3H1GA

Crystal structure of chey mutant t84a of helicobacter pylori
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITAEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY homolog
total genus 48
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h1gA00
1XHEA 1D5WA 1JYEA 5BQ3A 2MYNA 4LRQA 2IDMA 3O1IC 3KCNA 3ROTA 1JFVA 4MS4A 1USIA 4O1HA 5T7BA 4TN5A 5KWSA 1JHZA 4HNSA 3CU5A 2QV0A 4MQEB 3K4HA 1P6UA 2FLWA 4MAAA 1P2FA 4Q6WA 4EY3A 1FFWA 1USGA 2FW0A 4MQFB 4MR8A 3OM0A 1ABFA 3H6HA 2FQWA 4Q7EA 4RK0A 3H1EA 3RH0A 3O2SB 2NUBA 3NNSA 3DLHA 3Q7SA 1U2PA 4XFKA 1QKKA 4L4UA 2PUGA 2B1JA 3KJXA 3HUUA 2JBAB 1F51E 4YCSA 4F12A 1R8JA 3RVJA 3LUAA 3OO0A 4P98A 1W9HA 3SY8A 3OLZA 4QPJC 3RVRA 1BDHA 4EYKA 3CNBA 5EWMB 4W5TA 1LJLA 1Z2EA 2FN9A 1Z2DA 4DQDA 1JLKA 3OM1A 4KREA 3D02A 2MYUA 1ZN2A 5GQSA 3KHTA 3HO1A 1DRJA 3I45A 4EYQA 3DGEC 1DBQA 3LUKA 1CEYA 5I4CA 1TM2A 3T6KA 4MR8B 3M9WA 8ABPA 1MAVA 4PICA 1MB3A 3EODA 4ZJPA 5EWLA 2W42A 2JVIA 4EGSA 1YK0A 4YR7A 4CBVA 4XASA 1JF8A 1M5UA 4LX8A 3VNBA 2JB9A 2JBAA 3BRSA 6CHYA 3ILYA 4MQFA 2GKGA 3H5VA 4EVRA 3KSMA 3RVNA 2FXIA 4KVFA 5FBHA 4IGAA 2AYZA 1S8NA 1PNTA 4B09A 4D74A 1DCMA 4D6XA 4YRZA 1QO0A 3QLVA 4RKRA 5IBQA 5BRJA 3LFTA 3HM9A 3QEMB 1NATA 2PUEA 2FMHA 3VNAA 1DBPA 4N0QA 3MYYA 2GX6A 3QLUC 4KV7A 1RPJA 1Z18A 2VUHB 4S05A 2PLNA 1NTRA 3EQZA 3KKEA 4RXUA 4N47A 1QMPA 1MVOA 4UHJA 5DGCA 2PUCA 2ID7A 2VUIB 3HDVA 4XAQA 5TPWB 4G0XA 4OATA 4JB2A 4QYWA 5E3JA 5B3JA 4TLLB 2FN8A 4MS4B 1APBA 1FSPA 2O20A 3H5WA 3LKVA 4MR7B 3HV2A 3JVIA 1SXGA 3O74A 1NXOA 4JA2A 2WRZA 3Q15C 5FWYB 3N53A 2PMCA 5DTEA 1BAPA 3N75A 1ZY2A 1ZITA 2WJWA 4UHKA 4QICA 2TMYA 1OXKB 4ZMRA 3JS5A 4G0PA 5TQ2B 4MGEA 2IKSA 1K68A 4YGXB 3A10A 1SXHA 2JRLA 2RGYA 3IP7A 1KRWA 2PUAA 5JNRA 3BREA 5KQMA 2E4UA 2BGGA 1BA2A 3K9CA 4O1IA 1A04A 3RVPA 3OLWA 5GOTA 1CYEA 5HQJA 4F11A 4MS3B 3QX8A 4P1ZA 5CNJA 3QELA 4YP9A 2PE5A 1NXWA 4IRXA 5JS1A 2PKXA 1ZDMA 2IPLA 3LUCA 1JFSA 1KRXA 1JFTA 2Q5CA 3QEMA 4W5QA 3HUTA 4W5NA 1YMUA 3KYIB 3C6QA 2GI4A 5DLEA 3NHZA 2PAFA 1Z12A 2WJAA 5KC9A 1DRKA 2LUOA 1GUDA 3GV0A 3I42A 3N0RA 3E3MA 5EWLB 5TPZA 5ABPA 3CZ5A 3LMKA 4PEVA 3KLOA 1M2EA 2MSLA 2L18A 1NXSA 1VRVA 3BILA 2KYRA 3JTEA 4TMYA 2A9RA 2L17A 5T3YA 3RVLA 3RQIA 3GBPA 2FLKA 4Z4HA 4LE2A 2R4QA 1YIOA 3QELB 2FEWB 4RSMA 4JOQA 1QQAA 1LJUA 4RK7A 3H75A 5F64A 3IP5A 4WZZA 4KRFA 2R25B 4RK5A 4LE0A 3C97A 1MB0A 3S99A 3UUGA 4EYGA 4WUTA 3KTOA 4IMIB 4G0ZA 4RWEA 2P9HA 2WB4A 4JP1A 2JCGA 1P6QA 1NXPA 3A0RB 5FWXA 1JDPA 2E4YA 3Q41A 4O5AA 1LK0A 1DC7A 2HJ9A 4KK4A 3CZCA 4QYMA 4RKQA 4F8JA 4OLAA 5KI6A 1SXIA 3RVMA 4EYOA 1MIHA 1DCKA 4KQCA 3O75A 4GPAA 1ZVVA 2J48A 4RK4A 3QLUA 3LKBA 1JYFA 1U8TA 3HZHA 3LUJA 4RU1A 1VKRA 1NY5A 4RK1A 1RXEA 3MIZA 5IUNC 3QK7A 5CNIA 2VYCA 1EFAA 1EWTA 5PNTA 5IUKC 1Z25A 1JWLA 4OLBA 5KQGA 1GCGA 4NCAA 4RDCA 4Z4GA 2FEKA 3HEBA 4W5RA 3A3KA 3FDFA 4F06A 1EAYA 1M5TA 3Q9SA 4PYRA 2PUDA 2L19A 1I3CA 3H6GA 1Z16A 3GWGA 3TX6A 4OG2A 4ML3A 1UDRA 2YHAA 3R0JA 5DCLA 1FFGA 1Y1LA 2M98A 3L49A 7ABPA 5IEJA 3CLKA 4IF4A 1XWWA 5JNWA 2ZAYA 2F8SA 2E4XA 4YO7A 1DZ3A 4MPTA 3T95A 2P4UA 2AYXA 3A0UA 3OO1A 4NICA 1H9CA 4Q6BA 4D6YA 4EVQA 2MYPA 2IPAB 3N8IA 2GWRA 1P8AA 3I09A 4YLEA 2JVJA 3GT7A 5EWJA 4MLDA 4H3KB 3T38A 5TQJA 2PL9A 6ABPA 3N0WA 5TQ0B 2IPNA 2JK1A 4RZSA 1Z15A 1B00A 3LUHA 3GA5A 2HSGA 4NCBA 1A0OA 1PNRA 4HNQA 3SQNA 1DP4A 2QVCA 2LPMA 3OMXA 4G0OA 4LDAA 4DADA 1JL3A 3L6UA 2V0NA 3M6MD 5KC8A 3NNDA 3BBLA 1YTUA 4MYRA 3LTEA 4E7OA 4ZMSA 3TB6A 1DBWA 2R47A 3OLYA 3HS3A 4JAVC 5JNUA 1K66A 3MQ4A 5JS2A 5DKFA 2F8TA 3HSYA 3IPAA 2FVYA 2CWDA 2MSKA 4JB0A 5FWXB 3GYBA 3GBVA 3GRCA 2MYTA 4MLCA 3HDGA 3QLVC 3SG0A 3CTPA 3IDOA 1NXXA 1XHFA 4Z99A 1BDJA 4KMRA 3SAJA 1L5ZA 1TMYA 1YVUA 5FBKA 4KPYA 3RVSA 2ID9A 3LOPA 3DGFC 3HVRA 4RS3A 1SRRA 2R48A 4YS6A 2FMIA 1JX6A 4ZPJA 1J56A 2E4VA 3CKMA 3DBIA 1W25A 3HXMA 3O21A 4WXEA 2FTKE 5B3JC 1RNLA 1D2AA 1L5YA 3M9XA 4ZYLA 3H5IA 4WT7A 2LP4Y 1D1QA 4JASB 4MS3A 5ED4A 2HQRA 3W9SA 1U2QA 5HKOA 3RVKA 2PUFA 1KMIY 3NHMA 4FE4A 1SD5A 4MR7A 3IP6A 2I6FA 2B4AA 3JPWA 1QP0A 5KQPA 3TO5A 1BVHA 3FFTA 1EHCA 4ETIA 3N6VA 3FGZA 4OBBA 4Z9BA 3TMYA 1VPWA 4HNRA 3MF4A 3F73A 4IILA 1KGSA 2X7XA 2PUBA 4FE7A 1ZH4A 3IP9A 3KG2A 4N41A 4XARA 3KYJB 5FWYA 3G85A 1JH9A 2OQRA 2NT4A 4GNRA 3UKJA 3F6PA 5IEBA 1ISSA 3GL9A 2CD7A 1Z13A 1FQWA 2QR3A 2RDMA 1URPA 1U0SY 2LBPA 4Z4CA 3NBMA 4XLTA 1OXBB 4KZKA 3TD9A 3D8UA 2M1ZA 1M2FA 4RY0A 2A9PA 5HM6A 3NNNA 1YMVA 4S04A 3QX9A 4YWHA 4N03A 3HJFA 3QEKA 1RZRD 3DZDA 2N9UA 4WXMA 3LUFA 2NZVG 5HSGA 3CG0A 3B2NA 4EVSA 3C3KA 1QQBA 4G0YA 4Z0NA 5BR1A 1ZESA 3EDCA 4KK3A 4L85A 1LBHA 1GLGA 3KS9A 4Z4FA 3ILHA 4PE5B 1QNLA 2IOYA 1CHNA 3EQ2A 5IULC 1AB5A 4MS1B 2QVGA 4LDZA 2A9OA 4E7PA 1USKA 3F7NA 5TPWA 1ZH2A 5CNMA 1NXVA 1E6MA 5IX8A 2FEPA 3CFYA 3F6CA 1RZRA 2E4WA 3HK2A 2RJOA 3O2QB 2DRIA 2HPHA 3OQMA 1TJYA 1ABEA 2XDYA 3H5TA 2FSPA 5KQLA 2E4ZA 3ROFA 4MRMA 4YV7A 1E6LA 1QP4A 1EWKA 1PUXA 2QZJA 3IPCA 1TLFA 2NZUG 4G0QA 3OQNA 5EWMA 5TE9A 1U04A 1JDNA 4IMJB 3MMNA 4H3HB 4RK6A 1D1PA 1ZGZA 2QSJA 3JVDA 1PEYA 1VLZA 3CRNA 2PL1A 3FFWA 3O2JA 4MS1A 5TPZD 2QU7A 3H5OA 1GCAA 3BRQA 1F4VA 4MRMB 3JPYA 4KFCA 3C3WA 3JY6A 2FMKA 3OQOA 2NT3A 1BDIA 2FQYA 1YS6A 5TQ0A 4ETMA 3Q7TA 1PEAA 5BRAA 4N76A 2ZWMA 5D2CA 9ABPA 2CHEA 1IIBA 2PJUA 3EAFA 4NQRA 1WETA 3UK0A 2VK2A 1D4ZA 5IC5A 3O1JC 2WY2D 3N0XA 4EUKA 3MM4A 3O1HB 2HQBA 1AB6A 4Z4IA 4H60A 4OTZA 3H5LA 1HEYA 1DG9A 2YHBA 3KLNA 1A2OA 3OMWA 3OLXA 4G86A 4PZ0A 4HYEA 4MR9B 3FFXA 4RXMA 4M88A 2H0AA 2WWVD 4F3TA 2MSWA 5EWJB 3G1WA 1E2BA 3MA0A 1RXIA 3SNKA 2JVKA 3H1GA 5TQ2A 3I5AA 1Z17A 3LUGA 5CNKA 3RVQA 3EULA 3FMVA 4LE1A 1GUBA 2LIVA 1TVMA 4G97A 5C5EA 2IYNA 4KQ9A 1ZGGA 1FFSA 1C0EA 4MR9A 4KNYA 1DJMA 4WWHA 2FMFA 4DN6A 1QPZA 5JNVA 3SM9A 2WMYA 3OLVA 4NV3A 4RXTA 3HCWA 1C4WA 1NXTA 3LUDA 4Z4EA 4ETNA 5C5CA 2GBPA 2OENG 5IUJC 4TLMB 2H3HA 3DLBA 1YK1A 4Y9TA 4RV5A 3CS3A 2QXYA 5CHYA 3EGCA 3EJWA 4RY8A 1E6KA 2FQXA 2QW1A 3RVOA 4MQEA 3QLTA 1QO0D 2IPMA 2RJNA 3URMA 1ZHHA 3E61A 2A9QA 1EWVA 3H1FA 1PHRA 1YS7A 4LZLA 3C3MA 4W5OA 1QP7A 1Z26A 1LBIA 2CHFA 4RY9A 4Z9AA 1ZAYA 3Q7RA 4N0PA 3CHYA 2FKAA 4FB4A 1DCFA 1DC8A 1JBEA 3T8YA 5JNTA 2L2QA 4XXHA 3CG4A 5JNSA 4G0MA 1T34A 3P9YA 2HQOA 1ISRA
chains in the Genus database with same CATH superfamily
2AQIA 4EDFA 5C46F 4KO1S 4DLRA 1Z9BA 4MDYA 4OSEA 1Z08A 3TLXA 3O1IC 1H2AS 2ERCA 3LYUA 3OECA 2C9OA 3O4GA 1KMMA 2OTCA 1YNSA 3KYBA 2FLWA 4JGBA 3LM8A 1L8QA 4IIEA 4RY2A 2PSEA 4RTKA 3ADDA 1VIYA 1XXLA 4RANA 2G7MC 3L6BA 1ZCAA 2FW0A 4PG5A 1F3OA 4B6QA 1H1LA 5IS2A 4K2HA 3EWSA 1KDVA 3IE1A 4M8IA 5FWAA 1C9EA 3C3AA 2VRCD 4FLEA 1VIDA 2RI6A 2W48A 4CUJA 4XE5A 4AJKA 4N7JA 5JV5A 5ELLA 2NV2B 3H3XA 2Q27A 1YZYA 2FFJA 5I7SA 2QRVA 2IYWA 4L4UA 2A88A 5FOVA 2OHGA 2YKGA 1U3DA 2OFXA 2QU8A 2X5OA 3IPLA 4IP0A 5C34B 1FLDA 4JNCA 2DWQA 3CA8A 5ARBA 3FCSB 3FHJA 2VPQA 1PE0A 2J3LA 4ESVA 2OSVA 3O84A 2HRRA 4QPJC 3RVRA 5KNBH 1BDHA 3TQHA 2YHIB 2BFBA 3K1ZA 3DKRA 4IOKA 4PCLA 2AUTA 2XUGA 1EZZA 1BO6A 1YL6A 2GCIA 3E8SA 4K46A 3B3QA 4ARZB 1TT5B 1FFBA 3FOAA 2IXEA 3VBCA 3HO1A 2VJMA 1I0LA 1GCOA 3O2NA 2VBFA 4QUGA 4JLUA 5I01A 4IJ6A 5LBIA 4QGAA 1KEUA 2KX7A 4G89A 4P08A 4B0OA 5CK4A 4HV4A 4LXQA 3NAGA 2VKTA 3OU6A 3ND8A 5EJ5A 3CVVA 1W76A 1J25A 2W6ZA 2G0NA 4FOLA 1JRLA 1NAHA 2WZCA 4S35A 4WECA 2AN3A 4XASA 3MWDB 4CBVA 5LP1A 1LPAB 3NEAA 4CDGA 1OXSC 1QB8A 4BFCA 3UK7A 4Z3KA 2MSDB 2I8CA 4MUEA 4XFJA 1FP6A 4Z9XA 3T52A 1U9IC 5G0WA 1NQTA 1WDTA 5NLLA 4WX2B 3I9OA 4P4SA 4WCFA 4D74A 5G0SA 4LXTA 4AL4A 3LWBA 2E0IA 1FMTA 3OUUA 4ED9A 1RSZA 1EB9A 2GVZC 2O3SA 2VAWA 3B89A 3OJ0A 5DRTA 4BASA 2C4VA 1R8XA 3KPUA 4R83A 5HKAA 2FMHA 1CRQA 3VNAA 4HLDA 4ZDKA 2IS2A 1SBCA 2PUTA 4AG6A 2J5RA 4IW3B 4IF6A 4CG1A 4CV3A 4UM9B 2LWIA 2VN8A 3AKYA 2MSNA 2HA2A 3KB2A 2XMZA 3FMPB 4IJUA 4MPDA 2BGRA 5GM2A 4BNDB 3TLZA 5EJ6A 3U16A 1JEYA 3DV2A 4JI3B 3H2GA 3BGSA 1TCCA 1S01A 2ZRIA 1I6LA 3GLHE 4X93A 3T7DA 3HZOA 4RMNA 1WW2A 3MCAA 1OAOC 5CYOA 2F1KA 3H3FA 4Q4AB 1ULBA 2PPLA 2AC2A 3LKVA 3UM9A 2QRMA 3TRKA 1NUAA 4NRDA 2WVAA 1RMQA 4N8DA 2P0EA 3SHQA 2LVBA 1R0ZA 1U99A 4JJKA 3W05A 1V1MA 3BQ9A 2VXCA 1IIRA 1CZRA 1XZMA 2KSQA 2J3JA 4MVJA 1XQ6A 1FFCA 2J7PA 4K9RA 5DMHA 3D4PA 3OKAA 1Z0IA 4JY7A 1SC6A 3CQ9A 4LUCA 1HURA 4KYVA 5F7ZA 1JAXA 4D96A 1AQ6A 4Q4JA 2IKSA 2GRAA 5H82A 3IP7A 1PS9A 1YVRA 2C7RA 3IIMA 1BJRE 4H35A 3LX4A 2Q3DA 5ETJA 2J85A 1YVDA 3RUAA 3PK0A 1GADO 2XKBA 3VR6D 3DFMA 4TMVA 1GZHB 2B1IA 5I8WA 2AQHA 1E2FA 3F5DA 4DLXA 1P1CA 2GZAA 1D1TA 2WHRA 4Y6GB 5K20A 4AYTA 1X15A 1LX6A 2GRJA 4F45A 2GBLA 1WMDA 4ALLA 1ISPA 3NBXX 2WWGA 4WK6A 4K9SA 4R1TA 2FEXA 4TROA 1B74A 1Q0HA 1U8AA 4I1SA 4KQWA 1VZ2A 2WJZB 3AI1A 5LDDC 2E5WA 2ZANA 3E3MA 3Q1LA 1LLQA 4L7VA 2HCFA 4PEVA 3KLOA 4WZBA 2PRSA 1T2NA 2WDZA 4JHXA 4TKUB 4ZV7A 1JG6A 1I6KA 1VRVA 4IVRA 3M1IA 3JTEA 2QQ5A 3MS2A 1WSAA 2H1RA 2Y77A 5BSEA 2R62A 4HNGA 1HF3A 4NENB 5DGTA 1T4GA 2ORWA 3DXYA 4FDAA 5JI3E 1YD7A 3E03A 4Z4HA 2C9BA 4PFKA 2F48A 3GPCA 4OB7A 1R0RE 3K5IA 1JJIA 2B2XA 4B3HA 5L53A 1TO1E 2AFHE 2W6NA 1T0IA 4NFYA 4ZOQI 2BM9A 2O8BA 1Z4JA 4IR7A 2X0NA 4LC9A 5KAPA 2F55A 4P0QB 1ODJA 1OYOA 5IT5A 4OFWA 4LYDA 2V7XA 2RHLA 2EZUA 5FWXA 5EERA 5DYYA 4DUZB 2AXNA 3V4RA 2OAGA 4ZCSA 1U4SA 2EIHA 3GX1A 5IAOA 1WD7A 3IT0A 2OHXA 1AURA 3O75A 4JP3A 3X1JA 4A27A 2JIMA 1H0SA 4RK4A 2FPIA 2GZHA 2O2XA 4Q16A 1HT2E 3KJNA 2DGDA 1P4HA 4RJLA 3QFSA 4WKCA 3I12A 4MWBA 4S1VA 2NQ8A 1UANA 3CF4A 4OYHA 3CX3A 1O03A 1ORVA 5DP1A 1FDWA 1C5KA 3MIZA 4F4DA 2Y71A 3O9ZA 4KFRA 1R74A 3PUKA 5P8WA 1UAYA 3ROPA 1V3QE 2BHSA 1NA5A 5K3CA 4F91B 1JQLB 3FB1A 3C8HA 4KQ6A 2XMQA 1SXQA 4FYXA 3RROA 3WWDA 2W6JD 3A04A 1GDHA 1IHUA 3WFIA 5BR7A 4PSCA 5ITVA 3I62A 2C42A 4DLPA 4EH1A 1GU1A 4NNPA 4HQOA 4Y2QA 4I3HA 3TMKA 3VTZA 4B6SA 4YCCA 2XRMA 4ZO7A 1K8XB 2D54A 1WP9A 5AI9A 5DCLA 2R00C 2FG7C 3R24A 3DSRA 4NNOA 4H77A 1W87A 4CQMB 5A0VA 2PZMA 3FGNA 2NLOA 3M89A 4DZTA 1FEZA 1HLFA 4FDMA 2QN3A 1TGYA 4TL7A 2C98A 2C5EA 1G63A 2I6SA 2PWZA 1H2EA 1Z83A 4R9VA 3PE4A 4UBIA 1GZ5A 3WLTA 2OCKA 5EKUA 3E3NA 4I50A 1PJRA 1XFDA 2IPAB 3OQIA 4NOMA 2BKVA 5LWQA 3K0FB 2JVJA 3TJMA 4GU5A 4QT4A 5A5EA 3O8CA 3QLEA 1V4VA 1KBOA 3OSUA 1IN7A 4JI6B 5I9IA 4YCLA 4P4UA 4FYVA 2XKAA 6ABPA 4LOAA 1YTLA 1F7VA 4QDZA 5LQAA 1AK9A 1IZYA 1MTZA 1AQJA 2D7JA 1XG5A 4PS1A 2FI1A 2HU2A 1E18A 1YC2A 2OMEA 5MGNA 4GI5A 1YZNA 1N2EA 5HGJA 5C32A 1NN3A 2VDUE 1RJGA 1W19A 4OKNA 1N78A 3ZDZB 3CZ9A 1RWMA 2V0NA 5D3MA 2B7BA 1QIHA 1FX1A 4ZCQA 1XKQA 4BNIA 4R2JA 1YTUA 2WNHA 1Z34A 2WU8A 5DF1A 4RV4A 1F06A 3TLAA 4CV1A 2CEAA 3K70D 3I0ZA 4F2WA 1RRFA 4IJ5A 4OHKA 5DT2A 1Z0SA 4V39A 5J63A 5A03A 4FWIB 4ZJUA 3ROZA 2F8TA 3D3NA 2EIXA 1YCHA 5G0TA 8ADHA 1N1GA 2FVYA 2GF9A 4TOIA 4P82A 2GZ1A 2IQ5A 1U5AA 2XGSA 3H9UA 4J1QA 4MKXA 4XCVA 3UJ8A 2FE4A 3RTGA 1VCOA 3H9GA 2AZDA 3OIGA 2OAP1 3ULKA 4NZOA 3AF2A 2J0SA 3K16A 2O3UA 3DONA 3L0CA 1TMYA 4QGFA 3VPSA 2IA5A 5AXCA 1VSQA 3PCTA 2VA8A 3DFFA 3DGFC 2P35A 3ZE8A 2LR0A 2OD9A 5ITSA 2HHHB 4Y0AA 1UADA 1I7LA 1DG1G 1H0KA 4JXJA 1K06A 2HRCA 4O6VA 4DDHA 3GCZA 2CNNA 2VNKA 4NU6A 4WNYA 4DMHA 2A7QA 4WA7A 3NLLA 3FBGA 3ZDBA 4ESHA 3UXEA 1RLIA 1ISMA 3CIFA 5MHTA 1NBME 4FMCB 1H4SA 2H1OA 2WHXA 5AIBA 1I5EA 1MP0A 2C0QA 5HIMA 4XYBA 1JR2A 5T57A 3TIXB 1QZXA 3OPYA 2VYVA 3RWBA 2GEDA 1IN1A 6AT1A 2HTEA 4KAJA 3DCNA 3DZJA 3K31A 3RAJA 3SCZA 1GPBA 3FFTA 4AJ9A 1LY1A 4B3IA 1QO9A 4WBXC 3UTDA 4RA6A 2IPOA 1NDHA 3CEAA 4WY2A 3IR6A 5B1IA 3SSMA 3TEFA 5CH5A 3MF4A 4QQNA 4RJTA 1SA0A 2G04A 1KAOA 5I7OA 4PO9A 1JSLA 5I9NA 1JU4A 2ZB4A 3DDCA 2BKLA 4X1KB 2ZSFA 5CA1A 3OWHA 5DHPA 2HNAA 4RF3A 3EXHA 1OT3A 2D5IA 5EZYF 5FWYA 3SZGA 2G9ZA 2GPBA 3G85A 1VCHA 1DTEA 3DTVA 3CKYA 1M10A 3DVAB 1Y6FA 4K6FA 2H5EA 3M70A 3SJ7A 1FQWA 2QR3A 4YUVA 4QFMA 1QORA 2NTYC 4GZ3A 1BEUB 3GEPA 2CXTA 1SR8A 2IDKA 4CW7A 1IVNA 2E48A 2O0MA 1UBRS 4Y1RB 1NVUQ 1T10A 1JT2A 1PQ4A 4M1ZA 1QHHB 3T15A 5J47A 2WI8A 2HA5A 2CJPA 2QAGA 2ZBGA 3GK3A 4LMBA 3IP3A 2PT9A 4OAPA 4BKUA 4YBZA 4RW0A 1NF3A 4LIPD 5LFAA 1PZFA 4TUYA 1HR0B 2E89A 3KQNA 5REQA 4BKPA 1E1LA 2ZR9A 1L4HA 2ZRPA 3E9MA 3FR8A 3CVJA 1L7EA 1HEIA 1Q6ZA 3OLCX 1U1FA 2Q6LA 4OMCA 4YNBA 5IT4A 1XRJA 1TA9A 5LYJF 1QIIA 5J2UB 2X8LA 3B7WA 4RMJA 5IJAA 1EFLA 1FDRA 3BB3A 3SXUB 3SHFA 3WYCA 4BE7B 4D9JA 1N6PA 1CQPA 2OBNA 3NVAA 1KI6A 5FHQA 2XZDA 5ALWA 5EQTA 4F5YA 2AOTA 2R6FA 3QKUA 2HY7A 3V8PA 2GHTA 3PC7A 1K0UA 4BLTA 2XH8A 1TKAA 1VE5A 2E4WA 3WNVA 3P5SA 4PN3A 5B7GA 3HK2A 1ZIDA 2HPHA 3IEXA 2DECA 3NS7A 4RDIA 5TS2A 3ROFA 2OORC 2HK9A 1UBKS 4XQ9A 1ZSYA 1QP4A 1R0XA 1KOFA 3NHPA 1KDYA 1FRZA 4B6JA 2X0RA 3PZRA 4ZVLA 4ZWNA 5JRDS 1U04A 3QLJA 1JIUA 3KLPX 1XQYA 5DCUA 1D2CA 3KE9A 1CR1A 2HSWA 3VTFA 1N3BA 1NI3A 2YOHA 2QSJA 4D7AA 4CLXA 3HCNA 4DNPA 1DTWA 1SNYA 3BWBA 3RDPA 4AYWA 4ZAGA 1TPYA 1RW4A 2Z3VA 3OZSA 2Q8QA 1YDMA 4JI1B 1JPJA 2WUEA 3GD5A 1ZONA 1UPUA 5DM2A 4FGZA 3E22A 4ZU6X 4GWGA 2NTVA 3GOQA 1D09A 1IHXA 4QREA 5EKXA 4BC0A 1IEVA 1MEOA 4G1UC 4XX1A 1A2QA 2ZRCA 1X87A 1P4SA 3LPAA 3NKLA 4KW7A 2X0IA 1C4XA 3LLMA 3G0OA 4U9HS 1Y3HA 4KH0A 4QU9A 2WY2D 2QLBA 1F1JA 3O1JC 5G0UA 1LVUA 1NMYA 2QPOA 2PKYX 3I9FA 4M7RA 1QIDA 2O05A 2D5AA 3W5HA 1UOEA 1U7TA 3G2KA 3KVNA 5JAOA 1YGYA 3IODA 3G0IA 3MYRA 4L8VA 3AUYA 5CM2Z 5CT6A 4Z4IA 1T36B 1OQAA 1ZS9A 4H0NA 3TUJC 3MLEA 1XMIA 2CK3D 3OLXA 4FNAA 3PDIB 4QJ3A 2FQ1A 3ABQB 1AU9A 2AOUA 3OTGA 2HNKA 1TCVA 3COWA 2WW8A 4LMAA 2C58A 4URHA 4WMLA 2YC4C 4OXKA 3O4HA 3I64A 1OFGA 4UOEA 2O2EA 2XRZA 4YAGA 4CCWA 4YUXA 5CB4B 5KOHA 2H4FA 3MRTA 4DJAA 1BD3A 1WM1A 1ZGGA 1E77A 4MGZR 4P34A 2AUNA 1XTQA 2C5GA 3MAGA 1LW7A 4WWHA 2B36A 1GTSA 4CI0B 5JNVA 5KIAA 4Q47A 2RB4A 4XPIA 1UFQA 4NFHA 3LUDA 3RF7A 3L4EA 4QE3A 1QTQA 1A5BB 1M1YB 3KWFA 3TQCA 1AS2A 1P72A 3UATA 1DAPA 3SIXA 3QVGB 5CEEA 1GA6A 4DCUA 1L6IA 4UULA 2D2IA 4LY6A 2BLNA 5FX2A 1GAXA 3P7MA 2IX9A 2Q4EA 4FZ3A 2QXYA 2XYHA 1E6KA 2WT4A 3H2JA 1N1EA 1QO0D 1RBMA 1EDEA 3MJCA 4NHEA 4XWWA 2A8YA 2GM4A 4RCZA 3LBHA 3SR0A 1HL7A 3V8NA 3ZZNA 3OD1A 1Z6GA 3NONA 4F9TA 4WNAA 4KHZA 3O8QA 3VR6A 1PFUA 1XZKA 3T1QA 1WE2A 3IHLA 1M73E 1WZ2A 4XQ0A 2EP5A 4MJ7A 4IIVA 3T8YA 3CG4A 3VO1A 2GQ0A 2ZTSA 2QAIA 3DWIA 4IIUA 4BWVA 4AFNA 3KCNA 4D82A 1SUDA 4P5EA 2O8BB 4C7BA 1Z2OX 1L7OA 1YL5A 3SQLA 4MQEB 2IS1A 2OG1A 1LKZA 2CNWD 1E3QA 1Q19A 4HGRA 4IHJB 2G06A 4BVAA 3AU9A 3OX4A 2O2DA 2PO7A 1UMBB 5DHSA 2EARA 1SVKA 2MMGA 3HO8A 4MUYA 2XCOA 1ABFA 2CXRA 1MA3A 2PVCA 3R6LA 2NUBA 3B3GA 1PK9A 1XZ8A 4KL8S 4RHXA 1DRUA 5I9SA 1AUPA 2GF2A 3WS7A 2E85A 4MVJE 4HDSB 2B1JA 4I1IA 4ONEA 1REQA 2QZ4A 3HUUA 4F85A 1Q1GA 3KR1A 1XKTA 1SCNE 3OAAD 5T4HA 1MZVA 1N5RA 1DHRA 2BGJA 4RORA 4W82A 2ECQA 3KR9A 1BU8A 1FX0A 4R16A 2BHNA 3ZHQA 7AT1A 1K4MA 2O2IA 2ZW9A 2C1XA 1PSWA 3B12A 3DCIA 3QXHA 4NOJA 1Z2DA 2V3VA 5AKZA 3V9PA 3Q8KA 2E6KA 1RZ3A 1Q0PA 4MUAA 4Q48A 1E79A 1AQLA 1N8SA 1TA4A 4HWKA 4IZOA 4JR0A 4O2LA 4BLVA 2R60A 5A7HA 3WRVA 3PFWO 5GIOE 4G4GA 4I6GA 1EXDA 3GJ8A 1ML4A 3WLPA 5BQXA 4YMVA 3F4BA 3V1LA 4AP5A 3R6GA 2DFNA 3IP1A 5ALFA 3IDQA 5E2AA 5EXXA 2WIBA 2GPNA 3AF1A 1S8AA 3EGDA 1ZRSA 1KMCA 3G88A 3M3HA 4MMXB 3W6OA 3ESRA 2ODQA 1TK2A 5IF3A 1S2MA 3E9EA 1MNAA 4MVCA 4OQPA 1BFUA 1CV2A 3FWHA 2CW5A 4AVYA 2HL6A 2P4SA 2YHIA 4BCBA 2NYVA 2PQMA 3HBNA 2GO7A 4FXOA 1DEKA 1EHYA 3B6KA 3GJQA 5FBHA 2BDUA 5IARA 2C2WA 5DI3B 1V7PC 4OHOA 3GR6A 4IIJF 4ZOBA 2RD2A 2JIZA 1A2KC 2OESA 1BTOA 1G5TA 2ZBUA 3A25A 3A32A 1ZXLA 4WQMA 2JLBA 3K1TA 5FFFA 2R6ZA 3A27A 3GFSA 2GCOB 1WMBA 2BFDA 4GQBA 2JS7A 5ALGA 1NJ6A 3RS8A 4EF6A 2FZEA 4HL6A 4I4NA 2CWWA 4IUBS 4K03A 3BWXA 5ECDA 2PR7A 1MVOA 1MO5A 2UXBB 5J58A 4XAQA 5F9HA 1FF9A 1LQUA 1KI9A 5BN1A 1STOA 2HHJA 3CN9A 4TYQA 1YRQA 1HE1C 2QZPA 3R0QA 4MJLA 4TLLB 4RH3A 5C2JB 4FJ1A 1SY7A 3QPAA 1W0KD 4OHVA 3EDOA 3HV2A 3LX5A 3OF2A 5B37A 4GXTA 2IS4A 3WRXC 2N1MA 3CUYA 3Q15C 4YV2A 4BO1A 2DFDA 3M3PA 2ZXFA 4HN4B 4Q37A 1TKRA 1DQRA 3EBLA 1JQBA 2QP4A 2B4YA 2QN1A 3MLAA 3GWZA 2WFMA 1VIAA 3CUTA 4Q3OA 4RQBA 3LD9A 2KBEA 2AIRA 2HM7A 3NM4A 4DCTA 4PFSA 3IV9A 2I4IA 3K3PA 3V6MA 1KRWA 5JEDA 4EY7A 5BVHB 3NTVA 1SQFA 3BQNB 3E18A 3L6OO 1G21A 1NZJA 5B5SA 1E3JA 5ALOA 4GSLA 5G1OA 1U2EA 2G70A 2RKOA 2I80A 1H8HD 4B35A 1KI3A 2PH1A 2XOKD 4GIBA 5AVOA 1CZNA 3K6RA 5CYPA 1ZDMA 3DJFA 5IDWA 3QU4A 1QYVA 1XNRB 2HU8A 3LO5A 3NV9A 3OZTA 4W5QA 4DQKA 1YMUA 3I0NA 3I2FA 4ZOEA 3RBAA 5M5BA 2ZOSA 1QYIA 1S3FA 2YWHA 1AZSC 3L1HA 3OPNA 3S44A 1PYGA 2IHNA 2J32A 4R8VA 5L3VA 1TJPB 3ZDCA 3JQ9A 3EXAA 5DN6A 3VNVA 1T2FA 2XUZA 1V5WA 5T6BA 1Y63A 3JTMA 3PCRB 3PIRA 1WBDA 1SQ0A 2RH8A 4G2NA 1NI4A 4QHTA 1RP1A 1RYHA 2ZKIA 1OGYA 4I4TA 4W1RA 3ZQKA 3GJ7A 4DXAA 4YAUA 5IZCA 1M1UA 3IPRA 4PHFA 5CDFE 4TL6A 1XJCA 3E9RA 1HT0A 3ZD7A 4TXMA 5DSXA 1KEWA 3OVMA 1IK4A 4JEMA 4U2CA 3WKAA 3BXGA 2GO1A 1XPJA 3UAOA 1TD1A 4R7GA 5ECGC 4WJZA 1VJRA 5FORA 1DMSA 2HJVA 3TDNA 3UUGA 4M89A 5BSHA 4I5DA 1RLOA 4JVOA 5B1SA 2GJKA 2W58A 2N75A 3KQSA 1RVDA 2JCGA 3D6VA 1PSZA 2YQ4A 3BRWD 3I2YX 2HJ9A 4QYMA 1A76A 1KJ9A 3BX1A 4GYJA 4JLBA 1JZSA 3DHEA 1H2WA 3NORA 3OIDA 4B3SB 2P40A 5C0OE 1V26A 4MWEA 1K7FB 1X77A 4NJOA 1ZRNA 3QLUA 1T9GR 4WESB 1T0JB 1DIOB 2ORVA 1AKMA 3WWOA 1JEOA 3SP1A 2X5XA 4L3WA 3ZHYA 5LDHA 4YJHB 2C8VA 3U7JA 2DWCA 4EKIA 3TAUA 2BH9A 3E9DA 4ME6A 4NI5A 5J2TB 1NTOA 2CMHA 3CZ4A 3PXUA 5IDQA 2LNDA 1R8YA 4P54A 2QTLA 1DOHA 4JCCA 4CUKA 1MX3A 4NCAA 5ECWA 4RDCA 1C8KA 3LHSA 2FB9A 3ZR4B 4C29A 4OQFA 1JECA 1L8OA 4HRXA 2SCUB 3EDQA 4EKYA 1MC4A 3WMEA 5AVUA 2WTBA 3TQFA 4C7OA 1DKRA 2ZIGA 5EEGA 3QKWA 4NTZA 2GD1O 1IVYA 3AI7A 3BXZA 4BQFA 2D2VA 4YAOA 5DXAA 4DCNA 1RBQA 2IK8A 1ZVQA 4QUAA 1EQ2A 1GZ4A 3OZ7A 1DZ3A 4I0WB 4HATA 1NSYA 2YNMD 4XWOA 4J2OA 5ICSA 3OO1A 1NFFA 4EKNB 3WL5A 1QLJA 2D4AA 2F7SA 3AK4A 5H1YA 3MOIA 2H29A 3EXEA 3OCCA 3IA7A 2ZJOA 3FFAA 4HGYA 4NU5A 3TUIC 5K0TA 3E05A 2ZU6A 3I73A 2HT1A 3DZGA 4CETA 3DR5A 2CV0A 2DQ4A 2BN4A 3WLIA 1JIKA 4YFVA 4AJLA 2H07A 3N7UA 1VL6A 4TWJA 3C3EA 3SQNA 5LMZA 1FQJA 1LDEA 3PFFA 3CBQA 1AK2A 1U94A 1V6SA 1YJ8A 2B78A 4FILA 3RF6A 2ZJBA 3L6UA 3AIKA 3DE3X 3BBLA 2YYSA 2PKQP 3PFNA 1Z06A 1AX9A 1HX7A 2WFZA 3SZUA 2XCIA 3KYDA 1XEXA 1E0KA 4L0MA 1SU4A 4JUDX 4RENA 4AZ3B 3IEIA 3KZ1E 1DQZA 4HEA1 1G66A 4YX9A 1P17A 1VJ0A 2HA6A 4JT9A 5CIYA 2JD2A 2HMTA 3K1AA 3TIFA 5LKRA 2BEJA 4C4AA 4HSEA 3IEVA 2OD2A 3GBVA 1RJ9B 3BL5A 4B6PA 4UE2A 1BMFD 3RK0A 3SFVA 4CM6A 1W29A 4GX1A 2KM1A 3EGVA 4KN8A 5F2OA 1TVEA 4Y2GA 5FBKA 3Q8MA 1EZ1A 1WHTA 3AIOA 4EO4A 3S4YA 5AUPB 2GNAA 5L3SA 5CG1A 3EFHA 2GLXA 2A67A 2R1UA 3ILVA 3T1YB 2A1TR 4MW5A 1Z0AA 1L7BA 1HYHA 2AXEA 2G25A 2P9TA 1O9BA 3HRHA 5KNBD 2JEOA 1BW9B 1E5XA 5LA6F 3WHPA 4IVQA 2BZ1A 4IIBA 3QI7A 3Q8LA 3L7YA 3RGWS 3SHTA 2P0AA 4WXEA 4C7JA 4JKOA 1G98A 4U2EA 2WSMA 2GBGA 2LP4Y 1SO8A 1MH9A 2OYRA 2QMYA 5AW5A 5CCDA 1ZZGA 2Y6UA 4E5NA 5L51A 4QHYA 4QG3A 4M6WA 2K7FA 1EGQA 2ZJYA 2GAFA 1R0LA 4J1TA 4LXGA 3HXPA 2DBQA 4MI6A 2YZ2A 1ZC4A 1MU0A 2HJSA 5FULA 1BGVA 2BY4A 1D6MA 3D6MA 1DAFA 4ZO9A 4FFSA 3KJHA 3CJTA 3VR3D 3WBJA 3IJRA 1J00A 3EUEA 3PX2A 4N54A 5CLHA 3RT1A 3AR5A 3REOA 4D3ZA 2VJQA 3GGGA 4Y2SA 1QV9A 4ZVVA 5KREA 2V5VA 1ECPA 1YNOA 5FUVA 1C7IA 1E9AA 2GEKA 3LOUA 5B2ZA 2YWFA 3E15A 4WBNB 1KFKB 3M83A 4YMIA 5CVVA 3KNZA 5HKKD 5EKSA 4ALIA 2ZWAA 4YCAA 3SEFA 1FZTA 1U8EA 3UHJA 3N74A 4DHEA 5KX5F 4XM2A 1PQUA 3ESAA 2CB0A 2IU4A 1RXCA 3EB9A 3NH6A 3Q87B 2YRXA 5FJJA 3A6DA 2NO9A 2ZTMA 1IG3A 3BKXA 3TLEA 5BN4A 4OHBA 3KDSE 3RRMA 5JSFA 2P4EA 4DVGA 2L0XA 3GH1A 2GXSA 2XGOA 1O77A 2BFAA 2ZJ1A 4X20B 4RAQA 2J30A 3CO0S 2QG6A 5FI3A 5LYYA 1D9XA 2OCXA 1Y6JA 3BIFA 3WL8A 3GO4A 4DV4B 3ZHTA 2IHKA 1YU9A 3HJFA 3R7DA 1IB0A 1LK7A 3C3BA 3LP5A 2VYND 1CUAA 3GLHA 4I1UA 4QU8A 2P7IA 5DNVA 3TXAA 1RI4A 5HCUA 1DXQA 3CG0A 3IOBA 3P5BA 4A5SA 4UC0A 3D31A 4Z0NA 1ZESA 2DB3A 3SWWA 3PSAA 3EDCA 5DP2A 5SY6A 3VKWA 1G3MA 1UT5A 4B8YA 5FPKA 2WE7A 1A4RA 2VHUA 4CF6A 1AMUA 1NJFA 3WNZA 3F49S 4V1CI 1GNQA 4FD3A 4Y2XA 4P5DA 2G9VA 1DG3A 1GA1A 1YBHA 3LCMA 1SUCA 4CNBA 4TMZA 5EUMA 3D64A 4WCDA 1PDOA 1U1EA 4EX6A 5EXEA 5IX8A 3KSBC 1GTG1 3IV7A 1XLUA 3PD1A 4EHBA 1F0NA 3JZFA 4DUGA 4H1WA 2DRIA 2AQ8A 2FP3A 1K8ZB 2JW5A 3H5TA 3KVRA 5JXIA 1TM1E 1QS0B 2FP4B 2QQFA 2V7BA 4FQ5A 4AKIA 2G8NA 2D7DA 4K8RB 3EUWA 4TV9B 2EQAA 3DAYA 3IPCA 2NQ2C 2XUKA 4QPNA 5AIAA 4RDXA 2EWVA 1DJOA 4H4EA 3SYMA 2W2NA 4G6ZA 4HZIA 1CR2A 4G65A 3MCTA 1OVGA 2NADA 2M9MA 1ZD5A 4WACA 3DBHA 4A0HA 1VLZA 4DMRA 2ATVA 5GV8A 2O8CB 1MF7A 2HLDA 2J0VA 2WF5A 1L5HB 3ILSA 1P0CA 3KTAB 5A71A 4O3MA 2BZSA 3TNDA 2FRDC 3C5WP 1C1XA 1DWOA 2ES4A 3MMPA 2VJPA 3OQPA 4F2PA 1W35A 4LPKA 5SZHB 2X19A 1XTIA 3QUSA 4XRRA 3KBBA 5JZOA 2ZPAA 1HWYA 1II8B 4LMPA 4P32A 4AT1A 3COVA 2C96A 1EE2A 1F7UA 2P9YA 4MUKA 3G5AA 4QGGA 3SD7A 1PW7A 4DLVA 2FR8C 2NVUA 1SXJC 3HCCA 3IUSA 4NECA 3RS9A 2FGJA 3WA7A 1VHQA 3HU1A 3MM4A 3MUOA 2ZBEA 3AMVA 1B73A 5CJJA 1K88A 1W52X 3M1YA 3TM4A 4HNUA 3B51X 2EATA 3M0EA 4Z54A 2F9MA 4LHVA 4OTZA 4LXHA 2HCJB 2WSLA 3A6HA 1N3IA 4FFNA 5DW0A 4I4IA 3P9XA 2B8WA 4NV1A 2IQIA 1O08A 4D1YA 2JL1A 1FJ2A 3I05A 4OQXA 5D5QA 2WV9A 2EJCA 2O4UX 4FWTA 5CM8B 4F3TA 2RK4A 4RADA 2MSWA 1XF9A 2JA1A 3JWPA 4MX8A 5LOVB 5DOZA 4BPRA 5KWEA 1YDGA 4FCCA 3ETDA 1UDCA 2HRBA 2G5GX 2POQX 2WINI 3G8YA 4QXQA 5PGMA 3ZTYA 2GN9A 4OVKA 1RZUA 5CNKA 3UMVA 1KKMA 1WEHA 4OJNA 4LE1A 2FZCA 3RS2A 1F2VA 4FS8A 2O8NA 4G97A 1GRVA 3WGUA 1Z0UA 4D44A 5EJGA 4UVIA 4C7XA 2QYHA 2H17A 3FM9A 5BV0A 4BBPA 1U8YA 2D74A 3UQYS 1P7YA 3MTIA 4RXTA 4DLWA 2LV8A 3AYXB 1E9RA 1QAMA 2P3QA 2WYUA 1J1IA 3AONB 4PZZA 1MCZA 2I2DA 4NCKA 3IMEA 4E31A 5HVNA 2YZNA 1ZCFA 2JFVA 4YRIA 1RAHA 1SCAA 3IAUA 4Y9TA 3O7MA 2Q2VA 3OIFA 1U63A 2YIDA 3L4SO 2QXTA 1KKLA 2VP9A 5GTDA 1L0BA 2JIZD 2CJXA 3EVNA 3DNMA 3C3YA 3KQVA 4CM1A 2BFNA 4URFA 3UB3A 2HK7A 3G68A 3G0CA 4BMCA 2C4NA 2XZTA 2BGWA 3ENWA 3ROQA 1IJKA 2W2QA 3GVIA 1DQYA 1DKOA 5LD2B 1PG0A 1KYYA 3K70B 1BXRA 5G4LA 4BBZA 1P2UA 2IHVA 4TYMA 3Q3JB 3RR2A 1V0JA 3A4VA 5BMVB 5JNTA 3X1YA 4REOA 2DOKA 3PHGA 3HTXA 3P9YA 2XNSA 3QVGA 4FE3A 2C8JA 3BIWA 1Y0BA 4LG1A 4LRQA 2H65A 2IDMA 1JG3A 4QTUB 3ROTA 2O8DA 3FZGA 1N2XA 2F2TA 1CP3A 2CMGA 2B8EA 4HFJA 4ID3A 5EHZA 4RTJA 3FVRA 1NT4A 3R09A 3T9CA 2VSYA 3GPLA 3H8WA 3QFCA 4EQ6A 1UC4B 2XQKA 2CFSA 2O1EA 1RMTA 1BXZA 4C6TA 1FFWA 1GUFA 3K4PA 4EG4A 1JJ7A 4YHHB 5LD2C 2AL7A 2B35A 3F96A 3KLBA 4IJKA 2RARA 1CR0A 3L3BA 4RK0A 1ZO8A 3RC7A 5EXTA 2I2WA 1T8SA 5AM0A 5FTJA 3LBAA 1Q16A 1TM3E 5TEVA 4A2PA 4D4JA 2C5BA 5CPFA 1KWKA 2AYYA 4NESA 2CLKB 3SXJA 4DIDA 1SEVA 1Y3FE 4G9GA 4XX0B 5AOBA 5FL7D 3AUFA 3W2EA 1F51E 1T36A 4YCSA 3TB4A 1WTCA 4UBJA 4FDVA 2C31A 4P98A 1GZUA 3WLFA 1KOJA 3NHLA 1GQSA 1S8OA 2I7CA 4TYPA 3TLGA 1MJHA 1KAHA 4OI4A 3G8DA 1ND5A 3HWX1 2VTBA 4DWWA 2JKVA 5GQSA 2R44A 5K3FA 3OTQA 2M32A 3HDYA 1KZ4A 3QWFA 1G8GA 2ZBPA 2P1DA 1JHDA 4U39A 1XVVA 5B12A 3HNRA 1ATIA 3BXPA 4Z7JA 4H7PA 2AFHA 4GWKA 2GJ9A 3UMFA 1QO7A 5HIKA 3SYRA 3IAFA 1G16A 3FVWA 2JB9A 4ODIA 4WVLA 5I6DA 3ILYA 5A7GA 2PX0A 3NBAA 1ECGA 2GS9A 4CIXA 2EXXA 3KSMA 2PGLA 4HEJA 2OV6A 4KVFA 2R1VB 4YRZA 2VWPA 3A8TA 1T3GA 3Q9LA 4L5JA 4AO8A 4RKRA 4PIVA 4F4FA 1A7KA 2Z43A 4C0QC 2Z2ZA 4RKEA 4DCVA 3FN4A 4RGQA 4X1OA 1XQVA 5HQ3B 3QKRB 5CYFA 4MV8A 1MFZA 3G5LA 1S2GA 1YZTA 2IP1A 2W8BB 2BKAA 1Z18A 2BTQA 2O2ZA 3AP1A 2QVYX 1UF9A 1P9RA 2XEDA 3GLIB 4KUEA 4MDEA 3FNHA 2IIQA 3L9XA 3W6NA 4DFDA 4RVGA 1VOTA 4HAVA 5C5DA 2YL2A 1EYZA 3FI0A 3FTFA 1BJKA 4X64B 2ASVA 2W4QA 1H2ZA 2SKDA 2ZWOA 3DAHA 4G1CA 3TXXA 3UPDA 4BYGA 3G5UA 3N3AC 1H8HA 3R9WA 1T26A 4KGZA 5BPHA 4RM3A 5I7FA 1I36A 4FI3F 3N8NA 4K6HA 3NHBA 2VTBB 3I9KA 4HLUC 2A58A 4LNHA 5DYNA 4ES6A 1KC1A 4QDKA 3BL8A 5DTEA 3FOBA 2PGAA 1TEHA 2FRDA 3R4VA 3CEPB 3E3OA 3H97A 3JQ7B 3IAS1 4FN4A 2PT7A 4LBZA 5ISMA 4K9OA 4G0PA 1NQVA 2AZMA 4WJKB 2R0QC 1QK4A 3E9ZA 3K6KA 4HUJA 1NGSA 3NIGB 5JNRA 3ZI7A 2C3UA 4BZWA 4I1RA 1U8XX 5BO5A 2WU4A 3LC1O 3C70A 4NBLA 1PR5A 2IT1A 2VYVD 5F12A 2Z58A 1O95C 1KR2A 3K2BA 2Y4OA 3KEFA 4GAEA 4LV8B 4RFSA 4X60A 3LBFA 3WO0A 3MCVA 1O2DA 2VJAA 4KPFC 4C2AA 4LJ4A 1J0EA 3Q8WA 1BROA 4UMEA 2QN2A 2BFWA 4BNUA 1LDMA 4PBRA 1A8IA 3S8YA 4HLQB 4DB4A 4JI0B 2XB9A 3NGMA 4I6EA 5JCJA 1OA1A 5LA6A 1T91A 4O0LA 2LUOA 4U2FA 3ZV5A 5A5DA 5IYZB 5KC9A 4G0UA 3N2YA 5TPZA 4HDKA 1X1QA 1OKKD 1RYMA 2YQZA 3NHUA 3BB1A 2FEAA 1XELA 2HH9A 1IG0A 1IHPA 2L18A 4RPHA 2ZRQA 4LDJA 4UM7A 3WK9A 3ADCA 1EPUA 1NPTO 2IUYA 3C1OA 3CPSA 5LP6C 3U7RA 4G8JA 5LNK6 3UOAB 1X3LA 3DTTA 3GGOA 1QH1A 4CLRA 1MC8A 1YIOA 1DSSG 2IV3A 2FEWB 4LSWA 2G40A 5JHGB 4P86A 1UAAA 4L78A 2PZLA 4AW9A 5FBWB 3WK5A 3H75A 5B2EA 1XVAA 4LSGA 4XDGA 5AVWA 1CU1A 1L5LA 1QP0A 5F7OA 4CIDA 2FH5B 4EQ6B 3TGLA 1EMDA 2Y1DA 3HDQA 1DXHA 1IE3A 4KSYA 2ZSEA 4IMIB 1UP7A 1RHRA 3PRKE 2P9HA 2ZZKA 4WLFA 3FKQA 1XZNA 1N5DA 4GLJA 1NRWA 3OAAA 2XI4A 1DJNA 4DREA 2QVBA 3KFVA 1YASA 3AR4A 2QRKA 3L8EA 2AUMA 4RTOA 1CUIA 2GEBA 1S7GA 1K9SA 1HETA 2J9GA 4TT8A 3SE0A 1FYDA 2H18A 5JDCA 4TZKA 1DAMA 3GT0A 2Z09A 3L8YA 1S4QA 1VG0B 1FMLA 3GFQA 1GNVA 4EIWA 1CETA 4D57A 4XD2A 4YROA 2O19A 5FUQA 1FNNA 3KT3A 3R2JA 1ENOA 4GI7A 4O63O 1FMFA 1KJJA 3BTVA 1BOFA 2ADFA 3Q2OA 3QP9A 3V32A 4QQRA 3C3JA 3DMHA 1A9QA 4MA0A 2D5BA 1L4LA 1QZTA 2ZRHA 1EFPA 1QOZA 4CUZA 4WZ6A 3UT5B 4PCUA 1Z16A 5KU1A 1MC5A 4YRLA 1YR8A 2ZR8A 5H8WA 2OBLA 2QRGA 4I8IA 1UDRA 3WG9A 1X14A 1CW2B 1Y1LA 3COPA 4JLMA 1EUZA 2QG4A 1SWWA 1YO6A 4S1TA 3BN3A 2GFQA 4JVMA 1SM4A 4XM0A 4PLHA 3SE7A 3MK31 3HWSA 1GV0A 3A0UA 4DM7A 4IDEA 4EMBA 3ZHVA 4GI3A 1H9CA 1T4CA 3E48A 2HV9A 1YDFA 2PO5A 3NTXA 1OYYA 1M0TA 3G17A 2EG5A 2POCA 1P8AA 1P60A 1WNTA 4CMGA 4N3BA 1V9CA 4LYHA 1P0MA 4LRSB 1XYVA 4JI8B 2DUNA 3WOVA 5BW8A 1MGPA 4J4TA 3FI9A 3PHHA 2WILA 4OHZA 1HV8A 1ETUA 1I24A 5AOVA 4MVJG 1QIJA 1FDTA 4BNTA 1ULHA 3MWEA 1CDDA 4F56A 1A0OA 3A70A 1X7ZA 3QIVA 3ZYCA 2TMGA 2K87A 2A9JA 5DZSA 1NASA 1RCFA 2DY1A 3I58A 1G59A 3NJRA 5AWFC 2JFQA 4XIGS 4EGAA 5KTOA 1PS8A 4H4DA 4YGYA 3VBEA 2XOEA 5KJEA 1VGVA 3EZ2A 5CB4F 5DNWA 4POAA 5CFZA 1KI8A 3PE6A 4BQRA 4KWHA 3OC0A 5JXHA 2QUKA 1K92A 5LQMA 1JWBB 4X97A 1GT91 4LYFA 3K5HA 3ZW9A 1Y5NA 3AI3A 3N5CA 5HMMA 4EI8A 1IBRA 2ZG6A 5HK8A 2PTHA 4NKRA 3GGJA 1CE8A 3Q2IA 3ET4A 1KSGA 3DQQA 1EVQA 3L01A 4QYIB 2KBFA 5TB5A 4K05A 4GVPA 5EUCA 1Z6PA 3CTPA 3KUKA 3BDAA 3QFRA 4GE0A 2JNWA 4HVLA 1Z4NA 4DDVA 4HGPA 1UKVY 1OLSA 1WQ1R 1ZICA 3ND5A 1SXJE 3USES 1W9MA 2VH5R 3IHTA 4EUSA 3AL0C 3KQQA 1JMVA 1IN4A 3MCUA 3OU2A 1XE3A 4KVAA 4ZOAA 2NZ2A 3R5KA 1F2DA 5KYYB 4BRWA 5HE9A 4GKJB 1C3JA 2Z3WA 5K3DA 1NRIA 3UJDA 3WLEA 4CF5A 3CCBA 1KU6A 2NPFA 1BXKA 1D2AA 3GJ3A 2PV7A 2X3YA 3Q7EA 4O33A 3VZBA 2IVFA 5JZSA 1BEEA 2C5LA 4OM8A 4MINA 2Y1WA 5HXAA 4ZI5A 5EXDA 2PUFA 3NHMA 1UOQA 2CE2X 3CURA 2VKQA 2WF8A 4QNMA 4RLHA 3PR1A 3PDHA 2HR1A 4HYYA 4RFVA 1XWFA 1IWOA 1EFVA 3V1KA 5KQPA 3GCGA 3OT1B 1EHCA 3R40A 4EMTA 1Q0LA 3CZQA 4MWDA 3TECE 4LJSA 1R3DA 3JQAB 3M4YA 3OPMA 4INJA 3D6AA 4FE7A 3DCYA 3PHJA 4PPYA 1E5LA 2UZ0A 3CTMA 4TQUS 5DHAA 5H68A 1HY3A 5BQOA 2HSJA 3BIXA 1JKJB 1XLWA 3JQFC 4TUYB 1Z5PA 1B3RA 3IC5A 4I08A 3TRIA 2VDPB 4HQ0A 3DZCA 4MVJH 3K9NA 2GJ8A 4N6GA 5IEBA 1PQWA 1WMEA 1GKIA 1WAMA 3GL9A 4GLFA 4YC7A 1LZLA 1SCDA 1IH8A 2I91A 4C2BA 3A37A 4JLOA 4IICA 3ET5A 4WAUA 1C7ZA 3GH3A 1FNSA 2H31A 2R6HA 5EJ2A 3T9AA 2HBYA 2M1ZA 2PWBA 3JAWB 1P39A 2Q1WA 3B6JA 1YCFA 2D5CA 5E9JA 1E7SA 2H4YA 4JQCA 3ZH9B 3JR3A 5LVAA 1HFKA 3GLVA 3S1SA 4IV0A 1T29A 4Z0PA 4FOTA 1XQWA 1HSOA 3EVZA 3OCXA 3I4FA 3AHDA 4QGHA 5JSYA 3R9XA 2EV9A 1KVQA 4HS9A 3ZHRA 2G71A 1RC0A 4E6PA 3O8OA 4L9AA 2P78A 2V6BA 3ANMA 3LC7O 1ZU5A 4G5GA 4LZNA 4JIGA 4KDEA 5BR8B 1NRXA 1LBHA 2ZTVA 1GLGA 2Z9CA 3F46A 1NQXA 2O8FA 2NU9A 5G02A 3RC2A 2HJGA 2IDZA 1P19A 3I2KA 2NX2A 3INRA 3QOXA 4ZI7A 1E2NA 4HJRA 5GV7A 4IOMA 2RI1A 2PX3A 3HVUA 2ECOA 1MENA 1N6OA 1XCJA 3M4NA 2YWXA 2Z2JA 1WPGA 4LJYA 4RLFA 1HQCA 3PJFA 1QH0A 4V0ME 3GLIE 3WJ7A 3HNOA 5AW0A 1Q77A 3SHWA 3DFZA 5ALTA 4JELA 3OZUA 4JUFA 3TCKA 4QPCA 1YGPA 3EIQA 4IFEA 4UHDA 4YJ3B 3HA5A 4EG8A 3IULA 3K35A 2J6BA 5IWCA 2PFKA 3FW1A 3P4XA 3MJEA 3TLJA 1TLFA 5COAA 3PD0A 1MQAA 2CXPA 1VP3A 2A92A 3DZKA 3MMNA 3USZA 4RX1A 1GARA 4Y18A 5BWBA 3TNJA 3LI2A 5CXQA 1WKCA 3C15C 3MFYA 1EM6A 3ND9A 3O2JA 3T06B 4PRZA 4MH0R 1Y1QA 1FTNA 3BHMA 1A9YA 3OEYA 4MRMB 4GICA 4MRVA 1EBUA 2GTPA 2I6GA 3F9IA 3H2KA 1VLMA 4J94A 2GYUA 4ZALA 1COWA 5FI0B 4CQLB 1HZZA 1M2WA 2HF9A 3VOAA 1JE1A 2JFYA 1U0FA 2KJQA 3DKPA 3K5PA 1B41A 3BFXA 3T9DA 1E1RA 1GL9B 1GV1A 2Q4DA 2NU6A 3L7JA 3EDRA 4RPJA 5E6UB 1FOEB 5EJIA 4D45A 2I2FA 4G1BA 1TRKA 1ZL2A 2BBSA 4X71A 3WBFA 2PJUA 4WXYB 2FUKA 3E82A 2I4OA 3GJ6A 3ZTWA 2WAMA 1F12A 3ZWYA 1DAOA 2PRZA 2E7ZA 2R3SA 1OLXA 1T24A 4YJ2B 3TW6A 4YT2A 1OY1A 3RKSA 4EELA 3UBTA 5KKAA 1E99A 4HDOB 5I4KA 1P1KA 5E6RA 1RKUA 3TINA 4EAAA 2REXB 4BQSA 3KALA 3S2UA 2SICE 3AFGA 3LFHA 2I76A 1UBTS 2ZB3A 4ARIA 2A9KA 4N4AA 4B8WA 1CYDA 3IERA 5KO2A 3GUUA 4RVNA 2UVQA 3OKFA 3DLAA 3G1WA 2QL5A 2VDLB 4OOEA 2BUBA 3RVQA 3ADOA 2B69A 3ZDFA 4WHMA 2D0IA 3UJAA 1JH8A 1MAAA 2GEFA 4HI0E 3T5CA 1OIWA 4NABA 4B3TB 4MR9A 2JGDA 2DPYA 2P9ZA 5DBGA 2XW6A 4GMKA 4AXBA 2RGRA 5ENDA 4XJTA 3LF1A 4O4IA 1Y1SA 2HCBA 2P3SA 4U8GA 3IEKA 3KEQA 5F98A 1MG5A 2Q3MA 4PF1A 3L41A 4CT5A 3AERA 3ZV3A 4NPAA 6LDHA 4TXLA 4HVAA 4HDAA 5JVDF 1V3UA 5EHGA 5CHYA 3HJUA 2JHFA 2IYYA 1CUWA 3ICQB 2IPMA 3GAZA 1QKIA 3TE7A 2RJNA 3K1JA 1NBIA 2X5NA 1B23P 1GSAA 2REQA 3GA7A 4FSHA 1N2JA 3FYTA 4GBGA 5AW8A 1KWGA 4YP0A 3VR0A 4EZEA 2VWHA 5D1HA 1Z26A 2XF2A 1CQWA 1PZMA 1NUSA 3C14C 1WCIA 3Q7RA 1E3DA 3J80A 3JQ6A 4M1WA 3A1NA 4A6EA 1JFRA 1XALA 1OILA 3K70C 3HKEB 2QK4A 3ORYA 1U3TA 3MUFA 4A2QA 1QANA 5JNSA 1DDOA 2PS1A 3PR2B 4KMOA 4BNKA 3RJZA 1ISRA 1LWOA 2CBGA 2P4QA 4B31A 1CUFA 4PSUA 1GPUA 2VZ9A 3B1KA 3WMWA 1DJLA 1Y9ZA 3ZOKA 1JKFA 1J8VA 3A36A 4JWTA 3FNEA 4XUDA 5I7RA 1YB2A 1JXMA 4F21A 3NQ41 2FF5A 1GPLA 1WBBA 1AD2A 1TECE 3GGDA 5T6MA 2QBYB 2XTAA 1GA4A 2PEYA 1USGA 3EWIA 1VPLA 4INZA 4KPUA 2YV5A 1B8VA 4LOJA 3N87A 3BEDA 4JC5A 3U4QA 3T5MA 1NZFA 5EPEA 3N8KA 3QKRA 5JH7B 3Q7SA 1J0XO 1J33A 2OO3A 3FUVA 3EXHC 4YY3B 3OOJA 3UMBA 5JAMA 4MROA 4W63A 2NSDA 1O96A 4I4CA 3KKOA 1OX5A 2Q6OA 4QSHA 4Y9RA 2I7DA 5AW9A 3OA0A 4JI5B 5BSWA 2CE7A 3NC4A 4F12A 1I2AA 4F3KA 2DETA 4DR4B 2BYTA 4HDNB 3H2SA 1CS4C 4IGFA 1Q12A 2RGEA 4EYKA 1FUEA 2YVUA 1CXZA 4NULA 3MMZA 1Y4UA 3PUIA 4P7KA 4BVJA 4PG7A 4BQEA 1H3EA 4BNGA 1PX0A 4IKPA 1YC5A 1ZK0A 2OO7A 2ZYSA 3AESA 3VAAA 2IBTA 2I2BA 2C1ZA 1CEYA 2WZQA 4K3VA 4KR2A 1V4NA 3UMJA 4LF5B 3R4CA 3DFIA 2J3DA 4D3DA 4DG8A 4J1SA 1JHYA 1UMDB 3HKBA 3OY2A 2GPAA 1MJNA 4PICA 2QL7A 5GJWC 2ZS9A 3CCFA 4M8SA 5I45A 3FNRA 4UTVA 3OD5A 4D25A 2JVIA 3A9WA 4ZCPA 2XNHA 4YALA 2W5UA 5CDYA 4K26A 4L0CA 1LLCA 5DV9A 3KR0A 2C2MA 2IOHA 2GKGA 1MOSA 4KU4A 5IFKA 1USWA 4HEQA 5LOVA 3EPJA 1Z7YA 1WB6A 4F5DA 1N9GB 3DOHA 3V2IA 1ZXBA 4MITA 3DZBA 5HX7A 1ZBQA 3AVVA 3VKHA 2H63A 4F96A 1X8XA 5U4XA 4BNFA 5TGZA 5EQJB 5KWIA 2AQKA 4IHJF 4MCHA 4Y6SA 5HILA 3NDRA 1A8UA 5LQNA 3FUCA 3B2EA 1XZQA 1WUHS 2FGKA 4N9WA 4YMWA 3OOYA 3U0VA 4IQ0A 4F6RA 2ZCJA 1UBJS 4NBSA 1OWNA 4J16C 2FPKA 2W6QA 4G2TA 2QTZA 5GOZA 1V71A 1MIOA 2RHMA 3QA3E 4MCIA 4TSKA 4EGCB 2DWPA 2V7QA 2XE8A 1OAOA 3AW9A 3P4YA 1XYGA 4N5HX 1ZYUA 2IUFA 1CRLA 3R7SA 3RU7A 1HNXB 4RA6B 1PF7E 5JQGA 1KMHA 1TYBE 4JB2A 1N6HA 1I4OA 1O94A 2PSJA 1BKDR 3OUTA 1KEVA 2LCIA 4D9NA 3KM0A 4YRGA 5IFLA 2ZSHA 4H59A 4BGIA 1BS2A 2YFHA 4JODA 1RCTE 3GRFA 3M5PA 3PGA1 5FTLA 2FEMA 5AT1A 4C4ZA 1QG4A 4PGHA 2BRUC 4LNUB 1Q5PA 1PNOA 4MB0A 1QYDA 3BMXA 5F73A 1DX6A 1XJQA 2RGXA 4U4AA 3RU3A 2WVHA 1XF1A 5ICMA 3ZIAD 1OLSB 5BOSB 4S24A 2ZR0A 4CKEA 3JYLA 1OXKB 3NGLA 3PC8A 1FLNA 3KHUA 2H5JA 2X76A 4ZODA 4YGXB 3FTCA 1SQ5A 1NE2A 1YKSA 5JTTA 1K9VF 4OQMA 3SJAA 1ST2A 1ACLA 1N5LA 1VSVA 1I8TA 2VBCA 1DFIA 3NVMB 2BGGA 2JIDA 2Q21A 3ABRB 2PBFA 3F5MA 4KLZA 4O1IA 3ZWXA 3COSA 2NG1A 1XTKA 3A6FA 5HQJA 1KDZA 3QTLA 2VNSA 3FCYA 2XA1A 4PYOA 1LTHR 3K53A 5HW0A 1TUBB 3KZMA 2RK6A 3LUCA 1L3BA 2ZWIA 3JQPA 3V6LA 3WQQA 5C8YB 1T5OA 3KYIB 3O95A 2FLVA 1QGUB 5CBPB 3U19A 3NBKA 3K0EA 4HDRB 3NHZA 4ZC1A 3VR5A 5JQGB 5FP0A 4RHTA 2VPYA 3OU7A 5KQRA 1ZC3A 3N0VA 4MQUA 1N3YA 5EWLB 3SKXA 3P96A 4YMUA 1FSSA 4IJVA 3ETGA 4LA4A 4CT0A 4ZVUA 4TMTA 2Z8YA 2AOWA 5AHWA 4DWOA 1CWUA 5FLEX 1RJWA 3M2PA 3UXMA 4P8RA 4GOND 1P81A 3O8QB 1A1SA 3ORFA 1RQPA 5E4YA 4TVKA 3UC9A 1ZLYA 2Q8NA 4YFYA 4XFDA 2IS6A 1I3KA 1FVXA 3R5HA 2IDJA 4OYRA 4UW9A 4B4OA 2Z1NA 2ZCVA 4PLPA 3KSZO 4ZVTA 1VG9B 5FA6A 4KRFA 1N2CA 1U9JA 1OWPA 1GRQA 2X8AA 3E2PA 4DF3A 5CFPA 1ISGA 1YRYE 4EYGA 4DR7B 4JXXA 4AKEA 3NB0A 1SVWA 1YI0A 3DAPA 1YZUA 3KQOA 4RWEA 3W0LB 5DHFA 5KNDA 2WQ7A 2PYZA 4TL9A 3R7AA 4J0HA 4TWAA 3A6PC 2AXQA 3JQGB 3WY9A 1XMXA 2OE2A 2R5NA 3RVMA 2CMDA 3DG9A 2VJOA 1DCKA 3JATA 5LMCA 1GZVA 1GR1A 1Y4ZA 4BGUA 2W93A 1I7DA 1IN5A 4KP7A 4IPTA 4PX9A 3WWCA 1KHTA 2PA3A 1VKRA 3UNXA 2MSCB 3ZHOA 4H0FA 3W2HA 1VJTA 3VI4B 1Y6QA 4G0NA 1M6VA 2QRQA 1QUFA 3ICOA 2V1XA 4IIDA 1EFCA 2CNWA 3HWRA 1EWTA 4J7AA 5CLLA 4UNQA 4TYWA 1LVGA 4XUEA 3X2FA 1RHJA 1GG2A 1M1XB 2PN1A 4HLNA 1WA5A 1YV9A 2HIHA 3VSBA 2ZM6B 2VT2A 1B2LA 2WR8A 4K28A 2VP2A 4R8RA 5KMGA 3TE6A 5ICFA 1SCUA 1RXSA 2OXEA 4WKOA 5LQJA 3EXG1 3GWGA 2HMWA 4FBLA 3R9IA 3TX6A 3TD6A 1PCXA 1FW8A 2AD5A 2KPOA 1O8CA 2Q5FA 4OOFA 3T35A 1JVNA 4EGFA 1G7TA 1NMEA 4BUCA 1LNZA 2D8AA 3DA8A 4O4JA 1YQXA 4Y2PA 4ZI3A 3X44A 5IEJA 5DYTA 1KEEB 5JNWA 1SOWA 3GFBA 3H5NA 1UOPA 3DVRX 4L9SA 2GN0A 4ZI7F 2PMKA 1S8FA 4AZWA 4EW3A 4JH0A 1VYHA 4K86A 1M33A 4QM7A 3GNSA 1E1NA 1G8JA 1E9DA 1KYTA 1QHEA 2Q9CA 4CF3A 6Q21A 1OPXA 1LS6A 3PJGA 2WJYA 1BVRA 4MICA 1ODLA 2FRVA 4AQ7A 5DK6A 2YX1A 2WNIA 1SH7A 3KRTA 3G2HA 3G2MA 3TFWA 5ITZA 4H7DA 3RTEA 2ANBA 5JAUA 4GS5A 1E8MA 5EWJA 4ABYA 3ICWA 3ZUGA 5DX8A 1HYEA 4M0DA 3QZUA 5FOQA 2G07A 3T38A 4DKJA 5KCMA 1ODFA 3TRDA 2EX0A 1WDKA 5BV8A 1XL0A 3ICPA 1EGMB 3T1OA 1COZA 3GA5A 4CTJA 1I10A 3OURA 4LK2A 1BRMA 1RKXA 2RB5A 2OD7A 4L75A 5DH9A 3U3JA 1GL3A 4ZVSA 1YR6A 5LBTA 2UYYA 3THXA 1Z7WA 2O2HA 3O4RA 1CR6A 1JL3A 1NBEA 3U3RA 4ENSA 3IOEA 3VZSA 4TTQA 1VSTA 4QBHA 3OKCA 3I34X 1DBWA 1FP7A 3EH1A 5EUBA 3ZZ1A 3FRIA 1UIRA 5L3QA 3BGOS 1BD4A 2WKWA 5JS2A 3WGKA 3L6EA 2H2WA 3WLRA 2OLKA 1T5SA 3OZAA 1SUWA 2RGNC 4OHUA 2CWDA 3A2NA 1HMPA 2H08A 3LT2A 3AVUA 2RC5A 1QYCA 4R7TA 4BFSA 1K1EA 5JYBA 2J45A 5FAKA 3S27A 2L82A 5C8ZA 4J43A 2DTXA 3PGXA 1H6CA 2CT8A 2W2XA 3SAJA 3AM3A 1T8UA 5I4IA 3DS8A 3LDGA 4JFAA 1NVMB 2JZCA 1V11B 4KLCA 3ZQ6A 4IO0A 1LI5A 3RVSA 4TV8B 2P41A 1CQIA 4IDHA 4C07A 3B1JA 1G1AA 2H7VA 3BD9A 5LA6B 2P2NA 2B7CA 3QJ5A 3JQEA 1X86B 3NOQA 2PKCA 4G9BA 4IFBA 3RBXA 1CY0A 2W00A 4FDUA 2JARA 1GITA 4BE9A 3LL7A 5E6SB 3ZLTA 1T1SA 4BDSA 1XU7A 5ICGA 4D0NA 1E4OA 2Z2KA 3L2OB 2OV8A 1YS4A 2DMRA 3VDNB 3I92A 1AZWA 1JXOA 4YJDA 4DGSA 4XCXA 4CFYA 4DV2B 1M2NA 1LNSA 2HQRA 3W9SA 4RIGA 1M2KA 1MA0A 1E9VA 2YZKA 1A97A 4OHYA 5AH0A 4FLMA 2YJGA 1SRQA 1FVFA 1F5SA 5B58C 4QPPA 3GPIA 3E4DA 3D6HA 3DVAA 3NBQA 4HRVA 4M0FA 3A7DA 2ZJ8A 4WXPA 5AVRA 1VPWA 4AJNA 1Y9EA 2RIRA 1N5JA 1WBJB 2AR0A 1Z88A 2PUBA 1E2EA 1M0WA 4HGQA 4FOOA 2VPTA 1FYFA 1ZVMA 3IVCA 3LGXA 2GZSA 3IYLW 2F64A 1UQRA 3LHFA 5BRNA 1RADA 3SK0A 3MWJA 2YZMA 1QAOA 1SZCA 4KCGA 3NDPA 4PYNA 5B58T 1C9YA 2HJWA 4JQZA 4PTZA 2FDRA 5I47A 5DBOA 1BX1A 4WASA 4WOBA 5TDHA 4CXMA 4KRXA 5K8VA 1N5OX 1CNMA 3H4VA 4DPMA 3DEYX 1E3EA 1OXBB 2C00A 2QGZA 1XKLA 2VG8A 4PAOA 1G7RA 3HCPA 4XVRA 3OESA 1M1ZA 3I5UA 1GXSA 5KSPA 3RSOA 2CFTA 5DM60 2AV6A 4BL5A 5H4GA 1BHSA 3WWZA 3R7WA 3CKLA 4MTCA 4RC9A 3STYA 4LVOA 4MWGA 5LR6A 2ISCA 5G1PA 2FW9A 2H9YA 1CUSA 4ITUA 5FUBA 3N70A 5BV7A 2X58A 1VFNA 1O3YA 1M75A 3N07A 3C1TA 1Z07A 1RJDA 1MXFA 1RLJA 2DHEA 4XR9A 4DOMA 2XAUA 4L85A 4BBAA 1M2OB 1Q2XA 1L7RA 1M5RA 1QBKC 1UOOA 2J6IA 3KS9A 2VOJA 2YXDA 4MCAA 3E35A 4N0MA 2YQ5A 2PEZA 3K9LA 5BW6B 4B33A 4LKOA 3BZBA 3EQ2A 4QC2A 5FPHA 4RHFA 4YV0A 3RD5A 3QHAA 3TIGA 3ZHCA 4E2XA 4E7PA 1FQKA 7REQA 2BFCB 3BCHA 3W6PA 3DTVB 1MV8A 1Y3AA 4R1LA 5B57C 4FW9A 1GGEA 1XRRA 3R6WA 2FEPA 2WAOA 4GR9A 3EGXB 2R11A 1A27A 3K0BA 2W2LD 4OQNA 1ZK4A 4UHBA 4UKDA 3THOA 2RC6A 3MJSA 4B4WA 1C1YA 3C8ZA 4ZDWA 1XCBA 2QT0A 1UBOS 4HUQA 5K0SA 4ZHQA 2E4ZA 5KUTA 1FFDA 3FWKA 3FCUB 3INGA 3KSRA 3MB5A 4B2YA 2EW8A 4DSZA 4BBJA 4ZYZA 2PJZA 1JAYA 1Z36A 2UZ3A 5CCXA 1J2EA 1HTTA 2DUWA 3EQ8A 1CP2A 4R71A 1IN6A 3WLAA 1N9GA 4X00A 1JDNA 3NH9A 3L7OA 3NW9A 2ONJA 1E2QA 1XTTA 1YOVA 4RK6A 4CT4B 2UXCB 1P9OA 2BMJA 3VJMA 1T1EA 2JAOA 2V0CA 1WULS 4F3NA 4GVLA 3V3KA 4I36A 4HAOA 1M6WA 3MBKA 5JZBA 2J9ZB 3B48A 4QBGB 4LOIA 1U7UA 2CL5A 5DGXA 2NT3A 3WGZA 2VDNB 2VF5X 2O9JA 1LTKA 5TQ0A 4FB5A 4LV5B 1W1UA 2QRJA 3EXHB 4GMDA 5C7IO 4N76A 4GEGA 4V24A 1FYVA 2Z1DA 3MG9A 1ONBA 4MKHA 2XDAA 4C6TB 3AJ8A 1VMIA 3EBPA 4EENA 5FPQA 4AG3A 4MDFA 1TFUA 1WETA 4BY9E 5JALA 5FR1A 2ZSKA 3LQKA 3WK7A 1VXRA 1BU5A 5BVGB 1E64A 5K8IA 2HQBA 1XTVA 4EBFA 5J23A 2WKQA 1G4HA 2D1YA 2H9AA 2O8VA 1S2NA 1S9HA 4CKCA 4JL5A 4PAMA 4DKXA 1W73A 4JQSA 2H06A 3H5LA 4I99A 1E0DA 2FPRA 2VHYA 3R3VA 3LDAA 1QMGA 4A82A 1EK2A 4EI9A 4ZMBA 5IXSA 4LJRA 3ZE2B 2WWVD 2MDTA 1ZHFA 3QRWA 3PFBA 1IZZA 4P4GA 4UM5A 3VOTA 4MULA 4RSRA 3EA4A 3MA0A 1KEZA 3AY7A 3JQRA 5FNVF 2YICA 1THTA 1UINA 1H94A 1Q1BA 1GUBA 4QXRA 1NVVR 2JAPA 2LIVA 3MWEB 3FZNA 4L28A 5EHNA 3RHZA 2NO6A 1IXSB 5DM4A 4KNYA 1E2MA 2FWIA 2XYRA 2YZGA 2IV2X 4JC8A 3KC2A 4WEQA 3RRFA 1ZM9A 3LPDA 5IF9A 5ALMA 2XF8A 5LMNB 2G5TA 1DC4A 3P45A 2ZRJA 4EOGA 2B94A 3DYBA 1IXYA 4WNAB 4JL8A 1X9GA 1O6ZA 4ZOCA 4FFOA 4DL9A 5FNVA 2O4CA 2OLEA 5LQUA 4RV5A 3CS3A 4IDDA 2JKZA 5KS2A 3EPPA 1ZR2A 3THYA 1EGVB 1G60A 3GFPA 1JDSA 3CX6A 1I2DA 2DP4E 3V4ZA 1BCRA 2HQ1A 2XXBA 1EWVA 1F20A 4AZ0A 3IBFA 3D81A 2VHTA 3D2CA 2BELA 2ZYRA 4TWZA 1ZAYA 5CFRA 2C7OA 3K8QA 1VLHA 3E5HA 3O92A 4BFUA 3HE3A 1QF9A 1JV2B 2P2YA 1U4NA 2EFCB 2BTQB 3JD4A 3PS9A 4V0QA 5IVHA 1YFZA 3HPQA 3MD0A 1MDBA 4YDQA 2L2QA 3P2IA 3PUVA 4G0MA 3W3ZB 4PVCA 4OHCA 5BN5B 1JG4A 1UJ6A 3M5WA 1U11A 2VR1A 2IUSA 3RJTA 1L5GB 2W4MA 3DMDA 4XQEA 4ZREA 4D3XA 2QD3A 3H6KA 1PFQA 5ESRA 4HTFA 2JH9A 1JHMA 2EL9A 1M1YE 1Z68A 3I8SA 1JHZA 3QU9A 4RVOA 2RGWA 4CTKA 5EMHA 5ILGA 1ISJA 2HLPA 5K51A 4BMVA 1JR3D 1ORRA 4E4RA 2ASEA 3H86A 4C0KA 4C4TA 2BISA 4GGOA 3OFND 1P2FA 1GZ3A 3AIMA 2ZROA 1JQ3A 1V8FA 1ORHA 4L15A 2QN9A 721PA 4FBGA 1DAEA 2Q62A 4ZVNA 3R7BA 4C0LA 4TYYA 3UEOA 5JYCA 2ETVA 1GTL1 2FQWA 3O2SB 4GZLA 3CF4G 4WNCA 4KBGA 4HQFA 4WN9A 1UFOA 2TRSB 4XFKA 4I55F 4AO6A 4BNMA 5LJIA 1IZ0A 1AXEA 3O3NB 1XL1A 2B1QA 2HDWA 3B9QA 4ZRMA 2QR2A 5CBKA 1IRIA 1H6AA 3B9PA 3B6MA 5C1IA 4ENTA 3EIHA 3NAQA 3FRJA 4DANA 2UZ4A 4X90A 5FWDA 5B64A 1QTNA 2V0GA 2HA7A 2Z2IA 2GM9A 4E1AA 1HLPA 2M6RA 2XWBF 1K4YA 1OI4A 4X6UA 3NVKI 1UJBA 4ZCLA 2ZVPX 3IEUA 2GDZA 3M34A 1WMAA 1OBCA 3EK2A 2KB0A 4I7EA 2QX9A 3VH2A 2PGJA 3LLVA 1TU3A 2EGGA 4EPWA 4F5EA 3CX7A 2QVLA 5K0BA 1YRBA 3DWGA 3P9IA 4MKFA 4FK8A 4W4TA 5FCDA 4Q9DA 1M8FA 3ETJA 3GI1A 3AI2A 4IEIA 4NK5A 3THRA 3N5KA 1JBKA 1RFLA 3M1LA 4H6VA 4RBNA 4J07A 3U7IA 4L76A 3FYUC 5A5VA 3G1UA 5LU9A 4M87A 2W11A 4ZXPA 3AW8A 1B76A 1TLTA 4C04A 3ETCA 1O4WA 5K9ZA 3LS2A 2Q49A 4MQFA 5LLSA 3IBGA 2QB5A 3KU4A 3A7EA 3KUCA 1PAUA 3TWOA 4HHEA 2WA1A 3EGOA 5DASA 1QHYA 3LCVB 1BHJA 5D5HA 1U0RA 5FH9A 2OB2A 1FL9A 3T7CA 3QLVA 2BEUB 5CUQA 1L8XA 1REQB 2GBIA 3L5KA 3OX3A 2NNWB 4RAOA 1PTJC 3JAKA 3EXFA 4QULA 1ULUA 2NZWA 3HJAA 4Q19A 1EU1A 3HL4A 3L7DA 1EJ6A 3U31A 4LFBB 4XJSA 4ZJZA 2E82A 2PH7A 1ML3A 3QMMA 5EIWA 3ZWBA 2YCLA 1PV4A 1LPPA 1WHSA 2Q4TA 4F72A 3A9CA 3FB4A 1Y7IA 3HNPA 1L4YA 1TCBA 4PHCA 1S2OA 4DY6A 4A6PA 2OHOA 3O9MA 4M6WB 5AQEA 4EEXA 5T7BA 3ZJTA 1CS0B 4W6QA 2FPSA 3C3PA 3NWEA 1XDWA 4NE2A 3GHYA 1FU4A 1FQOA 3BMOB 3DDZX 4D3YA 4DG5A 2XCRB 2UUAB 1U2DA 1W44A 1QGYA 2JANA 3BGWA 4UJ3A 5D7BA 3ZLVA 4EI7A 1JWAB 1M6EX 5KYWA 1NUTA 1WABA 4EMUA 4Y6OA 1JU3A 3EXIA 3KD3A 3R41A 3MGGA 1XV5A 1WDLA 3L82B 3QWAA 5DTIA 2CF6A 2XWPA 3OEHA 4L4RA 3L0BA 5IABA 4PZYA 1D8TA 1A9PA 1RPNA 2H1CA 2QLNA 3ENKA 4L74A 1BN6A 1H42A 4QICA 1VC2A 2O52A 5JXJA 4PLGA 2V96A 4BVGA 3LLCA 3B9RA 2H1WA 2EBUA 3RSFA 4I6JA 2LDBA 4F4IA 4ENPA 1SXHA 1YB4A 2AG8A 4I4LA 4V0RA 1OLUA 3BREA 3DTNA 3QYAA 5NULA 3WDSA 4G5RA 1ZCZA 1JPNA 1ZCBA 2ZPUA 1FDOA 1JQJC 4CM4A 3K9CA 4CR8A 4HMPA 4DIFA 2R8EA 2QD2A 4YRFA 2HBQA 2P8SA 3ELUA 3OLWA 4RGBA 5TMEA 3W6ZA 3ZWQA 4G07A 4PCAA 3WGLA 4NCXA 2PD4A 1JFTA 1BA3A 1TTTA 1JGTA 3ND7A 1R6VA 1S9DA 5AP9A 3IDSA 5F5NA 1P45A 2HMSA 3KZKA 2FHSA 3B1YA 2BP7A 5K0NA 4CR6A 3PNLA 2ZUVA 4GL4A 1ZPDA 2QLFA 5IG2A 3GC6A 2RG7A 1ZN7A 1QBGA 1WB5A 3D6TB 1LBQA 2PG3A 1LEHA 4NAVA 3UCEA 4DSAA 3N2KB 2DYKA 4JU9A 1ZJ4A 3BA6A 4ALNA 3ZLUA 1W0CA 4O4LF 4E70A 3QBEA 3AFMA 2GXAA 1PR4A 4CWAA 3QELB 5HUJA 1ST3A 3GFOA 1PQYA 4RM2A 2WBLC 3VPGA 2ZUSA 2WJ6A 4PV7A 3P0IA 3TOVA 4F84A 2V6GA 5K4HA 3SYTA 3JARA 5KINB 2AOTB 1UBEA 1QRRA 4PZCA 1EFHA 4K6MA 3TTTA 5INTA 5TXGA 2EBWA 4QYXA 3HWWA 5FUXA 5G2OA 2UYQA 5CITA 2X4GA 3THSA 4YCNA 3ORRA 4DR6B 1VE7A 2CXXA 2Y1GA 4G1FA 3ZY4A 2C5HA 4G37A 2Z30A 1XK6A 2DERA 3UO8B 4QDJA 1HUQA 1E62A 1JYFA 2OGSA 3O3MB 4P3XA 4M3NA 2A5LA 1WF6A 3W2TA 521PA 1U2ZA 4RK1A 2SCUA 1RRMA 1EVKA 2QXUA 5IHPA 5C1OA 4ZOLF 5HEKA 5TR9A 1EFAA 5JVDA 5AD1A 3NHWA 2CLEB 1JQAA 2D1SA 3AF4A 1SC9A 3GHHA 2WM9B 3IE0A 4B3JA 1H2YA 3LBIA 1GCGA 1ONSA 4MW1A 1CZOA 2FW8A 5KCZA 5CVCA 4N49A 4LJKA 2XXAB 5EA2A 3QVXA 3AUKA 4XYGA 3V8QA 1WPQA 3AVPA 4DT1A 2W2TA 1M5TA 1ZW6A 1JS1X 1Z62A 2XADA 1EVZA 2WU1A 1E2LA 4QOGA 4FZRA 3IAM6 4AF6A 1AY0A 2FDXA 1JR4A 4FONA 3PYLA 4W8GA 5BWMA 4ML3A 1UXHA 3QY0A 1KF0A 1FK8A 3EVDA 3NUZA 5HP4A 2IJGX 4K1XA 3M3DA 4IF4A 1A5AB 4ZYUA 1M2VA 1MVNA 3OA2A 8ATCA 5DNYB 3QVWA 2HUNA 3ZC3A 2PU7A 3QITA 3I2HA 2XQGA 4UDNA 4X7MA 3T95A 3SOPA 1X1CA 4HRYA 3V7WA