3H1HG

Cytochrome bc1 complex from chicken
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1hG00
3H1LG 1PPJG 3L73G 1SQQG 1PP9G 3L72G 1NTMG 1P84H 3CX5H 1NTKG 3H1IG 3BCCG 1EZVG 1KYOH 1NU1G 2IBZG 1KB9H 3L75G 1BE3G 1SQBG 5KLVG 3CWBG 1L0NG 2BCCG 3H1JG 3L71G 3L70G 1L0LG 1BCCG 4U3FG 1SQPG 3L74G 3H1KG 2FYUG 1SQVG 3H1HG 3TGUG 1NTZG 3CXHH 2A06G 4PD4H 1SQXG 4D6TG 1BGYG
chains in the Genus database with same CATH superfamily
1QVFO 3AE7C 2BEQD 4AQRD 1USEA 1LTBC 3M0AA 3VP9A 1LT9A 4TT3H 1LP1A 5AW9B 4JYCA 3SSUA 1DH3A 2Y0EA 1R5SA 1VQ8P 1SQBD 3L70E 1CSBA 1SQPE 1FZBA 2YMYA 1SQQG 4DT0A 2HPCA 3N7NA 2PFXA 1ZLLA 1NJIQ 1NAYA 3B8EB 2E75B 3PRJA 3H1LD 2C0XA 1UIIA 1X79B 2IFNA 3PLNA 1OVRA 1QGKB 1BE3D 3GF7A 2XU6A 1SQVJ 3L71D 1JEKA 3K5BA 2FFDC 1WT6A 5BU8B 3AEGC 1FZAA 1SQXE 4D6TJ 2ZVNB 1QLED 3C9IA 2ZXXA 4ASVA 1NTKJ 4U3FG 5APSA 3D6YA 1BSNA 1E79H 2RMZA 2I1JA 2WPQA 4H13C 1ZR4A 2FFDB 4N78D 1U57A 3GHGA 2ZYGA 5AW0B 2FYUE 3TGUE 1N7SA 1G1JA 3F5HA 3L72G 1L0NK 4AYCA 3B5NA 5AVVB 1NO4A 1OWAA 1Q86Q 4WY4A 4ASWA 4BRYA 2H43A 3MTUE 1IO4A 1AVOA 4L73A 3RK3B 2M5AA 1L0LK 2QJKC 5CCHC 1GL2C 5M1BA 1HBWA 4CPGA 2KP8A 5AW3B 1XTCC 2WPRA 3AEEC 1Y47A 1EC5A 1M1JA 2ZAEB 3H1KJ 2CPSA 1KFMA 1KB9I 4R4LA 2XV5A 2QM7A 1KB9E 5KLVG 3R4YA 2NPSC 1P84D 2XNDH 3CCLP 4IL6E 1JTHB 2K1AA 2G8YA 2KK7A 4IFDK 2QJKB 5KAFE 3H32B 4PJ0E 3L70J 1SQPJ 4JQ0D 3H1HE 2Z4EA 3WUVA 3BASA 5AW7B 2L5GB 4IL6H 3CCMP 1M57D 1Y9BA 2E5YA 1VQMP 5AW2B 5KAFH 4PJ0H 1RE4A 1SFCC 2OYIB 2JKVA 2NPSB 3EFGA 5KLIB 3TF5A 4W80A 4PD4D 1NTMG 3L37A 3G3ZA 2KSEA 2R3CA 2GM4A 3MZWB 1JY3O 2IYOA 2WVRA 1IK7A 2RKLA 5KJ7C 2G3AA 3CCJP 1TU3F 1RQUA 1JY2N 1NTZG 3H1JE 2Q9IA 1MFZA 1BCCD 5C39A 3BCCG 4LLHA 3L36A 3M91A 1BGYJ 2A45G 1LTAC 1HVVA 1J2JB 3CX5D 2IZ0A 2N9YB 1L4AD 3CCSP 4BWNA 1URQC 2ZFCA 2GUVA 3AE2C 5KLVD 2FYUJ 2YKQA 3TGUJ 3TNUB 2P67A 1URQA 3NTNA 3L73E 4GODA 1NKZB 3QWOC 3KXDA 3VMAA 1S9KE 1VQKP 2GUSA 3D71A 2KSJA 3U1CA 1ZRTE 2KUBA 2JWDA 1DD3A 1GZLA 3L75E 2AEJA 3AE5C 1RHZB 5AW8B 1MZ9A 4DJGA 3NFQA 1T2KD 2IPPA 3AECC 4C7RA 4B86A 1DIPA 1IFPA 4K35A 4I1LA 4XA4A 1KILC 2R5BA 3CCUP 2W90A 3V6IA 2B87A 1FDOA 1KILA 2P2UA 3B71A 1LTSC 2AEFA 4Y28J 5DJTB 3PJSK 3I56P 1MFTA 2AEMA 3H1HJ 3N4XA 2OTKE 4L75A 4H0LC 1IZNB 2KS1A 2OYOA 4PV1D 5AW5B 3V2RA 1S4XA 5AVRB 1SQQK 4O9BA 1H8AA 3CC4P 3IR9A 3S4RA 2QJYC 4HKZH 1IK9A 1NVOA 1PP9G 1X0TA 1SQVD 2O1KA 1EZVG 3B5ND 2PGDA 1NHLA 3VMYA 1NTKD 3TYYA 3A3YB 3H1JJ 1BDDA 1GK6A 4WB4A 2WITA 2H88C 1M8OB 1OFCX 4GT1A 2BASA 2Q5UA 2KIKA 1YHQP 1Y8AA 1N7LA 2ZT9B 4RKUJ 4M3LA 2IDBA 1G1IA 4HH2A 5CJ0A 3E7KA 1FC2C 1ZW0A 2OQQA 2K3RA 3H1IE 4L76A 2K9JB 3D70A 3HRNA 1IC2A 3HUSC 3HD7C 1IFDA 1LTJB 5TJHA 1JY3P 4EYYQ 2JWAA 2YXQB 2OYHB 4OH8B 4YPCA 2AXTE 5APXA 5KKZB 4Y99C 1ZOYC 1ZV8A 1SLQA 4HYTB 3L75J 1PP9D 1OX3A 2QA4P 2BCCE 2DW3A 2WWWA 2N1TD 1BGYG 1W2EA 3H1KD 1YQ4C 2YMKA 2E74D 3P8MC 3HUSB 1SQBG 5GTHE 1FZGA 5CHXA 1K8AQ 1A02F 4Y99B 1HJBA 3H1LG 2QVAA 1HJ0A 3L70D 3L35A 1SQPD 2N9BA 5KLVK 1VPCA 5GTHH 1JB0J 3HE5B 2WSCH 1S5LH 4IFFA 3L71G 1QVGO 2BEZF 1FJKA 2GA1A 4H44D 3A7OA 1L0NE 2W6JH 2K88A 1FBMA 1FZCB 3PHLA 3AEDC 2QM8A 1RF1B 3CI9A 3ITKA 4XE5B 1EXJA 5E79H 1N73B 2A06G 1L0LE 2JP3A 1NTMK 1RF0A 1YTZI 4BXLA 2E75C 2FBWC 3O6QB 5CBOA 2WT7B 3U1AA 1PPJE 1BGYD 2WPVB 1NTZK 3IAOA 1LTIC 1JO5A 1FDIA 1ZMEC 3CD6P 2HG5D 3RGUA 3TGUD 4EOTA 3AE6C 3A0BE 2V7QH 3H1IJ 1L4AB 3WUUA 3CWBE 2KYVA 3OW2O 3RK2D 3L74E 2J58A 1FZEA 3IF4A 3HTKA 3A0BH 4JYBA 2IBZI 4IFMA 1LT9B 2JR8A 2PP6A 2FFDA 1X22A 4R4MA 2IBZE 2WQYC 1NU1J 1PGOA 1UIXA 2BCCJ 3CCQP 1K05A 2ZT9D 5KAIE 3V2NA 3USSA 1NKNA 3VMXA 2D2CB 4WWIA 2A06D 3G71P 2WSCJ 1D7MA 1KB9D 3PH0A 5KTBA 1VQ5P 2YNYA 2QJPB 3RK3C 2POHA 5GTIE 1QEXA 5CMZA 3H1HD 1Q7YQ 1FAVA 5CCGC 1KILE 2FXOA 1LT1A 2E76D 1ZXGA 1GW4A 1VQOP 2WSEH 4JF7A 2HODA 3T97A 1GDTA 3CMEP 3KZIE 2KLUA 1BCCG 2H89C 3CCRP 4PV1B 1EDIA 1BE3E 1GW3A 1LGHB 2OGUA 1OVVA 5CCHA 3H32A 1L0LJ 3AE4C 3FGAD 1GL2A 1N7SB 4EDFA 3H1JD 1YTZT 2IYPA 3FXEA 1A02J 3I5CA 1XTGB 3B5NB 2OYIC 2V7QJ 5KLIC 3Q3DA 3CMAP 4L74A 2OYIA 1AA0A 2NPSA 4W7ZA 3VP8A 1K9MQ 3GLMA 3FWLA 4JPZB 1KB9H 1NYHA 5AW6B 4GDOA 1FZFA 2LXBA 3M9BA 3CWBJ 1S9KD 1M1JB 3L74J 1H0TB 2VRSA 2FXPA 1M90Q 4YXWH 1YITP 2V4HA 3KYQA 1SFCA 3VTPC 1SQXJ 1ZRTD 5K5GB 1SQQE 2N1TC 1IFNA 3MUDC 3CXHI 3BRVB 3L75D 1FOSF 3SFEC 1PZQA 1JMBA 2RN0A 3CXHE 1J1EB 5KJ7A 5AVUB 1PIXA 3RL0D 4ZNCA 1YI2P 3FWNA 1IFIA 3G9RA 3Q5RA 1QX8A 2Z5HA 1G2CA 3CXHH 1JUNA 2N1TB 2OTLP 4U3FE 4OGQD 1RE3C 1VL2A 3F89A 2WSEJ 4MN4C 1VF5B 3Q2YA 1SQBK 2E74B 1KN7A 4H44C 1VQ9P 1CI6B 5L8RJ 2ZYAA 1SQVG 2PAJA 4D6TG 1FDMA 2K37A 1NTKG 3C1LA 2LKMA 1NU1G 1NH4A 1FOSE 2D2CD 1WRGA 4RO0A 3L72E 3Q5SA 1EXIA 1YIJP 2Y0DA 3SFDC 2KNCB 4H44B 2WSSH 2M8RA 1OXZA 4RESB 2I8DA 1JMMA 1KV4A 2KXPB 4GIFA 4ZKPA 1KTMA 2YO3A 3AEFC 1OW7A 4UB6E 3V4WA 2SPZA 2L91A 2QEXP 2K9YA 3RBZA 1HUCA 3P8CE 2Q7CA 1NWQA 3MP7B 1PV3A 5APVA 1KORA 1ZN5A 2O1JA 3CL3D 2W6AA 4UB6H 1S5LX 4YXDC 2WTYA 3L4FA 1KQSO 5KLVE 3H1ID 1USDA 1EDLA 4C7NA 1R5LA 4EIJA 1N2DC 1SVFA 2Y9ZA 1N7SD 1KZUB 2W8ZA 2WMMA 1SQQJ 2ZT9C 4WVZA 4D6TD 2XZRA 4N6JA 2B87B 2R44A 3H1KG 4HB1A 4WY4D 3LIDA 3TK1A 1NU1D 3C8VA 3RK2B 1PPJG 1RQVA 2BCCD 1J1DB 5CBNA 3M06A 3BATA 3IFMA 4TLFA 3JSVC 1NTME 5B5EE 3L70G 1SQPG 2MJZA 1KQLA 3KQGA 1LTJC 2K9JA 5CCHD 2OYHC 1YQ3C 4U3FJ 5KKZC 2M0BA 2W6BA 2UWJE 1NTZE 3MHVA 3L73J 3CCEP 2A45I 1HTLC 1PGJA 3BCCE 5APYA 2R32A 1SQXG 3D6ZA 1VQLP 3RK3E 3A0HE 3FXDA 2FYNB 1X8YA 4NPDA 3HUSA 3HD7A 4IOIH 1DEEG 3L72J 3E1IA 2WZ7A 5APUA 2A45H 2E76B 3BVHA 3OAKA 4LC1A 3E1RA 3A0HH 1VF5D 1KYOI 1EDJA 2AXTH 1VQ6P 1OW8A 2JJLA 1M56D 2HR3A 1KYOE 3G6EP 1HGVA 3GW6A 1PPJD 2FYUG 3AE8C 3TGUG 1YJNP 1FZCC 2KZJA 5KJ7D 4AUWA 2PRRA 2H8PD 3CC2P 1RF1C 1KYOH 2P58A 3SWKA 3WU2E 1N73C 3CCVP 1T6AA 1DD4A 1LTGC 1LWUC 3CWBD 3MGNA 5APQA 3L74D 1K73Q 1LNQA 3O6QA 1URQD 3WU2H 4ZKUA 3U59A 2WT7A 1OW6A 1SQXD 2FXMA 1ZP0C 1GK4A 4DOJA 2IBZD 2QSIA 2M3EA 3RL0C 2QG4A 2Q3EA 1MKMA 4K3AA 1FS0E 5BU5A 1LWUB 2YIUB 1EZVI 3HE4B 1L4AC 2I1KA 1PP9E 1NTMJ 4KT0J 1IFMA 1EZVE 2O3JA 3H1HG 1AQ5A 1L4AA 1JY2O 3M9QA 1LT9C 1NTZJ 2FYUD 1MUUA 1JNMA 3SWFA 3RL0B 3ZDMA 4IL6X 4GOEA 3BCCJ 1S72P 1KILD 3V2PA 1Q2NA 4OGQB 2D2CC 1JCCA 2FYZA 4ZMDA 4NPFX 3QH9A 1N86A 2E5TA 2Q6QA 1BDCA 2KI7B 3WUTA 3P7KA 3NXSA 3S9OA 3CPWO 1SQVK 3H1JG 1LP1B 2QJPC 4H0LD 2JDIH 1T2KC 5AW1B 1VDFA 1U7JA 5AVXB 1GD2E 2IX7C 1YYCA 2IZ1A 4EI2A 1DX7A 1NTKK 1NU1K 4I7ZC 2HPCB 2FKWB 5AW4B 1VQNP 5AVTB 1NAFA 5AVQB 5KAIH 2ZJSE 3L73G 3HTKB 3M9HA 1BGYE 4PV1C 2YO2A 3GHGC 1HF9A 1GU5A 5AVYB 4I7ZB 3EWKA 1N7SC 1CZQA 1SQBE 1DEBA 5CCGA 1L0NJ 3B5NC 5GTIH 5AVZB 2Y9YA 1JOCA 4WY4C 3L75G 3H1LE 1YJWP 3SWYA 2J5UA 3MD0A 1SQQD 4H13B 1HGZA 1JTHA 3GHGB 2NZ2A 3L71E 3FX0A 3GF3A 1FU1A 2WPSA 1AV1A 1M1KQ 3CXHD 3ABVC 2C0WA 3HD7D 2ITAA 3KZIH 1ZR2A 1PGPA 3P32A 1M1JC 1PP9J 2P1JA 4WY4B 4BRYB 3V5BA 1GMJA 1EQ7A 2NRGA 2HODB 2Y0CA 2ZVOB 1H0TA 3PTZA 4U3FD 3TDKA 1Q81Q 3T97B 2A06E 2XKMA 2RH0A 1R8EA 2ZYDA 2M5AB 1SQPK 4N78E 3L73D 4LGDE 2Z5IA 1J1EC 1Q82Q 1GL2B 3KDPB 1AFOA 2YKPA 1QL1A 3S1KA 1CW5A 1RE4C 4C46A 4QMAA 1SQXK 1VF5C 3L72D 3LIEA 5APTA 1L2PA 2E74C 2N1TA 3W67A 3MUDA 2CK3H 3EFFK 2CPBA 3TNUA 3GG2A 2KLVA 2ZXEB 2C9LY 1JY2P 5DJUB 1CI6A 3AEAC 1OVUA 3AE3C 2LR2A 3P8CD 3Q5PA 1K04A 3JC22 1P84I 2IFMA 1SFCB 1RH5B 3H1IG 1Q90D 1P84E 5AVSB 2B9BA 1PGQA 2FYUK 1RE3A 3AEBC 2E75D 1HWTC 1SQBJ 2KNCA 1KFNA 2YXRB 3AE9C 1P84H 1GU4A 4NPEA 3V4QA 3H1LJ 3JCUE 1AJYA 2R3SA 3W68A 2BCCG 4PD4I 1BE3J 1IFJA 1G2CB 3TSIA 4W7YA 4A7PA 2LXCB 3L71J 2YKOA 2KOGA 3B4SA 4PD4E 2O01N 4U7JA 3OA7A 1URQB 4WBAA 3JCUH 1S3JA 1BSHA 3CLQA 1NTMD 1H88A 3Q1MA 4PD4H 1BCCE 1T8ZA 5EFWB 5TISE 3PP5A 3CX5I 1AVYA 2WSFH 5APWA 1NTZD 3G4SP 3CX5E 3A2AA 2Q1KA 5CJ4A 1L0NG 3A5TA 3H25A 3RK2C 1U7MA 2XDJA 3KPEA 2FY8A 4H13D 3BCCD 1J1DC 1SS1A 1FJPA 5TISH 1YBKA 2P10A 3UIAA 3CX5H 2QRXA 3EQ2A 3RK3D 2C9NY 3MIWA 1OIPA 4Z1MH 4GKGA 3M0DC 1VQ7P 2OTJP 1T3JA 1L0LG 4RJTA 1X9VA 1KILB 2R5DA 5CCGD 3O8ZA 2J59M 1KC8Q 3M0DA 1W5CE 3WMM0 5B66E 3GMAA 2AXCA 3LW5H 3IN6A 2JO1A 1LJ2A 1N8RQ 2KS1B 3H6PA 4OVNF 4H0LB 1KYOD 3R2PA 1W2BO 1MV8A 2JEEA 2HYNA 4C7NB 2KZIA 2O01H 1VQ4P 1IJDB 1GL2D 2FYNC 5B66H 4KJMA 3RBXA 5H2FE 1LTJA 3VMZA 4JBZA 2OYHA 1S2EA 3VOPA 1EDKA 2E76C 2QJYB 4DZOA 3CWBG 3I55P 5B5EH 3L74G 1PFIA 1T3UA 2NPSD 5H2FH 1L0ND 4UB8E 1JCDA 2HFED 2IBZG 1JY3N 1KD1Q 1AQTA 2M3BA 1SP4A 1JM0A 3KHUA 2B88A 4OWFA 2Q3IA 2KB7P 1NOHA 1GTWA 1PL5A 1SQVE 4UB8H 1L0LD 1SFCD 4N3YB 2WSFJ 4D6TE 1FE6A 4XFJA 2P7JA 4I6MC 3HE5A 4GOFA 1NTKE 1HH0A 1NU1E 5AVWB 1EZVD 1LTTC 1YJ9P 3VN0A 1BCCJ 1Z56A 1RY3A 1KQGB 1OMIA 3HD7B 1E5WA 1FZCA 4HJGH 1S5LE 1KMIZ 1OZHA 3VYIA 1RF1A 2W83C 5KLVJ 1N73A 3RL0g 3II6A 2YIUC 4DCKA 4I2LC 2HLOA 2XNXA 1LWUA 1BE3G 3LW5J 4KHXA 1KQFB 3HE4A 3V2QA 2W27A 3CC7P 2E43A 1NGMB 1QL2A 5E79E 2O01J 5BVZA 2OARA 3AE1C 1H89A 2B89A 1S1CX 3OJAB 2MKVA 2QE7H 1RF0C 1VQPP 2QIWA 4OGQC 2E42A 2H7HA 3BRTB 3NMDA 1WMKA 1M7LA 4YTPC 3H1KE
chains in the Genus database with same CATH topology
3H1LG 1PPJG 3L73G 1SQQG 1PP9G 3L72G 1NTMG 1P84H 3CX5H 1NTKG 3H1IG 3BCCG 1EZVG 1KYOH 1NU1G 2IBZG 1KB9H 3L75G 1BE3G 1SQBG 5KLVG 3CWBG 1L0NG 2BCCG 3H1JG 3L71G 3L70G 1L0LG 1BCCG 4U3FG 1SQPG 3L74G 3H1KG 2FYUG 1SQVG 3H1HG 3TGUG 1NTZG 3CXHH 2A06G 4PD4H 1SQXG 4D6TG 1BGYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L G;  1PPJ G;  3L73 G;  1SQQ G;  1PP9 G;  3L72 G;  1NTM G;  1P84 H;  3CX5 H;  1NTK G;  3H1I G;  3BCC G;  1EZV G;  1KYO H;  1NU1 G;  2IBZ G;  1KB9 H;  3L75 G;  1BE3 G;  1SQB G;  5KLV G;  3CWB G;  1L0N G;  2BCC G;  3H1J G;  3L71 G;  3L70 G;  1L0L G;  1BCC G;  4U3F G;  1SQP G;  3L74 G;  3H1K G;  2FYU G;  1SQV G;  3H1H G;  3TGU G;  1NTZ G;  3CXH H;  2A06 G;  4PD4 H;  1SQX G;  4D6T G;  1BGY G; 
#chains in the Genus database with same CATH topology
 1QVF O;  3AE7 C;  2BEQ D;  4AQR D;  1USE A;  1LTB C;  3M0A A;  3VP9 A;  1LT9 A;  4TT3 H;  1LP1 A;  5AW9 B;  4JYC A;  3SSU A;  1DH3 A;  2Y0E A;  1R5S A;  1VQ8 P;  1SQB D;  3L70 E;  1CSB A;  1SQP E;  1FZB A;  2YMY A;  1SQQ G;  4DT0 A;  2HPC A;  3N7N A;  2PFX A;  1ZLL A;  1NJI Q;  1NAY A;  3B8E B;  2E75 B;  3PRJ A;  3H1L D;  2C0X A;  1UII A;  1X79 B;  2IFN A;  3PLN A;  1OVR A;  1QGK B;  1BE3 D;  3GF7 A;  2XU6 A;  1SQV J;  3L71 D;  1JEK A;  3K5B A;  2FFD C;  1WT6 A;  5BU8 B;  3AEG C;  1FZA A;  1SQX E;  4D6T J;  2ZVN B;  1QLE D;  3C9I A;  2ZXX A;  4ASV A;  1NTK J;  4U3F G;  5APS A;  3D6Y A;  1BSN A;  1E79 H;  2RMZ A;  2I1J A;  2WPQ A;  4H13 C;  1ZR4 A;  2FFD B;  4N78 D;  1U57 A;  3GHG A;  2ZYG A;  5AW0 B;  2FYU E;  3TGU E;  1N7S A;  1G1J A;  3F5H A;  3L72 G;  1L0N K;  4AYC A;  3B5N A;  5AVV B;  1NO4 A;  1OWA A;  1Q86 Q;  4WY4 A;  4ASW A;  4BRY A;  2H43 A;  3MTU E;  1IO4 A;  1AVO A;  4L73 A;  3RK3 B;  2M5A A;  1L0L K;  2QJK C;  5CCH C;  1GL2 C;  5M1B A;  1HBW A;  4CPG A;  2KP8 A;  5AW3 B;  1XTC C;  2WPR A;  3AEE C;  1Y47 A;  1EC5 A;  1M1J A;  2ZAE B;  3H1K J;  2CPS A;  1KFM A;  1KB9 I;  4R4L A;  2XV5 A;  2QM7 A;  1KB9 E;  5KLV G;  3R4Y A;  2NPS C;  1P84 D;  2XND H;  3CCL P;  4IL6 E;  1JTH B;  2K1A A;  2G8Y A;  2KK7 A;  4IFD K;  2QJK B;  5KAF E;  3H32 B;  4PJ0 E;  3L70 J;  1SQP J;  4JQ0 D;  3H1H E;  2Z4E A;  3WUV A;  3BAS A;  5AW7 B;  2L5G B;  4IL6 H;  3CCM P;  1M57 D;  1Y9B A;  2E5Y A;  1VQM P;  5AW2 B;  5KAF H;  4PJ0 H;  1RE4 A;  1SFC C;  2OYI B;  2JKV A;  2NPS B;  3EFG A;  5KLI B;  3TF5 A;  4W80 A;  4PD4 D;  1NTM G;  3L37 A;  3G3Z A;  2KSE A;  2R3C A;  2GM4 A;  3MZW B;  1JY3 O;  2IYO A;  2WVR A;  1IK7 A;  2RKL A;  5KJ7 C;  2G3A A;  3CCJ P;  1TU3 F;  1RQU A;  1JY2 N;  1NTZ G;  3H1J E;  2Q9I A;  1MFZ A;  1BCC D;  5C39 A;  3BCC G;  4LLH A;  3L36 A;  3M91 A;  1BGY J;  2A45 G;  1LTA C;  1HVV A;  1J2J B;  3CX5 D;  2IZ0 A;  2N9Y B;  1L4A D;  3CCS P;  4BWN A;  1URQ C;  2ZFC A;  2GUV A;  3AE2 C;  5KLV D;  2FYU J;  2YKQ A;  3TGU J;  3TNU B;  2P67 A;  1URQ A;  3NTN A;  3L73 E;  4GOD A;  1NKZ B;  3QWO C;  3KXD A;  3VMA A;  1S9K E;  1VQK P;  2GUS A;  3D71 A;  2KSJ A;  3U1C A;  1ZRT E;  2KUB A;  2JWD A;  1DD3 A;  1GZL A;  3L75 E;  2AEJ A;  3AE5 C;  1RHZ B;  5AW8 B;  1MZ9 A;  4DJG A;  3NFQ A;  1T2K D;  2IPP A;  3AEC C;  4C7R A;  4B86 A;  1DIP A;  1IFP A;  4K35 A;  4I1L A;  4XA4 A;  1KIL C;  2R5B A;  3CCU P;  2W90 A;  3V6I A;  2B87 A;  1FDO A;  1KIL A;  2P2U A;  3B71 A;  1LTS C;  2AEF A;  4Y28 J;  5DJT B;  3PJS K;  3I56 P;  1MFT A;  2AEM A;  3H1H J;  3N4X A;  2OTK E;  4L75 A;  4H0L C;  1IZN B;  2KS1 A;  2OYO A;  4PV1 D;  5AW5 B;  3V2R A;  1S4X A;  5AVR B;  1SQQ K;  4O9B A;  1H8A A;  3CC4 P;  3IR9 A;  3S4R A;  2QJY C;  4HKZ H;  1IK9 A;  1NVO A;  1PP9 G;  1X0T A;  1SQV D;  2O1K A;  1EZV G;  3B5N D;  2PGD A;  1NHL A;  3VMY A;  1NTK D;  3TYY A;  3A3Y B;  3H1J J;  1BDD A;  1GK6 A;  4WB4 A;  2WIT A;  2H88 C;  1M8O B;  1OFC X;  4GT1 A;  2BAS A;  2Q5U A;  2KIK A;  1YHQ P;  1Y8A A;  1N7L A;  2ZT9 B;  4RKU J;  4M3L A;  2IDB A;  1G1I A;  4HH2 A;  5CJ0 A;  3E7K A;  1FC2 C;  1ZW0 A;  2OQQ A;  2K3R A;  3H1I E;  4L76 A;  2K9J B;  3D70 A;  3HRN A;  1IC2 A;  3HUS C;  3HD7 C;  1IFD A;  1LTJ B;  5TJH A;  1JY3 P;  4EYY Q;  2JWA A;  2YXQ B;  2OYH B;  4OH8 B;  4YPC A;  2AXT E;  5APX A;  5KKZ B;  4Y99 C;  1ZOY C;  1ZV8 A;  1SLQ A;  4HYT B;  3L75 J;  1PP9 D;  1OX3 A;  2QA4 P;  2BCC E;  2DW3 A;  2WWW A;  2N1T D;  1BGY G;  1W2E A;  3H1K D;  1YQ4 C;  2YMK A;  2E74 D;  3P8M C;  3HUS B;  1SQB G;  5GTH E;  1FZG A;  5CHX A;  1K8A Q;  1A02 F;  4Y99 B;  1HJB A;  3H1L G;  2QVA A;  1HJ0 A;  3L70 D;  3L35 A;  1SQP D;  2N9B A;  5KLV K;  1VPC A;  5GTH H;  1JB0 J;  3HE5 B;  2WSC H;  1S5L H;  4IFF A;  3L71 G;  1QVG O;  2BEZ F;  1FJK A;  2GA1 A;  4H44 D;  3A7O A;  1L0N E;  2W6J H;  2K88 A;  1FBM A;  1FZC B;  3PHL A;  3AED C;  2QM8 A;  1RF1 B;  3CI9 A;  3ITK A;  4XE5 B;  1EXJ A;  5E79 H;  1N73 B;  2A06 G;  1L0L E;  2JP3 A;  1NTM K;  1RF0 A;  1YTZ I;  4BXL A;  2E75 C;  2FBW C;  3O6Q B;  5CBO A;  2WT7 B;  3U1A A;  1PPJ E;  1BGY D;  2WPV B;  1NTZ K;  3IAO A;  1LTI C;  1JO5 A;  1FDI A;  1ZME C;  3CD6 P;  2HG5 D;  3RGU A;  3TGU D;  4EOT A;  3AE6 C;  3A0B E;  2V7Q H;  3H1I J;  1L4A B;  3WUU A;  3CWB E;  2KYV A;  3OW2 O;  3RK2 D;  3L74 E;  2J58 A;  1FZE A;  3IF4 A;  3HTK A;  3A0B H;  4JYB A;  2IBZ I;  4IFM A;  1LT9 B;  2JR8 A;  2PP6 A;  2FFD A;  1X22 A;  4R4M A;  2IBZ E;  2WQY C;  1NU1 J;  1PGO A;  1UIX A;  2BCC J;  3CCQ P;  1K05 A;  2ZT9 D;  5KAI E;  3V2N A;  3USS A;  1NKN A;  3VMX A;  2D2C B;  4WWI A;  2A06 D;  3G71 P;  2WSC J;  1D7M A;  1KB9 D;  3PH0 A;  5KTB A;  1VQ5 P;  2YNY A;  2QJP B;  3RK3 C;  2POH A;  5GTI E;  1QEX A;  5CMZ A;  3H1H D;  1Q7Y Q;  1FAV A;  5CCG C;  1KIL E;  2FXO A;  1LT1 A;  2E76 D;  1ZXG A;  1GW4 A;  1VQO P;  2WSE H;  4JF7 A;  2HOD A;  3T97 A;  1GDT A;  3CME P;  3KZI E;  2KLU A;  1BCC G;  2H89 C;  3CCR P;  4PV1 B;  1EDI A;  1BE3 E;  1GW3 A;  1LGH B;  2OGU A;  1OVV A;  5CCH A;  3H32 A;  1L0L J;  3AE4 C;  3FGA D;  1GL2 A;  1N7S B;  4EDF A;  3H1J D;  1YTZ T;  2IYP A;  3FXE A;  1A02 J;  3I5C A;  1XTG B;  3B5N B;  2OYI C;  2V7Q J;  5KLI C;  3Q3D A;  3CMA P;  4L74 A;  2OYI A;  1AA0 A;  2NPS A;  4W7Z A;  3VP8 A;  1K9M Q;  3GLM A;  3FWL A;  4JPZ B;  1KB9 H;  1NYH A;  5AW6 B;  4GDO A;  1FZF A;  2LXB A;  3M9B A;  3CWB J;  1S9K D;  1M1J B;  3L74 J;  1H0T B;  2VRS A;  2FXP A;  1M90 Q;  4YXW H;  1YIT P;  2V4H A;  3KYQ A;  1SFC A;  3VTP C;  1SQX J;  1ZRT D;  5K5G B;  1SQQ E;  2N1T C;  1IFN A;  3MUD C;  3CXH I;  3BRV B;  3L75 D;  1FOS F;  3SFE C;  1PZQ A;  1JMB A;  2RN0 A;  3CXH E;  1J1E B;  5KJ7 A;  5AVU B;  1PIX A;  3RL0 D;  4ZNC A;  1YI2 P;  3FWN A;  1IFI A;  3G9R A;  3Q5R A;  1QX8 A;  2Z5H A;  1G2C A;  3CXH H;  1JUN A;  2N1T B;  2OTL P;  4U3F E;  4OGQ D;  1RE3 C;  1VL2 A;  3F89 A;  2WSE J;  4MN4 C;  1VF5 B;  3Q2Y A;  1SQB K;  2E74 B;  1KN7 A;  4H44 C;  1VQ9 P;  1CI6 B;  5L8R J;  2ZYA A;  1SQV G;  2PAJ A;  4D6T G;  1FDM A;  2K37 A;  1NTK G;  3C1L A;  2LKM A;  1NU1 G;  1NH4 A;  1FOS E;  2D2C D;  1WRG A;  4RO0 A;  3L72 E;  3Q5S A;  1EXI A;  1YIJ P;  2Y0D A;  3SFD C;  2KNC B;  4H44 B;  2WSS H;  2M8R A;  1OXZ A;  4RES B;  2I8D A;  1JMM A;  1KV4 A;  2KXP B;  4GIF A;  4ZKP A;  1KTM A;  2YO3 A;  3AEF C;  1OW7 A;  4UB6 E;  3V4W A;  2SPZ A;  2L91 A;  2QEX P;  2K9Y A;  3RBZ A;  1HUC A;  3P8C E;  2Q7C A;  1NWQ A;  3MP7 B;  1PV3 A;  5APV A;  1KOR A;  1ZN5 A;  2O1J A;  3CL3 D;  2W6A A;  4UB6 H;  1S5L X;  4YXD C;  2WTY A;  3L4F A;  1KQS O;  5KLV E;  3H1I D;  1USD A;  1EDL A;  4C7N A;  1R5L A;  4EIJ A;  1N2D C;  1SVF A;  2Y9Z A;  1N7S D;  1KZU B;  2W8Z A;  2WMM A;  1SQQ J;  2ZT9 C;  4WVZ A;  4D6T D;  2XZR A;  4N6J A;  2B87 B;  2R44 A;  3H1K G;  4HB1 A;  4WY4 D;  3LID A;  3TK1 A;  1NU1 D;  3C8V A;  3RK2 B;  1PPJ G;  1RQV A;  2BCC D;  1J1D B;  5CBN A;  3M06 A;  3BAT A;  3IFM A;  4TLF A;  3JSV C;  1NTM E;  5B5E E;  3L70 G;  1SQP G;  2MJZ A;  1KQL A;  3KQG A;  1LTJ C;  2K9J A;  5CCH D;  2OYH C;  1YQ3 C;  4U3F J;  5KKZ C;  2M0B A;  2W6B A;  2UWJ E;  1NTZ E;  3MHV A;  3L73 J;  3CCE P;  2A45 I;  1HTL C;  1PGJ A;  3BCC E;  5APY A;  2R32 A;  1SQX G;  3D6Z A;  1VQL P;  3RK3 E;  3A0H E;  3FXD A;  2FYN B;  1X8Y A;  4NPD A;  3HUS A;  3HD7 A;  4IOI H;  1DEE G;  3L72 J;  3E1I A;  2WZ7 A;  5APU A;  2A45 H;  2E76 B;  3BVH A;  3OAK A;  4LC1 A;  3E1R A;  3A0H H;  1VF5 D;  1KYO I;  1EDJ A;  2AXT H;  1VQ6 P;  1OW8 A;  2JJL A;  1M56 D;  2HR3 A;  1KYO E;  3G6E P;  1HGV A;  3GW6 A;  1PPJ D;  2FYU G;  3AE8 C;  3TGU G;  1YJN P;  1FZC C;  2KZJ A;  5KJ7 D;  4AUW A;  2PRR A;  2H8P D;  3CC2 P;  1RF1 C;  1KYO H;  2P58 A;  3SWK A;  3WU2 E;  1N73 C;  3CCV P;  1T6A A;  1DD4 A;  1LTG C;  1LWU C;  3CWB D;  3MGN A;  5APQ A;  3L74 D;  1K73 Q;  1LNQ A;  3O6Q A;  1URQ D;  3WU2 H;  4ZKU A;  3U59 A;  2WT7 A;  1OW6 A;  1SQX D;  2FXM A;  1ZP0 C;  1GK4 A;  4DOJ A;  2IBZ D;  2QSI A;  2M3E A;  3RL0 C;  2QG4 A;  2Q3E A;  1MKM A;  4K3A A;  1FS0 E;  5BU5 A;  1LWU B;  2YIU B;  1EZV I;  3HE4 B;  1L4A C;  2I1K A;  1PP9 E;  1NTM J;  4KT0 J;  1IFM A;  1EZV E;  2O3J A;  3H1H G;  1AQ5 A;  1L4A A;  1JY2 O;  3M9Q A;  1LT9 C;  1NTZ J;  2FYU D;  1MUU A;  1JNM A;  3SWF A;  3RL0 B;  3ZDM A;  4IL6 X;  4GOE A;  3BCC J;  1S72 P;  1KIL D;  3V2P A;  1Q2N A;  4OGQ B;  2D2C C;  1JCC A;  2FYZ A;  4ZMD A;  4NPF X;  3QH9 A;  1N86 A;  2E5T A;  2Q6Q A;  1BDC A;  2KI7 B;  3WUT A;  3P7K A;  3NXS A;  3S9O A;  3CPW O;  1SQV K;  3H1J G;  1LP1 B;  2QJP C;  4H0L D;  2JDI H;  1T2K C;  5AW1 B;  1VDF A;  1U7J A;  5AVX B;  1GD2 E;  2IX7 C;  1YYC A;  2IZ1 A;  4EI2 A;  1DX7 A;  1NTK K;  1NU1 K;  4I7Z C;  2HPC B;  2FKW B;  5AW4 B;  1VQN P;  5AVT B;  1NAF A;  5AVQ B;  5KAI H;  2ZJS E;  3L73 G;  3HTK B;  3M9H A;  1BGY E;  4PV1 C;  2YO2 A;  3GHG C;  1HF9 A;  1GU5 A;  5AVY B;  4I7Z B;  3EWK A;  1N7S C;  1CZQ A;  1SQB E;  1DEB A;  5CCG A;  1L0N J;  3B5N C;  5GTI H;  5AVZ B;  2Y9Y A;  1JOC A;  4WY4 C;  3L75 G;  3H1L E;  1YJW P;  3SWY A;  2J5U A;  3MD0 A;  1SQQ D;  4H13 B;  1HGZ A;  1JTH A;  3GHG B;  2NZ2 A;  3L71 E;  3FX0 A;  3GF3 A;  1FU1 A;  2WPS A;  1AV1 A;  1M1K Q;  3CXH D;  3ABV C;  2C0W A;  3HD7 D;  2ITA A;  3KZI H;  1ZR2 A;  1PGP A;  3P32 A;  1M1J C;  1PP9 J;  2P1J A;  4WY4 B;  4BRY B;  3V5B A;  1GMJ A;  1EQ7 A;  2NRG A;  2HOD B;  2Y0C A;  2ZVO B;  1H0T A;  3PTZ A;  4U3F D;  3TDK A;  1Q81 Q;  3T97 B;  2A06 E;  2XKM A;  2RH0 A;  1R8E A;  2ZYD A;  2M5A B;  1SQP K;  4N78 E;  3L73 D;  4LGD E;  2Z5I A;  1J1E C;  1Q82 Q;  1GL2 B;  3KDP B;  1AFO A;  2YKP A;  1QL1 A;  3S1K A;  1CW5 A;  1RE4 C;  4C46 A;  4QMA A;  1SQX K;  1VF5 C;  3L72 D;  3LIE A;  5APT A;  1L2P A;  2E74 C;  2N1T A;  3W67 A;  3MUD A;  2CK3 H;  3EFF K;  2CPB A;  3TNU A;  3GG2 A;  2KLV A;  2ZXE B;  2C9L Y;  1JY2 P;  5DJU B;  1CI6 A;  3AEA C;  1OVU A;  3AE3 C;  2LR2 A;  3P8C D;  3Q5P A;  1K04 A;  3JC2 2;  1P84 I;  2IFM A;  1SFC B;  1RH5 B;  3H1I G;  1Q90 D;  1P84 E;  5AVS B;  2B9B A;  1PGQ A;  2FYU K;  1RE3 A;  3AEB C;  2E75 D;  1HWT C;  1SQB J;  2KNC A;  1KFN A;  2YXR B;  3AE9 C;  1P84 H;  1GU4 A;  4NPE A;  3V4Q A;  3H1L J;  3JCU E;  1AJY A;  2R3S A;  3W68 A;  2BCC G;  4PD4 I;  1BE3 J;  1IFJ A;  1G2C B;  3TSI A;  4W7Y A;  4A7P A;  2LXC B;  3L71 J;  2YKO A;  2KOG A;  3B4S A;  4PD4 E;  2O01 N;  4U7J A;  3OA7 A;  1URQ B;  4WBA A;  3JCU H;  1S3J A;  1BSH A;  3CLQ A;  1NTM D;  1H88 A;  3Q1M A;  4PD4 H;  1BCC E;  1T8Z A;  5EFW B;  5TIS E;  3PP5 A;  3CX5 I;  1AVY A;  2WSF H;  5APW A;  1NTZ D;  3G4S P;  3CX5 E;  3A2A A;  2Q1K A;  5CJ4 A;  1L0N G;  3A5T A;  3H25 A;  3RK2 C;  1U7M A;  2XDJ A;  3KPE A;  2FY8 A;  4H13 D;  3BCC D;  1J1D C;  1SS1 A;  1FJP A;  5TIS H;  1YBK A;  2P10 A;  3UIA A;  3CX5 H;  2QRX A;  3EQ2 A;  3RK3 D;  2C9N Y;  3MIW A;  1OIP A;  4Z1M H;  4GKG A;  3M0D C;  1VQ7 P;  2OTJ P;  1T3J A;  1L0L G;  4RJT A;  1X9V A;  1KIL B;  2R5D A;  5CCG D;  3O8Z A;  2J59 M;  1KC8 Q;  3M0D A;  1W5C E;  3WMM 0;  5B66 E;  3GMA A;  2AXC A;  3LW5 H;  3IN6 A;  2JO1 A;  1LJ2 A;  1N8R Q;  2KS1 B;  3H6P A;  4OVN F;  4H0L B;  1KYO D;  3R2P A;  1W2B O;  1MV8 A;  2JEE A;  2HYN A;  4C7N B;  2KZI A;  2O01 H;  1VQ4 P;  1IJD B;  1GL2 D;  2FYN C;  5B66 H;  4KJM A;  3RBX A;  5H2F E;  1LTJ A;  3VMZ A;  4JBZ A;  2OYH A;  1S2E A;  3VOP A;  1EDK A;  2E76 C;  2QJY B;  4DZO A;  3CWB G;  3I55 P;  5B5E H;  3L74 G;  1PFI A;  1T3U A;  2NPS D;  5H2F H;  1L0N D;  4UB8 E;  1JCD A;  2HFE D;  2IBZ G;  1JY3 N;  1KD1 Q;  1AQT A;  2M3B A;  1SP4 A;  1JM0 A;  3KHU A;  2B88 A;  4OWF A;  2Q3I A;  2KB7 P;  1NOH A;  1GTW A;  1PL5 A;  1SQV E;  4UB8 H;  1L0L D;  1SFC D;  4N3Y B;  2WSF J;  4D6T E;  1FE6 A;  4XFJ A;  2P7J A;  4I6M C;  3HE5 A;  4GOF A;  1NTK E;  1HH0 A;  1NU1 E;  5AVW B;  1EZV D;  1LTT C;  1YJ9 P;  3VN0 A;  1BCC J;  1Z56 A;  1RY3 A;  1KQG B;  1OMI A;  3HD7 B;  1E5W A;  1FZC A;  4HJG H;  1S5L E;  1KMI Z;  1OZH A;  3VYI A;  1RF1 A;  2W83 C;  5KLV J;  1N73 A;  3RL0 g;  3II6 A;  2YIU C;  4DCK A;  4I2L C;  2HLO A;  2XNX A;  1LWU A;  1BE3 G;  3LW5 J;  4KHX A;  1KQF B;  3HE4 A;  3V2Q A;  2W27 A;  3CC7 P;  2E43 A;  1NGM B;  1QL2 A;  5E79 E;  2O01 J;  5BVZ A;  2OAR A;  3AE1 C;  1H89 A;  2B89 A;  1S1C X;  3OJA B;  2MKV A;  2QE7 H;  1RF0 C;  1VQP P;  2QIW A;  4OGQ C;  2E42 A;  2H7H A;  3BRT B;  3NMD A;  1WMK A;  1M7L A;  4YTP C;  3H1K E; 
#chains in the Genus database with same CATH homology
 3H1L G;  1PPJ G;  3L73 G;  1SQQ G;  1PP9 G;  3L72 G;  1NTM G;  1P84 H;  3CX5 H;  1NTK G;  3H1I G;  3BCC G;  1EZV G;  1KYO H;  1NU1 G;  2IBZ G;  1KB9 H;  3L75 G;  1BE3 G;  1SQB G;  5KLV G;  3CWB G;  1L0N G;  2BCC G;  3H1J G;  3L71 G;  3L70 G;  1L0L G;  1BCC G;  4U3F G;  1SQP G;  3L74 G;  3H1K G;  2FYU G;  1SQV G;  3H1H G;  3TGU G;  1NTZ G;  3CXH H;  2A06 G;  4PD4 H;  1SQX G;  4D6T G;  1BGY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...