3H1HG

Cytochrome bc1 complex from chicken
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1hG00
1SQXG 3H1KG 4PD4H 1SQVG 2IBZG 2FYUG 1BE3G 1SQBG 3H1HG 3CX5H 3H1LG 1BGYG 1P84H 4D6TG 1SQPG 1NTMG 2A06G 5KLVG 3H1JG 3BCCG 3CXHH 1NU1G 1SQQG 3L75G 3CWBG 1NTZG 1PPJG 3H1IG 3TGUG 3L70G 4U3FG 3L72G 3L74G 3L73G 3L71G 1KB9H 1BCCG 1L0NG 1L0LG 1PP9G 1KYOH 2BCCG 1EZVG 1NTKG
chains in the Genus database with same CATH superfamily
1NU1E 1PGJA 5KKZC 3TF5A 3PH0A 3D70A 2IBZG 1N73C 1VQ6P 1S5LH 3FWNA 3MD0A 2OYIC 3HE5A 1SQXE 2WWWA 3AE9C 1VQ9P 2M3EA 1R8EA 1NTME 3B5NB 4QMAA 1AFOA 3CCMP 2YKPA 5AVRB 3L73J 3B8EB 2Q3EA 1JMMA 1FE6A 2WPVB 5B66H 3Q1MA 1KILB 2PGDA 5KJ7D 2G8YA 1URQA 2R3SA 2N9BA 4D6TJ 4HH2A 4EI2A 1ZOYC 1LNQA 3NFQA 2WSEJ 3QWOC 1LTJC 1ZMEC 4YPCA 3L75D 3H1HE 1J1DB 2Z4EA 2ZT9C 1GDTA 1PPJD 5CCHD 2QM8A 2IPPA 3H1JE 1QX8A 2K9JB 1OVVA 1Q81Q 1VF5C 1VL2A 1JOCA 2QRXA 3P8CE 5KLVD 3JCUE 3H1JJ 4H13B 2WSFH 2QG4A 5C39A 3VTPC 4WWIA 5KJ7A 1T3UA 2ZVNB 4KT0J 3B4SA 1D7MA 1X79B 3M06A 4XE5B 1YYCA 4ZNCA 5APTA 1JY2N 5AVVB 5AW3B 1FZBA 1IFJA 2FYUG 2JKVA 4GODA 3V6IA 1NTMK 1CI6B 2L5GB 3H1HG 3L71E 2ZYAA 5KLIC 3VMAA 2NPSC 3H1LG 3HE4B 4Y99C 2QM7A 4OVNF 1SQBK 1KILA 2A06G 5E79H 1NTMJ 5APVA 3CLQA 2P7JA 2P67A 3EQ2A 1S1CX 1HGZA 2FYZA 1VQ5P 2NRGA 1EXIA 2BEQD 1HUCA 1JY3N 1RY3A 1IFNA 1S3JA 2RMZA 3U1AA 3RK2D 5KTBA 1RF1C 1NU1J 3A0HH 2C0XA 2FXPA 2RN0A 1SQVK 3AE8C 3KPEA 3L71G 1KORA 3M91A 1NTZJ 1ZXGA 2AEMA 2CPSA 2P1JA 4H0LC 1OMIA 3G71P 3D71A 3CCEP 1KTMA 1ZR2A 1BGYE 3QH9A 2Y9YA 2W90A 4D6TD 4PD4E 1NKZB 1RH5B 2KS1A 2H89C 4WB4A 3NMDA 1GMJA 2KI7B 3AEAC 2J5UA 1RE3C 3PLNA 5AW7B 2P2UA 1SQVE 1BDCA 1K73Q 1PGPA 3HD7B 2QIWA 1WRGA 2KNCA 2JP3A 2KP8A 3RBXA 5H2FE 1TU3F 4RO0A 3CMEP 1GW4A 1YJ9P 1EDLA 4HJGH 3H25A 4PV1C 1IFIA 1PPJG 1KFNA 2B87B 1GL2A 2O1JA 4W7YA 3CX5E 3H1IG 1USDA 2H43A 1DIPA 3IFMA 4I7ZC 4ZKUA 1URQD 1M57D 1VQLP 3E1RA 1QEXA 3I55P 4AQRD 2A06D 1NTMD 1KILE 2YKQA 1ZR4A 1HTLC 2IFMA 1M90Q 3KZIH 1BGYD 5TJHA 4GDOA 1PP9E 4K35A 3MZWB 3FXDA 1N2DC 1N8RQ 1H0TA 1NAYA 1EDIA 1Z56A 3E7KA 3B5NC 3BASA 4O9BA 4BWNA 4OGQD 1PIXA 2KLUA 3PHLA 3MP7B 2ITAA 4K3AA 2E75D 1LP1A 1K04A 2YMYA 1BE3E 2N1TD 2ZXEB 3EFGA 3MIWA 1PL5A 2W6AA 2YIUB 3A2AA 1GTWA 1OX3A 3GF7A 2A45I 1KQFB 1FU1A 1NVOA 3KQGA 3RL0g 3OW2O 3Q2YA 2IYPA 2XDJA 4NPDA 1URQC 4AUWA 1JCDA 4IFMA 2OQQA 4IL6E 3L71D 2HG5D 4IL6H 3PP5A 2K9YA 2AEJA 1H8AA 3M9QA 2BASA 3M0AA 4GOFA 1NTKJ 5CBOA 2MJZA 4EOTA 1DEEG 2FXMA 5EFWB 2IBZI 5DJUB 4TT3H 3T97A 2QE7H 3A7OA 3AEBC 1KQGB 1LTBC 1NKNA 2BCCG 2Z5IA 2C9LY 1NTKE 1L4AD 3H1HD 2WPRA 4H0LB 1EDKA 1YJWP 4ASVA 2M0BA 3H1KG 3Q5RA 1JEKA 1SQXD 1JUNA 1VQMP 3E1IA 3L74E 3L72E 1YTZT 3F89A 2WMMA 3S9OA 3CWBJ 4C7NA 1CI6A 5AW4B 4L75A 4N3YB 3ABVC 4CPGA 2M5AA 3CC2P 3UIAA 1MFZA 2AXTE 2HR3A 4WY4C 3IF4A 2AXTH 2XKMA 3TNUB 1SQQK 3F5HA 4PJ0E 3L70E 1H88A 2W6JH 1L0NK 2O01J 2V4HA 3FXEA 1NTZD 2NZ2A 3L74G 1ZW0A 3A3YB 1SFCC 1MV8A 2ZT9D 3CCJP 1PP9J 1DH3A 1SQPE 1L0LG 4WY4B 3L35A 5B5EH 4H13C 1BDDA 5B5EE 1SS1A 5KJ7C 3V2QA 1VPCA 2K37A 1NHLA 2WZ7A 2SPZA 1SQVG 2RH0A 1KQLA 1FDOA 1NU1K 1RF0C 2IBZD 2KK7A 3ITKA 5TISE 3WUUA 2FYNB 1SFCA 2NPSA 1SQPK 3AEFC 4JPZB 5TISH 1XTCC 3RGUA 2N1TC 1BCCD 1LT9B 1SLQA 2FYUE 2O01H 3VMXA 4UB6H 4D6TG 1Y9BA 1L0LE 1T6AA 1SP4A 2Q6QA 1Q2NA 1LTTC 1NU1G 3HUSC 4GT1A 1M56D 1PZQA 3L75G 4MN4C 2MKVA 1SQQE 4JF7A 4RESB 4YTPC 2HYNA 4OH8B 1YHQP 1FOSF 1U7MA 5AVZB 2D2CC 2ZFCA 1KV4A 3LIDA 3BRTB 4WBAA 3CWBD 2OYIB 2C0WA 1N7SB 5AVXB 1R5LA 3CXHE 3V2NA 4TLFA 1PGOA 3C1LA 5AVWB 3O6QB 1BCCE 1BGYJ 1KN7A 1PP9G 1L0NG 2DW3A 2A06E 3P8CD 3TK1A 5KLVE 1CSBA 2WT7B 1FS0E 2OARA 1OW6A 1UIXA 1ZP0C 3L75E 1L0LK 4BRYA 3CCSP 1FZCB 1FDMA 3T97B 1PGQA 5AW2B 5CCGC 2LKMA 2POHA 5AW9B 2GUVA 3OAKA 2LR2A 2R32A 2VRSA 3CX5H 1IFMA 3PTZA 1S5LE 2FFDC 1VQKP 1NTKD 2KIKA 2YIUC 4R4MA 1FZCA 1N7SC 2K9JA 1VQ4P 1RF1A 3AE3C 1EXJA 5KLVG 1GZLA 1DD3A 2L91A 3RL0D 2I1KA 3L71J 3G3ZA 3CWBG 2JEEA 3O6QA 1NTZG 1FAVA 5KAIH 5KAFH 4NPEA 1T3JA 4DOJA 1X0TA 3GF3A 4U3FJ 2YKOA 4H44C 1BSHA 2QVAA 1EQ7A 1YQ4C 2QJKB 3TDKA 1GU4A 3N4XA 5APSA 3H1LE 3VP9A 4PD4D 1KYOD 2OYHA 1NU1D 1W2BO 1NJIQ 1JCCA 2WITA 2ZVOB 5AVYB 3LW5J 4DZOA 2ZXXA 4D6TE 1FZEA 1NTKG 2E43A 3H1HJ 4GIFA 1JTHB 2JR8A 1SFCB 1Y47A 2QJYC 2B89A 1LWUC 4U3FE 1Y8AA 2FKWB 1OXZA 3BVHA 2ZAEB 3VP8A 2JWAA 4ASWA 1OZHA 1BGYG 1IFPA 2HODA 1GK6A 2YMKA 1EDJA 3C9IA 1GL2B 3B5ND 3H1JG 2JO1A 4WY4A 4N78D 3Q5SA 3BRVB 2W8ZA 3MUDA 1UIIA 4DCKA 5E79E 1LGHB 3HUSA 2OTKE 2YNYA 3SWFA 3CCUP 2OYHB 5CMZA 3L70G 2OGUA 3H1ID 4RKUJ 2R5BA 4U3FD 3V5BA 2WTYA 3V2RA 1LTSC 1VF5D 3CL3D 4U7JA 3CCQP 1KB9D 2E76C 1CZQA 2UWJE 3A0HE 1S72P 2OYIA 2Q9IA 4M3LA 3D6YA 2YO3A 1IC2A 2BCCJ 1SQPD 1PPJE 2M3BA 1NGMB 3OA7A 1RF1B 2E42A 2IX7C 4L74A 2ZYGA 4LLHA 2HLOA 1KYOI 1VDFA 1J1EC 3SFDC 2H8PD 3H1KD 4PD4H 5K5GB 1OIPA 2E76D 4W80A 1KFMA 4A7PA 4JBZA 3W67A 1ZV8A 2HFED 4C46A 2PRRA 1X8YA 3AE7C 2NPSB 1VQ8P 5KLIB 3AE1C 1J2JB 1M8OB 1XTGB 2FYUJ 2Y0EA 2XNXA 2WT7A 1JM0A 2FXOA 3WU2E 1YI2P 2O1KA 3S1KA 1H0TB 3L37A 3O8ZA 2W83C 1L2PA 1URQB 2A45G 2E5YA 3H1KE 3NXSA 3TGUJ 1PFIA 1HJBA 1VQNP 3RK3D 1YJNP 1SQBE 1VF5B 3MTUE 1NWQA 1M1JC 2WSCH 2E74B 1KB9H 1J1DC 1JTHA 2J59M 2K1AA 2RKLA 2KYVA 1KQSO 2WSCJ 1T2KC 1JO5A 1AVOA 1OW7A 3AE2C 1KILC 4UB6E 1BE3D 5KAIE 3U1CA 2YXQB 2WSFJ 3H1KJ 2BEZF 2E5TA 1ZN5A 2QEXP 1FDIA 1M7LA 3B71A 1SQBG 2OYOA 3BATA 4I7ZB 1FBMA 3JSVC 3ZDMA 1JMBA 1KZUB 1L0LD 2BCCD 3KHUA 1SQPG 4PV1B 1NTMG 1AA0A 2KUBA 2FFDB 3CD6P 3CXHH 5CCGA 1Q90D 3VOPA 1KB9I 1HF9A 2CPBA 4R4LA 4WVZA 5KKZB 3MUDC 1YBKA 3I5CA 3CMAP 1FZCC 3A0BE 1S4XA 3VN0A 3HTKA 1LTIC 1CW5A 2FYUK 3A0BH 5AVTB 3TGUD 2FY8A 1H89A 4ZMDA 4IOIH 3CCLP 4BXLA 2IDBA 5CCGD 5CJ4A 1QVGO 2HODB 3HD7C 1GK4A 1A02J 3H32B 1KYOH 3KYQA 2JDIH 3KXDA 2G3AA 1NO4A 4BRYB 2K88A 1OVUA 1S5LX 1MKMA 4UB8H 2XNDH 2J58A 3GHGC 2O01N 5CHXA 3OJAB 3K5BA 4DJGA 1SQVD 5KAFE 2FFDA 1BE3G 1LTAC 3KDPB 3HE4A 5APQA 3SFEC 2E75B 3G6EP 2N1TB 1HGVA 1S2EA 3GW6A 1A02F 4C7RA 5B66E 2YXRB 3BCCG 1JY2P 1FJKA 1PV3A 2WSSH 2IYOA 4HYTB 3U59A 2WPQA 1BE3J 2GUSA 2CK3H 1NTZK 1SVFA 3IAOA 3L74D 2WVRA 4Y99B 2HPCB 2PP6A 3RK2B 1NH4A 1M1JB 3AEEC 3H1IE 1YITP 1BSNA 3MGNA 4RJTA 2H88C 1G2CB 1IK9A 4WY4D 2WQYC 1E79H 1AV1A 1JY3P 1L0NJ 1X22A 2KZIA 4N78E 1GU5A 4W7ZA 3AEDC 1G1JA 5APYA 2KLVA 3WU2H 3NTNA 4PD4I 1FZGA 1IO4A 1AQ5A 1YQ3C 3TGUE 1SFCD 3D6ZA 5AW1B 2B88A 5AVQB 3SWYA 3RK2C 1IJDB 1LJ2A 2QA4P 3LIEA 3IN6A 4IFFA 2ZYDA 3CXHD 4ZKPA 3L73D 5GTHE 1N73A 5L8RJ 4HB1A 3V4WA 1VQOP 2LXBA 5GTHH 2AEFA 5GTIH 4U3FG 4C7NB 5GTIE 1NOHA 3A5TA 3L4FA 1FJPA 4L76A 5AW0B 1N73B 1K9MQ 4DT0A 5BU5A 4YXWH 2OTJP 1T2KD 2KSJA 1N86A 1LT9A 5KLVJ 2Y0CA 1BCCJ 3IR9A 1NTZE 3L36A 2QJPB 1USEA 3P8MC 5CBNA 2Y0DA 1SQBD 3II6A 1SQXG 1JNMA 3HD7A 5BVZA 3HE5B 1DD4A 1DEBA 1S9KE 1QL1A 1OFCX 1ZRTE 1N7SA 4N6JA 1U7JA 3AEGC 1L0ND 2QJYB 3W68A 1T8ZA 1G2CA 1Q86Q 1KYOE 3EFFK 3H32A 1N7LA 4JYCA 3RL0B 1IZNB 1SQQG 2KB7P 2YO2A 3L72D 1QL2A 4GKGA 1KB9E 1OW8A 1R5SA 5APWA 2P10A 1FC2C 4XFJA 2M8RA 1VQPP 1LP1B 5CCHC 1ZLLA 3FGAD 5AVSB 3H6PA 3L73G 1N7SD 2D2CD 5DJTB 2Q7CA 3G4SP 1SQQD 1HVVA 1L0NE 2FYNC 2XV5A 3AE4C 5APXA 4H13D 3CCRP 1W2EA 1OWAA 3CX5I 1RHZB 2IFNA 1HH0A 3M9HA 1HWTC 1ZRTD 1LTGC 3FX0A 3PJSK 4KHXA 5AW5B 1LT1A 3H1LJ 3H1IJ 4GOEA 2E74C 2IZ1A 5M1BA 2Y9ZA 3L70J 3PRJA 4I2LC 3WUVA 3MHVA 3TYYA 1FZFA 3CC7P 2IBZE 2KSEA 2KS1B 3AE6C 4OGQB 4L73A 3JCUH 3S4RA 1P84E 3L73E 1MZ9A 1NAFA 1P84H 2P58A 3R2PA 1LTJA 2B9BA 2R44A 2W6BA 2XU6A 1JY3O 3GG2A 1RE3A 5AW8B 2C9NY 2K3RA 2QJPC 1EZVE 1OVRA 3CWBE 1KC8Q 3L72J 3JC22 3L74J 1X9VA 1SQXJ 1HJ0A 3CC4P 4HKZH 2W27A 1M1KQ 2JJLA 2N1TA 4LGDE 2KNCB 4UB8E 3CXHI 3SWKA 2FBWC 1WMKA 3L75J 3BCCD 3R4YA 1J1EB 1KD1Q 1W5CE 2D2CB 2KOGA 2Q3IA 2PAJA 2A45H 1RE4C 1EZVG 1EZVI 1RQVA 3AECC 2R3CA 2AXCA 3B5NA 3GHGA 3HUSB 1WT6A 4I1LA 2E76B 5KLVK 1MUUA 1LT9C 3C8VA 1RQUA 4H0LD 3TSIA 3USSA 4Z1MH 4Y28J 3V4QA 3HD7D 2I1JA 1FOSE 4H44D 1P84I 2XZRA 1SQQJ 5AW6B 2R5DA 3HTKB 1U57A 5APUA 2OYHC 3LW5H 4JQ0D 4LC1A 1L0LJ 2GA1A 1GL2D 3WUTA 1G1IA 2KXPB 3P7KA 1NYHA 4PJ0H 1GL2C 5CJ0A 3RBZA 3CPWO 1EC5A 1S9KD 3BCCE 4EDFA 3AE5C 2WSEH 3CX5D 4AYCA 4EYYQ 1E5WA 1AVYA 1QGKB 1JB0J 2V7QJ 3GMAA 3CCVP 1YTZI 4OGQC 5H2FH 3I56P 1DX7A 1LWUB 1KMIZ 1GW3A 2QSIA 4EIJA 1SQXK 1LWUA 3HRNA 3FWLA 3CI9A 3VMZA 5CCHA 2ZT9B 3GLMA 1BCCG 4YXDC 1SQPJ 3M9BA 2H7HA 1HBWA 1LTJB 1QVFO 2JWDA 4IFDK 3VMYA 2FYUD 1SQBJ 3N7NA 1QLED 1GD2E 5BU8B 1Q7YQ 2E75C 1YIJP 3WMM0 2V7QH 2QJKC 1MFTA 3BCCJ 3KZIE 3V2PA 4B86A 4H44B 3Q3DA 1VQ7P 2GM4A 1M1JA 1AJYA 1RF0A 1FZAA 1EZVD 1K05A 4PV1D 2NPSD 1K8AQ 1JY2O 2HPCA 4NPFX 2B87A 1PP9D 2O3JA 1RE4A 4JYBA 2ZJSE 1KILD 2I8DA 2N9YB 1P84D 2WPSA 2Q5UA 2Q1KA 3GHGB 1SQVJ 1L4AC 1IFDA 2PFXA 3M0DC 5AVUB 3RL0C 3TGUG 3L70D 2LXCB 1Q82Q 3G9RA 3L72G 3RK3B 3TNUA 3P32A 4IL6X 4OWFA 3Q5PA 2Z5HA 1IK7A 2IZ0A 2BCCE 2KZJA 2OTLP 2E74D 2M5AB 1AQTA 1NTKK 3H1JD 3RK3C 3SSUA 4KJMA 1L4AA 3M0DA 4I6MC 3VYIA 3H1LD 4XA4A 1L4AB 3EWKA 3RK3E
chains in the Genus database with same CATH topology
1SQXG 3H1KG 4PD4H 1SQVG 2IBZG 2FYUG 1BE3G 1SQBG 3H1HG 3CX5H 3H1LG 1BGYG 1P84H 4D6TG 1SQPG 1NTMG 2A06G 5KLVG 3H1JG 3BCCG 3CXHH 1NU1G 1SQQG 3L75G 3CWBG 1NTZG 1PPJG 3H1IG 3TGUG 3L70G 4U3FG 3L72G 3L74G 3L73G 3L71G 1KB9H 1BCCG 1L0NG 1L0LG 1PP9G 1KYOH 2BCCG 1EZVG 1NTKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX G;  3H1K G;  4PD4 H;  1SQV G;  2IBZ G;  2FYU G;  1BE3 G;  1SQB G;  3H1H G;  3CX5 H;  3H1L G;  1BGY G;  1P84 H;  4D6T G;  1SQP G;  1NTM G;  2A06 G;  5KLV G;  3H1J G;  3BCC G;  3CXH H;  1NU1 G;  1SQQ G;  3L75 G;  3CWB G;  1NTZ G;  1PPJ G;  3H1I G;  3TGU G;  3L70 G;  4U3F G;  3L72 G;  3L74 G;  3L73 G;  3L71 G;  1KB9 H;  1BCC G;  1L0N G;  1L0L G;  1PP9 G;  1KYO H;  2BCC G;  1EZV G;  1NTK G; 
#chains in the Genus database with same CATH topology
 1NU1 E;  1PGJ A;  5KKZ C;  3TF5 A;  3PH0 A;  3D70 A;  2IBZ G;  1N73 C;  1VQ6 P;  1S5L H;  3FWN A;  3MD0 A;  2OYI C;  3HE5 A;  1SQX E;  2WWW A;  3AE9 C;  1VQ9 P;  2M3E A;  1R8E A;  1NTM E;  3B5N B;  4QMA A;  1AFO A;  3CCM P;  2YKP A;  5AVR B;  3L73 J;  3B8E B;  2Q3E A;  1JMM A;  1FE6 A;  2WPV B;  5B66 H;  3Q1M A;  1KIL B;  2PGD A;  5KJ7 D;  2G8Y A;  1URQ A;  2R3S A;  2N9B A;  4D6T J;  4HH2 A;  4EI2 A;  1ZOY C;  1LNQ A;  3NFQ A;  2WSE J;  3QWO C;  1LTJ C;  1ZME C;  4YPC A;  3L75 D;  3H1H E;  1J1D B;  2Z4E A;  2ZT9 C;  1GDT A;  1PPJ D;  5CCH D;  2QM8 A;  2IPP A;  3H1J E;  1QX8 A;  2K9J B;  1OVV A;  1Q81 Q;  1VF5 C;  1VL2 A;  1JOC A;  2QRX A;  3P8C E;  5KLV D;  3JCU E;  3H1J J;  4H13 B;  2WSF H;  2QG4 A;  5C39 A;  3VTP C;  4WWI A;  5KJ7 A;  1T3U A;  2ZVN B;  4KT0 J;  3B4S A;  1D7M A;  1X79 B;  3M06 A;  4XE5 B;  1YYC A;  4ZNC A;  5APT A;  1JY2 N;  5AVV B;  5AW3 B;  1FZB A;  1IFJ A;  2FYU G;  2JKV A;  4GOD A;  3V6I A;  1NTM K;  1CI6 B;  2L5G B;  3H1H G;  3L71 E;  2ZYA A;  5KLI C;  3VMA A;  2NPS C;  3H1L G;  3HE4 B;  4Y99 C;  2QM7 A;  4OVN F;  1SQB K;  1KIL A;  2A06 G;  5E79 H;  1NTM J;  5APV A;  3CLQ A;  2P7J A;  2P67 A;  3EQ2 A;  1S1C X;  1HGZ A;  2FYZ A;  1VQ5 P;  2NRG A;  1EXI A;  2BEQ D;  1HUC A;  1JY3 N;  1RY3 A;  1IFN A;  1S3J A;  2RMZ A;  3U1A A;  3RK2 D;  5KTB A;  1RF1 C;  1NU1 J;  3A0H H;  2C0X A;  2FXP A;  2RN0 A;  1SQV K;  3AE8 C;  3KPE A;  3L71 G;  1KOR A;  3M91 A;  1NTZ J;  1ZXG A;  2AEM A;  2CPS A;  2P1J A;  4H0L C;  1OMI A;  3G71 P;  3D71 A;  3CCE P;  1KTM A;  1ZR2 A;  1BGY E;  3QH9 A;  2Y9Y A;  2W90 A;  4D6T D;  4PD4 E;  1NKZ B;  1RH5 B;  2KS1 A;  2H89 C;  4WB4 A;  3NMD A;  1GMJ A;  2KI7 B;  3AEA C;  2J5U A;  1RE3 C;  3PLN A;  5AW7 B;  2P2U A;  1SQV E;  1BDC A;  1K73 Q;  1PGP A;  3HD7 B;  2QIW A;  1WRG A;  2KNC A;  2JP3 A;  2KP8 A;  3RBX A;  5H2F E;  1TU3 F;  4RO0 A;  3CME P;  1GW4 A;  1YJ9 P;  1EDL A;  4HJG H;  3H25 A;  4PV1 C;  1IFI A;  1PPJ G;  1KFN A;  2B87 B;  1GL2 A;  2O1J A;  4W7Y A;  3CX5 E;  3H1I G;  1USD A;  2H43 A;  1DIP A;  3IFM A;  4I7Z C;  4ZKU A;  1URQ D;  1M57 D;  1VQL P;  3E1R A;  1QEX A;  3I55 P;  4AQR D;  2A06 D;  1NTM D;  1KIL E;  2YKQ A;  1ZR4 A;  1HTL C;  2IFM A;  1M90 Q;  3KZI H;  1BGY D;  5TJH A;  4GDO A;  1PP9 E;  4K35 A;  3MZW B;  3FXD A;  1N2D C;  1N8R Q;  1H0T A;  1NAY A;  1EDI A;  1Z56 A;  3E7K A;  3B5N C;  3BAS A;  4O9B A;  4BWN A;  4OGQ D;  1PIX A;  2KLU A;  3PHL A;  3MP7 B;  2ITA A;  4K3A A;  2E75 D;  1LP1 A;  1K04 A;  2YMY A;  1BE3 E;  2N1T D;  2ZXE B;  3EFG A;  3MIW A;  1PL5 A;  2W6A A;  2YIU B;  3A2A A;  1GTW A;  1OX3 A;  3GF7 A;  2A45 I;  1KQF B;  1FU1 A;  1NVO A;  3KQG A;  3RL0 g;  3OW2 O;  3Q2Y A;  2IYP A;  2XDJ A;  4NPD A;  1URQ C;  4AUW A;  1JCD A;  4IFM A;  2OQQ A;  4IL6 E;  3L71 D;  2HG5 D;  4IL6 H;  3PP5 A;  2K9Y A;  2AEJ A;  1H8A A;  3M9Q A;  2BAS A;  3M0A A;  4GOF A;  1NTK J;  5CBO A;  2MJZ A;  4EOT A;  1DEE G;  2FXM A;  5EFW B;  2IBZ I;  5DJU B;  4TT3 H;  3T97 A;  2QE7 H;  3A7O A;  3AEB C;  1KQG B;  1LTB C;  1NKN A;  2BCC G;  2Z5I A;  2C9L Y;  1NTK E;  1L4A D;  3H1H D;  2WPR A;  4H0L B;  1EDK A;  1YJW P;  4ASV A;  2M0B A;  3H1K G;  3Q5R A;  1JEK A;  1SQX D;  1JUN A;  1VQM P;  3E1I A;  3L74 E;  3L72 E;  1YTZ T;  3F89 A;  2WMM A;  3S9O A;  3CWB J;  4C7N A;  1CI6 A;  5AW4 B;  4L75 A;  4N3Y B;  3ABV C;  4CPG A;  2M5A A;  3CC2 P;  3UIA A;  1MFZ A;  2AXT E;  2HR3 A;  4WY4 C;  3IF4 A;  2AXT H;  2XKM A;  3TNU B;  1SQQ K;  3F5H A;  4PJ0 E;  3L70 E;  1H88 A;  2W6J H;  1L0N K;  2O01 J;  2V4H A;  3FXE A;  1NTZ D;  2NZ2 A;  3L74 G;  1ZW0 A;  3A3Y B;  1SFC C;  1MV8 A;  2ZT9 D;  3CCJ P;  1PP9 J;  1DH3 A;  1SQP E;  1L0L G;  4WY4 B;  3L35 A;  5B5E H;  4H13 C;  1BDD A;  5B5E E;  1SS1 A;  5KJ7 C;  3V2Q A;  1VPC A;  2K37 A;  1NHL A;  2WZ7 A;  2SPZ A;  1SQV G;  2RH0 A;  1KQL A;  1FDO A;  1NU1 K;  1RF0 C;  2IBZ D;  2KK7 A;  3ITK A;  5TIS E;  3WUU A;  2FYN B;  1SFC A;  2NPS A;  1SQP K;  3AEF C;  4JPZ B;  5TIS H;  1XTC C;  3RGU A;  2N1T C;  1BCC D;  1LT9 B;  1SLQ A;  2FYU E;  2O01 H;  3VMX A;  4UB6 H;  4D6T G;  1Y9B A;  1L0L E;  1T6A A;  1SP4 A;  2Q6Q A;  1Q2N A;  1LTT C;  1NU1 G;  3HUS C;  4GT1 A;  1M56 D;  1PZQ A;  3L75 G;  4MN4 C;  2MKV A;  1SQQ E;  4JF7 A;  4RES B;  4YTP C;  2HYN A;  4OH8 B;  1YHQ P;  1FOS F;  1U7M A;  5AVZ B;  2D2C C;  2ZFC A;  1KV4 A;  3LID A;  3BRT B;  4WBA A;  3CWB D;  2OYI B;  2C0W A;  1N7S B;  5AVX B;  1R5L A;  3CXH E;  3V2N A;  4TLF A;  1PGO A;  3C1L A;  5AVW B;  3O6Q B;  1BCC E;  1BGY J;  1KN7 A;  1PP9 G;  1L0N G;  2DW3 A;  2A06 E;  3P8C D;  3TK1 A;  5KLV E;  1CSB A;  2WT7 B;  1FS0 E;  2OAR A;  1OW6 A;  1UIX A;  1ZP0 C;  3L75 E;  1L0L K;  4BRY A;  3CCS P;  1FZC B;  1FDM A;  3T97 B;  1PGQ A;  5AW2 B;  5CCG C;  2LKM A;  2POH A;  5AW9 B;  2GUV A;  3OAK A;  2LR2 A;  2R32 A;  2VRS A;  3CX5 H;  1IFM A;  3PTZ A;  1S5L E;  2FFD C;  1VQK P;  1NTK D;  2KIK A;  2YIU C;  4R4M A;  1FZC A;  1N7S C;  2K9J A;  1VQ4 P;  1RF1 A;  3AE3 C;  1EXJ A;  5KLV G;  1GZL A;  1DD3 A;  2L91 A;  3RL0 D;  2I1K A;  3L71 J;  3G3Z A;  3CWB G;  2JEE A;  3O6Q A;  1NTZ G;  1FAV A;  5KAI H;  5KAF H;  4NPE A;  1T3J A;  4DOJ A;  1X0T A;  3GF3 A;  4U3F J;  2YKO A;  4H44 C;  1BSH A;  2QVA A;  1EQ7 A;  1YQ4 C;  2QJK B;  3TDK A;  1GU4 A;  3N4X A;  5APS A;  3H1L E;  3VP9 A;  4PD4 D;  1KYO D;  2OYH A;  1NU1 D;  1W2B O;  1NJI Q;  1JCC A;  2WIT A;  2ZVO B;  5AVY B;  3LW5 J;  4DZO A;  2ZXX A;  4D6T E;  1FZE A;  1NTK G;  2E43 A;  3H1H J;  4GIF A;  1JTH B;  2JR8 A;  1SFC B;  1Y47 A;  2QJY C;  2B89 A;  1LWU C;  4U3F E;  1Y8A A;  2FKW B;  1OXZ A;  3BVH A;  2ZAE B;  3VP8 A;  2JWA A;  4ASW A;  1OZH A;  1BGY G;  1IFP A;  2HOD A;  1GK6 A;  2YMK A;  1EDJ A;  3C9I A;  1GL2 B;  3B5N D;  3H1J G;  2JO1 A;  4WY4 A;  4N78 D;  3Q5S A;  3BRV B;  2W8Z A;  3MUD A;  1UII A;  4DCK A;  5E79 E;  1LGH B;  3HUS A;  2OTK E;  2YNY A;  3SWF A;  3CCU P;  2OYH B;  5CMZ A;  3L70 G;  2OGU A;  3H1I D;  4RKU J;  2R5B A;  4U3F D;  3V5B A;  2WTY A;  3V2R A;  1LTS C;  1VF5 D;  3CL3 D;  4U7J A;  3CCQ P;  1KB9 D;  2E76 C;  1CZQ A;  2UWJ E;  3A0H E;  1S72 P;  2OYI A;  2Q9I A;  4M3L A;  3D6Y A;  2YO3 A;  1IC2 A;  2BCC J;  1SQP D;  1PPJ E;  2M3B A;  1NGM B;  3OA7 A;  1RF1 B;  2E42 A;  2IX7 C;  4L74 A;  2ZYG A;  4LLH A;  2HLO A;  1KYO I;  1VDF A;  1J1E C;  3SFD C;  2H8P D;  3H1K D;  4PD4 H;  5K5G B;  1OIP A;  2E76 D;  4W80 A;  1KFM A;  4A7P A;  4JBZ A;  3W67 A;  1ZV8 A;  2HFE D;  4C46 A;  2PRR A;  1X8Y A;  3AE7 C;  2NPS B;  1VQ8 P;  5KLI B;  3AE1 C;  1J2J B;  1M8O B;  1XTG B;  2FYU J;  2Y0E A;  2XNX A;  2WT7 A;  1JM0 A;  2FXO A;  3WU2 E;  1YI2 P;  2O1K A;  3S1K A;  1H0T B;  3L37 A;  3O8Z A;  2W83 C;  1L2P A;  1URQ B;  2A45 G;  2E5Y A;  3H1K E;  3NXS A;  3TGU J;  1PFI A;  1HJB A;  1VQN P;  3RK3 D;  1YJN P;  1SQB E;  1VF5 B;  3MTU E;  1NWQ A;  1M1J C;  2WSC H;  2E74 B;  1KB9 H;  1J1D C;  1JTH A;  2J59 M;  2K1A A;  2RKL A;  2KYV A;  1KQS O;  2WSC J;  1T2K C;  1JO5 A;  1AVO A;  1OW7 A;  3AE2 C;  1KIL C;  4UB6 E;  1BE3 D;  5KAI E;  3U1C A;  2YXQ B;  2WSF J;  3H1K J;  2BEZ F;  2E5T A;  1ZN5 A;  2QEX P;  1FDI A;  1M7L A;  3B71 A;  1SQB G;  2OYO A;  3BAT A;  4I7Z B;  1FBM A;  3JSV C;  3ZDM A;  1JMB A;  1KZU B;  1L0L D;  2BCC D;  3KHU A;  1SQP G;  4PV1 B;  1NTM G;  1AA0 A;  2KUB A;  2FFD B;  3CD6 P;  3CXH H;  5CCG A;  1Q90 D;  3VOP A;  1KB9 I;  1HF9 A;  2CPB A;  4R4L A;  4WVZ A;  5KKZ B;  3MUD C;  1YBK A;  3I5C A;  3CMA P;  1FZC C;  3A0B E;  1S4X A;  3VN0 A;  3HTK A;  1LTI C;  1CW5 A;  2FYU K;  3A0B H;  5AVT B;  3TGU D;  2FY8 A;  1H89 A;  4ZMD A;  4IOI H;  3CCL P;  4BXL A;  2IDB A;  5CCG D;  5CJ4 A;  1QVG O;  2HOD B;  3HD7 C;  1GK4 A;  1A02 J;  3H32 B;  1KYO H;  3KYQ A;  2JDI H;  3KXD A;  2G3A A;  1NO4 A;  4BRY B;  2K88 A;  1OVU A;  1S5L X;  1MKM A;  4UB8 H;  2XND H;  2J58 A;  3GHG C;  2O01 N;  5CHX A;  3OJA B;  3K5B A;  4DJG A;  1SQV D;  5KAF E;  2FFD A;  1BE3 G;  1LTA C;  3KDP B;  3HE4 A;  5APQ A;  3SFE C;  2E75 B;  3G6E P;  2N1T B;  1HGV A;  1S2E A;  3GW6 A;  1A02 F;  4C7R A;  5B66 E;  2YXR B;  3BCC G;  1JY2 P;  1FJK A;  1PV3 A;  2WSS H;  2IYO A;  4HYT B;  3U59 A;  2WPQ A;  1BE3 J;  2GUS A;  2CK3 H;  1NTZ K;  1SVF A;  3IAO A;  3L74 D;  2WVR A;  4Y99 B;  2HPC B;  2PP6 A;  3RK2 B;  1NH4 A;  1M1J B;  3AEE C;  3H1I E;  1YIT P;  1BSN A;  3MGN A;  4RJT A;  2H88 C;  1G2C B;  1IK9 A;  4WY4 D;  2WQY C;  1E79 H;  1AV1 A;  1JY3 P;  1L0N J;  1X22 A;  2KZI A;  4N78 E;  1GU5 A;  4W7Z A;  3AED C;  1G1J A;  5APY A;  2KLV A;  3WU2 H;  3NTN A;  4PD4 I;  1FZG A;  1IO4 A;  1AQ5 A;  1YQ3 C;  3TGU E;  1SFC D;  3D6Z A;  5AW1 B;  2B88 A;  5AVQ B;  3SWY A;  3RK2 C;  1IJD B;  1LJ2 A;  2QA4 P;  3LIE A;  3IN6 A;  4IFF A;  2ZYD A;  3CXH D;  4ZKP A;  3L73 D;  5GTH E;  1N73 A;  5L8R J;  4HB1 A;  3V4W A;  1VQO P;  2LXB A;  5GTH H;  2AEF A;  5GTI H;  4U3F G;  4C7N B;  5GTI E;  1NOH A;  3A5T A;  3L4F A;  1FJP A;  4L76 A;  5AW0 B;  1N73 B;  1K9M Q;  4DT0 A;  5BU5 A;  4YXW H;  2OTJ P;  1T2K D;  2KSJ A;  1N86 A;  1LT9 A;  5KLV J;  2Y0C A;  1BCC J;  3IR9 A;  1NTZ E;  3L36 A;  2QJP B;  1USE A;  3P8M C;  5CBN A;  2Y0D A;  1SQB D;  3II6 A;  1SQX G;  1JNM A;  3HD7 A;  5BVZ A;  3HE5 B;  1DD4 A;  1DEB A;  1S9K E;  1QL1 A;  1OFC X;  1ZRT E;  1N7S A;  4N6J A;  1U7J A;  3AEG C;  1L0N D;  2QJY B;  3W68 A;  1T8Z A;  1G2C A;  1Q86 Q;  1KYO E;  3EFF K;  3H32 A;  1N7L A;  4JYC A;  3RL0 B;  1IZN B;  1SQQ G;  2KB7 P;  2YO2 A;  3L72 D;  1QL2 A;  4GKG A;  1KB9 E;  1OW8 A;  1R5S A;  5APW A;  2P10 A;  1FC2 C;  4XFJ A;  2M8R A;  1VQP P;  1LP1 B;  5CCH C;  1ZLL A;  3FGA D;  5AVS B;  3H6P A;  3L73 G;  1N7S D;  2D2C D;  5DJT B;  2Q7C A;  3G4S P;  1SQQ D;  1HVV A;  1L0N E;  2FYN C;  2XV5 A;  3AE4 C;  5APX A;  4H13 D;  3CCR P;  1W2E A;  1OWA A;  3CX5 I;  1RHZ B;  2IFN A;  1HH0 A;  3M9H A;  1HWT C;  1ZRT D;  1LTG C;  3FX0 A;  3PJS K;  4KHX A;  5AW5 B;  1LT1 A;  3H1L J;  3H1I J;  4GOE A;  2E74 C;  2IZ1 A;  5M1B A;  2Y9Z A;  3L70 J;  3PRJ A;  4I2L C;  3WUV A;  3MHV A;  3TYY A;  1FZF A;  3CC7 P;  2IBZ E;  2KSE A;  2KS1 B;  3AE6 C;  4OGQ B;  4L73 A;  3JCU H;  3S4R A;  1P84 E;  3L73 E;  1MZ9 A;  1NAF A;  1P84 H;  2P58 A;  3R2P A;  1LTJ A;  2B9B A;  2R44 A;  2W6B A;  2XU6 A;  1JY3 O;  3GG2 A;  1RE3 A;  5AW8 B;  2C9N Y;  2K3R A;  2QJP C;  1EZV E;  1OVR A;  3CWB E;  1KC8 Q;  3L72 J;  3JC2 2;  3L74 J;  1X9V A;  1SQX J;  1HJ0 A;  3CC4 P;  4HKZ H;  2W27 A;  1M1K Q;  2JJL A;  2N1T A;  4LGD E;  2KNC B;  4UB8 E;  3CXH I;  3SWK A;  2FBW C;  1WMK A;  3L75 J;  3BCC D;  3R4Y A;  1J1E B;  1KD1 Q;  1W5C E;  2D2C B;  2KOG A;  2Q3I A;  2PAJ A;  2A45 H;  1RE4 C;  1EZV G;  1EZV I;  1RQV A;  3AEC C;  2R3C A;  2AXC A;  3B5N A;  3GHG A;  3HUS B;  1WT6 A;  4I1L A;  2E76 B;  5KLV K;  1MUU A;  1LT9 C;  3C8V A;  1RQU A;  4H0L D;  3TSI A;  3USS A;  4Z1M H;  4Y28 J;  3V4Q A;  3HD7 D;  2I1J A;  1FOS E;  4H44 D;  1P84 I;  2XZR A;  1SQQ J;  5AW6 B;  2R5D A;  3HTK B;  1U57 A;  5APU A;  2OYH C;  3LW5 H;  4JQ0 D;  4LC1 A;  1L0L J;  2GA1 A;  1GL2 D;  3WUT A;  1G1I A;  2KXP B;  3P7K A;  1NYH A;  4PJ0 H;  1GL2 C;  5CJ0 A;  3RBZ A;  3CPW O;  1EC5 A;  1S9K D;  3BCC E;  4EDF A;  3AE5 C;  2WSE H;  3CX5 D;  4AYC A;  4EYY Q;  1E5W A;  1AVY A;  1QGK B;  1JB0 J;  2V7Q J;  3GMA A;  3CCV P;  1YTZ I;  4OGQ C;  5H2F H;  3I56 P;  1DX7 A;  1LWU B;  1KMI Z;  1GW3 A;  2QSI A;  4EIJ A;  1SQX K;  1LWU A;  3HRN A;  3FWL A;  3CI9 A;  3VMZ A;  5CCH A;  2ZT9 B;  3GLM A;  1BCC G;  4YXD C;  1SQP J;  3M9B A;  2H7H A;  1HBW A;  1LTJ B;  1QVF O;  2JWD A;  4IFD K;  3VMY A;  2FYU D;  1SQB J;  3N7N A;  1QLE D;  1GD2 E;  5BU8 B;  1Q7Y Q;  2E75 C;  1YIJ P;  3WMM 0;  2V7Q H;  2QJK C;  1MFT A;  3BCC J;  3KZI E;  3V2P A;  4B86 A;  4H44 B;  3Q3D A;  1VQ7 P;  2GM4 A;  1M1J A;  1AJY A;  1RF0 A;  1FZA A;  1EZV D;  1K05 A;  4PV1 D;  2NPS D;  1K8A Q;  1JY2 O;  2HPC A;  4NPF X;  2B87 A;  1PP9 D;  2O3J A;  1RE4 A;  4JYB A;  2ZJS E;  1KIL D;  2I8D A;  2N9Y B;  1P84 D;  2WPS A;  2Q5U A;  2Q1K A;  3GHG B;  1SQV J;  1L4A C;  1IFD A;  2PFX A;  3M0D C;  5AVU B;  3RL0 C;  3TGU G;  3L70 D;  2LXC B;  1Q82 Q;  3G9R A;  3L72 G;  3RK3 B;  3TNU A;  3P32 A;  4IL6 X;  4OWF A;  3Q5P A;  2Z5H A;  1IK7 A;  2IZ0 A;  2BCC E;  2KZJ A;  2OTL P;  2E74 D;  2M5A B;  1AQT A;  1NTK K;  3H1J D;  3RK3 C;  3SSU A;  4KJM A;  1L4A A;  3M0D A;  4I6M C;  3VYI A;  3H1L D;  4XA4 A;  1L4A B;  3EWK A;  3RK3 E; 
#chains in the Genus database with same CATH homology
 1SQX G;  3H1K G;  4PD4 H;  1SQV G;  2IBZ G;  2FYU G;  1BE3 G;  1SQB G;  3H1H G;  3CX5 H;  3H1L G;  1BGY G;  1P84 H;  4D6T G;  1SQP G;  1NTM G;  2A06 G;  5KLV G;  3H1J G;  3BCC G;  3CXH H;  1NU1 G;  1SQQ G;  3L75 G;  3CWB G;  1NTZ G;  1PPJ G;  3H1I G;  3TGU G;  3L70 G;  4U3F G;  3L72 G;  3L74 G;  3L73 G;  3L71 G;  1KB9 H;  1BCC G;  1L0N G;  1L0L G;  1PP9 G;  1KYO H;  2BCC G;  1EZV G;  1NTK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...