A 4MCHA 4D0SA 3OF2A 1XO1A 2GKSA 2EF0A 2YNMA 3KVYA 2P4QA 1NE2A 3NRBA 1VKJA 4N9WA 1I1HA 3P97A 2AZXA 2IIQA 3A3YA 5EMNA 3R5SA 4XLTA 1P31A 3K1TA 3UMMA 2XMZA 1FVOA 1YOVA 3EXEB 1X38A 3BWMA 2BHRA 3RWOA 1JIQA 2CL0X 3QLVA 5JV5A 3C98A 1BHQ1 5FOQA 1L5HB 1Q2UA 2GN4A 4R01A 4BMXA 3L0PA 1W9MA 2RHOA 1I1OA 1H5QA 3OURA 4ROSA 3BBPA 1G8SA 1Z8NA 2F9LA 3C6QA 4UDXX 3CE9A 1RTTA 2OYRA 3X1ZA 3PJRA 3ETGA 1P7CA 2VJLA 3I2HA 4ZT3A 4E32A 2OC4A 1W48A 5EJFA 2FVYA 4TTRA 2C7OA 4KMOA 2Z08A 3Q85A 4RD6A 5K20A 1TF5A 1U94A 3OPNA 4OJTA 1J22A 5TMDA 3GT0A 2G9RA 4KR9A 3OPYB 4KR0A 3I4FA 4W1QA 3UFXB 5C5CA 3C4JA 5FL7A 3IT1A 2BMDA 5KVAA 3K2BA 2H4HA 3NHKA 1PE0A 2PV7A 4DY4A 4MVJI 2A5JA 1WS6A 4DJAA 4OLAA 3DKKA 1DWQA 2A59A 3IQIX 4CDMA 3QVKA 3EZLA 3QE0A 2QX7A 4KGZA 4L8YA 2B0CA 4NH0A 1A2KC 1N4AA 1DG9A 5J2TA 3REGA 2VZ0A 5GZ3A 2E6UX 3ZI0A 2XD9A 1FRNA 3EF1A 4LRSB 4DCCA 3R74A 9ABPA 1J2YA 2CNWA 5T4FA 2YY7A 2QD1A 5EZSA 1GP2A 4E09A 5HW0A 5LMNB 4TYWA 1TIKA 2ZROA 4B6PA 3ICOA 4D79A 4KQHA 3DBRB 1PGNA 3PC8C 5EE0A 3LUGA 3OZXA 1FW8A 3BMOB 1FMCA 3LLUA 1XWIA 3JQ7B 4WNCA 3N28A 4D3SA 4E5YA 2WAAA 2ZIFA 3TSOA 4WX2B 2ZJ5A 3OHMA 4EDHA 3R20A 3ND5A 1UKEA 4KE8A 2ZBFA 4KI7A 1JHMA 1X1DA 7ABPA 1E9FA 1J9GA 4OH1A 1AVTA 3TR6A 4KMRA 1H69A 4Y2VA 3RS8A 3A4TA 2XVZA 3LQFA 4L51A 1R0YA 2W2KB 2EL7A 1E2JA 3O4HA 4UMDA 1ECGA 5B1DA 5DXFA 4F72A 1EUDB 5BRJA 5JATA 5CIQA 4ZA2A 5JQWA 1XB2A 4OLBA 2A9FA 1N2GA 3IRVA 1S02A 1NW3A 1DP4A 2P9FA 5DZSA 3FG9A 3WKAA 1K0FA 1FF9A 1ZVKA 1F6BA 1SG0A 4IGEA 5ICCA 3ZG6A 1W4CA 2I4NA 4PSUA 5TQ0A 1EINA 4LYAA 2G3YA 1VKRA 4MSUA 4NMLA 4G81A 4ML3A 4MDEA 5DBGA 5FOVA 4EK9A 1AS3A 2PWYA 4O6VA 4RK7A 5H4GA 5GINE 1KY3A 1U3CA 2X5OA 4IDBA 1JEYA 3KNZA 3WXMA 3DFFA 3HS3A 3OKFA 2IH2A 2GM9A 2ECOA 2F9FA 3ELBA 4M89A 3BQMB 1S4QA 3CGWA 4KPUA 3CMCO 1DAOA 1HLFA 3EWAA 3KRTA 3ZDZB 2VHCA 2O8DA 4TXNA 2G63A 3BA1A 3EIXA 2PFKA 3Q3HA 1UBSB 1SD1A 5KSWB 1KWKA 3HCCA 3H5TA 4RIEA 1Z13A 4PN3A 3A4IA 3D3JA 1SUWA 4I8XA 4E70A 1IZ9A 2PV0A 1ATIA 1IQUA 3TI9A 1K8ZB 3K16A 4PHGA 3L6RA 3G68A 4RSMA 3HL4A 3ZWYA 2VLBA 3PX2A 1JFRA 1IE3A 3KLBA 1R00A 5HZGA 4Q24A 5BUZA 1UXIA 2ZSEA 4B4KA 5AKLA 5BSKA 2GN0A 3IP1A 3H5NA 3TLAA 3UQZA 3BWBA 2O5RA 1XJCA 1M2OA 2WQ6A 2F8TA 2WFLA 1ADJA 4B3MB 4ROTA 2ZWPA 4FDUA 1KAQA 4RQTA 4F86A 5KC9A 1H3EA 1DARA 2IYXA 3M1IA 4Y2HA 1EAYA 3QU5A 3W77A 2PKXA 2XTMA 2CF5A 2IDJA 4W82A 3GGSA 4U8HA 4ZKDA 2J5XA 1WNTA 3UOAB 4BNKA 1DRWA 5C0OE 1W87A 3FWNA 1TLFA 4D9BA 3GH1A 1HI9A 2ZIVB 1BKSB 5A4MS 4HFNA 1EX6A 4EO7A 3ESQA 1S2IA 2PXHA 4HVCA 1Z4NA 4O2AB 5B2ZA 1ESNA 1VPEA 3C15C 1WB9A 4QHSA 5JSFA 4CLXA 3F6BX 1PR0A 2ZWMA 2D5BA 1HFEL 1Z4KA 1R64A 2GTIA 3EFEA 1YMQA 2VZEA 4L3OA 2PTGA 5AKKA 3AEZA 1HE1C 1GYPA 3CEHA 4KQXA 1KR2A 1OB2A 5IKMA 3SIRA 4DLPA 5H3HA 4MJXA 4LK3A 4JHXA 4UAVA 2NYRA 3IMEA 1QZUA 2DBZA 3AR2A 3LYUA 4E08A 4KMMA 4LS3A 4MLPA 4RYLA 4KDEA 5DDIP 1P1RA 5IP5A 5I8PA 5A05A 3VOSA 2XCSB 3GLGE 2JLWA 1ADYA 3GP3A 3IPCA 1VKNA 1FSGA 4XPIB 2O2HA 5FORA 2CHVA 3KQYA 4BNXA 4B3XA 4FLFA 1L5QA 4I4NA 2OXIA 2M6LA 4JSTA 3IKTA 4TUYF 4GSKA 1UKBA 2WWWA 3QX9A 1SBNE 2E7ZA 2I3AA 4UASA 4CG0A 1KQGA 4FGKA 4QGBA 3WTBA 3QQPA 5IS2A 4KGVA 2G8NA 4HOYA 3UKJA 2VP3A 4ZIRA 4J0GA 4HL6A 2AYZA 5KPDA 4QATA 1E6MA 3O93A 3GLKA 4JYBA 4JJKA 4WXPA 5KAPA 3RCBA 3ZZMA 5AVYA 4JP3A 1LEHA 1ZD4A 3PNSA 2GKGA 3MTJA 1Q44A 5C8YB 4TMKA 2BFCB 3WNDA 4TRJA 5I51A 5T7BA 2H2DA 1Y6QA 3ZK9A 3MLBA 1GAQA 1QVRA 3EGXB 1O4WA 4BNTA 4PGAA 1V3UA 3L7AA 4YQZA 4Z4FA 2GZMA 5JXWA 1Q20A 4YAIA 4PTYA 2PMBA 4QVKA 2GM3A 2HWYA 4EPWA 4ZVNA 3THXA 3I6IA 1NI4B 3AKDA 3HCNA 4G09A 5GOZA 3IR6A 4A03A 4BWVA 3O90A 1R6VA 1PO7A 1UOOA 1NBAA 1SC6A 1XQ6A 1G66A 2J7KA 4JFAA 4HKTA 4DXHA 3BIOA 3KOWA 2IH4A 5BOVA 1M6YA 2QRPA 3A3NA 3FAKA 3IDOA 3JYHA 3QEOA 4JSYA 1P7VA 3FWHA 1VKHA 1XJ0A 1KY2A 3V4VB 1U0RA 2IF0A 1N5KA 2ID4A 1VTKA 3T99A 1ID1A 4DN6A 2FOIA 1VYUA 4EJSC 1IXKA 4BPBA 3U7HB 4B46A 3PWSA 1QO0A 2ZYGA 1EFPB 1Q14A 4L7QA 4KYTA 5KYUB 3MERA 1E7MA 2OAQ1 2XE4A 1VMDA 2ZSJA 2GZSA 3P0IA 3WNVA 3WLTA 3UPTA 1Z0DA 2FQXA 3EF3A 2H11A 4N5MA 2I8LA 4UVIA 4XVRA 5G1OA 2DERA 1D7OA 4L76A 1Q84A 4UNSA 1I0LA 2EQBA 1LV8A 4KREA 5ECYA 2QSUA 3LBFA 3K73O 2UYOA 2A86A 1QAQA 4XPZA 3KX2A 3ORRA 4MA5A 2AZTA 3A1EA 3EARA 4MQMA 5EIWA 2HF7A 4K87A 4L02A 2ZJ2A 3HO1A 2O6LA 1AKNA 5EMKA 3ZLBA 1PR1A 1PP4A 4MVJM 5D5HA 1ENPA 3HBMA 3AFGA 1QCZA 4XVHA 3D4LA 2C0CA 3H9GA 2HCJB 4EAQA 3LF2A 3DD1A 1L7AA 4MIEA 1B8UA 4UU0A 1XPOA 1F9AA 4RL4A 4L27A 3MJDA 2ZXUA 2AQ8A 1W8DA 2SHKA 3D43A 2JNWA 3EG5A 4M2LA 1CZHA 1I1QB 1RNLA 1Y8QA 3HGQA 5KJEA 3KSUA 4IMPA 3VR6A 3AU8A 4B8WA 2GJKA 1X9GA 3HI4A 1DO0A 2JCGA 4UBIA 3W6UA 1QVVA 5CVJA 2CFSA 4JA0A 4BQOA 2C9CA 5HS6A 2QTVA 2NIPA 4OL0A 3SQNA 2PJZA 3CSDA 4NDAA 1ULSA 2CL7X 3DT8A 3IBGA 3K15A 4X8HA 2HXSA 3KPYA 5A5DA 2C3OA 4XX0B 4P3OA 5FL3A 3VPXA 1G9TA 4P82A 4UQLA 4EVQA 3DVAB 4JBGA 2Z4TA 3X43A 2G1UA 2IZ1A 4QVIA 4MVJE 3KSZO 3LQKA 5FQOA 1Q1BA 2XUDA 4ZOAA 1XEAA 2CSUA 3TKLA 4B74A 1TL7C 1YE3A 4LSZA 1DKMA 4X3CA 4K7JA 1B43A 1ZOIA 3JRWA 1GNSA 1P3DA 3KKNA 1W5SA 4FHZA 3QI2A 1T1EA 1NR7A 3N7AA 4IX1A 4PLHA 2G28A 3SPXA 1VI2A 3S2SA 1QUEA 1XDZA 1FMJA 3TNFA 1CULC 5ALQA 4YJKA 5FTMA 1W93A 1NMYA 4CODB 1GSOA 1Z35A 1ZIYA 4XQGA 4DA0A 3NHYA 1JGTA 3K8QA 4B3GA 3C97A 4EMUA 3UV6A 1YZNA 4L4YA 4GNRA 1Y8ZA 4OH7A 5G40A 4IH1A 3A26A 3N76A 3ND7A 4Y1RB 4JQSA 5LB2A 4B0OA 4OHVA 2XOEA 3RBVA 2CYBA 3RB8A 4CKXA 1RYNA 3UANA 4OKIA 3JALA 4RTPA 3L4JA 1N5OX 4FPXA 2PN1A 2W2KA 1IBKB 1CDZA 1YZYA 4ECAA 3KEQA 4CCWA 4FYXA 4PS1A 3AESA 4G2TA 4V0RA 1F8XA 4G1VA 4JYCA 2I9KA 3KAKA 1T2CA 1QYRA 3LHKA 4FGUA 4IIJB 4BFYA 4P31A 3TMKA 1YS1X 13PKA 2B83A 4HFRA 2H7YA 1H85A 5IC4A 1XU7A 4G3XA 4FX5A 1JEOA 3HB5X 5E8RA 1NBEA 1MH9A 4EO9A 3JALB 2R84A 3THWA 3QJ5A 5ICFA 2FSFA 4RF2A 2VOEA 1V8BA 2I9PA 5BV7A 3C6ZA 5AWFC 2P9TA 4RMIA 3U40A 3W06A 4JOQA 4EY4A 4L73A 1M2FA 3Q8MA 3ROXA 4OGKA 3U19A 4EJ2A 1KC1A 3W8DA 1Z2OX 3LRTA 4MYCA 5I3ZA 1WHTA 2C7VA 2Y67A 2QUIA 5I7EA 5EJGA 3GFFA 3A8TA 4MUMA 4MW7A 1T1GA 1CV2A 2G0AA 1MMFB 2VF2A 3N6VA 3QE4A 5FIUA 2B7CA 1TGVA 1UAGA 1V25A 2EU8A 2H1HA 2VVTA 4GBMA 4UHCA 4NFSA 3PQ6A 3L8HA 1ES9A 4JU9A 5J2TB 1I0ZA 1OQAA 2HEGA 2Z6QA 1JE0A 1ZH4A 5LMZA 1W59A 2YMLA 3JYPA 2CLCX 3U81A 1MA0A 3E9QA 3TLCA 4MQ5A 4F4UA 1V5WA 2C00A 2WINI 5JD5A 5FADA 5B58C 2UYQA 3WC4A 4YX9A 4KQIA 5C1OA 2BGGA 4YIHA 1P6UA 3AR3A 2DPXA 1SZDA 4E2FA 1PTKA 4UMVA 1CQJB 1DWPA 4OIFA 1P4RA 3NH6A 4CM4B 1UQUA 3N7TA 4S05A 1R8XA 4A8TA 3UYLA 1JEEA 2ICAA 1YUNA 1Y6ZA 4NOLA 1MB4A 3WY9A 4UJ3A 2LE0A 4B43A 5IFLA 1N2OA 1NG1A 1PJSA 1OBCA 1Z5GA 1E5DA 1VSQA 2Q6TA 5JOQA 3EQZA 3KYCA 5DB4A 3IUNA 1C9EA 3SC6A 1U0BB 3SD7A 5JLAA 3TSYA 4FZ5A 5CK4A 3ZGYA 3G79A 1YDFA 1DBIA 2F59A 1H42A 2GLTA 2KPOA 2ZBGA 4QYWA 3TK1A 4B1FA 1ECFA 3G88A 3G9ZA 4ZGBA 3OJEA 3OMLA 1OA1A 3GYBA 3U39A 3ZXYA 4MPTA 3NZEA 2O05A 4JL6A 4AP5A 3DOUA 2OCDA 2W22A 5GJVC 2I62A 1ZHOA 3I28A 4AF6A 1D4OA 4N65A 5MFZA 3L18A 4JLDA 5CCXA 3ADKA 3B53X 3ZD9A 1N36B 5LIPA 1TVCA 2ECPA 5K3SA 3S2IA 4UUMA 3PTAA 2F4VB 2HCRA 4F5EA 2C5AA 4H16A 5SICE 2O3TA 4A5OA 1J0DA 4FHFA 4KN9S 4O4LB 1XXHE 3TZEA 1BQEA 3E4DA 3HP1A 1E2DA 1AKMA 2F90A 3DM5A 4F9TA 4J7CA 2W2PA 4C7MA 5KREA 1ILWA 1ZJJA 1Z4OA 3QNWA 4WEOA 2RHMA 5BMVF 3TQRA 3A1SA 2VDKB 1B3RA 5DNEA 4QUAA 2ZVJA 4FYVA 4IQ4A 4LBZA 4BO8A 1I4TD 4P2BA 4B0PA 2QXTA 4LNUB 3UENA 4BC1A 4RJTA 4DA8A 3IVMA 2VJQA 2H16A 4PYLA 4TMTA 1IONA 3ZDXB 4HBGA 3EZNA 4LPKA 4JKOA 3WGHA 4QTUB 4CU2A 1UDBA 2PL5A 2O4CA 4M1OA 3IUJA 3ZU4A 5JECA 3NTXA 1B0ZA 3NV9A 3PF8A 3OPYA 5LN1A 2GZDA 2P0AA 2PZFA 1WXFA 4CG3A 2FOXA 2YHBA 1SQGA 3H2ZA 1JT2A 4QIHA 3WIVA 2JFPA 1XZLA 2VP2A 1L3CA 1J2UA 2PFSA 5AQ1A 1R6UA 2KQUA 2PVPA 4FQ8A 5ITVA 3L93A 1NA5A 4JLJA 2I7TA 5JR3A 4IDOA 3A6DA 2ZRFA 1I3KA 3UEOA 3ME5A 4IIXA 3P9RA 1IC6A 1E94E 3C16C 1Z7BA 2YN2A 3T4UA 3UM9A 4WNYA 2VCHA 2GHTA 3EDOA 3L6UA 3I05A 1KZ4A 3TPCA 1P8JA 2R2AA 2EJCA 3CLVA 1FCJA 2PXXA 4FMDB 4IOJA 5IDWA 5GZ1A 4Q12A 2C97A 3PHGA 3D8RA 3EMDA 1G8HA 2WJPA 1A82A 3DAHA 3QJGA 4I5GA 3GRZA 2FOLA 2XYHA 4RK6A 2ONJA 2AEEA 2DLNA 2VBGA 3Q0EA 1ZR4A 4POAA 3G2JA 4J90A 1PJRA 2Q45A 4RTNA 5DSXA 4TVBA 1VJDA 2G7MC 5EIEA 5CB4A 3GGOA 4R5HA 3K6SB 5ERGB 4K8OA 1PW7A 2GZ1A 4MB2A 5GMOA 3DF7A 3E18A 1WQ4A 4C4SA 5FUQA 3FTFA 3I2FA 4U9IS 2I6SA 3B7GA 2X0DA 3W79A 1V47A 5DLYA 3OZEA 1VQ1A 1C7EA 1ECCA 1R4NA 2M6SA 3AY0A 2DPMA 3B3FA 2A4KA 4LJ7A 4TQGA 2P2SA 3DMGA 3MVEA 2N75A 5DNAA 3HDHA 4BBPA 2JFFA 1THGA 2WHEA 1M1ZA 4FJ0A 4RAQA 1PJ8A 4C29A 5ICSA 1MDBA 4P4LA 3WRYC 3IV7A 1KTIA 1CR2A 3S4YA 2GBLA 1H2AS 3NBZC 3VZDA 1Z0SA 3SYTA 5LQAA 1SA0A 1GVNB 1W73A 2GR9A 4JC4A 2BGNA 2D7DA 5BY2A 1BQ4A 3UFBA 1ZD1A 1EFHA 3HDTA 1PFYA 2O48X 3JWHA 3OKCA 2GUWA 4L6AA 2PH7A 3V2UA 3AZQA 4LQCA 4WZZA 1N0HA 3WV5A 3LY8A 4LF8B 3KOOA 1VE9A 4L4ZA 1UBLS 3I53A 4GP6A 3ZW7A 3FPCA 2XOXA 2BHTA 3VR5H 3UMJA 5FT9A 3H11B 2IXGA 5KHLB 2BSQA 1X1QA 1H4VB 1KY4A 3LUHA 4WK2B 5AKXA 3W2FA 4YUZA 4RGQA 3IDFA 4EY5A 2FWAA 4K05A 5D00A 3L4SO 1NVMB 3EWNA 4HDNB 4KI0A 1DVRA 5E7IA 2JFUA 4IZHA 4DJ5X 5BR1A 3PU6A 1Q83A 3OFVA 1RCTE 1SUFA 4R40A 2OGZA 4DTIA 3D6HA 5JNRA 1G55A 1FNMA 1E1MA 1C7ZA 2FSVA 2C3MA 2V03A 3VYRB 1C2YA 3WMXA 2HSJA 1TRKA 2I29A 2K5UA 2WAYA 4G36A 4H15A 3FWYA 4IIHA 3VPSA 4P4SB 1L4GA 1CP3A 1GRNA 3LVBA 4I08A 3ZU5A 3PEEA 3EPJA 3ELDA 3TE7A 5B55A 3RFTA 4KQGA 1X1BA 4KQ6A 1GSAA 4TLCA 1U3VA 3W0LB 3ACCA 5C7OO 3UK2A 5HF5A 1QQ7A 2A0FA 3KDPA 2IL1A 1PIWA 1KH1A 1XK6A 1YD7A 2VATA 4L8GA 5EMJA 5JG7A 1IJBA 1ZHHA 4X24A 5KVVA 1GYRA 1ITZA 4QWMA 4YCMA 5MGNA 4RH1A 2WZQA 4K6MA 1STOA 3SKXA 3WIOA 1W30A 1ZD3A 4Z0NA 1W25A 4GZLA 1JTFA 3WLHA 1U1GA 3VMMA 4D8WA 3EB9A 4NK5A 5AVUA 2P6OA 4ER0A 2ZR7A 1VJCA 3PUYA 5DKFA 1G0OA 3TL6A 1AZWA 5C3MA 3Q88A 5IEJA 1AA6A 2YBEA 4Y2JA 1HGXA 1S1CA 3UJHA 4I50A 4ARUA 4HVTA 4L2IB 1AOXA 5EGNA 3AEUA 2W8ZA 4ES6A 2YVUA 1U8UA 5JRDS 4N0DA 1QWOA 3UAOA 2DTDA 4TN1A 4D0RA 4KXWA 1OXMA 4K9NA 3NAGA 5E7JA 3RJTA 3IMGA 3RUAA 1SHTX 3JATA 1Y6FA 4RORA 4CLDA 3EEOA 4HMPA 4DQLA 3CZQA 1KU0A 2QU8A 3FNQA 1WTAA 2GO1A 2Z9DA 1NBMD 1THMA 1WW2A 4XB6B 5DYTA 1VJ1A 1Z6XA 1MAAA 4JGIA 3PT5A 4ZQCB 1ODLA 2WU4A 1LBTA 2EKLA 1DRJA 4A6PA 3OWXA 3K6RA 1U8FO 1X1CA 3QG1A 2QMZA 3GA5A 5TX7A 1PJ4A 5FV7A 2RARA 3X1YA 4XYEA 2QW8A 1QIDA 1EUDA 3W8NA 4F5YA 2CNBA 1C2TA 2AHRA 4AX4A 1JDPA 1XEWY 3TM5A 5U1PA 3TH5A 5FBRB 2JGNA 2GJAA 2TRSB 3I3SR 3W3AD 3FCYA 1Z0JA 3WJAA 3ILXA 3P2KA 4J3JA 2CK3A 3ONDA 3WRXC 4O29A 1BN6A 1E62A 3O8QA 3QVOA 4MS3B 1E5TA 5FO0A 3WYEA 5EZ5A 3EGWA 1USUA 5TMPA 4UPDA 3CRVA 3FFAA 5CGQB 1TQ8A 4JUIA 4OMCA 1FS5A 2HJHA 1CIVA 3Q3GE 4I8DA 3SHWA 4C3OB 4DQVA 4CKZA 2CWDA 4PLTA 4C06A 5C1IA 1XQWA 2BV3A 4UEKA 1VCHA 4MVJA 1P73A 3L7KA 2ZETA 4Z6KA 4XWWA 3EZYA 3BDAA 4JI5B 5KOJB 2WV7A 2SCUB 4A2QA 1DKPA 3OZBA 3VR4A 1DG1G 1SK8A 1GCAA 2GZHA 1XTBA 1P44A 3RC7A 3I37X 5DX1A 2WM2A 4MVJP 4I50F 2FXVA 4HNUA 5JASA 4AS3A 3O75A 3L1VA 2WBLC 4MI6A 1W581 2WF8A 4QA9A 1X80A 5G0SA 5L7WA 4EB6B 2N1BA 1C9MA 2HDHA 4R9VA 3FUTA 4Y6QA 2M32A 3UMYA 1QXSA 4YYEA 4Z5XA 2AOTA 4Q1BA 4Y8VA 5MGBA 1NF8A 5JY6A 1DC3A 2WJZB 3NDRA 2QM3A 3N8GA 1A4RA 3AETB 1RXWA 2NTEA 4HWSA 2FWNA 5E2IA 3UGJA 3REOA 2VNAA 1SVKA 3T7AA 1Q77A 1WZIA 1FUEA 1LQUA 3FDIA 3K8OE 3ANLA 3PDHA 4MMZB 1KOJA 4NBKA 1Z34A 5D51S 5F3RA 5F7JA 1Z26A 3OPXA 4P80A 1JDBC 1RLIA 2IYEA 2ILVA 4NZPA 1ZSVA 2IEIA 3EUAA 4X6YA 3R4CA 5U4XA 5EQJB 1TM5E 1MCZA 3CNEA 3DM9B 3ROFA 1GNRA 1T2VA 4IMIB 3VR3A 3ZQ6A 4AZSA 4Y7DA 3HRIA 3ZY4A 3TSZA 3GFTA 4PXYA 1FUYB 2LVBA 4X1YA 2VXCA 4J0EA 2XB2A 1NUTA 3OE5A 4Z0TA 4FOSA 5ERXA 3T7KA 1EVEA 1D9XA 2EKPA 4TRNA 2XMRA 1EH5A 5K0CA 1FA9A 4AYWA 3ZWBA 1O9HA 3K6JA 4GMXA 2Z8ZA 4I55A 4G5QA 3E5HA 4QOSA 1FSPA 4OQLA 3TLEA 1E0KA 2G72A 4HDMA 4GYWA 3BQ9A 3ZJTA 3QVSA 3K5IA 4P4TA 1LZLA 3MYRA 2ZBVA 3PQ7A 4O2BB 4WLOA 3QLVC 1EP1B 1LPAB 4RXMA 3LCCA 2HJRA 2HRDA 1NVFA 4H6XA 4QXPA 1SOVA 2UKDA 3U1TA 2CC2A 1XQ1A 1RKBA 1UPFA 3PTZA 1HR0B 1U2RA 2CLEB 1U7XA 2I6UA 4YWJA 5HM6A 1Q2XA 3FSJX 1V41E 5F1YA 3LBAA 3H8VA 4NCXA 1QNLA 3BYZA 4JI2B 1HC7A 4DVGA 4KXNA 2ZVPX 2X7HA 3LPLA 3FWKA 4FOPA 4DDKA 2PS1A 1E1RD 1XT6A 2J0VA 1N5IA 1WHSB 3JQCA 4N0EA 4QO8A 3W4KA 3WB9A 1I24A 5K4HA 5JS2A 5G3YA 3PNKA 3RSLA 3ODGA 4ZU6X 1QVZA 3UXHA 1YZTA 2FWPA 2ADMA 3IDAA 1W46A 2X0FA 3HCEA 3L41A 4F96A 3KT8A 4I46A 3KKQA 2YXEA 4G0PA 4WXHA 1P77A 1GNTA 3ZQ4A 4LMBA 5GVRA 4V0OA 2FP4A 2F2TA 1QRRA 2PKCA 1GPYA 2RHGB 2WAOA 2WHYA 2H4YA 2XDWA 3ZWNA 2AGVA 4M98A 3G0HA 2OBXA 2OEPA 2OXRA 2VH2A 4J4BA 3CVVA 1X14A 1JR4A 1ZCJA 4H1HA 2OQ2A 3CM0A 3NVMB 4GRAA 3SK0A 1EUQA 3N59A 3TFWA 5K01A 4DILA 1FFBA 2Q6VA 4JROA 3NPMA 1L6IA 3EFHA 2ZITA 3P32A 3SXUA 1ZHFA 3AI1A 1X8XA 4ZHQB 2ZFUA 2X7JA 3RJ5A 1XZBA 1QR2A 2O50A 2UXCB 4C4OA 4MP8A 2LBPA 3LT1A 3MTEA 1LF0A 2H85A 2FF5A 3G0CA 3FPKA 4GICA 1ZMRA 2PVCA 2ZI3A 3C48A 3OMXA 3KLMX 1U4SA 4DMFA 3H04A 3DQQA 3LKZA 3TBHA 4EPXA 3DG9A 4UBLA 5FTWA 3SFZA 4BWGA 1I2MA 5ALKA 1XIVA 1BVYF 2JGEA 1MOSA 2E3JA 3FNBA 2QZJA 1YB6A 2L42A 4FNGA 3O3CA 3VISA 3GLFE 2EHJA 3ZY5A 2IEYA 3DBHB 5JVDF 1O87A 3WDMA 5JS7A 1XL0A 4BTVA 5DX0A 3STVA 1V4BA 4IF4A 1JE1A 4KR6A 4QBIA 2YN0A 1THTA 4PC3A 4ZODA 4CEIB 1C1XA 2FFJA 2AFIE 1FDRA 1GKYA 1U11A 2JAUA 1ZMOA 4L15A 4QTZA 1YR1A 1GNQA 4R3WA 3ZC3A 5JXHA 1VZ2A 2A2ZA 1K89A 1O6BA 5TB5A 1QZTA 1JNYA 1E1KA 2X6TA 3KPWA 4NPHA 3NEAA 1OI2A 2Y0EA 4B8ZA 2JI9A 4YAUA 1SHZA 5IF3A 2QM7A 3OU7A 4PHFA 4TV9B 3VJLA 2C9DA 4CHGA 3ISTA 2AZMA 1JSXA 4UULA 1HFJA 2QN7A 2CUKA 3A3PA 2OSBA 2WLTA 2J9FA 4BNWA 4M8LA 4HQ0A 1XJ5A 3RTBA 2PCJA 3N3AC 1QQBA 1B6GA 1PT5A 3MGBA 2ZIAA 4N7JA 1J9EA 5IXJA 1IULA 4NE7A 3Q3IA 4JCOA 3EXHA 2JKZA 3G02A 4Q3LA 3KB1A 2WEKA 3SBXA 5ALEA 1DBQA 1FX0A 3D5QA 5LWHA 1ZUNB 3IHLA 4PTLA 2YINC 4RABA 4EMTA 3AY7A 1DCMA 3U6BA 2VA9A 4BUCA 2GPAA 4Q7LA 3H7IA 5HMLA 3CXUA 3EW9A 1JPJA 4KFUA 4K6HA 4W1SA 4QG3A 1BKYA 1XTPA 3F97A 3JCZA 4R1UA 1HK7A 3BGWA 3TZBA 2Z6AA 4FVTA 3ZWDA 3CBGA 3Q9SA 1NF3A 3BGOS 3LUJA 3TTUA 4ZOBA 3ZE8A 3KQKA 1K08A 5JZVA 4H2DA 4ZP1A 2X1LA 2XGMA 2ZIZA 3O1JC 5JPIA 3K96A 2YL2A 3FLEA 1U3UA 2PUTA 4D8VA 2W2NA 1GV0A 1T4MA 3LMKA 4HADA 3VPBA 5JNVA 2JATA 4FYWA 2HMUA 4N4AA 4Q6WA 1FFSA 1QVWA 1WXQA 2GASA 2X6QA 2WYVA 1P1JA 3KVNA 4OQ4A 4AP9A 1OV4A 3T1YB 2MR5A 2ATVA 2WD9A 3L7DA 1DDIA 4N39A 5AW5A 2FRDC 4FSDA 4RVHA 4EG3A 3DEYX 4JS0A 3R8XA 3A28A 3PHJA 1QTQA 2X9QA 1VM6A 2BI4A 2ASVA 3RC9A 3B78A 3K9GA 1JBEA 4LECA 1URPA 1UK8A 1Z07A 3LE8A 3PCRB 1UT5A 2F43A 2Z3ZA 5D2CA 3WSTA 2CV0A 2P4HX 4WT7A 4BVKA 4YDQA 4ZV4A 2I3DA 4M38A 5C4IA 2IT1A 2OAEA 2XQJA 4LDQA 3IVGA 1GQ2A 1JP7A 1SEVA 1MRZA 5HJ2A 5TVKA 1SUDA 5A6SA 1NASA 3RBXA 2GBIA 5B5SA 1CEXA 4TYNA 4UFPA 4QPDA 4V38A 5H82A 3SHQA 3S0JA 4E1BA 1WOMA 1C1XB 2AZDA 2UAGA 2WHXA 1E9DA 4LVCA 4N01A 3C5VA 2HRCA 4RZIA 1PFUA 1DSSG 1CE8B 2IHTA 3P2OA 3VBEA 2CNKA 2I5PO 4FZJA 4YRIA 3WHKA 2ZT8A 4M7PA 4FI3C 5E3HA 3QTBA 3CUTA 2GA8A 1GTSA 4PINA 3QJYA 4LI0A 1U3FA 1U7UA 3RRYA 3I42A 1QO9A 4DLZA 5KQGA 4U7TB 1B1CA 1RADA 3F6EX 5AVQA 1HETA 2GXAA 4IV8A 1NI4A 2GD1O 2J9ZB 1C5KA 2PA0A 1MOPA 4HRYA 1HDGO 4UZFA 4DDMA 1D1PA 2F1IA 3Q6NA 4L0QA 5J1TB 1GU1A 4HX5A 3TUZC 2CDCA 1FNNA 1V3QE 1UMDA 3IEIA 4MYDA 2H0QA 5E6RA 4N47A 4Q15A 4BVBA 2VF7A 2PANA 4GI2A 1IWOA 2R7MA 4I8IA 4PXAA 2VJNA 4AZ3A 4MKZA 3RYCB 4HH0A 3SXUB 2H57A 1QZXA 1CD5A 3OPVA 4NNJA 3R24A 5F7OA 4PONA 3DDUA 3PD1A 1AKEA 4KODA 1GLNA 3Q8WA 1DBVO 5IZCC 3PFHA 4P4NA 2B4AA 4M1ZA 3KU4A 3W5UA 1CNEA 1KZHA 3TIVA 3CUSA 4DOMA 3JQ7A 1VI5A 4PZ0A 1G7RA 1NM5C 1XKLA 1U8XX 2A5DA 2TMKA 3HCDA 4FOLA 4R69A 5LUBA 5F7XA 1GSIA 5DM70 4XD2A 2VQEB 3DMHA 1O97C 4PSKA 1N2SA 4E14A 1W75A 3W3AH 4AN1A 1E3MA 4CUKA 1OR8A 2PZKA 2R7LA 2HF9A 4LXHA 2AOTB 3S29A 2QRNA 2WTEA 1RKQA 2Q4RA 1D8TA 1OFUA 2W6IA 2A5LA 3L79A 4W6QA 4WKBA 1XRJA 2B8JA 1BWSA 2ZTMA 1FP2A 3D8HA 4L7VA 3AHFA 3AI7A 1QHXA 1WDTA 3GJ3A 3UUEA 1VL2A 2W43A 3DGFC 4PFKA 4HYEA 4TXLA 3VUFA 5A06A 1RACA 5CYFA 1Y6GA 1L0BA 1BE6A 3H4IA 5BPFA 2QX9A 4F3CA 3FCEA 4F3RA 3A2KA 4FEYA 4GC5A 3FX2A 3K31A 4IMRA 3RFXA 1YS2X 1D9ZA 5CR9A 1R4NB 1KZ9A 3NHZA 4IYJA 5ESXA 4OUKX 2ZJAA 3N1UA 3TXYA 1H3FA 2C31A 3BHMA 5JAQA 3FM9A 2HUPA 2A1UA 2B7BA 3YASA 5ALSA 4MUYA 1PJCA 3H1FA 3NWJA 3S27A 3D6NB 3ONNA 1D4FA 2WB2A 3MINB 4LC0A 3DTNA 4J7XA 4MTCA 2X23A 4FGWA 3OQBA 4GZ6A 1QRUA 1KRWA 2WWVD 1K9VF 2V7VA 5B7PA 1IIRA 4TM7A 2ZRBA 4M7WA 4X20A 8GPBA 5B36A 5AVXA 1OGJA 4CIXA 1HOXA 2C0QA 2WKWA 5EESA 4ZT5A 5JCOA 3BWVA 5EXTA 5CDTA 1AQIA 1E2IA 1GEGA 4R0VA 4AO8A 3BH6A 4YS6A 3HWSA 5CT5A 3BL8A 2NSHA 1H66A 3CZ5A 2X76A 4P32A 4E11A 3KZMA 4RM2A 3GJ0A 3L3BA 4JXXA 1DC4A 2O23A 3T4XA 2VLIA 5IJZA 3M82A 2ID9A 2DCMA 4JP2A 3UK6A 3N8HA 2GLXA 4AWXA 1ORVA 1D2MA 3H17A 1OH6A 4PWYA 4UTOA 3QOWA 4P86A 1I3CA 2IDMA 3K0AB 5GV7A 2VPIA 1IM8A 4F2DA 2YV5A 1B6RA 4UTVA 4IXWA 3FFBA 1XZJA 5DI9A 1ZICA 1ZN8A 4P08A 4W99A 4U2FA 2HBZA 3MAJA 3GLIA 2HSEA 2PIAA 3HVJA 1XMVA 4RJLA 5LXTF 4C30A 3BMCA 4RKWA 2QT0A 1CXZA 4ZRMA 5FDFA 2BSXA