3H1HG

Cytochrome bc1 complex from chicken
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1hG00
1SQXG 2FYUG 3L72G 1PP9G 3H1IG 2BCCG 3H1KG 1SQBG 1EZVG 1BCCG 1NTZG 3CXHH 4PD4H 1BE3G 1P84H 1SQVG 1L0LG 1NTKG 3H1LG 4U3FG 2IBZG 3L70G 1NU1G 3L71G 3L73G 1KYOH 3BCCG 3L75G 3CWBG 3H1HG 1SQPG 3L74G 3CX5H 4D6TG 1L0NG 3H1JG 3TGUG 1SQQG 1PPJG 1BGYG 1KB9H 2A06G 5KLVG 1NTMG
chains in the Genus database with same CATH superfamily
2AEFA 1GW3A 1NYHA 3RL0g 2ITAA 3V5BA 1E79H 1SQXG 2V4HA 4L76A 3AECC 1FU1A 3CXHD 3RL0B 4CPGA 3G71P 1IFIA 4D6TE 2D2CC 1M8OB 3C1LA 4GIFA 3MTUE 1FZFA 1X0TA 1BE3G 4NPFX 1LTSC 4N3YB 3MUDA 1NKZB 2E5TA 2FYUJ 1KYOD 2R32A 5DJTB 5KLVJ 1SQPD 1KB9I 1MFZA 3CC4P 1NWQA 3L71G 1L0LD 3IN6A 1S72P 4JQ0D 2ZVNB 3AE2C 5AVZB 1FJPA 3CWBG 4Z1MH 1VQ6P 1GMJA 4BWNA 1NTZK 1J1DB 1L0NK 4ZKUA 1S9KE 2PRRA 2XNXA 2K9JA 3CMEP 3R4YA 3L35A 1WT6A 3CWBJ 3FXDA 2NZ2A 3T97A 4ASWA 5TISH 3W67A 1IFPA 1VQOP 1Q82Q 3MZWB 4LC1A 4WWIA 1Y8AA 4YXWH 1LTJB 3RK2C 4DOJA 4BRYA 1SLQA 2HFED 2K88A 5KJ7C 2BCCG 2KZJA 2H88C 1AA0A 1NAYA 3JSVC 2KZIA 2IBZI 4JF7A 3CXHH 1SQPJ 1NTMD 2E74B 4IL6X 4U7JA 5APXA 3VN0A 3WMM0 1P84H 1CZQA 2QEXP 1SQPE 2WSFJ 4H44B 5EFWB 1KD1Q 1KYOE 3EFGA 5L8RJ 2Z5HA 3FXEA 4DJGA 1L0LJ 2J5UA 3EQ2A 2UWJE 1KILA 1PGPA 3GMAA 2IFNA 3PLNA 4K35A 1LTJA 5BU8B 1MUUA 1OFCX 1SQVK 2O01J 3JCUH 4D6TG 1L0NG 1X9VA 3SWKA 1SQVE 2QG4A 1FZCC 1K05A 2C0XA 1GL2B 1NTZE 1PGJA 1SQQG 2MKVA 3H1ID 4LGDE 1QEXA 2P2UA 2Q5UA 3AE7C 3P32A 2IBZE 3H1IE 1LT9C 3L70E 1IK7A 3GF7A 3HUSA 3LW5J 3I55P 1IO4A 1LWUB 1QLED 3OAKA 2FBWC 3TNUA 4H13C 3AE8C 1RF1A 5APSA 1LTTC 1FZAA 3P8MC 3KYQA 2FFDA 1PPJE 2Q7CA 2AXTE 2E43A 3H1JE 1SQBG 3TGUE 2QM7A 4I7ZB 1HUCA 1NTZJ 1OVUA 3G9RA 1SQXD 2E75D 1ZW0A 3JC22 3KPEA 4I1LA 5APYA 3VMAA 4YXDC 2E74D 1GU5A 3IF4A 3RGUA 2K37A 2AEJA 2JKVA 5KLVE 1YIJP 2XV5A 2JWDA 4JPZB 1Q2NA 2WPSA 1NU1J 1FAVA 5AW1B 1AVOA 1KILB 1BGYJ 1NHLA 1Z56A 3H1HG 3QH9A 2R3CA 5AVXB 1FZGA 2E5YA 1P84D 1GZLA 1Q7YQ 1GDTA 3TYYA 3OJAB 1CW5A 1OWAA 3H1KD 3CCLP 3AEBC 2XNDH 2E76D 1QL2A 4I7ZC 3Q2YA 1EZVI 5TISE 1KB9D 2YKPA 4BRYB 1VQPP 1SFCC 1N73A 3D70A 1SQXK 3AEGC 3LW5H 2H8PD 3M0DA 1T8ZA 1BSNA 1FBMA 1PZQA 2W6JH 1LWUC 2Y0DA 3GLMA 3PP5A 4IFMA 3CWBE 1M1JB 2OTKE 1LT9B 2N9BA 3NXSA 5KAIE 1SS1A 2NRGA 1AV1A 2K9YA 1KORA 4AYCA 1FDIA 2ZT9C 2I8DA 5KKZB 3GHGB 1URQC 1NOHA 3A0BH 3VP9A 4L75A 2A06E 3H1LG 4BXLA 4XA4A 2CPSA 5E79H 3CCVP 4GDOA 3CXHE 4H13D 2V7QH 2WWWA 2RH0A 3HD7D 1KC8Q 1NTKE 2FYUK 2WPRA 3A0HE 1EQ7A 1U57A 3IAOA 4K3AA 3TK1A 4ZMDA 3H1JG 1OW8A 2ZFCA 3II6A 1EZVE 1Y47A 5TJHA 4H44C 5CBOA 1PPJG 4Y28J 2HPCA 2W6AA 2E74C 3AEDC 4Y99C 3L71J 3B4SA 1NJIQ 1NTKD 1PFIA 1ZRTD 2KSEA 2PGDA 4KHXA 1E5WA 3PTZA 1KFNA 2N9YB 5AVYB 2V7QJ 1S5LX 5AW9B 2XDJA 1BCCG 4M3LA 2WMMA 2IZ1A 3FWNA 2A06D 1L0NE 4IL6H 1LP1A 4WVZA 1G1JA 2BEZF 2IYPA 1MKMA 2N1TD 1N8RQ 2RN0A 2WITA 3ABVC 2GA1A 3VOPA 1VQ9P 4U3FG 1VQ8P 2WPVB 5H2FH 3A2AA 4PV1D 5K5GB 1SFCD 1N7SA 1FE6A 1JY3P 2WVRA 2ZAEB 3CX5H 1NKNA 2GM4A 1HWTC 1IFMA 1N86A 1YHQP 1BE3E 1X22A 2ZXEB 3V2RA 3ITKA 3TF5A 2Y9ZA 3L71D 4JBZA 1S5LE 5BVZA 1KQSO 4W7YA 1NU1K 1ZV8A 2KSJA 2ZT9D 3L72J 1URQD 2A06G 2JJLA 2Y9YA 1NTMG 3H1LE 3L75E 1USEA 2C9LY 2Q3IA 4EI2A 1A02J 2C9NY 4H0LB 2P58A 1M56D 2WZ7A 2YO2A 3AEFC 2HPCB 3B5NA 3E1IA 1BCCJ 2IPPA 2YMKA 3RBZA 1VF5D 3L74E 4PD4H 2HODB 2IZ0A 3F5HA 3HE4A 5KLVD 1BDCA 1GW4A 1LTBC 2N1TB 2ZYDA 2NPSC 2B9BA 2B87B 1YQ3C 3CCSP 1OIPA 1K04A 4XFJA 1NO4A 3H1JD 4KJMA 1W5CE 3TNUB 4DZOA 5KAIH 1D7MA 2QJYC 4TT3H 3QWOC 3CCEP 3BRVB 1JY2O 2OGUA 2OYHB 4IFDK 1FC2C 1RH5B 3M9QA 5GTHE 5CCGA 1DIPA 2JP3A 1EDIA 2YNYA 3MIWA 1RF0A 2KP8A 1FJKA 1GK6A 2H89C 1M1JA 4JYCA 1ZMEC 1GK4A 1J2JB 1A02F 2CPBA 2YXRB 2BASA 2GUSA 3CMAP 3N4XA 3HD7A 1KB9H 1SQBD 2W83C 2N1TC 5AVTB 2K3RA 2KXPB 3A0HH 4WY4D 4DT0A 1NU1E 5KLVK 4HJGH 1BCCD 2R5DA 3H32B 3R2PA 1KQLA 5CJ0A 1JM0A 1UIIA 4W80A 5AW8B 1DEEG 3WUTA 3Q5PA 3BRTB 1G2CA 3CI9A 1M1KQ 1EXJA 1X79B 2KNCB 2WTYA 3H32A 5CCHC 3H1JJ 4HH2A 3L75J 3PRJA 1LJ2A 4WY4B 1YTZI 1PP9J 2YIUC 3PHLA 3S4RA 1MFTA 1OVRA 1AVYA 3L75G 2Z4EA 1QL1A 1IFDA 4U3FD 1URQB 2XZRA 2ZJSE 5APQA 5KKZC 3D71A 3CXHI 1BDDA 1EDKA 2BCCE 2WSEH 1LGHB 2J58A 1SQBJ 2DW3A 3EWKA 4TLFA 3TSIA 1NVOA 1VQ4P 2QJKC 4HKZH 5AW6B 2BEQD 2P1JA 2OYIC 2HR3A 2HLOA 1XTGB 1JTHA 4KT0J 2BCCD 2NPSD 2WQYC 4RESB 3Q5SA 1S9KD 2A45I 4AQRD 2JWAA 3M06A 2QE7H 3B5ND 1L0LE 2HODA 4HYTB 4N78E 1S5LH 1VQ5P 1Q81Q 1RE3C 1YI2P 4B86A 1EDJA 3H6PA 1DEBA 1QX8A 4GODA 3M9BA 2QRXA 4L74A 1Y9BA 2P7JA 1PP9D 3P8CE 1HGVA 5AVSB 3N7NA 1KN7A 3BCCJ 4Y99B 2OTLP 5B5EH 3C8VA 3B8EB 4GKGA 3RK2D 3NMDA 4C7NA 1BGYD 1R5LA 2KS1B 2M3EA 3OA7A 4PD4E 4D6TD 1SQPK 3S1KA 3CPWO 4I2LC 3BCCG 2FXMA 2FXPA 1NTMJ 1PGQA 1RE4A 3GF3A 1VQKP 1T3UA 2LKMA 2ZYAA 1GD2E 4GT1A 1P84I 4WBAA 1N7SB 2JEEA 3RBXA 1QGKB 4UB6E 4NPEA 2KUBA 1LT1A 5CCHD 5APWA 3HTKA 3U1CA 3GHGC 5CCGD 5GTIH 1JCDA 1NAFA 3HD7B 4O9BA 1GU4A 2H43A 1EXIA 1BE3J 4H13B 1OVVA 2R5BA 1AFOA 3M0AA 2FYUG 1WRGA 2M3BA 4MN4C 5B66E 1HBWA 1L4AA 2LXBA 3H1IJ 1VDFA 5AVWB 1SQBK 3O8ZA 3SWYA 1YJ9P 1GL2C 4WY4A 3KQGA 3A5TA 2OYHA 3A7OA 2M5AA 4IOIH 2R3SA 2P67A 3CLQA 5GTIE 1SQQK 3VMZA 3SWFA 2IBZG 3H1HD 3L70G 5AW2B 4I6MC 5KLIB 1KYOH 1VL2A 2FFDC 4QMAA 3B5NC 3D6ZA 5AW3B 1KILC 1JOCA 1JY2N 1NH4A 2WSFH 3CL3D 3L75D 4R4LA 5KAFE 1MV8A 1KQGB 1BSHA 2W90A 1HF9A 3NFQA 3H25A 1HGZA 5APTA 1M90Q 1YJNP 3D6YA 1BE3D 2QJPC 3E1RA 2B88A 1QVGO 1L4AD 4OGQD 1FZCA 1EDLA 1KTMA 3MUDC 4U3FJ 4RKUJ 2YKOA 2I1JA 3O6QB 3TGUJ 1PP9G 1SQQD 3H1IG 1ZN5A 1LT9A 1RY3A 3SSUA 5BU5A 1H0TA 3V6IA 3KDPB 3S9OA 3H1HE 3H1KJ 2FKWB 3UIAA 1ZLLA 1RF1C 2OARA 2E75B 2A45H 3EFFK 3PJSK 2OYIB 3E7KA 1L0ND 2YKQA 3L70J 2AEMA 3CCMP 1RQVA 3Q3DA 1H0TB 1DD3A 2IYOA 3WU2E 2FXOA 1IFNA 1PV3A 2LR2A 3AE1C 1HTLC 1ZRTE 1YTZT 3MP7B 3RL0D 1R8EA 1FOSE 3Q1MA 1S1CX 3AEAC 4EDFA 5B5EE 1NTKK 1IK9A 1LNQA 2FYUE 3FX0A 1GL2D 1CI6B 1N7LA 1EC5A 5E79E 3V2QA 4AUWA 5KJ7A 4D6TJ 1M7LA 2WSCH 3BCCE 3AE3C 2IX7C 1GTWA 1SQQJ 1QVFO 5DJUB 2E42A 3SFDC 2O01N 2WT7A 3CC2P 4W7ZA 1BGYE 3H1KG 1EZVG 1DD4A 2QIWA 1VPCA 1JY2P 1KMIZ 2KB7P 3AEEC 1CI6A 4H44D 1SFCA 1LTJC 3RK2B 1H8AA 2FYZA 3MGNA 1L0LG 1Q90D 2WPQA 1OX3A 1LWUA 1YBKA 2Y0CA 5APVA 5B66H 3HUSB 3CWBD 3BVHA 3CD6P 5AVQB 2MJZA 2WSEJ 1KZUB 2HG5D 1L4AB 4OGQB 3HTKB 5KJ7D 3HUSC 1IJDB 1KB9E 1YQ4C 3ZDMA 2YMYA 4PD4I 2IDBA 5AVUB 4YTPC 1HVVA 1SVFA 2NPSB 1BGYG 2W27A 2YO3A 3H1HJ 3H1KE 3L4FA 1KFMA 5AW5B 5CJ4A 4UB8E 4EOTA 5CMZA 2KLVA 4PJ0E 3CX5E 2L91A 2RKLA 3M91A 3O6QA 4PV1C 4U3FE 3F89A 4ASVA 1S4XA 1G2CB 5AW7B 1SQVJ 3PH0A 1JY3O 2YXQB 2D2CB 3RL0C 4H0LC 1NTZG 3MD0A 2WSSH 1AJYA 3L72D 1IFJA 3VP8A 5KTBA 1SQVG 3L73E 4C7NB 1W2BO 1IZNB 3V2NA 3P7KA 2PAJA 4OH8B 5AW0B 3G4SP 1OMIA 3TGUD 2GUVA 1NU1G 5AVRB 1PPJD 3TDKA 2KOGA 3VMYA 1USDA 2Q6QA 1JTHB 3V4WA 3AE9C 1VF5C 2L5GB 3CX5I 3GG2A 5H2FE 1J1EB 2M0BA 2C0WA 3MHVA 1N73C 1SQBE 3I5CA 3TGUG 1JY3N 2IBZD 1N7SD 2BCCJ 3L70D 1JEKA 2E75C 2AXTH 2JO1A 2JR8A 2KS1A 3M0DC 4LLHA 1RF1B 4UB8H 2QVAA 1SQVD 2IFMA 1FDMA 1IC2A 5AVVB 2KIKA 1VQ7P 2O01H 2B89A 2KLUA 1URQA 3K5BA 4PD4D 3A0BE 3KZIH 1S2EA 2QJPB 3L36A 2H7HA 4OVNF 1JNMA 3HRNA 1PL5A 4XE5B 2WSCJ 3P8CD 1PP9E 4RJTA 3H1LJ 3L73D 2J59M 3L72E 1NTME 2E76C 1W2EA 3B5NB 2RMZA 1RHZB 3L74D 2KYVA 1KQFB 1FZBA 3I56P 2OQQA 4N78D 3CCRP 3FWLA 1OXZA 5KLIC 4UB6H 3G6EP 1SQPG 2NPSA 2XKMA 2VRSA 1TU3F 2FY8A 3CX5D 2P10A 2JDIH 4H0LD 3AE6C 1L2PA 3GW6A 4C7RA 3CCQP 1JO5A 1KV4A 3RK3B 1WMKA 1DX7A 2PP6A 1N2DC 1OZHA 2R44A 2M8RA 2FYNC 2ZT9B 5KLVG 2Z5IA 1HJBA 1RF0C 1LP1B 1M1JC 2ZVOB 1YYCA 1ZOYC 4IFFA 3T97B 2PFXA 1T6AA 3LIDA 1H88A 1OW7A 2K9JB 1LTIC 2G3AA 2G8YA 2FYNB 3L72G 4L73A 3HD7C 3BATA 3VMXA 3CCJP 3RK3C 1SFCB 1UIXA 3AE4C 1T2KD 4A7PA 1JB0J 2I1KA 2ZXXA 3Q5RA 4C46A 2OTJP 2W8ZA 4RO0A 2POHA 1LTGC 1KYOI 1N7SC 2B87A 2CK3H 2Y0EA 1SQXJ 1JUNA 3VYIA 4ZKPA 5M1BA 1U7JA 1ZR2A 3HE4B 5KAFH 5CCHA 1VQNP 1BCCE 3V2PA 3CCUP 1NU1D 1S3JA 4ZNCA 4GOFA 3BCCD 2KNCA 2SPZA 2Q3EA 5CHXA 5AW4B 4YPCA 1HJ0A 1K73Q 1VQLP 2QA4P 1K8AQ 2O1JA 1EZVD 1H89A 2FYUD 3C9IA 2Q9IA 1FDOA 2LXCB 1R5SA 2W6BA 1PIXA 1JMBA 2OYOA 3B71A 3FGAD 1FS0E 3BASA 3HE5A 1AQTA 2QSIA 3VTPC 3NTNA 4OWFA 2KK7A 1M57D 1L0NJ 1G1IA 2QJKB 3LIEA 2ZYGA 4HB1A 2Q1KA 3OW2O 1VF5B 4WB4A 5GTHH 5CCGC 1K9MQ 2XU6A 4R4MA 5C39A 3WUUA 3KZIE 1KILE 1FZCB 3L73G 3W68A 1SQQE 2O1KA 1LTAC 2D2CD 3L74G 4EIJA 3A3YB 2YIUB 2N1TA 3L37A 2O3JA 3IFMA 1U7MA 1ZP0C 1MZ9A 3H1LD 1T3JA 1FZEA 3L73J 3RK3D 1T2KC 3G3ZA 3L74J 3WUVA 3L71E 2E76B 3KHUA 1RE4C 1YITP 2WT7B 1NTMK 1OW6A 3RK3E 3IR9A 1P84E 1Q86Q 1AQ5A 2K1AA 4PV1B 2KI7B 3M9HA 1KILD 1ZXGA 2M5AB 1NTKJ 2FFDB 3GHGA 5APUA 4GOEA 4DCKA 4EYYQ 3V4QA 1YJWP 1HH0A 3JCUE 1ZR4A 4NPDA 3U59A 2HYNA 1NTKG 1SQXE 1NGMB 1L4AC 4OGQC 3USSA 1PGOA 4IL6E 5CBNA 4N6JA 3AE5C 1GL2A 1VQMP 4WY4C 1DH3A 1J1DC 2OYHC 1N73B 1X8YA 2AXCA 2QJYB 1J1EC 2OYIA 3SFEC 1CSBA 1RQUA 4PJ0H 1JMMA 2A45G 1JCCA 3HE5B 3U1AA 1L0LK 3WU2H 1NTZD 3CC7P 3KXDA 1FOSF 2QM8A 1SP4A 1RE3A 1XTCC 4JYBA
chains in the Genus database with same CATH topology
1SQXG 2FYUG 3L72G 1PP9G 3H1IG 2BCCG 3H1KG 1SQBG 1EZVG 1BCCG 1NTZG 3CXHH 4PD4H 1BE3G 1P84H 1SQVG 1L0LG 1NTKG 3H1LG 4U3FG 2IBZG 3L70G 1NU1G 3L71G 3L73G 1KYOH 3BCCG 3L75G 3CWBG 3H1HG 1SQPG 3L74G 3CX5H 4D6TG 1L0NG 3H1JG 3TGUG 1SQQG 1PPJG 1BGYG 1KB9H 2A06G 5KLVG 1NTMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX G;  2FYU G;  3L72 G;  1PP9 G;  3H1I G;  2BCC G;  3H1K G;  1SQB G;  1EZV G;  1BCC G;  1NTZ G;  3CXH H;  4PD4 H;  1BE3 G;  1P84 H;  1SQV G;  1L0L G;  1NTK G;  3H1L G;  4U3F G;  2IBZ G;  3L70 G;  1NU1 G;  3L71 G;  3L73 G;  1KYO H;  3BCC G;  3L75 G;  3CWB G;  3H1H G;  1SQP G;  3L74 G;  3CX5 H;  4D6T G;  1L0N G;  3H1J G;  3TGU G;  1SQQ G;  1PPJ G;  1BGY G;  1KB9 H;  2A06 G;  5KLV G;  1NTM G; 
#chains in the Genus database with same CATH topology
 2AEF A;  1GW3 A;  1NYH A;  3RL0 g;  2ITA A;  3V5B A;  1E79 H;  1SQX G;  2V4H A;  4L76 A;  3AEC C;  1FU1 A;  3CXH D;  3RL0 B;  4CPG A;  3G71 P;  1IFI A;  4D6T E;  2D2C C;  1M8O B;  3C1L A;  4GIF A;  3MTU E;  1FZF A;  1X0T A;  1BE3 G;  4NPF X;  1LTS C;  4N3Y B;  3MUD A;  1NKZ B;  2E5T A;  2FYU J;  1KYO D;  2R32 A;  5DJT B;  5KLV J;  1SQP D;  1KB9 I;  1MFZ A;  3CC4 P;  1NWQ A;  3L71 G;  1L0L D;  3IN6 A;  1S72 P;  4JQ0 D;  2ZVN B;  3AE2 C;  5AVZ B;  1FJP A;  3CWB G;  4Z1M H;  1VQ6 P;  1GMJ A;  4BWN A;  1NTZ K;  1J1D B;  1L0N K;  4ZKU A;  1S9K E;  2PRR A;  2XNX A;  2K9J A;  3CME P;  3R4Y A;  3L35 A;  1WT6 A;  3CWB J;  3FXD A;  2NZ2 A;  3T97 A;  4ASW A;  5TIS H;  3W67 A;  1IFP A;  1VQO P;  1Q82 Q;  3MZW B;  4LC1 A;  4WWI A;  1Y8A A;  4YXW H;  1LTJ B;  3RK2 C;  4DOJ A;  4BRY A;  1SLQ A;  2HFE D;  2K88 A;  5KJ7 C;  2BCC G;  2KZJ A;  2H88 C;  1AA0 A;  1NAY A;  3JSV C;  2KZI A;  2IBZ I;  4JF7 A;  3CXH H;  1SQP J;  1NTM D;  2E74 B;  4IL6 X;  4U7J A;  5APX A;  3VN0 A;  3WMM 0;  1P84 H;  1CZQ A;  2QEX P;  1SQP E;  2WSF J;  4H44 B;  5EFW B;  1KD1 Q;  1KYO E;  3EFG A;  5L8R J;  2Z5H A;  3FXE A;  4DJG A;  1L0L J;  2J5U A;  3EQ2 A;  2UWJ E;  1KIL A;  1PGP A;  3GMA A;  2IFN A;  3PLN A;  4K35 A;  1LTJ A;  5BU8 B;  1MUU A;  1OFC X;  1SQV K;  2O01 J;  3JCU H;  4D6T G;  1L0N G;  1X9V A;  3SWK A;  1SQV E;  2QG4 A;  1FZC C;  1K05 A;  2C0X A;  1GL2 B;  1NTZ E;  1PGJ A;  1SQQ G;  2MKV A;  3H1I D;  4LGD E;  1QEX A;  2P2U A;  2Q5U A;  3AE7 C;  3P32 A;  2IBZ E;  3H1I E;  1LT9 C;  3L70 E;  1IK7 A;  3GF7 A;  3HUS A;  3LW5 J;  3I55 P;  1IO4 A;  1LWU B;  1QLE D;  3OAK A;  2FBW C;  3TNU A;  4H13 C;  3AE8 C;  1RF1 A;  5APS A;  1LTT C;  1FZA A;  3P8M C;  3KYQ A;  2FFD A;  1PPJ E;  2Q7C A;  2AXT E;  2E43 A;  3H1J E;  1SQB G;  3TGU E;  2QM7 A;  4I7Z B;  1HUC A;  1NTZ J;  1OVU A;  3G9R A;  1SQX D;  2E75 D;  1ZW0 A;  3JC2 2;  3KPE A;  4I1L A;  5APY A;  3VMA A;  4YXD C;  2E74 D;  1GU5 A;  3IF4 A;  3RGU A;  2K37 A;  2AEJ A;  2JKV A;  5KLV E;  1YIJ P;  2XV5 A;  2JWD A;  4JPZ B;  1Q2N A;  2WPS A;  1NU1 J;  1FAV A;  5AW1 B;  1AVO A;  1KIL B;  1BGY J;  1NHL A;  1Z56 A;  3H1H G;  3QH9 A;  2R3C A;  5AVX B;  1FZG A;  2E5Y A;  1P84 D;  1GZL A;  1Q7Y Q;  1GDT A;  3TYY A;  3OJA B;  1CW5 A;  1OWA A;  3H1K D;  3CCL P;  3AEB C;  2XND H;  2E76 D;  1QL2 A;  4I7Z C;  3Q2Y A;  1EZV I;  5TIS E;  1KB9 D;  2YKP A;  4BRY B;  1VQP P;  1SFC C;  1N73 A;  3D70 A;  1SQX K;  3AEG C;  3LW5 H;  2H8P D;  3M0D A;  1T8Z A;  1BSN A;  1FBM A;  1PZQ A;  2W6J H;  1LWU C;  2Y0D A;  3GLM A;  3PP5 A;  4IFM A;  3CWB E;  1M1J B;  2OTK E;  1LT9 B;  2N9B A;  3NXS A;  5KAI E;  1SS1 A;  2NRG A;  1AV1 A;  2K9Y A;  1KOR A;  4AYC A;  1FDI A;  2ZT9 C;  2I8D A;  5KKZ B;  3GHG B;  1URQ C;  1NOH A;  3A0B H;  3VP9 A;  4L75 A;  2A06 E;  3H1L G;  4BXL A;  4XA4 A;  2CPS A;  5E79 H;  3CCV P;  4GDO A;  3CXH E;  4H13 D;  2V7Q H;  2WWW A;  2RH0 A;  3HD7 D;  1KC8 Q;  1NTK E;  2FYU K;  2WPR A;  3A0H E;  1EQ7 A;  1U57 A;  3IAO A;  4K3A A;  3TK1 A;  4ZMD A;  3H1J G;  1OW8 A;  2ZFC A;  3II6 A;  1EZV E;  1Y47 A;  5TJH A;  4H44 C;  5CBO A;  1PPJ G;  4Y28 J;  2HPC A;  2W6A A;  2E74 C;  3AED C;  4Y99 C;  3L71 J;  3B4S A;  1NJI Q;  1NTK D;  1PFI A;  1ZRT D;  2KSE A;  2PGD A;  4KHX A;  1E5W A;  3PTZ A;  1KFN A;  2N9Y B;  5AVY B;  2V7Q J;  1S5L X;  5AW9 B;  2XDJ A;  1BCC G;  4M3L A;  2WMM A;  2IZ1 A;  3FWN A;  2A06 D;  1L0N E;  4IL6 H;  1LP1 A;  4WVZ A;  1G1J A;  2BEZ F;  2IYP A;  1MKM A;  2N1T D;  1N8R Q;  2RN0 A;  2WIT A;  3ABV C;  2GA1 A;  3VOP A;  1VQ9 P;  4U3F G;  1VQ8 P;  2WPV B;  5H2F H;  3A2A A;  4PV1 D;  5K5G B;  1SFC D;  1N7S A;  1FE6 A;  1JY3 P;  2WVR A;  2ZAE B;  3CX5 H;  1NKN A;  2GM4 A;  1HWT C;  1IFM A;  1N86 A;  1YHQ P;  1BE3 E;  1X22 A;  2ZXE B;  3V2R A;  3ITK A;  3TF5 A;  2Y9Z A;  3L71 D;  4JBZ A;  1S5L E;  5BVZ A;  1KQS O;  4W7Y A;  1NU1 K;  1ZV8 A;  2KSJ A;  2ZT9 D;  3L72 J;  1URQ D;  2A06 G;  2JJL A;  2Y9Y A;  1NTM G;  3H1L E;  3L75 E;  1USE A;  2C9L Y;  2Q3I A;  4EI2 A;  1A02 J;  2C9N Y;  4H0L B;  2P58 A;  1M56 D;  2WZ7 A;  2YO2 A;  3AEF C;  2HPC B;  3B5N A;  3E1I A;  1BCC J;  2IPP A;  2YMK A;  3RBZ A;  1VF5 D;  3L74 E;  4PD4 H;  2HOD B;  2IZ0 A;  3F5H A;  3HE4 A;  5KLV D;  1BDC A;  1GW4 A;  1LTB C;  2N1T B;  2ZYD A;  2NPS C;  2B9B A;  2B87 B;  1YQ3 C;  3CCS P;  1OIP A;  1K04 A;  4XFJ A;  1NO4 A;  3H1J D;  4KJM A;  1W5C E;  3TNU B;  4DZO A;  5KAI H;  1D7M A;  2QJY C;  4TT3 H;  3QWO C;  3CCE P;  3BRV B;  1JY2 O;  2OGU A;  2OYH B;  4IFD K;  1FC2 C;  1RH5 B;  3M9Q A;  5GTH E;  5CCG A;  1DIP A;  2JP3 A;  1EDI A;  2YNY A;  3MIW A;  1RF0 A;  2KP8 A;  1FJK A;  1GK6 A;  2H89 C;  1M1J A;  4JYC A;  1ZME C;  1GK4 A;  1J2J B;  1A02 F;  2CPB A;  2YXR B;  2BAS A;  2GUS A;  3CMA P;  3N4X A;  3HD7 A;  1KB9 H;  1SQB D;  2W83 C;  2N1T C;  5AVT B;  2K3R A;  2KXP B;  3A0H H;  4WY4 D;  4DT0 A;  1NU1 E;  5KLV K;  4HJG H;  1BCC D;  2R5D A;  3H32 B;  3R2P A;  1KQL A;  5CJ0 A;  1JM0 A;  1UII A;  4W80 A;  5AW8 B;  1DEE G;  3WUT A;  3Q5P A;  3BRT B;  1G2C A;  3CI9 A;  1M1K Q;  1EXJ A;  1X79 B;  2KNC B;  2WTY A;  3H32 A;  5CCH C;  3H1J J;  4HH2 A;  3L75 J;  3PRJ A;  1LJ2 A;  4WY4 B;  1YTZ I;  1PP9 J;  2YIU C;  3PHL A;  3S4R A;  1MFT A;  1OVR A;  1AVY A;  3L75 G;  2Z4E A;  1QL1 A;  1IFD A;  4U3F D;  1URQ B;  2XZR A;  2ZJS E;  5APQ A;  5KKZ C;  3D71 A;  3CXH I;  1BDD A;  1EDK A;  2BCC E;  2WSE H;  1LGH B;  2J58 A;  1SQB J;  2DW3 A;  3EWK A;  4TLF A;  3TSI A;  1NVO A;  1VQ4 P;  2QJK C;  4HKZ H;  5AW6 B;  2BEQ D;  2P1J A;  2OYI C;  2HR3 A;  2HLO A;  1XTG B;  1JTH A;  4KT0 J;  2BCC D;  2NPS D;  2WQY C;  4RES B;  3Q5S A;  1S9K D;  2A45 I;  4AQR D;  2JWA A;  3M06 A;  2QE7 H;  3B5N D;  1L0L E;  2HOD A;  4HYT B;  4N78 E;  1S5L H;  1VQ5 P;  1Q81 Q;  1RE3 C;  1YI2 P;  4B86 A;  1EDJ A;  3H6P A;  1DEB A;  1QX8 A;  4GOD A;  3M9B A;  2QRX A;  4L74 A;  1Y9B A;  2P7J A;  1PP9 D;  3P8C E;  1HGV A;  5AVS B;  3N7N A;  1KN7 A;  3BCC J;  4Y99 B;  2OTL P;  5B5E H;  3C8V A;  3B8E B;  4GKG A;  3RK2 D;  3NMD A;  4C7N A;  1BGY D;  1R5L A;  2KS1 B;  2M3E A;  3OA7 A;  4PD4 E;  4D6T D;  1SQP K;  3S1K A;  3CPW O;  4I2L C;  3BCC G;  2FXM A;  2FXP A;  1NTM J;  1PGQ A;  1RE4 A;  3GF3 A;  1VQK P;  1T3U A;  2LKM A;  2ZYA A;  1GD2 E;  4GT1 A;  1P84 I;  4WBA A;  1N7S B;  2JEE A;  3RBX A;  1QGK B;  4UB6 E;  4NPE A;  2KUB A;  1LT1 A;  5CCH D;  5APW A;  3HTK A;  3U1C A;  3GHG C;  5CCG D;  5GTI H;  1JCD A;  1NAF A;  3HD7 B;  4O9B A;  1GU4 A;  2H43 A;  1EXI A;  1BE3 J;  4H13 B;  1OVV A;  2R5B A;  1AFO A;  3M0A A;  2FYU G;  1WRG A;  2M3B A;  4MN4 C;  5B66 E;  1HBW A;  1L4A A;  2LXB A;  3H1I J;  1VDF A;  5AVW B;  1SQB K;  3O8Z A;  3SWY A;  1YJ9 P;  1GL2 C;  4WY4 A;  3KQG A;  3A5T A;  2OYH A;  3A7O A;  2M5A A;  4IOI H;  2R3S A;  2P67 A;  3CLQ A;  5GTI E;  1SQQ K;  3VMZ A;  3SWF A;  2IBZ G;  3H1H D;  3L70 G;  5AW2 B;  4I6M C;  5KLI B;  1KYO H;  1VL2 A;  2FFD C;  4QMA A;  3B5N C;  3D6Z A;  5AW3 B;  1KIL C;  1JOC A;  1JY2 N;  1NH4 A;  2WSF H;  3CL3 D;  3L75 D;  4R4L A;  5KAF E;  1MV8 A;  1KQG B;  1BSH A;  2W90 A;  1HF9 A;  3NFQ A;  3H25 A;  1HGZ A;  5APT A;  1M90 Q;  1YJN P;  3D6Y A;  1BE3 D;  2QJP C;  3E1R A;  2B88 A;  1QVG O;  1L4A D;  4OGQ D;  1FZC A;  1EDL A;  1KTM A;  3MUD C;  4U3F J;  4RKU J;  2YKO A;  2I1J A;  3O6Q B;  3TGU J;  1PP9 G;  1SQQ D;  3H1I G;  1ZN5 A;  1LT9 A;  1RY3 A;  3SSU A;  5BU5 A;  1H0T A;  3V6I A;  3KDP B;  3S9O A;  3H1H E;  3H1K J;  2FKW B;  3UIA A;  1ZLL A;  1RF1 C;  2OAR A;  2E75 B;  2A45 H;  3EFF K;  3PJS K;  2OYI B;  3E7K A;  1L0N D;  2YKQ A;  3L70 J;  2AEM A;  3CCM P;  1RQV A;  3Q3D A;  1H0T B;  1DD3 A;  2IYO A;  3WU2 E;  2FXO A;  1IFN A;  1PV3 A;  2LR2 A;  3AE1 C;  1HTL C;  1ZRT E;  1YTZ T;  3MP7 B;  3RL0 D;  1R8E A;  1FOS E;  3Q1M A;  1S1C X;  3AEA C;  4EDF A;  5B5E E;  1NTK K;  1IK9 A;  1LNQ A;  2FYU E;  3FX0 A;  1GL2 D;  1CI6 B;  1N7L A;  1EC5 A;  5E79 E;  3V2Q A;  4AUW A;  5KJ7 A;  4D6T J;  1M7L A;  2WSC H;  3BCC E;  3AE3 C;  2IX7 C;  1GTW A;  1SQQ J;  1QVF O;  5DJU B;  2E42 A;  3SFD C;  2O01 N;  2WT7 A;  3CC2 P;  4W7Z A;  1BGY E;  3H1K G;  1EZV G;  1DD4 A;  2QIW A;  1VPC A;  1JY2 P;  1KMI Z;  2KB7 P;  3AEE C;  1CI6 A;  4H44 D;  1SFC A;  1LTJ C;  3RK2 B;  1H8A A;  2FYZ A;  3MGN A;  1L0L G;  1Q90 D;  2WPQ A;  1OX3 A;  1LWU A;  1YBK A;  2Y0C A;  5APV A;  5B66 H;  3HUS B;  3CWB D;  3BVH A;  3CD6 P;  5AVQ B;  2MJZ A;  2WSE J;  1KZU B;  2HG5 D;  1L4A B;  4OGQ B;  3HTK B;  5KJ7 D;  3HUS C;  1IJD B;  1KB9 E;  1YQ4 C;  3ZDM A;  2YMY A;  4PD4 I;  2IDB A;  5AVU B;  4YTP C;  1HVV A;  1SVF A;  2NPS B;  1BGY G;  2W27 A;  2YO3 A;  3H1H J;  3H1K E;  3L4F A;  1KFM A;  5AW5 B;  5CJ4 A;  4UB8 E;  4EOT A;  5CMZ A;  2KLV A;  4PJ0 E;  3CX5 E;  2L91 A;  2RKL A;  3M91 A;  3O6Q A;  4PV1 C;  4U3F E;  3F89 A;  4ASV A;  1S4X A;  1G2C B;  5AW7 B;  1SQV J;  3PH0 A;  1JY3 O;  2YXQ B;  2D2C B;  3RL0 C;  4H0L C;  1NTZ G;  3MD0 A;  2WSS H;  1AJY A;  3L72 D;  1IFJ A;  3VP8 A;  5KTB A;  1SQV G;  3L73 E;  4C7N B;  1W2B O;  1IZN B;  3V2N A;  3P7K A;  2PAJ A;  4OH8 B;  5AW0 B;  3G4S P;  1OMI A;  3TGU D;  2GUV A;  1NU1 G;  5AVR B;  1PPJ D;  3TDK A;  2KOG A;  3VMY A;  1USD A;  2Q6Q A;  1JTH B;  3V4W A;  3AE9 C;  1VF5 C;  2L5G B;  3CX5 I;  3GG2 A;  5H2F E;  1J1E B;  2M0B A;  2C0W A;  3MHV A;  1N73 C;  1SQB E;  3I5C A;  3TGU G;  1JY3 N;  2IBZ D;  1N7S D;  2BCC J;  3L70 D;  1JEK A;  2E75 C;  2AXT H;  2JO1 A;  2JR8 A;  2KS1 A;  3M0D C;  4LLH A;  1RF1 B;  4UB8 H;  2QVA A;  1SQV D;  2IFM A;  1FDM A;  1IC2 A;  5AVV B;  2KIK A;  1VQ7 P;  2O01 H;  2B89 A;  2KLU A;  1URQ A;  3K5B A;  4PD4 D;  3A0B E;  3KZI H;  1S2E A;  2QJP B;  3L36 A;  2H7H A;  4OVN F;  1JNM A;  3HRN A;  1PL5 A;  4XE5 B;  2WSC J;  3P8C D;  1PP9 E;  4RJT A;  3H1L J;  3L73 D;  2J59 M;  3L72 E;  1NTM E;  2E76 C;  1W2E A;  3B5N B;  2RMZ A;  1RHZ B;  3L74 D;  2KYV A;  1KQF B;  1FZB A;  3I56 P;  2OQQ A;  4N78 D;  3CCR P;  3FWL A;  1OXZ A;  5KLI C;  4UB6 H;  3G6E P;  1SQP G;  2NPS A;  2XKM A;  2VRS A;  1TU3 F;  2FY8 A;  3CX5 D;  2P10 A;  2JDI H;  4H0L D;  3AE6 C;  1L2P A;  3GW6 A;  4C7R A;  3CCQ P;  1JO5 A;  1KV4 A;  3RK3 B;  1WMK A;  1DX7 A;  2PP6 A;  1N2D C;  1OZH A;  2R44 A;  2M8R A;  2FYN C;  2ZT9 B;  5KLV G;  2Z5I A;  1HJB A;  1RF0 C;  1LP1 B;  1M1J C;  2ZVO B;  1YYC A;  1ZOY C;  4IFF A;  3T97 B;  2PFX A;  1T6A A;  3LID A;  1H88 A;  1OW7 A;  2K9J B;  1LTI C;  2G3A A;  2G8Y A;  2FYN B;  3L72 G;  4L73 A;  3HD7 C;  3BAT A;  3VMX A;  3CCJ P;  3RK3 C;  1SFC B;  1UIX A;  3AE4 C;  1T2K D;  4A7P A;  1JB0 J;  2I1K A;  2ZXX A;  3Q5R A;  4C46 A;  2OTJ P;  2W8Z A;  4RO0 A;  2POH A;  1LTG C;  1KYO I;  1N7S C;  2B87 A;  2CK3 H;  2Y0E A;  1SQX J;  1JUN A;  3VYI A;  4ZKP A;  5M1B A;  1U7J A;  1ZR2 A;  3HE4 B;  5KAF H;  5CCH A;  1VQN P;  1BCC E;  3V2P A;  3CCU P;  1NU1 D;  1S3J A;  4ZNC A;  4GOF A;  3BCC D;  2KNC A;  2SPZ A;  2Q3E A;  5CHX A;  5AW4 B;  4YPC A;  1HJ0 A;  1K73 Q;  1VQL P;  2QA4 P;  1K8A Q;  2O1J A;  1EZV D;  1H89 A;  2FYU D;  3C9I A;  2Q9I A;  1FDO A;  2LXC B;  1R5S A;  2W6B A;  1PIX A;  1JMB A;  2OYO A;  3B71 A;  3FGA D;  1FS0 E;  3BAS A;  3HE5 A;  1AQT A;  2QSI A;  3VTP C;  3NTN A;  4OWF A;  2KK7 A;  1M57 D;  1L0N J;  1G1I A;  2QJK B;  3LIE A;  2ZYG A;  4HB1 A;  2Q1K A;  3OW2 O;  1VF5 B;  4WB4 A;  5GTH H;  5CCG C;  1K9M Q;  2XU6 A;  4R4M A;  5C39 A;  3WUU A;  3KZI E;  1KIL E;  1FZC B;  3L73 G;  3W68 A;  1SQQ E;  2O1K A;  1LTA C;  2D2C D;  3L74 G;  4EIJ A;  3A3Y B;  2YIU B;  2N1T A;  3L37 A;  2O3J A;  3IFM A;  1U7M A;  1ZP0 C;  1MZ9 A;  3H1L D;  1T3J A;  1FZE A;  3L73 J;  3RK3 D;  1T2K C;  3G3Z A;  3L74 J;  3WUV A;  3L71 E;  2E76 B;  3KHU A;  1RE4 C;  1YIT P;  2WT7 B;  1NTM K;  1OW6 A;  3RK3 E;  3IR9 A;  1P84 E;  1Q86 Q;  1AQ5 A;  2K1A A;  4PV1 B;  2KI7 B;  3M9H A;  1KIL D;  1ZXG A;  2M5A B;  1NTK J;  2FFD B;  3GHG A;  5APU A;  4GOE A;  4DCK A;  4EYY Q;  3V4Q A;  1YJW P;  1HH0 A;  3JCU E;  1ZR4 A;  4NPD A;  3U59 A;  2HYN A;  1NTK G;  1SQX E;  1NGM B;  1L4A C;  4OGQ C;  3USS A;  1PGO A;  4IL6 E;  5CBN A;  4N6J A;  3AE5 C;  1GL2 A;  1VQM P;  4WY4 C;  1DH3 A;  1J1D C;  2OYH C;  1N73 B;  1X8Y A;  2AXC A;  2QJY B;  1J1E C;  2OYI A;  3SFE C;  1CSB A;  1RQU A;  4PJ0 H;  1JMM A;  2A45 G;  1JCC A;  3HE5 B;  3U1A A;  1L0L K;  3WU2 H;  1NTZ D;  3CC7 P;  3KXD A;  1FOS F;  2QM8 A;  1SP4 A;  1RE3 A;  1XTC C;  4JYB A; 
#chains in the Genus database with same CATH homology
 1SQX G;  2FYU G;  3L72 G;  1PP9 G;  3H1I G;  2BCC G;  3H1K G;  1SQB G;  1EZV G;  1BCC G;  1NTZ G;  3CXH H;  4PD4 H;  1BE3 G;  1P84 H;  1SQV G;  1L0L G;  1NTK G;  3H1L G;  4U3F G;  2IBZ G;  3L70 G;  1NU1 G;  3L71 G;  3L73 G;  1KYO H;  3BCC G;  3L75 G;  3CWB G;  3H1H G;  1SQP G;  3L74 G;  3CX5 H;  4D6T G;  1L0N G;  3H1J G;  3TGU G;  1SQQ G;  1PPJ G;  1BGY G;  1KB9 H;  2A06 G;  5KLV G;  1NTM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...