3H1HD

Cytochrome bc1 complex from chicken
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 73
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3h1hD01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3h1hD02
2AI5A 5H2FV 1IO3A 1DW3A 2OZ1A 2QJKB 2KS1A 1YICA 1CTJA 1RAPA 1ETPA 2N9JA 3PHLA 4A7PA 2AXTV 1CTZA 3RLMA 1FI3A 1CRGA 2BCCD 1H33B 2Q3EA 1FI7A 1DVHA 1WEJF 3DMIA 1CEDA 3L4MA 1I8OA 1NTMD 3ORVA 2MHMA 3ZOWA 1CSWA 1L9JC 4WQ7A 1M6ZA 1LFMA 4WQCA 3ZIYA 2Y0EA 1LMSA 3HQ7A 5C9MA 1LS9A 1FI9A 1FOCA 3BCCD 3JBTB 1R0QA 4FA4A 1CRJA 1C7MA 1CXCA 2N18C 2GC7D 3O0RC 1CO6A 3OA8B 1DW0A 2V07A 3KZIV 3CU4A 3VRDA 3SLEA 1IRWA 1EZVD 1MZ4A 2K9JB 1C6RA 1NMIA 2FWLA 1K3GA 1GIWA 2N3BA 1CIEA 1K3HA 1NMLA 2N9YB 1HRCA 3ZOYA 4WQBA 1YEAA 3TF5A 2C9XB 5AURA 1MG3D 1LC1A 1U75B 5B5EV 2D0WA 1H9XA 2PCBB 2VHDA 4P4QB 1W5CT 2BLFB 1E8EA 1GDVA 4O1WA 5CIFB 4GEDB 1SQVD 1CHHA 1N90A 2B10B 2C2CA 2ZOOA 1AKKA 351CA 1MG2D 451CA 2ZZS1 2MTAC 4YE1A 155CA 2B12B 1I6EA 2BPBB 4PWAA 4AANA 2ZXYA 1HJ5A 3M97X 1HZUA 2CA3B 5DJQC 1CYCA 4DY9A 5KLIB 1I6DA 4H0JA 4AAMA 1H32A 2OZ1B 2BH4X 1SQXD 2I8FA 1DT1A 2KNCB 4UB8V 1OCDA 3KHUA 1CTYA 3WC8A 1YNRA 1BGYD 3PXSA 3RN0A 4EIFA 3C2CA 1NNOA 4FA1A 1IZL0 2IBZD 4WQEA 5B66V 1SQBD 1DW2A 3CX5D 3ITKA 5CIDB 2GC4D 2A06D 2DVHA 3PXTA 3ZOXA 1H31A 3MK7C 3L74D 2C1DB 4AAOA 1AYGA 3O1YA 5E79V 5EXQA 1P84D 5KAFV 3GG2A 3CX5W 2JWAA 1CC5A 3OCDA 4FAVA 1HZVA 1BE3D 3WFEC 5CIGB 1SQPD 3L73D 4FA5A 2B11B 1F1FA 1HCMA 3WFBC 1KB0A 5TJHA 1QN2A 1QL4A 1M70A 1CORA 1CRYA 3L71D 3L72D 1KX2A 5IY51 3H1KD 1RZ5A 1GQ1A 2PACA 2FYUD 3GW6A 2D0SA 2AIUA 1B7VA 2QJYB 4FA9A 4PD4D 2Y0DA 5DFSA 2CE1A 4KMGA 1I54A 1PP9D 1DVVA 3CXHD 4WQ8A 3H1HD 5CYTR 2JQRA 3SVWA 4XYDB 4IL6V 1CCHA 1NIRA 1HJ4A 3A0HV 1F1CA 2C1UA 1L0ND 1DW1A 4FANA 4H0KA 3H1LD 1C2NA 3CXHW 1C6SA 3TGUD 3CYTI 3PTZA 3TYIA 1ZZHA 1U74B 1CSVA 2L91A 3PXWA 1C52A 1AOFA 1DIIC 3O20A 3RN1A 1H1OA 4RSZA 1LC2A 1CRIA 1GU2A 3HQ9A 1YTCA 4EIEA 3H1ID 3WU2V 2PCCB 5KAIV 2HV4A 1N50A 3NBTA 4FB1A 2DGEA 4JCGA 1E2RA 4LJIA 1CIGA 4GYDA 1HROA 1NTKD 1H31B 2YQBA 1L0LD 1C75A 1VYDA 2Y0CA 5DF5A 2EXVA 1A8CA 3ZBMA 4D6TD 4EIDA 4WQAA 3ZOOA 1A56A 3PLNA 2RMZA 1QL3A 1C6OA 1WVEC 1YIQA 1CHJA 3OCDB 4O1QA 1RAQA 2N18B 2N9IA 5KKZB 3ZCFA 3NWVA 2CXBA 4QAOA 1GKSA 4L3GA 4AX3A 3X39A 4EDFA 2YK3A 1CIHA 1CSUA 1IQCA 1A2SA 2V08A 3WFCC 3PH2B 5GTIV 1CCRA 2C8SA 1YEBA 2YIUB 2B4ZA 1JDLA 4U3FD 3PRJA 3DP5A 2LITA 3L4OA 1QKSA 2ZONG 3CWBD 1KIBA 1BL9A 2XTSB 3SJLA 4L1QA 1M60A 1I5TA 3NBSA 1S5LV 1I55A 2C1DA 1E29A 4L3HA 2N3YA 4N0KA 1H33A 1CYIA 1CXAA 3SWSA 1CSXA 1KB9D 1KX7A 3FWLA 1CNOA 1CYJA 2GB8B 3WFDC 5DJQB 1IRVA 1NU1D 1EB7A 2BCNB 1KYOD 2RN0A 2YCCA 1FHBA 1HH7A 5CIHB 4MU8A 2QG4A 1I8PA 3WUIA 4V2KA 3OA8A 4WQDA 1ZRTD 2FRCA 3O5CA 4PW9B 1H32B 1SQQD 5CICB 5C0ZA 1AOQA 4RJTA 1KYOW 2ORLA 3DR0A 3TDKA 1CIFA 3A0BV 1OAEA 5GTHV 3VYMA 1C2RA 1CRCA 1PPJD 1W2LA 4PJ0V 2BH5X 3SXTA 1QYZA 2CE0A 4NFGB 3HQ6A 2ZBOA 2L4DA 1YCCA 3L70D 3MK7B 4UB6V 1BCCD 2QJPB 2CA4B 1RZ6A 1S6VB 1CHIA 4XXLA 3A9FA 1FCDC 4J20A 2O3JA 3H1JD 5CIBB 1J3SA 1H9YA 3VNWA 1YFCA 4AALA 2LIRA 1KV9A 1COTA 4EICA 2B0ZB 1N15A 4K3IA 2C1VA 3L75D 2GIWA 1DIQC 1HJ3A 1N9CA 2JTIB 3HQ8A 5KLVD 4WQ9A 3RMZA 4Q5PA 3CP5A 4Y5RA 1NTZD 5CIEB 1CRHA 1FJ0A 2FYNB 5B6QA 5TISV 1L9BC 3VMAA 2BGVX 1GJQA
chains in the Genus database with same CATH superfamily
2YKPA 1DW3A 2IBZI 2OZ1A 1PL5A 2KS1A 1CTJA 1X0TA 3H1HE 3MP7B 1RAPA 4BRYB 3H6PA 4A7PA 4KJMA 5KLIC 1KB9H 3HUSA 2AXTV 1GL2B 1RF1B 1CTZA 2ZYGA 3LIDA 1YQ4C 2Q3IA 4R4LA 2XNXA 1FI7A 2JR8A 1DVHA 1L0LJ 3DMIA 1YBKA 3F5HA 2KZJA 1LWUA 2MHMA 1L9JC 2Y0EA 4IL6E 3HQ7A 4WY4D 1FOCA 2D2CC 2CPSA 3BCCD 3CMEP 2D2CD 3CC4P 1CXCA 2R44A 2W6JH 2G8YA 3OA8B 2E76C 2ZXEB 4U3FG 3VRDA 3SLEA 1SQXE 4TLFA 3MGNA 3GHGA 2WPRA 1J2JB 2K9JB 1C6RA 1K3GA 2YKOA 2E75B 1K3HA 1UIIA 5GTHH 1HRCA 3P8MC 1KILA 4PJ0H 4PD4I 3AEFC 1VQ5P 2FYUG 1AQTA 3FWNA 5AVXB 1NJIQ 4KT0J 1FBMA 1N90A 3HRNA 2HR3A 2LR2A 2ZAEB 351CA 1MG2D 3RK2B 1IFIA 3JCUH 1VQ9P 1VDFA 1I6EA 1KFMA 1AQ5A 2IFMA 3IAOA 2WSSH 2OYHB 4PWAA 4AANA 1JY3P 3M97X 1HZUA 4YXWH 4U3FE 1CYCA 4M3LA 4IOIH 1NGMB 5KLIB 1IFNA 1NTZK 3D0WA 1IFPA 2I8FA 3RBZA 1QVFO 2Q7CA 1Q90D 2FYUE 3HE5B 3RN0A 4H13D 4PD4E 3C2CA 1NTKG 4I6MC 4WQEA 2FFDA 5CIDB 1HH0A 5AVWB 2FBWC 2ZYAA 2DVHA 4JF7A 1H31A 2E76B 4XA4A 3L74D 2R5DA 4WY4A 2XKMA 3AE5C 3O1YA 1NTZG 3HD7C 3AE3C 1CC5A 1IFJA 1BE3D 4HJGH 3L75J 2WWWA 1Y9BA 5EFWB 2BEZF 1S9KD 5CIGB 1GU5A 1F1FA 1HCMA 3E1RA 1VL2A 3AE2C 3VOPA 3L37A 2KSEA 1QN2A 3L70E 1CRYA 3L35A 4GOFA 2FKWB 1EDIA 2NPSC 1NTKE 2OYIA 2PACA 2NPSD 2AEMA 4IL6H 3V5BA 2AIUA 2QJYB 2Y0DA 5DFSA 4WQ8A 3H1HD 4CPGA 3SVWA 1L4AC 4GIFA 1CCHA 1NTZE 3O6QA 1HJ4A 1M1JC 1RF0C 1U7MA 1U7JA 3BCCJ 3HTKB 1ZMEC 3P32A 2E43A 3M06A 1VQ6P 2ZVOB 1NU1J 1VQLP 1E79H 3PXWA 5TISE 1IFDA 1FDOA 5AVYB 1GU2A 2JP3A 3EQ2A 1FZFA 4OVNF 5KAIV 1IK7A 2POHA 4LLHA 3VMZA 1N50A 4FB1A 1YQ3C 2N9BA 1CIGA 1SQBK 4AUWA 5M1BA 1C75A 1VQ7P 2Y0CA 2EXVA 1CW5A 3H1JG 3ZBMA 1YTZI 3D6YA 3USSA 1LTJA 1EC5A 4K35A 1A56A 1QL3A 2FXMA 4WWIA 1C6OA 4GKGA 2N9IA 1S1CX 2HODA 1BSHA 4L3GA 1JOCA 2QJPC 4AX3A 3X39A 2YK3A 3FXEA 1CIHA 5CJ4A 3AEGC 4PD4H 2KNCA 3WMM0 2O01N 3E1IA 5GTIV 1SQBG 1GU4A 1KILE 2HLOA 4YTPC 2B4ZA 2MJZA 1OW6A 3RK3B 3VYIA 1JDLA 4U3FD 5AW2B 2LITA 3L4OA 1KIBA 3GLMA 4L76A 5KTBA 3SJLA 4C7NA 2LXBA 4Y28J 4L1QA 4O9BA 1RH5B 3W67A 1NVOA 3IN6A 1QGKB 3H1JE 2ITAA 2C1DA 1N7SC 2N3YA 2W27A 3L74J 3PJSK 3B5NB 4PV1C 1M7LA 2KP8A 1S4XA 4PV1D 1M1JA 4IFFA 3MUDA 3BRVB 1CNOA 2GB8B 2P58A 1PGOA 1EB7A 2BCNB 1L0NK 1BE3J 2QG4A 2ZT9D 1SQBE 4WQDA 4EIJA 1URQC 5CICB 5C0ZA 1J1EB 2WT7A 3I56P 3SFDC 5KAIH 1CRCA 4BXLA 1FZBA 3AEBC 1QYZA 1KFNA 4NFGB 3R4YA 2JJLA 1M8OB 5B66E 4Y99B 3L70D 1QL2A 1VF5B 2QJPB 1CHIA 4XXLA 5CCHC 1QX8A 1SLQA 3H1HJ 1FCDC 1LTSC 3L73E 3JC22 1G2CB 1SFCB 4EICA 2G3AA 1N15A 3BVHA 5TISH 2C1VA 4HYTB 2GIWA 1N9CA 1X9VA 5K5GB 4OGQD 2J59M 4ZKPA 2KZIA 1FZCC 3H1IG 3D70A 3CP5A 4Y5RA 1NTZD 2YKQA 3U59A 1FJ0A 2I1JA 1D7MA 3I55P 2BGVX 1IO3A 2DW3A 1OVUA 2WMMA 1CI6B 1Q2NA 1ETPA 2N9JA 1RE4A 1J1DC 2M3BA 4D6TG 1JTHB 1SQXJ 4H0LB 3FX0A 2QSIA 1NTMK 2XDJA 1H89A 2KB7P 3Q5SA 1YHQP 3MTUE 1WEJF 1DD3A 1QVGO 1BDDA 5B5EE 3HUSC 3G4SP 1I8OA 1W5CE 4WQ7A 1OXZA 3ZIYA 3NMDA 4DZOA 1LMSA 5AW8B 2Y9YA 1URQB 3JBTB 3PP5A 5AVTB 2R5BA 1JO5A 1YJWP 2N18C 1JY2O 1VQNP 1DW0A 3N4XA 3R2PA 3H1IE 4U7JA 1IRWA 3CWBG 1LTGC 1CIEA 5KJ7C 1SQQK 2B87A 3ZOYA 1YEAA 3GHGC 3FXDA 5KJ7D 4D6TE 4I2LC 4U3FJ 1LC1A 2P10A 5B5EV 3II6A 3AEAC 1H9XA 3Q2YA 3VP8A 1BSNA 2ZJSE 1KQFB 4P4QB 2BLFB 1E8EA 3QH9A 4H44C 1KILC 1XTGB 3AE8C 1X79B 2N1TD 4H44D 1CHHA 5C39A 1WRGA 3ZDMA 2C2CA 2FYUJ 1FZCB 2M0BA 3UIAA 2L5GB 2C9NY 2O01H 2BPBB 2J5UA 1LP1A 3KDPB 3I5CA 2WPVB 2ZXYA 1HJ5A 2ZFCA 1J1DB 1ZV8A 5KLVK 4DY9A 2QVAA 3CWBE 3RL0C 1NH4A 4GOEA 3CD6P 4ASWA 4AAMA 3RL0D 1H32A 2OZ1B 1USDA 2E74B 1AFOA 2BH4X 5B66H 2M3EA 1CTYA 1BCCG 2QEXP 1N7LA 3V2QA 2P67A 2ZXXA 1ZR2A 3KYQA 1IO4A 3NXSA 1SQBD 1K05A 1LWUB 4HKZH 2JDIH 2KYVA 1DIPA 5APTA 3ZOXA 3MK7C 1RE3A 1G1JA 2FFDC 1FDMA 1Y8AA 3AE7C 2YMYA 1NTKJ 2UWJE 3NTNA 1FZGA 3AECC 1AYGA 1FOSE 5EXQA 2JWAA 4IL6X 4FAVA 4WY4C 1MZ9A 1JCCA 1GK4A 3A0HE 5AVSB 1M57D 3L73D 2B11B 5CHXA 1AA0A 1NTZJ 3WFBC 1KB0A 1PIXA 1BCCE 5KJ7A 2FYNC 4TT3H 1OIPA 5B5EH 2R3CA 1RF1A 3H1KD 1RZ5A 1JUNA 1GQ1A 1PFIA 2N1TA 4FA9A 1S2EA 2CE1A 3O8ZA 1SQVK 4KMGA 4UB6E 3RL0g 4DCKA 1I54A 2K37A 1OW8A 2OYIC 1DVVA 3VN0A 1Q81Q 1KQLA 1N73B 1DH3A 4XYDB 4IL6V 1NIRA 4I1LA 3A0HV 2WSCH 1EXJA 1EZVG 1PGPA 2HYNA 1KZUB 2C1UA 4GT1A 1L0ND 2KK7A 1DW1A 4JYCA 1C2NA 2OTKE 1HGVA 3TGUD 5APSA 2W6BA 2BASA 1CSVA 2L91A 4KHXA 1DIIC 1SQVG 1N8RQ 5H2FE 4JBZA 3RN1A 1Z56A 3HQ9A 1YTCA 4RO0A 4EIEA 1NYHA 3H1ID 2IZ1A 2DGEA 3L70G 3CMAP 4GYDA 3CCRP 1H31B 3M91A 4H13C 1VYDA 1IJDB 2WSEH 3OW2O 4D6TD 4EIDA 2E42A 3PLNA 2D2CB 1Y47A 2Y9ZA 1WVEC 2K1AA 1CHJA 1EZVE 4O1QA 2PFXA 5APQA 3NWVA 1LTJC 3H1JJ 4EDFA 2QRXA 1CSUA 1SQPK 1IQCA 2V08A 3WFCC 1M56D 5APVA 3WUVA 1AVOA 1RQUA 1LT1A 1SQVE 2P1JA 1YEBA 3H25A 3MIWA 2A06G 1VQ8P 2JKVA 2Q5UA 2O01J 1GW4A 1QKSA 2ZONG 3CWBD 2HG5D 4YPCA 4MN4C 1YITP 1SQBJ 4OWFA 1ZN5A 1K8AQ 1M60A 1I5TA 3NBSA 2VRSA 1I55A 2QJKC 2LKMA 3O6QB 4N0KA 1H33A 1GDTA 3A0HH 1SQPG 3SWSA 4IFDK 1H88A 1KX7A 4L74A 2PAJA 5AW6B 1FE6A 2AXCA 3KQGA 1USEA 3GF3A 1NO4A 2KOGA 3SSUA 1VQKP 3L72G 1BGYE 3MUDC 4V2KA 2E5YA 3CCLP 3CX5E 2A06E 4PW9B 1SQQD 3E7KA 4RJTA 3DR0A 1NWQA 1PP9G 4UB6H 1OAEA 1W2LA 1ZP0C 3V2PA 5AVZB 2CE0A 1YTZT 1G1IA 3AE9C 2A45G 3CC2P 1DEBA 3HQ6A 3B4SA 3C8VA 1LTJB 1PGQA 1BCCD 2CA4B 2IYOA 1S6VB 1OZHA 5CBNA 3A9FA 3H1LG 5CCGC 2O3JA 3B5ND 3HD7B 1SQPE 5CCGD 1H9YA 2HODB 4AALA 1FZEA 2LIRA 1KV9A 1GK6A 5E79E 3GMAA 2B0ZB 4N6JA 5APWA 4K3IA 5AW7B 4C46A 3EFFK 1LT9C 3MD0A 3L72E 1HJ3A 2JTIB 3HQ8A 5H2FH 5KLVD 4Q5PA 3CL3D 1M1KQ 5CIEB 1KN7A 4K3AA 4N78E 3T97B 5TISV 1L9BC 3G9RA 2AI5A 2NPSB 3KZIE 1IC2A 1PP9E 2QJKB 3N7NA 3CXHE 2ZYDA 1YICA 2OARA 1T3UA 4C7NB 1MV8A 3PHLA 3AEEC 3H1IJ 2WSCJ 1H0TA 2P7JA 3RLMA 1FI3A 1CRGA 2Q3EA 1VF5D 1RE4C 1L4AB 2SPZA 3P8CE 3H1LE 3ORVA 3ZOWA 1CSWA 4D6TJ 1M1JB 1M6ZA 3CCVP 3G3ZA 3LIEA 5C9MA 2K9YA 3M9QA 3CC7P 3Q1MA 1HF9A 1C7MA 1CZQA 5L8RJ 1VPCA 1NU1K 3L73G 2GM4A 4DOJA 3KZIV 3CU4A 1AVYA 2P2UA 1EZVD 2FWLA 1RQVA 2ZT9C 1GIWA 2N3BA 3L4FA 2WSEJ 1IK9A 1NMLA 4L75A 3H1KG 4WQBA 2C9XB 5AURA 2YIUC 1U75B 3WU2E 2D0WA 3CWBJ 2PCBB 4UB8E 1W5CT 1K73Q 1GDVA 1LTIC 2C0WA 4O1WA 3CCUP 4GEDB 1SQVD 1PGJA 2B10B 2XU6A 3B5NA 2ZOOA 5CCGA 1YJNP 2ZZS1 3OA7A 2MTAC 4YE1A 2B12B 3BRTB 4I7ZC 1HVVA 3V4WA 1L0NG 2FY8A 5CJ0A 3F89A 3CX5H 1LT9A 3TGUG 5DJQC 2K88A 3AE1C 2WPSA 3HE4A 4H0JA 1LTAC 1HWTC 3JSVC 4OGQC 1DT1A 3S1KA 4UB8V 1KD1Q 5AW9B 3H1KE 1YI2P 2FXOA 3WC8A 2PRRA 1YNRA 1MKMA 1BGYD 2B9BA 5APYA 3PXSA 5BU5A 4EIFA 2K3RA 4FA1A 1IZL0 5B66V 5AW3B 3RGUA 3CX5D 3ITKA 1N7SB 3EFGA 2RH0A 2A06D 1KYOE 1BCCJ 1S5LE 4PV1B 3PXTA 1X8YA 3BASA 1EDJA 4EOTA 1A02J 3IF4A 1L0NE 1YIJP 1P84D 2MKVA 3GG2A 1R8EA 2W90A 1RE3C 3OCDA 2WZ7A 3TGUE 3A2AA 3KZIH 3WFEC 4L73A 3G6EP 3CXHH 1PPJE 1SQPD 3A3YB 4WVZA 2E74D 2IYPA 2A45H 5TJHA 2M5AA 3A7OA 1CORA 1CI6A 2BCCG 3K5BA 4W7ZA 3IFMA 3L72D 3IR9A 3A0BE 3KXDA 3GF7A 5GTHE 1NTMG 2V7QH 1NKNA 3CCMP 4BWNA 1NHLA 1OFCX 4N78D 1B7VA 1GL2C 1Q7YQ 2RKLA 1RF1C 1JMBA 1GMJA 1PP9D 1GL2D 3CXHD 2HPCA 3FGAD 2N1TC 4HB1A 2OGUA 5CBOA 1WT6A 4HH2A 3P8CD 2QA4P 4FANA 3H1LD 3C9IA 5AVVB 2YNYA 3CYTI 1EDLA 1VQPP 3WU2H 1R5LA 3WUTA 2QM7A 1SQQG 4UB8H 1JNMA 1C52A 2BCCE 1SQXK 1UIXA 1GZLA 5CMZA 1KQSO 1NTME 4ASVA 4B86A 3CLQA 2KS1B 2E75D 2PCCB 3PH0A 2HV4A 3ABVC 2AXTE 3OAKA 1NAYA 4EI2A 4JPZB 4JCGA 1E2RA 2WVRA 3HUSB 1HROA 1SP4A 1SQVJ 1FC2C 1GW3A 1RY3A 1A8CA 2HFED 2XNDH 3ZOOA 1N2DC 1VQ4P 2WQYC 1YIQA 4AQRD 3L70J 1M90Q 1RAQA 2N18B 3RK2C 2PP6A 1OX3A 3Q3DA 2CXBA 4QAOA 2KSJA 3H32A 3RK2D 1DD4A 1GKSA 1T2KD 5KLVG 2QIWA 3TNUA 2OYHC 5AVUB 4RESB 1A2SA 1SQQE 3PH2B 3RK3E 2KUBA 2IBZG 4LGDE 2OQQA 1CCRA 3GHGB 2C8SA 1LTTC 1E5WA 1KYOH 1S5LH 2N1TB 1BGYJ 4H44B 1KILB 4NPEA 1BL9A 1OMIA 1KV4A 2XTSB 4BRYA 1H8AA 1JEKA 2FYUK 2NRGA 2KXPB 3Q5RA 1GL2A 5AW1B 3CCJP 4L3HA 4GODA 3S9OA 1HTLC 3G71P 2WSFH 5AVRB 1R5SA 1KB9D 2E76D 3SWFA 3FWLA 1FAVA 3WFDC 5KLVE 1IRVA 1NU1D 1EZVI 4NPDA 1KYOD 2RN0A 2YCCA 1FHBA 1HH7A 3L71G 3RL0B 2I1KA 1I8PA 2QM8A 3U1AA 1SQPJ 3A0BH 1JM0A 1OW7A 1AV1A 1T3JA 3OA8A 3P7KA 2IBZE 2JEEA 1JY3O 1AJYA 2FRCA 2C9LY 2K9JA 2OYOA 1AOQA 1W2EA 2ORLA 3MZWB 3L72J 3TDKA 1Q82Q 1PPJD 4NPFX 2IZ0A 3QWOC 4IFMA 1HJ0A 1FDIA 3MK7B 1YCCA 1NTKK 2FFDB 5APXA 4UB6V 1L0LK 1MFZA 4WBAA 1RZ6A 1N73A 1IZNB 1LGHB 1PP9J 2QJYC 1HBWA 4J20A 1MFTA 1J3SA 1VQMP 2W8ZA 1YFCA 4QMAA 1COTA 4WY4B 1W2BO 3M0DC 3L71E 1SS1A 1PV3A 2V7QJ 3H1LJ 3SWKA 2M8RA 2OYHA 3RMZA 5DJUB 5BVZA 1CRHA 2AXTH 2FYNB 1L2PA 1LTBC 4ZKUA 1GJQA 3TK1A 5H2FV 1L0LG 1BGYG 4W7YA 2IFNA 3CX5I 2AEJA 3CI9A 1EXIA 1K9MQ 3HE5A 2LXCB 2OYIB 2BCCD 1H33B 3AE4C 5AW4B 1CEDA 1FOSF 3L4MA 2IX7C 2KI7B 1FU1A 1P84I 1NTMD 2YO3A 3HD7D 3MHVA 1LFMA 4WQCA 2JO1A 4JYBA 1LS9A 1FI9A 2YO2A 2WPQA 3RBXA 2Z4EA 1R0QA 4FA4A 1CRJA 2QE7H 2O1KA 2R3SA 1FJPA 2ZVNB 2H88C 3CCQP 2GC7D 3O0RC 1CO6A 1QLED 4C7RA 2V07A 3LW5H 5AW5B 3VP9A 1MZ4A 1NMIA 1SVFA 3TYYA 3D71A 1L0LE 1A02F 2N9YB 1NAFA 3L73J 2Z5HA 2NZ2A 3TF5A 1MG3D 3U1CA 3M0AA 1OVVA 4H13B 5KAIE 3RK3C 1S3JA 3SWYA 3CXHI 2VHDA 3B71A 3RK3D 1VQOP 5DJTB 5CIFB 5APUA 1JY2N 1L4AD 2A45I 3H1KJ 3VMYA 4JQ0D 4LC1A 1AKKA 451CA 1P84E 155CA 4Z1MH 2I8DA 3B5NC 3M0DA 1IFMA 2CA3B 3AEDC 3HTKA 5KAFE 1I6DA 4ZMDA 1L0NJ 3L36A 5GTIE 2PGDA 1SQXD 2KNCB 3BATA 1OCDA 3KHUA 2IPPA 3M9HA 3TGUJ 1H0TB 2YXRB 1J1EC 1WMKA 2WSFJ 2XZRA 1NNOA 2IBZD 1OWAA 1DW2A 2GC4D 2O1JA 1ZR4A 3HD7A 4DJGA 1U57A 3V6IA 4Y99C 3L75G 2FYZA 3S4RA 3SFEC 2C1DB 1VF5C 5AW0B 4DT0A 4AAOA 3CPWO 5E79V 1HUCA 5KAFV 3CX5W 1ZRTE 4RKUJ 3Q5PA 1HZVA 1SFCC 1SFCD 2J58A 4FA5A 4XE5B 3T97A 1NOHA 2NPSA 5KKZC 2XV5A 1QL4A 1M70A 3L71D 1N86A 4R4MA 1HJBA 2H7HA 1KX2A 1KTMA 5IY51 2WT7B 3CCSP 1YYCA 2KLUA 2FYUD 3GW6A 2D0SA 1N7SD 1L4AA 2B88A 4PD4D 1X22A 4OH8B 2BCCJ 4H0LC 3A5TA 3BCCG 1RF0A 4H0LD 3L75E 1KB9I 1NTMJ 2GA1A 5CYTR 2JQRA 2WTYA 2JWDA 3EWKA 1KYOI 1LT9B 1F1CA 1NU1G 1S72P 2E5TA 1EDKA 4H0KA 1DEEG 3HE4B 3CXHW 1C6SA 1GD2E 1ZW0A 3WUUA 1URQD 3PTZA 3TSIA 3TYIA 3OJAB 1ZZHA 1U74B 2AEFA 1AOFA 2B89A 3O20A 1GTWA 1H1OA 1JCDA 1PPJG 4WB4A 4RSZA 1LC2A 1CRIA 2WITA 1DX7A 3WU2V 1P84H 3NBTA 1KQGB 1SQQJ 5CCHD 4LJIA 1NTKD 1JY3N 2YQBA 3BCCE 1JB0J 2Q6QA 1L0LD 2Z5IA 5DF5A 4ZNCA 1KMIZ 1PZQA 2GUSA 4GDOA 3LW5J 1KB9E 4WQAA 1KORA 2RMZA 1S5LX 5E79H 3OCDB 2H8PD 5KAFH 1NU1E 3V4QA 2Q9IA 3W68A 5KKZB 3ZCFA 3VMXA 5AVQB 5GTIH 1G2CA 1SFCA 2IDBA 4XFJA 2ZT9B 2YXQB 2M5AB 1ZOYC 2OTLP 2YMKA 1T8ZA 5KLVJ 2YIUB 1LNQA 2E74C 1KC8Q 1OVRA 3PRJA 3M9BA 2B87B 3DP5A 2V4HA 3C1LA 3L74G 1N7SA 1FS0E 4W80A 1BDCA 2W6AA 2HPCB 1JTHA 2R32A 3AE6C 4YXDC 1RHZB 1S5LV 4PJ0E 1E29A 1BE3G 1LWUC 4I7ZB 1EQ7A 1CYIA 1CXAA 1CSXA 1ZLLA 1K04A 2CK3H 1CYJA 5DJQB 1LP1B 2FXPA 5CIHB 4MU8A 1URQA 1JY2P 3JCUE 3WUIA 4OGQB 2W83C 2C0XA 4EYYQ 1T6AA 3D6ZA 1ZRTD 1YJ9P 1QEXA 3O5CA 1JMMA 1XTCC 3KPEA 2CPBA 1H32B 3L71J 1KYOW 2KIKA 2BEQD 2KLVA 1CIFA 3A0BV 5GTHV 3VYMA 1C2RA 1KILD 3H1HG 1MUUA 3L74E 2GUVA 4PJ0V 2BH5X 3SXTA 4AYCA 5CCHA 2ZBOA 2H89C 2E75C 2L4DA 4N3YB 5BU8B 2H43A 1BE3E 3NFQA 1HGZA 1S9KE 3H1JD 5CIBB 1TU3F 3H32B 3VTPC 3VNWA 3CCEP 1N73C 1FZCA 3TNUB 1FZAA 2OTJP 2Q1KA 1LJ2A 1FJKA 3L75D 1DIQC 1Q86Q 3V2RA 4WQ9A 1T2KC 1ZXGA 1SQXG 5B6QA 1CSBA 3B8EB 3VMAA 3V2NA 1QL1A 1NKZB
chains in the Genus database with same CATH topology
2AI5A 5H2FV 1IO3A 1DW3A 2OZ1A 2QJKB 2KS1A 1YICA 1CTJA 1RAPA 1ETPA 2N9JA 3PHLA 4A7PA 2AXTV 1CTZA 3RLMA 1FI3A 1CRGA 2BCCD 1H33B 2Q3EA 1FI7A 1DVHA 1WEJF 3DMIA 1CEDA 3L4MA 1I8OA 1NTMD 3ORVA 2MHMA 3ZOWA 1CSWA 1L9JC 4WQ7A 1M6ZA 1LFMA 4WQCA 3ZIYA 2Y0EA 1LMSA 3HQ7A 5C9MA 1LS9A 1FI9A 1FOCA 3BCCD 3JBTB 1R0QA 4FA4A 1CRJA 1C7MA 1CXCA 2N18C 2GC7D 3O0RC 1CO6A 3OA8B 1DW0A 2V07A 3KZIV 3CU4A 3VRDA 3SLEA 1IRWA 1EZVD 1MZ4A 2K9JB 1C6RA 1NMIA 2FWLA 1K3GA 1GIWA 2N3BA 1CIEA 1K3HA 1NMLA 2N9YB 1HRCA 3ZOYA 4WQBA 1YEAA 3TF5A 2C9XB 5AURA 1MG3D 1LC1A 1U75B 5B5EV 2D0WA 1H9XA 2PCBB 2VHDA 4P4QB 1W5CT 2BLFB 1E8EA 1GDVA 4O1WA 5CIFB 4GEDB 1SQVD 1CHHA 1N90A 2B10B 2C2CA 2ZOOA 1AKKA 351CA 1MG2D 451CA 2ZZS1 2MTAC 4YE1A 155CA 2B12B 1I6EA 2BPBB 4PWAA 4AANA 2ZXYA 1HJ5A 3M97X 1HZUA 2CA3B 5DJQC 1CYCA 4DY9A 5KLIB 1I6DA 4H0JA 4AAMA 1H32A 2OZ1B 2BH4X 1SQXD 2I8FA 1DT1A 2KNCB 4UB8V 1OCDA 3KHUA 1CTYA 3WC8A 1YNRA 1BGYD 3PXSA 3RN0A 4EIFA 3C2CA 1NNOA 4FA1A 1IZL0 2IBZD 4WQEA 5B66V 1SQBD 1DW2A 3CX5D 3ITKA 5CIDB 2GC4D 2A06D 2DVHA 3PXTA 3ZOXA 1H31A 3MK7C 3L74D 2C1DB 4AAOA 1AYGA 3O1YA 5E79V 5EXQA 1P84D 5KAFV 3GG2A 3CX5W 2JWAA 1CC5A 3OCDA 4FAVA 1HZVA 1BE3D 3WFEC 5CIGB 1SQPD 3L73D 4FA5A 2B11B 1F1FA 1HCMA 3WFBC 1KB0A 5TJHA 1QN2A 1QL4A 1M70A 1CORA 1CRYA 3L71D 3L72D 1KX2A 5IY51 3H1KD 1RZ5A 1GQ1A 2PACA 2FYUD 3GW6A 2D0SA 2AIUA 1B7VA 2QJYB 4FA9A 4PD4D 2Y0DA 5DFSA 2CE1A 4KMGA 1I54A 1PP9D 1DVVA 3CXHD 4WQ8A 3H1HD 5CYTR 2JQRA 3SVWA 4XYDB 4IL6V 1CCHA 1NIRA 1HJ4A 3A0HV 1F1CA 2C1UA 1L0ND 1DW1A 4FANA 4H0KA 3H1LD 1C2NA 3CXHW 1C6SA 3TGUD 3CYTI 3PTZA 3TYIA 1ZZHA 1U74B 1CSVA 2L91A 3PXWA 1C52A 1AOFA 1DIIC 3O20A 3RN1A 1H1OA 4RSZA 1LC2A 1CRIA 1GU2A 3HQ9A 1YTCA 4EIEA 3H1ID 3WU2V 2PCCB 5KAIV 2HV4A 1N50A 3NBTA 4FB1A 2DGEA 4JCGA 1E2RA 4LJIA 1CIGA 4GYDA 1HROA 1NTKD 1H31B 2YQBA 1L0LD 1C75A 1VYDA 2Y0CA 5DF5A 2EXVA 1A8CA 3ZBMA 4D6TD 4EIDA 4WQAA 3ZOOA 1A56A 3PLNA 2RMZA 1QL3A 1C6OA 1WVEC 1YIQA 1CHJA 3OCDB 4O1QA 1RAQA 2N18B 2N9IA 5KKZB 3ZCFA 3NWVA 2CXBA 4QAOA 1GKSA 4L3GA 4AX3A 3X39A 4EDFA 2YK3A 1CIHA 1CSUA 1IQCA 1A2SA 2V08A 3WFCC 3PH2B 5GTIV 1CCRA 2C8SA 1YEBA 2YIUB 2B4ZA 1JDLA 4U3FD 3PRJA 3DP5A 2LITA 3L4OA 1QKSA 2ZONG 3CWBD 1KIBA 1BL9A 2XTSB 3SJLA 4L1QA 1M60A 1I5TA 3NBSA 1S5LV 1I55A 2C1DA 1E29A 4L3HA 2N3YA 4N0KA 1H33A 1CYIA 1CXAA 3SWSA 1CSXA 1KB9D 1KX7A 3FWLA 1CNOA 1CYJA 2GB8B 3WFDC 5DJQB 1IRVA 1NU1D 1EB7A 2BCNB 1KYOD 2RN0A 2YCCA 1FHBA 1HH7A 5CIHB 4MU8A 2QG4A 1I8PA 3WUIA 4V2KA 3OA8A 4WQDA 1ZRTD 2FRCA 3O5CA 4PW9B 1H32B 1SQQD 5CICB 5C0ZA 1AOQA 4RJTA 1KYOW 2ORLA 3DR0A 3TDKA 1CIFA 3A0BV 1OAEA 5GTHV 3VYMA 1C2RA 1CRCA 1PPJD 1W2LA 4PJ0V 2BH5X 3SXTA 1QYZA 2CE0A 4NFGB 3HQ6A 2ZBOA 2L4DA 1YCCA 3L70D 3MK7B 4UB6V 1BCCD 2QJPB 2CA4B 1RZ6A 1S6VB 1CHIA 4XXLA 3A9FA 1FCDC 4J20A 2O3JA 3H1JD 5CIBB 1J3SA 1H9YA 3VNWA 1YFCA 4AALA 2LIRA 1KV9A 1COTA 4EICA 2B0ZB 1N15A 4K3IA 2C1VA 3L75D 2GIWA 1DIQC 1HJ3A 1N9CA 2JTIB 3HQ8A 5KLVD 4WQ9A 3RMZA 4Q5PA 3CP5A 4Y5RA 1NTZD 5CIEB 1CRHA 1FJ0A 2FYNB 5B6QA 5TISV 1L9BC 3VMAA 2BGVX 1GJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AI5 A;  5H2F V;  1IO3 A;  1DW3 A;  2OZ1 A;  2QJK B;  2KS1 A;  1YIC A;  1CTJ A;  1RAP A;  1ETP A;  2N9J A;  3PHL A;  4A7P A;  2AXT V;  1CTZ A;  3RLM A;  1FI3 A;  1CRG A;  2BCC D;  1H33 B;  2Q3E A;  1FI7 A;  1DVH A;  1WEJ F;  3DMI A;  1CED A;  3L4M A;  1I8O A;  1NTM D;  3ORV A;  2MHM A;  3ZOW A;  1CSW A;  1L9J C;  4WQ7 A;  1M6Z A;  1LFM A;  4WQC A;  3ZIY A;  2Y0E A;  1LMS A;  3HQ7 A;  5C9M A;  1LS9 A;  1FI9 A;  1FOC A;  3BCC D;  3JBT B;  1R0Q A;  4FA4 A;  1CRJ A;  1C7M A;  1CXC A;  2N18 C;  2GC7 D;  3O0R C;  1CO6 A;  3OA8 B;  1DW0 A;  2V07 A;  3KZI V;  3CU4 A;  3VRD A;  3SLE A;  1IRW A;  1EZV D;  1MZ4 A;  2K9J B;  1C6R A;  1NMI A;  2FWL A;  1K3G A;  1GIW A;  2N3B A;  1CIE A;  1K3H A;  1NML A;  2N9Y B;  1HRC A;  3ZOY A;  4WQB A;  1YEA A;  3TF5 A;  2C9X B;  5AUR A;  1MG3 D;  1LC1 A;  1U75 B;  5B5E V;  2D0W A;  1H9X A;  2PCB B;  2VHD A;  4P4Q B;  1W5C T;  2BLF B;  1E8E A;  1GDV A;  4O1W A;  5CIF B;  4GED B;  1SQV D;  1CHH A;  1N90 A;  2B10 B;  2C2C A;  2ZOO A;  1AKK A;  351C A;  1MG2 D;  451C A;  2ZZS 1;  2MTA C;  4YE1 A;  155C A;  2B12 B;  1I6E A;  2BPB B;  4PWA A;  4AAN A;  2ZXY A;  1HJ5 A;  3M97 X;  1HZU A;  2CA3 B;  5DJQ C;  1CYC A;  4DY9 A;  5KLI B;  1I6D A;  4H0J A;  4AAM A;  1H32 A;  2OZ1 B;  2BH4 X;  1SQX D;  2I8F A;  1DT1 A;  2KNC B;  4UB8 V;  1OCD A;  3KHU A;  1CTY A;  3WC8 A;  1YNR A;  1BGY D;  3PXS A;  3RN0 A;  4EIF A;  3C2C A;  1NNO A;  4FA1 A;  1IZL 0;  2IBZ D;  4WQE A;  5B66 V;  1SQB D;  1DW2 A;  3CX5 D;  3ITK A;  5CID B;  2GC4 D;  2A06 D;  2DVH A;  3PXT A;  3ZOX A;  1H31 A;  3MK7 C;  3L74 D;  2C1D B;  4AAO A;  1AYG A;  3O1Y A;  5E79 V;  5EXQ A;  1P84 D;  5KAF V;  3GG2 A;  3CX5 W;  2JWA A;  1CC5 A;  3OCD A;  4FAV A;  1HZV A;  1BE3 D;  3WFE C;  5CIG B;  1SQP D;  3L73 D;  4FA5 A;  2B11 B;  1F1F A;  1HCM A;  3WFB C;  1KB0 A;  5TJH A;  1QN2 A;  1QL4 A;  1M70 A;  1COR A;  1CRY A;  3L71 D;  3L72 D;  1KX2 A;  5IY5 1;  3H1K D;  1RZ5 A;  1GQ1 A;  2PAC A;  2FYU D;  3GW6 A;  2D0S A;  2AIU A;  1B7V A;  2QJY B;  4FA9 A;  4PD4 D;  2Y0D A;  5DFS A;  2CE1 A;  4KMG A;  1I54 A;  1PP9 D;  1DVV A;  3CXH D;  4WQ8 A;  3H1H D;  5CYT R;  2JQR A;  3SVW A;  4XYD B;  4IL6 V;  1CCH A;  1NIR A;  1HJ4 A;  3A0H V;  1F1C A;  2C1U A;  1L0N D;  1DW1 A;  4FAN A;  4H0K A;  3H1L D;  1C2N A;  3CXH W;  1C6S A;  3TGU D;  3CYT I;  3PTZ A;  3TYI A;  1ZZH A;  1U74 B;  1CSV A;  2L91 A;  3PXW A;  1C52 A;  1AOF A;  1DII C;  3O20 A;  3RN1 A;  1H1O A;  4RSZ A;  1LC2 A;  1CRI A;  1GU2 A;  3HQ9 A;  1YTC A;  4EIE A;  3H1I D;  3WU2 V;  2PCC B;  5KAI V;  2HV4 A;  1N50 A;  3NBT A;  4FB1 A;  2DGE A;  4JCG A;  1E2R A;  4LJI A;  1CIG A;  4GYD A;  1HRO A;  1NTK D;  1H31 B;  2YQB A;  1L0L D;  1C75 A;  1VYD A;  2Y0C A;  5DF5 A;  2EXV A;  1A8C A;  3ZBM A;  4D6T D;  4EID A;  4WQA A;  3ZOO A;  1A56 A;  3PLN A;  2RMZ A;  1QL3 A;  1C6O A;  1WVE C;  1YIQ A;  1CHJ A;  3OCD B;  4O1Q A;  1RAQ A;  2N18 B;  2N9I A;  5KKZ B;  3ZCF A;  3NWV A;  2CXB A;  4QAO A;  1GKS A;  4L3G A;  4AX3 A;  3X39 A;  4EDF A;  2YK3 A;  1CIH A;  1CSU A;  1IQC A;  1A2S A;  2V08 A;  3WFC C;  3PH2 B;  5GTI V;  1CCR A;  2C8S A;  1YEB A;  2YIU B;  2B4Z A;  1JDL A;  4U3F D;  3PRJ A;  3DP5 A;  2LIT A;  3L4O A;  1QKS A;  2ZON G;  3CWB D;  1KIB A;  1BL9 A;  2XTS B;  3SJL A;  4L1Q A;  1M60 A;  1I5T A;  3NBS A;  1S5L V;  1I55 A;  2C1D A;  1E29 A;  4L3H A;  2N3Y A;  4N0K A;  1H33 A;  1CYI A;  1CXA A;  3SWS A;  1CSX A;  1KB9 D;  1KX7 A;  3FWL A;  1CNO A;  1CYJ A;  2GB8 B;  3WFD C;  5DJQ B;  1IRV A;  1NU1 D;  1EB7 A;  2BCN B;  1KYO D;  2RN0 A;  2YCC A;  1FHB A;  1HH7 A;  5CIH B;  4MU8 A;  2QG4 A;  1I8P A;  3WUI A;  4V2K A;  3OA8 A;  4WQD A;  1ZRT D;  2FRC A;  3O5C A;  4PW9 B;  1H32 B;  1SQQ D;  5CIC B;  5C0Z A;  1AOQ A;  4RJT A;  1KYO W;  2ORL A;  3DR0 A;  3TDK A;  1CIF A;  3A0B V;  1OAE A;  5GTH V;  3VYM A;  1C2R A;  1CRC A;  1PPJ D;  1W2L A;  4PJ0 V;  2BH5 X;  3SXT A;  1QYZ A;  2CE0 A;  4NFG B;  3HQ6 A;  2ZBO A;  2L4D A;  1YCC A;  3L70 D;  3MK7 B;  4UB6 V;  1BCC D;  2QJP B;  2CA4 B;  1RZ6 A;  1S6V B;  1CHI A;  4XXL A;  3A9F A;  1FCD C;  4J20 A;  2O3J A;  3H1J D;  5CIB B;  1J3S A;  1H9Y A;  3VNW A;  1YFC A;  4AAL A;  2LIR A;  1KV9 A;  1COT A;  4EIC A;  2B0Z B;  1N15 A;  4K3I A;  2C1V A;  3L75 D;  2GIW A;  1DIQ C;  1HJ3 A;  1N9C A;  2JTI B;  3HQ8 A;  5KLV D;  4WQ9 A;  3RMZ A;  4Q5P A;  3CP5 A;  4Y5R A;  1NTZ D;  5CIE B;  1CRH A;  1FJ0 A;  2FYN B;  5B6Q A;  5TIS V;  1L9B C;  3VMA A;  2BGV X;  1GJQ A; 
#chains in the Genus database with same CATH topology
 2YKP A;  1DW3 A;  2IBZ I;  2OZ1 A;  1PL5 A;  2KS1 A;  1CTJ A;  1X0T A;  3H1H E;  3MP7 B;  1RAP A;  4BRY B;  3H6P A;  4A7P A;  4KJM A;  5KLI C;  1KB9 H;  3HUS A;  2AXT V;  1GL2 B;  1RF1 B;  1CTZ A;  2ZYG A;  3LID A;  1YQ4 C;  2Q3I A;  4R4L A;  2XNX A;  1FI7 A;  2JR8 A;  1DVH A;  1L0L J;  3DMI A;  1YBK A;  3F5H A;  2KZJ A;  1LWU A;  2MHM A;  1L9J C;  2Y0E A;  4IL6 E;  3HQ7 A;  4WY4 D;  1FOC A;  2D2C C;  2CPS A;  3BCC D;  3CME P;  2D2C D;  3CC4 P;  1CXC A;  2R44 A;  2W6J H;  2G8Y A;  3OA8 B;  2E76 C;  2ZXE B;  4U3F G;  3VRD A;  3SLE A;  1SQX E;  4TLF A;  3MGN A;  3GHG A;  2WPR A;  1J2J B;  2K9J B;  1C6R A;  1K3G A;  2YKO A;  2E75 B;  1K3H A;  1UII A;  5GTH H;  1HRC A;  3P8M C;  1KIL A;  4PJ0 H;  4PD4 I;  3AEF C;  1VQ5 P;  2FYU G;  1AQT A;  3FWN A;  5AVX B;  1NJI Q;  4KT0 J;  1FBM A;  1N90 A;  3HRN A;  2HR3 A;  2LR2 A;  2ZAE B;  351C A;  1MG2 D;  3RK2 B;  1IFI A;  3JCU H;  1VQ9 P;  1VDF A;  1I6E A;  1KFM A;  1AQ5 A;  2IFM A;  3IAO A;  2WSS H;  2OYH B;  4PWA A;  4AAN A;  1JY3 P;  3M97 X;  1HZU A;  4YXW H;  4U3F E;  1CYC A;  4M3L A;  4IOI H;  1NGM B;  5KLI B;  1IFN A;  1NTZ K;  3D0W A;  1IFP A;  2I8F A;  3RBZ A;  1QVF O;  2Q7C A;  1Q90 D;  2FYU E;  3HE5 B;  3RN0 A;  4H13 D;  4PD4 E;  3C2C A;  1NTK G;  4I6M C;  4WQE A;  2FFD A;  5CID B;  1HH0 A;  5AVW B;  2FBW C;  2ZYA A;  2DVH A;  4JF7 A;  1H31 A;  2E76 B;  4XA4 A;  3L74 D;  2R5D A;  4WY4 A;  2XKM A;  3AE5 C;  3O1Y A;  1NTZ G;  3HD7 C;  3AE3 C;  1CC5 A;  1IFJ A;  1BE3 D;  4HJG H;  3L75 J;  2WWW A;  1Y9B A;  5EFW B;  2BEZ F;  1S9K D;  5CIG B;  1GU5 A;  1F1F A;  1HCM A;  3E1R A;  1VL2 A;  3AE2 C;  3VOP A;  3L37 A;  2KSE A;  1QN2 A;  3L70 E;  1CRY A;  3L35 A;  4GOF A;  2FKW B;  1EDI A;  2NPS C;  1NTK E;  2OYI A;  2PAC A;  2NPS D;  2AEM A;  4IL6 H;  3V5B A;  2AIU A;  2QJY B;  2Y0D A;  5DFS A;  4WQ8 A;  3H1H D;  4CPG A;  3SVW A;  1L4A C;  4GIF A;  1CCH A;  1NTZ E;  3O6Q A;  1HJ4 A;  1M1J C;  1RF0 C;  1U7M A;  1U7J A;  3BCC J;  3HTK B;  1ZME C;  3P32 A;  2E43 A;  3M06 A;  1VQ6 P;  2ZVO B;  1NU1 J;  1VQL P;  1E79 H;  3PXW A;  5TIS E;  1IFD A;  1FDO A;  5AVY B;  1GU2 A;  2JP3 A;  3EQ2 A;  1FZF A;  4OVN F;  5KAI V;  1IK7 A;  2POH A;  4LLH A;  3VMZ A;  1N50 A;  4FB1 A;  1YQ3 C;  2N9B A;  1CIG A;  1SQB K;  4AUW A;  5M1B A;  1C75 A;  1VQ7 P;  2Y0C A;  2EXV A;  1CW5 A;  3H1J G;  3ZBM A;  1YTZ I;  3D6Y A;  3USS A;  1LTJ A;  1EC5 A;  4K35 A;  1A56 A;  1QL3 A;  2FXM A;  4WWI A;  1C6O A;  4GKG A;  2N9I A;  1S1C X;  2HOD A;  1BSH A;  4L3G A;  1JOC A;  2QJP C;  4AX3 A;  3X39 A;  2YK3 A;  3FXE A;  1CIH A;  5CJ4 A;  3AEG C;  4PD4 H;  2KNC A;  3WMM 0;  2O01 N;  3E1I A;  5GTI V;  1SQB G;  1GU4 A;  1KIL E;  2HLO A;  4YTP C;  2B4Z A;  2MJZ A;  1OW6 A;  3RK3 B;  3VYI A;  1JDL A;  4U3F D;  5AW2 B;  2LIT A;  3L4O A;  1KIB A;  3GLM A;  4L76 A;  5KTB A;  3SJL A;  4C7N A;  2LXB A;  4Y28 J;  4L1Q A;  4O9B A;  1RH5 B;  3W67 A;  1NVO A;  3IN6 A;  1QGK B;  3H1J E;  2ITA A;  2C1D A;  1N7S C;  2N3Y A;  2W27 A;  3L74 J;  3PJS K;  3B5N B;  4PV1 C;  1M7L A;  2KP8 A;  1S4X A;  4PV1 D;  1M1J A;  4IFF A;  3MUD A;  3BRV B;  1CNO A;  2GB8 B;  2P58 A;  1PGO A;  1EB7 A;  2BCN B;  1L0N K;  1BE3 J;  2QG4 A;  2ZT9 D;  1SQB E;  4WQD A;  4EIJ A;  1URQ C;  5CIC B;  5C0Z A;  1J1E B;  2WT7 A;  3I56 P;  3SFD C;  5KAI H;  1CRC A;  4BXL A;  1FZB A;  3AEB C;  1QYZ A;  1KFN A;  4NFG B;  3R4Y A;  2JJL A;  1M8O B;  5B66 E;  4Y99 B;  3L70 D;  1QL2 A;  1VF5 B;  2QJP B;  1CHI A;  4XXL A;  5CCH C;  1QX8 A;  1SLQ A;  3H1H J;  1FCD C;  1LTS C;  3L73 E;  3JC2 2;  1G2C B;  1SFC B;  4EIC A;  2G3A A;  1N15 A;  3BVH A;  5TIS H;  2C1V A;  4HYT B;  2GIW A;  1N9C A;  1X9V A;  5K5G B;  4OGQ D;  2J59 M;  4ZKP A;  2KZI A;  1FZC C;  3H1I G;  3D70 A;  3CP5 A;  4Y5R A;  1NTZ D;  2YKQ A;  3U59 A;  1FJ0 A;  2I1J A;  1D7M A;  3I55 P;  2BGV X;  1IO3 A;  2DW3 A;  1OVU A;  2WMM A;  1CI6 B;  1Q2N A;  1ETP A;  2N9J A;  1RE4 A;  1J1D C;  2M3B A;  4D6T G;  1JTH B;  1SQX J;  4H0L B;  3FX0 A;  2QSI A;  1NTM K;  2XDJ A;  1H89 A;  2KB7 P;  3Q5S A;  1YHQ P;  3MTU E;  1WEJ F;  1DD3 A;  1QVG O;  1BDD A;  5B5E E;  3HUS C;  3G4S P;  1I8O A;  1W5C E;  4WQ7 A;  1OXZ A;  3ZIY A;  3NMD A;  4DZO A;  1LMS A;  5AW8 B;  2Y9Y A;  1URQ B;  3JBT B;  3PP5 A;  5AVT B;  2R5B A;  1JO5 A;  1YJW P;  2N18 C;  1JY2 O;  1VQN P;  1DW0 A;  3N4X A;  3R2P A;  3H1I E;  4U7J A;  1IRW A;  3CWB G;  1LTG C;  1CIE A;  5KJ7 C;  1SQQ K;  2B87 A;  3ZOY A;  1YEA A;  3GHG C;  3FXD A;  5KJ7 D;  4D6T E;  4I2L C;  4U3F J;  1LC1 A;  2P10 A;  5B5E V;  3II6 A;  3AEA C;  1H9X A;  3Q2Y A;  3VP8 A;  1BSN A;  2ZJS E;  1KQF B;  4P4Q B;  2BLF B;  1E8E A;  3QH9 A;  4H44 C;  1KIL C;  1XTG B;  3AE8 C;  1X79 B;  2N1T D;  4H44 D;  1CHH A;  5C39 A;  1WRG A;  3ZDM A;  2C2C A;  2FYU J;  1FZC B;  2M0B A;  3UIA A;  2L5G B;  2C9N Y;  2O01 H;  2BPB B;  2J5U A;  1LP1 A;  3KDP B;  3I5C A;  2WPV B;  2ZXY A;  1HJ5 A;  2ZFC A;  1J1D B;  1ZV8 A;  5KLV K;  4DY9 A;  2QVA A;  3CWB E;  3RL0 C;  1NH4 A;  4GOE A;  3CD6 P;  4ASW A;  4AAM A;  3RL0 D;  1H32 A;  2OZ1 B;  1USD A;  2E74 B;  1AFO A;  2BH4 X;  5B66 H;  2M3E A;  1CTY A;  1BCC G;  2QEX P;  1N7L A;  3V2Q A;  2P67 A;  2ZXX A;  1ZR2 A;  3KYQ A;  1IO4 A;  3NXS A;  1SQB D;  1K05 A;  1LWU B;  4HKZ H;  2JDI H;  2KYV A;  1DIP A;  5APT A;  3ZOX A;  3MK7 C;  1RE3 A;  1G1J A;  2FFD C;  1FDM A;  1Y8A A;  3AE7 C;  2YMY A;  1NTK J;  2UWJ E;  3NTN A;  1FZG A;  3AEC C;  1AYG A;  1FOS E;  5EXQ A;  2JWA A;  4IL6 X;  4FAV A;  4WY4 C;  1MZ9 A;  1JCC A;  1GK4 A;  3A0H E;  5AVS B;  1M57 D;  3L73 D;  2B11 B;  5CHX A;  1AA0 A;  1NTZ J;  3WFB C;  1KB0 A;  1PIX A;  1BCC E;  5KJ7 A;  2FYN C;  4TT3 H;  1OIP A;  5B5E H;  2R3C A;  1RF1 A;  3H1K D;  1RZ5 A;  1JUN A;  1GQ1 A;  1PFI A;  2N1T A;  4FA9 A;  1S2E A;  2CE1 A;  3O8Z A;  1SQV K;  4KMG A;  4UB6 E;  3RL0 g;  4DCK A;  1I54 A;  2K37 A;  1OW8 A;  2OYI C;  1DVV A;  3VN0 A;  1Q81 Q;  1KQL A;  1N73 B;  1DH3 A;  4XYD B;  4IL6 V;  1NIR A;  4I1L A;  3A0H V;  2WSC H;  1EXJ A;  1EZV G;  1PGP A;  2HYN A;  1KZU B;  2C1U A;  4GT1 A;  1L0N D;  2KK7 A;  1DW1 A;  4JYC A;  1C2N A;  2OTK E;  1HGV A;  3TGU D;  5APS A;  2W6B A;  2BAS A;  1CSV A;  2L91 A;  4KHX A;  1DII C;  1SQV G;  1N8R Q;  5H2F E;  4JBZ A;  3RN1 A;  1Z56 A;  3HQ9 A;  1YTC A;  4RO0 A;  4EIE A;  1NYH A;  3H1I D;  2IZ1 A;  2DGE A;  3L70 G;  3CMA P;  4GYD A;  3CCR P;  1H31 B;  3M91 A;  4H13 C;  1VYD A;  1IJD B;  2WSE H;  3OW2 O;  4D6T D;  4EID A;  2E42 A;  3PLN A;  2D2C B;  1Y47 A;  2Y9Z A;  1WVE C;  2K1A A;  1CHJ A;  1EZV E;  4O1Q A;  2PFX A;  5APQ A;  3NWV A;  1LTJ C;  3H1J J;  4EDF A;  2QRX A;  1CSU A;  1SQP K;  1IQC A;  2V08 A;  3WFC C;  1M56 D;  5APV A;  3WUV A;  1AVO A;  1RQU A;  1LT1 A;  1SQV E;  2P1J A;  1YEB A;  3H25 A;  3MIW A;  2A06 G;  1VQ8 P;  2JKV A;  2Q5U A;  2O01 J;  1GW4 A;  1QKS A;  2ZON G;  3CWB D;  2HG5 D;  4YPC A;  4MN4 C;  1YIT P;  1SQB J;  4OWF A;  1ZN5 A;  1K8A Q;  1M60 A;  1I5T A;  3NBS A;  2VRS A;  1I55 A;  2QJK C;  2LKM A;  3O6Q B;  4N0K A;  1H33 A;  1GDT A;  3A0H H;  1SQP G;  3SWS A;  4IFD K;  1H88 A;  1KX7 A;  4L74 A;  2PAJ A;  5AW6 B;  1FE6 A;  2AXC A;  3KQG A;  1USE A;  3GF3 A;  1NO4 A;  2KOG A;  3SSU A;  1VQK P;  3L72 G;  1BGY E;  3MUD C;  4V2K A;  2E5Y A;  3CCL P;  3CX5 E;  2A06 E;  4PW9 B;  1SQQ D;  3E7K A;  4RJT A;  3DR0 A;  1NWQ A;  1PP9 G;  4UB6 H;  1OAE A;  1W2L A;  1ZP0 C;  3V2P A;  5AVZ B;  2CE0 A;  1YTZ T;  1G1I A;  3AE9 C;  2A45 G;  3CC2 P;  1DEB A;  3HQ6 A;  3B4S A;  3C8V A;  1LTJ B;  1PGQ A;  1BCC D;  2CA4 B;  2IYO A;  1S6V B;  1OZH A;  5CBN A;  3A9F A;  3H1L G;  5CCG C;  2O3J A;  3B5N D;  3HD7 B;  1SQP E;  5CCG D;  1H9Y A;  2HOD B;  4AAL A;  1FZE A;  2LIR A;  1KV9 A;  1GK6 A;  5E79 E;  3GMA A;  2B0Z B;  4N6J A;  5APW A;  4K3I A;  5AW7 B;  4C46 A;  3EFF K;  1LT9 C;  3MD0 A;  3L72 E;  1HJ3 A;  2JTI B;  3HQ8 A;  5H2F H;  5KLV D;  4Q5P A;  3CL3 D;  1M1K Q;  5CIE B;  1KN7 A;  4K3A A;  4N78 E;  3T97 B;  5TIS V;  1L9B C;  3G9R A;  2AI5 A;  2NPS B;  3KZI E;  1IC2 A;  1PP9 E;  2QJK B;  3N7N A;  3CXH E;  2ZYD A;  1YIC A;  2OAR A;  1T3U A;  4C7N B;  1MV8 A;  3PHL A;  3AEE C;  3H1I J;  2WSC J;  1H0T A;  2P7J A;  3RLM A;  1FI3 A;  1CRG A;  2Q3E A;  1VF5 D;  1RE4 C;  1L4A B;  2SPZ A;  3P8C E;  3H1L E;  3ORV A;  3ZOW A;  1CSW A;  4D6T J;  1M1J B;  1M6Z A;  3CCV P;  3G3Z A;  3LIE A;  5C9M A;  2K9Y A;  3M9Q A;  3CC7 P;  3Q1M A;  1HF9 A;  1C7M A;  1CZQ A;  5L8R J;  1VPC A;  1NU1 K;  3L73 G;  2GM4 A;  4DOJ A;  3KZI V;  3CU4 A;  1AVY A;  2P2U A;  1EZV D;  2FWL A;  1RQV A;  2ZT9 C;  1GIW A;  2N3B A;  3L4F A;  2WSE J;  1IK9 A;  1NML A;  4L75 A;  3H1K G;  4WQB A;  2C9X B;  5AUR A;  2YIU C;  1U75 B;  3WU2 E;  2D0W A;  3CWB J;  2PCB B;  4UB8 E;  1W5C T;  1K73 Q;  1GDV A;  1LTI C;  2C0W A;  4O1W A;  3CCU P;  4GED B;  1SQV D;  1PGJ A;  2B10 B;  2XU6 A;  3B5N A;  2ZOO A;  5CCG A;  1YJN P;  2ZZS 1;  3OA7 A;  2MTA C;  4YE1 A;  2B12 B;  3BRT B;  4I7Z C;  1HVV A;  3V4W A;  1L0N G;  2FY8 A;  5CJ0 A;  3F89 A;  3CX5 H;  1LT9 A;  3TGU G;  5DJQ C;  2K88 A;  3AE1 C;  2WPS A;  3HE4 A;  4H0J A;  1LTA C;  1HWT C;  3JSV C;  4OGQ C;  1DT1 A;  3S1K A;  4UB8 V;  1KD1 Q;  5AW9 B;  3H1K E;  1YI2 P;  2FXO A;  3WC8 A;  2PRR A;  1YNR A;  1MKM A;  1BGY D;  2B9B A;  5APY A;  3PXS A;  5BU5 A;  4EIF A;  2K3R A;  4FA1 A;  1IZL 0;  5B66 V;  5AW3 B;  3RGU A;  3CX5 D;  3ITK A;  1N7S B;  3EFG A;  2RH0 A;  2A06 D;  1KYO E;  1BCC J;  1S5L E;  4PV1 B;  3PXT A;  1X8Y A;  3BAS A;  1EDJ A;  4EOT A;  1A02 J;  3IF4 A;  1L0N E;  1YIJ P;  1P84 D;  2MKV A;  3GG2 A;  1R8E A;  2W90 A;  1RE3 C;  3OCD A;  2WZ7 A;  3TGU E;  3A2A A;  3KZI H;  3WFE C;  4L73 A;  3G6E P;  3CXH H;  1PPJ E;  1SQP D;  3A3Y B;  4WVZ A;  2E74 D;  2IYP A;  2A45 H;  5TJH A;  2M5A A;  3A7O A;  1COR A;  1CI6 A;  2BCC G;  3K5B A;  4W7Z A;  3IFM A;  3L72 D;  3IR9 A;  3A0B E;  3KXD A;  3GF7 A;  5GTH E;  1NTM G;  2V7Q H;  1NKN A;  3CCM P;  4BWN A;  1NHL A;  1OFC X;  4N78 D;  1B7V A;  1GL2 C;  1Q7Y Q;  2RKL A;  1RF1 C;  1JMB A;  1GMJ A;  1PP9 D;  1GL2 D;  3CXH D;  2HPC A;  3FGA D;  2N1T C;  4HB1 A;  2OGU A;  5CBO A;  1WT6 A;  4HH2 A;  3P8C D;  2QA4 P;  4FAN A;  3H1L D;  3C9I A;  5AVV B;  2YNY A;  3CYT I;  1EDL A;  1VQP P;  3WU2 H;  1R5L A;  3WUT A;  2QM7 A;  1SQQ G;  4UB8 H;  1JNM A;  1C52 A;  2BCC E;  1SQX K;  1UIX A;  1GZL A;  5CMZ A;  1KQS O;  1NTM E;  4ASV A;  4B86 A;  3CLQ A;  2KS1 B;  2E75 D;  2PCC B;  3PH0 A;  2HV4 A;  3ABV C;  2AXT E;  3OAK A;  1NAY A;  4EI2 A;  4JPZ B;  4JCG A;  1E2R A;  2WVR A;  3HUS B;  1HRO A;  1SP4 A;  1SQV J;  1FC2 C;  1GW3 A;  1RY3 A;  1A8C A;  2HFE D;  2XND H;  3ZOO A;  1N2D C;  1VQ4 P;  2WQY C;  1YIQ A;  4AQR D;  3L70 J;  1M90 Q;  1RAQ A;  2N18 B;  3RK2 C;  2PP6 A;  1OX3 A;  3Q3D A;  2CXB A;  4QAO A;  2KSJ A;  3H32 A;  3RK2 D;  1DD4 A;  1GKS A;  1T2K D;  5KLV G;  2QIW A;  3TNU A;  2OYH C;  5AVU B;  4RES B;  1A2S A;  1SQQ E;  3PH2 B;  3RK3 E;  2KUB A;  2IBZ G;  4LGD E;  2OQQ A;  1CCR A;  3GHG B;  2C8S A;  1LTT C;  1E5W A;  1KYO H;  1S5L H;  2N1T B;  1BGY J;  4H44 B;  1KIL B;  4NPE A;  1BL9 A;  1OMI A;  1KV4 A;  2XTS B;  4BRY A;  1H8A A;  1JEK A;  2FYU K;  2NRG A;  2KXP B;  3Q5R A;  1GL2 A;  5AW1 B;  3CCJ P;  4L3H A;  4GOD A;  3S9O A;  1HTL C;  3G71 P;  2WSF H;  5AVR B;  1R5S A;  1KB9 D;  2E76 D;  3SWF A;  3FWL A;  1FAV A;  3WFD C;  5KLV E;  1IRV A;  1NU1 D;  1EZV I;  4NPD A;  1KYO D;  2RN0 A;  2YCC A;  1FHB A;  1HH7 A;  3L71 G;  3RL0 B;  2I1K A;  1I8P A;  2QM8 A;  3U1A A;  1SQP J;  3A0B H;  1JM0 A;  1OW7 A;  1AV1 A;  1T3J A;  3OA8 A;  3P7K A;  2IBZ E;  2JEE A;  1JY3 O;  1AJY A;  2FRC A;  2C9L Y;  2K9J A;  2OYO A;  1AOQ A;  1W2E A;  2ORL A;  3MZW B;  3L72 J;  3TDK A;  1Q82 Q;  1PPJ D;  4NPF X;  2IZ0 A;  3QWO C;  4IFM A;  1HJ0 A;  1FDI A;  3MK7 B;  1YCC A;  1NTK K;  2FFD B;  5APX A;  4UB6 V;  1L0L K;  1MFZ A;  4WBA A;  1RZ6 A;  1N73 A;  1IZN B;  1LGH B;  1PP9 J;  2QJY C;  1HBW A;  4J20 A;  1MFT A;  1J3S A;  1VQM P;  2W8Z A;  1YFC A;  4QMA A;  1COT A;  4WY4 B;  1W2B O;  3M0D C;  3L71 E;  1SS1 A;  1PV3 A;  2V7Q J;  3H1L J;  3SWK A;  2M8R A;  2OYH A;  3RMZ A;  5DJU B;  5BVZ A;  1CRH A;  2AXT H;  2FYN B;  1L2P A;  1LTB C;  4ZKU A;  1GJQ A;  3TK1 A;  5H2F V;  1L0L G;  1BGY G;  4W7Y A;  2IFN A;  3CX5 I;  2AEJ A;  3CI9 A;  1EXI A;  1K9M Q;  3HE5 A;  2LXC B;  2OYI B;  2BCC D;  1H33 B;  3AE4 C;  5AW4 B;  1CED A;  1FOS F;  3L4M A;  2IX7 C;  2KI7 B;  1FU1 A;  1P84 I;  1NTM D;  2YO3 A;  3HD7 D;  3MHV A;  1LFM A;  4WQC A;  2JO1 A;  4JYB A;  1LS9 A;  1FI9 A;  2YO2 A;  2WPQ A;  3RBX A;  2Z4E A;  1R0Q A;  4FA4 A;  1CRJ A;  2QE7 H;  2O1K A;  2R3S A;  1FJP A;  2ZVN B;  2H88 C;  3CCQ P;  2GC7 D;  3O0R C;  1CO6 A;  1QLE D;  4C7R A;  2V07 A;  3LW5 H;  5AW5 B;  3VP9 A;  1MZ4 A;  1NMI A;  1SVF A;  3TYY A;  3D71 A;  1L0L E;  1A02 F;  2N9Y B;  1NAF A;  3L73 J;  2Z5H A;  2NZ2 A;  3TF5 A;  1MG3 D;  3U1C A;  3M0A A;  1OVV A;  4H13 B;  5KAI E;  3RK3 C;  1S3J A;  3SWY A;  3CXH I;  2VHD A;  3B71 A;  3RK3 D;  1VQO P;  5DJT B;  5CIF B;  5APU A;  1JY2 N;  1L4A D;  2A45 I;  3H1K J;  3VMY A;  4JQ0 D;  4LC1 A;  1AKK A;  451C A;  1P84 E;  155C A;  4Z1M H;  2I8D A;  3B5N C;  3M0D A;  1IFM A;  2CA3 B;  3AED C;  3HTK A;  5KAF E;  1I6D A;  4ZMD A;  1L0N J;  3L36 A;  5GTI E;  2PGD A;  1SQX D;  2KNC B;  3BAT A;  1OCD A;  3KHU A;  2IPP A;  3M9H A;  3TGU J;  1H0T B;  2YXR B;  1J1E C;  1WMK A;  2WSF J;  2XZR A;  1NNO A;  2IBZ D;  1OWA A;  1DW2 A;  2GC4 D;  2O1J A;  1ZR4 A;  3HD7 A;  4DJG A;  1U57 A;  3V6I A;  4Y99 C;  3L75 G;  2FYZ A;  3S4R A;  3SFE C;  2C1D B;  1VF5 C;  5AW0 B;  4DT0 A;  4AAO A;  3CPW O;  5E79 V;  1HUC A;  5KAF V;  3CX5 W;  1ZRT E;  4RKU J;  3Q5P A;  1HZV A;  1SFC C;  1SFC D;  2J58 A;  4FA5 A;  4XE5 B;  3T97 A;  1NOH A;  2NPS A;  5KKZ C;  2XV5 A;  1QL4 A;  1M70 A;  3L71 D;  1N86 A;  4R4M A;  1HJB A;  2H7H A;  1KX2 A;  1KTM A;  5IY5 1;  2WT7 B;  3CCS P;  1YYC A;  2KLU A;  2FYU D;  3GW6 A;  2D0S A;  1N7S D;  1L4A A;  2B88 A;  4PD4 D;  1X22 A;  4OH8 B;  2BCC J;  4H0L C;  3A5T A;  3BCC G;  1RF0 A;  4H0L D;  3L75 E;  1KB9 I;  1NTM J;  2GA1 A;  5CYT R;  2JQR A;  2WTY A;  2JWD A;  3EWK A;  1KYO I;  1LT9 B;  1F1C A;  1NU1 G;  1S72 P;  2E5T A;  1EDK A;  4H0K A;  1DEE G;  3HE4 B;  3CXH W;  1C6S A;  1GD2 E;  1ZW0 A;  3WUU A;  1URQ D;  3PTZ A;  3TSI A;  3TYI A;  3OJA B;  1ZZH A;  1U74 B;  2AEF A;  1AOF A;  2B89 A;  3O20 A;  1GTW A;  1H1O A;  1JCD A;  1PPJ G;  4WB4 A;  4RSZ A;  1LC2 A;  1CRI A;  2WIT A;  1DX7 A;  3WU2 V;  1P84 H;  3NBT A;  1KQG B;  1SQQ J;  5CCH D;  4LJI A;  1NTK D;  1JY3 N;  2YQB A;  3BCC E;  1JB0 J;  2Q6Q A;  1L0L D;  2Z5I A;  5DF5 A;  4ZNC A;  1KMI Z;  1PZQ A;  2GUS A;  4GDO A;  3LW5 J;  1KB9 E;  4WQA A;  1KOR A;  2RMZ A;  1S5L X;  5E79 H;  3OCD B;  2H8P D;  5KAF H;  1NU1 E;  3V4Q A;  2Q9I A;  3W68 A;  5KKZ B;  3ZCF A;  3VMX A;  5AVQ B;  5GTI H;  1G2C A;  1SFC A;  2IDB A;  4XFJ A;  2ZT9 B;  2YXQ B;  2M5A B;  1ZOY C;  2OTL P;  2YMK A;  1T8Z A;  5KLV J;  2YIU B;  1LNQ A;  2E74 C;  1KC8 Q;  1OVR A;  3PRJ A;  3M9B A;  2B87 B;  3DP5 A;  2V4H A;  3C1L A;  3L74 G;  1N7S A;  1FS0 E;  4W80 A;  1BDC A;  2W6A A;  2HPC B;  1JTH A;  2R32 A;  3AE6 C;  4YXD C;  1RHZ B;  1S5L V;  4PJ0 E;  1E29 A;  1BE3 G;  1LWU C;  4I7Z B;  1EQ7 A;  1CYI A;  1CXA A;  1CSX A;  1ZLL A;  1K04 A;  2CK3 H;  1CYJ A;  5DJQ B;  1LP1 B;  2FXP A;  5CIH B;  4MU8 A;  1URQ A;  1JY2 P;  3JCU E;  3WUI A;  4OGQ B;  2W83 C;  2C0X A;  4EYY Q;  1T6A A;  3D6Z A;  1ZRT D;  1YJ9 P;  1QEX A;  3O5C A;  1JMM A;  1XTC C;  3KPE A;  2CPB A;  1H32 B;  3L71 J;  1KYO W;  2KIK A;  2BEQ D;  2KLV A;  1CIF A;  3A0B V;  5GTH V;  3VYM A;  1C2R A;  1KIL D;  3H1H G;  1MUU A;  3L74 E;  2GUV A;  4PJ0 V;  2BH5 X;  3SXT A;  4AYC A;  5CCH A;  2ZBO A;  2H89 C;  2E75 C;  2L4D A;  4N3Y B;  5BU8 B;  2H43 A;  1BE3 E;  3NFQ A;  1HGZ A;  1S9K E;  3H1J D;  5CIB B;  1TU3 F;  3H32 B;  3VTP C;  3VNW A;  3CCE P;  1N73 C;  1FZC A;  3TNU B;  1FZA A;  2OTJ P;  2Q1K A;  1LJ2 A;  1FJK A;  3L75 D;  1DIQ C;  1Q86 Q;  3V2R A;  4WQ9 A;  1T2K C;  1ZXG A;  1SQX G;  5B6Q A;  1CSB A;  3B8E B;  3VMA A;  3V2N A;  1QL1 A;  1NKZ B; 
#chains in the Genus database with same CATH homology
 2AI5 A;  5H2F V;  1IO3 A;  1DW3 A;  2OZ1 A;  2QJK B;  2KS1 A;  1YIC A;  1CTJ A;  1RAP A;  1ETP A;  2N9J A;  3PHL A;  4A7P A;  2AXT V;  1CTZ A;  3RLM A;  1FI3 A;  1CRG A;  2BCC D;  1H33 B;  2Q3E A;  1FI7 A;  1DVH A;  1WEJ F;  3DMI A;  1CED A;  3L4M A;  1I8O A;  1NTM D;  3ORV A;  2MHM A;  3ZOW A;  1CSW A;  1L9J C;  4WQ7 A;  1M6Z A;  1LFM A;  4WQC A;  3ZIY A;  2Y0E A;  1LMS A;  3HQ7 A;  5C9M A;  1LS9 A;  1FI9 A;  1FOC A;  3BCC D;  3JBT B;  1R0Q A;  4FA4 A;  1CRJ A;  1C7M A;  1CXC A;  2N18 C;  2GC7 D;  3O0R C;  1CO6 A;  3OA8 B;  1DW0 A;  2V07 A;  3KZI V;  3CU4 A;  3VRD A;  3SLE A;  1IRW A;  1EZV D;  1MZ4 A;  2K9J B;  1C6R A;  1NMI A;  2FWL A;  1K3G A;  1GIW A;  2N3B A;  1CIE A;  1K3H A;  1NML A;  2N9Y B;  1HRC A;  3ZOY A;  4WQB A;  1YEA A;  3TF5 A;  2C9X B;  5AUR A;  1MG3 D;  1LC1 A;  1U75 B;  5B5E V;  2D0W A;  1H9X A;  2PCB B;  2VHD A;  4P4Q B;  1W5C T;  2BLF B;  1E8E A;  1GDV A;  4O1W A;  5CIF B;  4GED B;  1SQV D;  1CHH A;  1N90 A;  2B10 B;  2C2C A;  2ZOO A;  1AKK A;  351C A;  1MG2 D;  451C A;  2ZZS 1;  2MTA C;  4YE1 A;  155C A;  2B12 B;  1I6E A;  2BPB B;  4PWA A;  4AAN A;  2ZXY A;  1HJ5 A;  3M97 X;  1HZU A;  2CA3 B;  5DJQ C;  1CYC A;  4DY9 A;  5KLI B;  1I6D A;  4H0J A;  4AAM A;  1H32 A;  2OZ1 B;  2BH4 X;  1SQX D;  2I8F A;  1DT1 A;  2KNC B;  4UB8 V;  1OCD A;  3KHU A;  1CTY A;  3WC8 A;  1YNR A;  1BGY D;  3PXS A;  3RN0 A;  4EIF A;  3C2C A;  1NNO A;  4FA1 A;  1IZL 0;  2IBZ D;  4WQE A;  5B66 V;  1SQB D;  1DW2 A;  3CX5 D;  3ITK A;  5CID B;  2GC4 D;  2A06 D;  2DVH A;  3PXT A;  3ZOX A;  1H31 A;  3MK7 C;  3L74 D;  2C1D B;  4AAO A;  1AYG A;  3O1Y A;  5E79 V;  5EXQ A;  1P84 D;  5KAF V;  3GG2 A;  3CX5 W;  2JWA A;  1CC5 A;  3OCD A;  4FAV A;  1HZV A;  1BE3 D;  3WFE C;  5CIG B;  1SQP D;  3L73 D;  4FA5 A;  2B11 B;  1F1F A;  1HCM A;  3WFB C;  1KB0 A;  5TJH A;  1QN2 A;  1QL4 A;  1M70 A;  1COR A;  1CRY A;  3L71 D;  3L72 D;  1KX2 A;  5IY5 1;  3H1K D;  1RZ5 A;  1GQ1 A;  2PAC A;  2FYU D;  3GW6 A;  2D0S A;  2AIU A;  1B7V A;  2QJY B;  4FA9 A;  4PD4 D;  2Y0D A;  5DFS A;  2CE1 A;  4KMG A;  1I54 A;  1PP9 D;  1DVV A;  3CXH D;  4WQ8 A;  3H1H D;  5CYT R;  2JQR A;  3SVW A;  4XYD B;  4IL6 V;  1CCH A;  1NIR A;  1HJ4 A;  3A0H V;  1F1C A;  2C1U A;  1L0N D;  1DW1 A;  4FAN A;  4H0K A;  3H1L D;  1C2N A;  3CXH W;  1C6S A;  3TGU D;  3CYT I;  3PTZ A;  3TYI A;  1ZZH A;  1U74 B;  1CSV A;  2L91 A;  3PXW A;  1C52 A;  1AOF A;  1DII C;  3O20 A;  3RN1 A;  1H1O A;  4RSZ A;  1LC2 A;  1CRI A;  1GU2 A;  3HQ9 A;  1YTC A;  4EIE A;  3H1I D;  3WU2 V;  2PCC B;  5KAI V;  2HV4 A;  1N50 A;  3NBT A;  4FB1 A;  2DGE A;  4JCG A;  1E2R A;  4LJI A;  1CIG A;  4GYD A;  1HRO A;  1NTK D;  1H31 B;  2YQB A;  1L0L D;  1C75 A;  1VYD A;  2Y0C A;  5DF5 A;  2EXV A;  1A8C A;  3ZBM A;  4D6T D;  4EID A;  4WQA A;  3ZOO A;  1A56 A;  3PLN A;  2RMZ A;  1QL3 A;  1C6O A;  1WVE C;  1YIQ A;  1CHJ A;  3OCD B;  4O1Q A;  1RAQ A;  2N18 B;  2N9I A;  5KKZ B;  3ZCF A;  3NWV A;  2CXB A;  4QAO A;  1GKS A;  4L3G A;  4AX3 A;  3X39 A;  4EDF A;  2YK3 A;  1CIH A;  1CSU A;  1IQC A;  1A2S A;  2V08 A;  3WFC C;  3PH2 B;  5GTI V;  1CCR A;  2C8S A;  1YEB A;  2YIU B;  2B4Z A;  1JDL A;  4U3F D;  3PRJ A;  3DP5 A;  2LIT A;  3L4O A;  1QKS A;  2ZON G;  3CWB D;  1KIB A;  1BL9 A;  2XTS B;  3SJL A;  4L1Q A;  1M60 A;  1I5T A;  3NBS A;  1S5L V;  1I55 A;  2C1D A;  1E29 A;  4L3H A;  2N3Y A;  4N0K A;  1H33 A;  1CYI A;  1CXA A;  3SWS A;  1CSX A;  1KB9 D;  1KX7 A;  3FWL A;  1CNO A;  1CYJ A;  2GB8 B;  3WFD C;  5DJQ B;  1IRV A;  1NU1 D;  1EB7 A;  2BCN B;  1KYO D;  2RN0 A;  2YCC A;  1FHB A;  1HH7 A;  5CIH B;  4MU8 A;  2QG4 A;  1I8P A;  3WUI A;  4V2K A;  3OA8 A;  4WQD A;  1ZRT D;  2FRC A;  3O5C A;  4PW9 B;  1H32 B;  1SQQ D;  5CIC B;  5C0Z A;  1AOQ A;  4RJT A;  1KYO W;  2ORL A;  3DR0 A;  3TDK A;  1CIF A;  3A0B V;  1OAE A;  5GTH V;  3VYM A;  1C2R A;  1CRC A;  1PPJ D;  1W2L A;  4PJ0 V;  2BH5 X;  3SXT A;  1QYZ A;  2CE0 A;  4NFG B;  3HQ6 A;  2ZBO A;  2L4D A;  1YCC A;  3L70 D;  3MK7 B;  4UB6 V;  1BCC D;  2QJP B;  2CA4 B;  1RZ6 A;  1S6V B;  1CHI A;  4XXL A;  3A9F A;  1FCD C;  4J20 A;  2O3J A;  3H1J D;  5CIB B;  1J3S A;  1H9Y A;  3VNW A;  1YFC A;  4AAL A;  2LIR A;  1KV9 A;  1COT A;  4EIC A;  2B0Z B;  1N15 A;  4K3I A;  2C1V A;  3L75 D;  2GIW A;  1DIQ C;  1HJ3 A;  1N9C A;  2JTI B;  3HQ8 A;  5KLV D;  4WQ9 A;  3RMZ A;  4Q5P A;  3CP5 A;  4Y5R A;  1NTZ D;  5CIE B;  1CRH A;  1FJ0 A;  2FYN B;  5B6Q A;  5TIS V;  1L9B C;  3VMA A;  2BGV X;  1GJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...